F496817

General Info

Members Datasets Scaffolds Average Seq Length
2457 933 2145 240

Family's Representative Sequence

Representative Sequence 3300005336|Ga0070680_100288492|Ga0070680_1002884922
Length 286
Sequence MPGLVPGIHVLLVDSSEDVDGRDKPGHDEINGIGESTGRWKGPVNYHWNWGIFFEPNPMGTGTYLDLLLSGLVLTLKTGLLAWIIALVSGSIIGVMRTLPSRTASWIGFAYVEFFRNMPLLVQLFLWFFVLPELLPRSAGLWLKQLPNAPFWTAAIGIGVFMSARVAVQLQAGIGSLPRGQRQAATALGLTTVQTYRYVLLPMAFRIILPPLTSEFLNTIKNTAVAITIGLLELTGQARSMEEFSFQVFEAFTAATMMYLLINLVVVTAMRFLERYVAVPGYISGK

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
3 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
4 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
5 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
6 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
7 2511231026 Herbaspirillum sp. YR522 Isolate Rhizosphere
8 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
9 2513237087 Azorhizobium doebereinerae UFLA1-100 Isolate Nodule
10 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
11 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
12 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
13 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
14 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
15 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
16 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
17 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
18 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
19 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
20 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
21 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
22 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
23 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
24 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
25 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
26 2521172590 Herbaspirillum sp. GW103 Isolate Rhizosphere
27 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
28 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
29 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
30 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
31 2545555834 Methylobacterium sp. WSM2598 Isolate Nodule
32 2548876994 Herbaspirillum lusitanum P6-12 Isolate Nodule
33 2551306416 Herbaspirillum seropedicae Os34 Isolate Unclassified
34 2595698237 Methylobacterium sp. UNCCL125 Isolate Unclassified
35 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
36 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
37 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
38 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
39 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
40 2643221569 Achromobacter sp. Root565 Isolate Unclassified
41 2643221594 Achromobacter sp. Root170 Isolate Unclassified
42 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
43 2643221638 Duganella sp. Root336D2 Isolate Unclassified
44 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
45 2738541277 Variovorax sp. GV051 Isolate Unclassified
46 2738541281 Methylobacterium sp. GV094 Isolate Unclassified
47 2738541337 Pelomonas sp. BT06 Isolate Unclassified
48 2738543019 Variovorax sp. GV040 Isolate Unclassified
49 2738543032 Methylobacterium sp. GV104 Isolate Unclassified
50 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
51 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
52 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
53 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
54 2791355199
55 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
56 2808606386 Herbaspirillum sp. SJZ099 Isolate Rhizosphere
57 2808606395 Achromobacter sp. SLBN-14 Isolate Unclassified
58 2808606415 Herbaspirillum sp. SJZ130 Isolate Rhizosphere
59 2808606419 Herbaspirillum sp. SJZ106 Isolate Rhizosphere
60 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
61 2818991436 Collimonas arenae 515 Isolate Unclassified
62 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
63 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
64 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
65 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
66 2823421272 Pseudomonas mendocina S5.2 Isolate Rhizoplane
67 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
68 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
69 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
70 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
71 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
72 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
73 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
74 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
75 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
76 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
77 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
78 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
79 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
80 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
81 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
82 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
83 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
84 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
85 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
86 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
87 2829745981 Methylorubrum rhodinum DSM 2163 Isolate Rhizosphere
88 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
89 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
90 2839094727 Herbaspirillum robiniae HZ10 Isolate Nodule
91 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
92 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
93 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
94 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
95 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
96 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
97 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
98 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
99 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
100 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
101 2842698319 Methylobacterium sp. R-72139 Isolate Unclassified
102 2842711865 Duganella sp. R-73148 Isolate Unclassified
103 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
104 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
105 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
106 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
107 2852618963 Herbaspirillum sp. SJZ102 Isolate Rhizosphere
108 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
109 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
110 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
111 2857558681 Duganella sp. R-74565 Isolate Unclassified
112 2857576091 Pigmentiphaga sp. R-72090 Isolate Unclassified
113 2858950400 Achromobacter sp. K91 Isolate Unclassified
114 2861691609 Methylorubrum thiocyanatum DSM 11490 Isolate Rhizosphere
115 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
116 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
117 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
118 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
119 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
120 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
121 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
122 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
123 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
124 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
125 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
126 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
127 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
128 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
129 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
130 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
131 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
132 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
133 2881927736 Candidimonas sp. SYP-B2681 Isolate Rhizosphere
134 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
135 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
136 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
137 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
138 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
139 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
140 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
141 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
142 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
143 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
144 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
145 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
146 2889306138 Methylobacterium sp. PvR107 Isolate Rhizosphere
147 2895511927 Pseudoxanthomonas sp. SGD-5-1 Isolate Rhizosphere
148 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
149 2902330777 Methylobacterium sp. 2A Isolate Unclassified
150 2902405164 Methylobacterium sp. P1-11 Isolate Unclassified
151 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
152 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
153 2904424332 Duganella sp. 1411 Isolate Rhizosphere
154 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
155 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
156 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
157 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
158 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
159 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
160 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
161 2904699407
162 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
163 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
164 2906610324
165 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
166 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
167 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
168 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
169 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
170 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
171 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
172 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
173 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
174 2919476304 Duganella sp. 3397 Isolate Unclassified
175 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
176 2922368715
177 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
178 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
179 2922425934
180 2923510766 Herbaspirillum rubrisubalbicans SLBN-127 Isolate Rhizosphere
181 2928125067 Methylobacterium sp. 1973 Isolate Unclassified
182 2928130867 Herbaspirillum seropedicae 1977 Isolate Unclassified
183 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
184 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
185 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
186 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere
187 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
188 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
189 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
190 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
191 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
192 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
193 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
194 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
195 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
196 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
197 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
198 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
199 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
200 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
201 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
202 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
203 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
204 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
205 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
206 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
207 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
208 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
209 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
210 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
211 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
212 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
213 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
214 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
215 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
216 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
217 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
218 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
219 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
220 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
221 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
222 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
223 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
224 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
225 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
226 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
227 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
228 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
229 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
230 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
231 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
232 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
233 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
234 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
235 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
236 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
237 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
238 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
239 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
240 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
241 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
242 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
243 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
244 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
245 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
246 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
247 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
248 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
249 3003665799 Methylobacterium aquaticum BG2 Isolate Unclassified
250 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
251 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
252 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
253 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
254 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
255 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
256 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
257 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
258 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
259 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
260 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
261 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
262 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
263 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
264 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
265 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
266 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
267 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
268 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
269 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
270 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
271 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
272 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
273 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
274 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
275 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
276 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
277 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
278 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
279 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
280 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
281 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
282 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
283 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
284 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
285 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
286 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
287 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
288 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
289 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
290 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
291 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
292 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
293 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
294 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
295 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
296 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
297 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
298 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
299 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
300 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
301 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
302 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
303 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
304 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
305 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
306 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
307 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
308 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
309 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
310 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
311 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
312 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
313 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
314 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
315 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
316 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
317 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
318 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
319 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
320 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
321 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
322 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
323 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
324 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
325 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
326 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
327 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
328 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
329 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
330 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
331 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
332 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
333 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
334 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
335 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
336 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
337 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
338 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
339 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
340 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
341 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
342 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
343 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
344 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
345 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
346 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
347 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
348 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
349 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
350 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
351 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
352 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
353 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
354 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
355 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
356 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
357 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
358 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
359 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
360 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
361 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
362 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
363 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
364 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
365 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
366 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
367 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
368 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
369 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
370 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
371 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
372 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
373 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
374 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
375 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
376 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
377 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
378 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
379 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
380 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
381 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
382 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
383 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
384 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
385 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
386 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
387 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
388 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
389 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
390 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
391 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
392 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
393 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
394 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
395 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
396 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
397 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
398 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
399 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
400 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
401 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
402 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
403 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
404 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
405 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
406 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
407 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
408 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
409 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
410 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
411 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
412 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
413 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
414 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
415 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
416 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
417 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
418 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
419 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
420 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
421 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
422 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
423 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
424 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
425 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
426 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
427 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
428 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
429 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
430 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
431 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
432 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
433 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
434 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
435 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
436 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
437 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
438 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
439 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
440 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
441 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
442 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
443 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
444 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
445 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
446 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
447 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
448 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
449 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
450 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
451 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
452 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
453 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
454 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
455 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
456 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
457 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
458 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
459 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
460 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
461 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
462 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
463 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
464 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
465 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
466 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
467 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
468 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
469 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
470 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
471 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
472 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
473 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
474 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
475 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
476 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
477 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
478 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
479 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
480 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
481 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
482 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
483 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
484 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
485 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
486 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
487 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
488 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
489 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
490 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
491 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
492 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
493 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
494 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
495 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
496 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
497 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
498 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
499 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
500 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
501 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
502 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
503 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
504 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
505 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
506 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
507 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
508 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
509 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
510 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
511 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
512 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
513 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
514 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
515 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
516 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
517 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
518 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
519 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
520 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
521 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
522 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
523 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
524 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
525 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
526 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
527 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
528 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
529 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
530 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
531 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
532 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
533 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
534 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
535 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
536 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
537 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
538 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
539 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
540 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
541 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
542 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
543 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
544 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
545 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
546 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
547 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
548 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
549 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
550 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
551 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
552 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
553 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
554 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
555 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
556 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
557 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
558 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
559 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
560 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
561 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
562 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
563 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
564 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
565 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
566 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
567 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
568 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
569 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
570 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
571 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
572 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
573 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
574 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
575 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
576 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
577 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
578 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
579 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
580 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
581 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
582 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
583 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
584 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
585 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
586 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
587 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
588 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
589 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
590 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
591 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
592 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
593 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
594 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
595 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
596 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
597 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
598 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
599 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
600 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
601 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
602 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
603 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
604 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
605 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
606 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
607 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
608 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
609 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
610 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
611 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
612 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
613 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
614 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
615 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
616 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
617 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
618 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
619 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
620 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
621 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
622 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
623 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
624 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
625 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
626 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
627 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
628 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
629 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
630 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
631 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
632 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
633 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
634 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
635 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
636 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
637 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
638 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
639 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
640 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
641 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
642 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
643 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
644 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
645 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
646 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
647 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
648 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
649 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
650 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
651 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
652 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
653 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
654 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
655 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
656 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
657 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
658 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
659 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
660 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
661 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
662 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
663 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
664 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
665 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
666 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
667 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
668 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
669 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
670 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
671 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
672 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
673 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
674 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
675 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
676 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
677 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
678 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
679 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
680 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
681 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
682 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
683 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
684 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
685 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
686 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
687 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
688 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
689 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
690 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
691 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
692 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
693 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
694 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
695 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
696 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
697 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
698 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
699 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
700 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
701 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
702 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
703 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
704 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
705 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
706 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
707 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
708 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
709 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
710 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
711 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
712 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
713 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
714 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
715 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
716 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
717 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
718 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
719 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
720 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
721 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
722 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
723 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
724 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
725 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
726 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
727 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
728 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
729 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
730 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
731 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
732 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
733 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
734 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
735 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
736 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
737 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
738 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
739 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
740 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
741 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
742 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
743 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
744 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
745 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
746 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
747 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
748 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
749 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
750 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
751 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
752 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
753 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
754 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
755 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
756 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
757 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
758 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
759 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
760 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
761 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
762 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
763 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
764 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
765 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
766 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
767 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
768 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
769 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
770 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
771 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
772 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
773 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
774 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
775 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
776 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
777 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
778 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
779 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
780 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
781 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
782 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
783 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
784 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
785 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
786 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
787 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
788 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
789 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
790 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
791 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
792 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
793 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
794 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
795 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
796 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
797 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
798 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
799 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
800 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
801 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
802 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
803 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
804 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
805 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
806 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
807 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
808 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
809 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
810 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
811 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
812 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
813 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
814 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
815 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
816 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
817 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
818 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
819 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
820 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
821 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
822 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
823 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
824 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
825 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
826 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
827 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
828 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
829 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
830 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
831 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
832 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
833 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
834 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
835 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
836 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
837 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
838 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
839 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
840 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
841 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
842 3300053097 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere Metagenome Endosphere
843 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
844 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
845 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
846 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
847 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
848 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
849 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
850 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
851 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
852 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
853 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
854 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
855 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
856 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
857 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
858 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
859 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
860 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
861 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
862 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
863 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
864 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
865 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
866 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
867 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
868 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
869 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
870 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
871 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
872 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
873 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
874 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
875 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
876 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
877 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
878 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
879 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
880 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
881 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
882 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
883 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
884 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
885 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
886 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
887 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
888 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
889 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
890 3300059649 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
891 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
892 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
893 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
894 641522639 Methylobacterium sp. 4-46 Isolate Nodule
895 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule
896 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
897 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
898 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
899 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
900 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
901 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
902 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
903 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
904 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
905 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
906 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
907 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
908 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
909 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
910 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
911 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
912 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
913 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
914 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
915 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
916 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
917 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
918 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
919 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
920 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
921 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
922 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
923 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
924 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
925 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
926 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
927 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
928 8034962539 Pseudomonas sediminis PI11 Isolate Rhizosphere
929 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
930 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
931 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
932 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
933 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 87.07
Metatranscriptomes 0.41
Isolates 12.52

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.27
Nodule 8.18
Rhizoplane 4.88
Rhizosphere 63.86
Stem 0
Stem Tuber 0
Unclassified 9.81

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_742313 2162886007 Bacteria 4098
2 LJQas_1004228 3300000549 Bacteria 1881
3 JGI24740J21852_10009976 3300001979 Bacteria 3682
4 JGI24743J22301_10002879 3300001991 Bacteria 2654
5 JGI24750J21931_1002501 3300002070 Bacteria 2215
6 JGI24748J21848_1000640 3300002074 Bacteria 3747
7 JGI24749J21850_1002027 3300002076 Bacteria 2863
8 JGI24744J21845_10001437 3300002077 Bacteria 4734
9 JGI24034J26672_10002470 3300002239 Bacteria 2540
10 JGI24751J29686_10008937 3300002459 Bacteria 2054
11 JGI25155J39150_1000361 3300002704 Bacteria 14083
12 JGI25155J39150_1000686 3300002704 Bacteria 6296
13 JGI25155J39150_1000695 3300002704 Bacteria 6203
14 JGI25156J39149_1000283 3300002705 Bacteria 34253
15 JGI25156J39149_1002023 3300002705 Bacteria 7741
16 JGI25156J39149_1003687 3300002705 Bacteria 4915
17 JGI25162J39368_1000063 3300002737 Bacteria 134747
18 JGI25154J39366_1000252 3300002738 Bacteria 34253
19 JGI25154J39366_1000261 3300002738 Bacteria 33723
20 JGI25154J39366_1000370 3300002738 Bacteria 25155
21 JGI25157J39369_1000319 3300002741 Bacteria 34439
22 JGI25157J39369_1000831 3300002741 Bacteria 15314
23 JGI25157J39369_1005379 3300002741 Bacteria 2101
24 JGI25164J39214_1008879 3300002772 Bacteria 996
25 JGI25152J39213_1020960 3300002773 Bacteria 1156
26 JGI25159J45721_1001744 3300002987 Bacteria 8758
27 JGI25151J46595_10002292 3300003187 Bacteria 11705
28 JGI25406J46586_10000055 3300003203 Bacteria 53491
29 JGI25406J46586_10004826 3300003203 Bacteria 6268
30 JGI25165J46597_1000069 3300003214 Bacteria 195460
31 JGI25153J46596_10002315 3300003215 Bacteria 11075
32 JGI25153J46596_10013885 3300003215 Bacteria 3380
33 JGI25153J46596_10016150 3300003215 Bacteria 3007
34 JGI25160J50197_1000092 3300003354 Bacteria 89966
35 JGI25160J50197_1002292 3300003354 Bacteria 8968
36 JGI25160J50197_1002807 3300003354 Bacteria 7976
37 JGI25161J50226_1000069 3300003374 Bacteria 89966
38 JGI25161J50226_1000568 3300003374 Bacteria 15639
39 JGI25161J50226_1014814 3300003374 Bacteria 864
40 JGI25404J52841_10025716 3300003659 Bacteria 1267
41 JGI25404J52841_10026484 3300003659 Bacteria 1247
42 Ga0055538_1000034 3300003751 Bacteria 195460
43 Ga0055538_1000084 3300003751 Bacteria 81835
44 Ga0055539_1000044 3300003752 Bacteria 195460
45 Ga0055539_1000125 3300003752 Bacteria 81835
46 Ga0055539_1005431 3300003752 Bacteria 1657
47 Ga0055533_1000055 3300003756 Bacteria 195460
48 Ga0055533_1000132 3300003756 Bacteria 81835
49 Ga0055532_1000136 3300003758 Bacteria 72117
50 Ga0055525_1000066 3300003759 Bacteria 195460
51 Ga0055525_1000171 3300003759 Bacteria 81835
52 Ga0055526_1000226 3300003771 Bacteria 47921
53 Ga0055526_1001304 3300003771 Bacteria 17872
54 Ga0055537_1000047 3300003773 Bacteria 88000
55 Ga0055537_1000853 3300003773 Bacteria 14833
56 Ga0055524_1000039 3300003775 Bacteria 159897
57 Ga0055524_1003008 3300003775 Bacteria 8354
58 Ga0055524_1003701 3300003775 Bacteria 7317
59 Ga0055524_1004101 3300003775 Bacteria 6833
60 Ga0055536_1000782 3300003781 Bacteria 21233
61 Ga0055534_1000803 3300003784 Bacteria 14593
62 Ga0055534_1002558 3300003784 Bacteria 6236
63 Ga0055534_1008291 3300003784 Bacteria 2369
64 Ga0055528_1001770 3300003790 Bacteria 12400
65 Ga0055530_10000199 3300003791 Bacteria 53828
66 Ga0055530_10021636 3300003791 Bacteria 1889
67 Ga0055530_10021637 3300003791 Bacteria 1889
68 Ga0055540_1000047 3300003792 Bacteria 146914
69 Ga0055531_10000848 3300003794 Bacteria 25238
70 Ga0055531_10005239 3300003794 Bacteria 7617
71 Ga0055531_10009445 3300003794 Bacteria 4981
72 Ga0055531_10023954 3300003794 Bacteria 2269
73 Ga0055541_1000032 3300003841 Bacteria 195460
74 Ga0055541_1000083 3300003841 Bacteria 81835
75 JGI25405J52794_10005134 3300003911 Bacteria 2353
76 Ga0055543_1000131 3300004625 Bacteria 61862
77 Ga0055543_1006488 3300004625 Bacteria 2821
78 Ga0055543_1012305 3300004625 Bacteria 1726
79 Ga0065165_1000054 3300005262 Bacteria 187351
80 Ga0065165_1000369 3300005262 Bacteria 73834
81 Ga0065165_1001013 3300005262 Bacteria 34221
82 Ga0065165_1001177 3300005262 Bacteria 30398
83 Ga0065165_1021076 3300005262 Bacteria 2272
84 Ga0065165_1044585 3300005262 Bacteria 1296
85 Ga0065704_10071994 3300005289 Bacteria 9434
86 Ga0065715_10101969 3300005293 Bacteria 3155
87 Ga0065715_10106988 3300005293 Bacteria 2782
88 Ga0065707_10011328 3300005295 Bacteria 2913
89 Ga0070658_10141682 3300005327 Bacteria 2009
90 Ga0070658_10240001 3300005327 Bacteria 1536
91 Ga0070676_10038738 3300005328 Bacteria 2754
92 Ga0070676_10068294 3300005328 Bacteria 2127
93 Ga0070676_10070256 3300005328 Bacteria 2100
94 Ga0070676_10299708 3300005328 Bacteria 1089
95 Ga0070683_100001874 3300005329 Bacteria 16425
96 Ga0070683_100003885 3300005329 Bacteria 12224
97 Ga0070683_100042654 3300005329 Bacteria 4177
98 Ga0070683_100056278 3300005329 Bacteria 3652
99 Ga0070690_100007910 3300005330 Bacteria 6100
100 Ga0070690_100419967 3300005330 Bacteria 986
101 Ga0070670_100010833 3300005331 Bacteria 7788
102 Ga0070670_100104898 3300005331 Bacteria 2435
103 Ga0070670_100380301 3300005331 Bacteria 1244
104 Ga0070677_10002360 3300005333 Bacteria 6034
105 Ga0068869_100046383 3300005334 Bacteria 3133
106 Ga0068869_100136372 3300005334 Bacteria 1891
107 Ga0068869_100178093 3300005334 Bacteria 1665
108 Ga0068869_100261861 3300005334 Bacteria 1384
109 Ga0070666_10007112 3300005335 Bacteria 6902
110 Ga0070666_10216926 3300005335 Bacteria 1349
111 Ga0070680_100029444 3300005336 Bacteria 4411
112 Ga0070680_100044693 3300005336 Bacteria 3599
113 Ga0070680_100117542 3300005336 Bacteria 2217
114 Ga0070680_100143235 3300005336 Bacteria 2004
115 Ga0070680_100262877 3300005336 Bacteria 1460
116 Ga0070680_100288492 3300005336 Bacteria 1391
117 Ga0070680_100462462 3300005336 Bacteria 1084
118 Ga0070682_100059731 3300005337 Bacteria 2409
119 Ga0070682_100063938 3300005337 Bacteria 2334
120 Ga0070682_100306991 3300005337 Bacteria 1166
121 Ga0068868_100023745 3300005338 Bacteria 4644
122 Ga0068868_100467690 3300005338 Bacteria 1099
123 Ga0070660_100000725 3300005339 Bacteria 21879
124 Ga0070660_100014684 3300005339 Bacteria 5650
125 Ga0070660_100074555 3300005339 Bacteria 2655
126 Ga0070689_100026934 3300005340 Bacteria 4331
127 Ga0070689_100063112 3300005340 Bacteria 2883
128 Ga0070691_10110834 3300005341 Bacteria 1373
129 Ga0070691_10165768 3300005341 Bacteria 1142
130 Ga0070691_10172761 3300005341 Bacteria 1121
131 Ga0070687_100029279 3300005343 Bacteria 2680
132 Ga0070687_100058540 3300005343 Bacteria 2025
133 Ga0070661_100022805 3300005344 Bacteria 4482
134 Ga0070661_100066892 3300005344 Bacteria 2640
135 Ga0070661_100082398 3300005344 Bacteria 2376
136 Ga0070661_100134546 3300005344 Bacteria 1859
137 Ga0070661_100261971 3300005344 Bacteria 1337
138 Ga0070661_100302635 3300005344 Bacteria 1245
139 Ga0070668_100075105 3300005347 Bacteria 2638
140 Ga0070668_100090375 3300005347 Bacteria 2412
141 Ga0070668_100118852 3300005347 Bacteria 2110
142 Ga0070668_100187574 3300005347 Bacteria 1692
143 Ga0070668_100232862 3300005347 Bacteria 1523
144 Ga0070668_100300230 3300005347 Bacteria 1347
145 Ga0070669_100042587 3300005353 Bacteria 3304
146 Ga0070669_100048709 3300005353 Bacteria 3093
147 Ga0070669_100210526 3300005353 Bacteria 1533
148 Ga0070675_100016993 3300005354 Bacteria 5781
149 Ga0070675_100017595 3300005354 Bacteria 5682
150 Ga0070675_100228826 3300005354 Bacteria 1621
151 Ga0070675_100457232 3300005354 Bacteria 1146
152 Ga0070675_100513585 3300005354 Bacteria 1081
153 Ga0070675_100596324 3300005354 Bacteria 1002
154 Ga0070671_100078165 3300005355 Bacteria 2766
155 Ga0070671_100259298 3300005355 Bacteria 1477
156 Ga0070671_100626426 3300005355 Bacteria 930
157 Ga0070674_100078979 3300005356 Bacteria 2346
158 Ga0070674_100227375 3300005356 Bacteria 1454
159 Ga0070674_100346130 3300005356 Bacteria 1199
160 Ga0070673_100181623 3300005364 Bacteria 1801
161 Ga0070673_100186597 3300005364 Bacteria 1778
162 Ga0070673_100196405 3300005364 Bacteria 1736
163 Ga0070673_100293048 3300005364 Bacteria 1430
164 Ga0070673_100614225 3300005364 Bacteria 993
165 Ga0070688_100019262 3300005365 Bacteria 3952
166 Ga0070659_100018058 3300005366 Bacteria 5319
167 Ga0070659_100037158 3300005366 Bacteria 3796
168 Ga0070659_100044112 3300005366 Bacteria 3490
169 Ga0070659_100069568 3300005366 Bacteria 2794
170 Ga0070659_100090480 3300005366 Bacteria 2452
171 Ga0070659_100229952 3300005366 Bacteria 1532
172 Ga0070659_100860744 3300005366 Bacteria 791
173 Ga0070667_100362738 3300005367 Bacteria 1313
174 Ga0070667_100462199 3300005367 Bacteria 1160
175 Ga0070709_10001276 3300005434 Bacteria 13760
176 Ga0070709_10082232 3300005434 Bacteria 2104
177 Ga0070714_100009911 3300005435 Bacteria 7514
178 Ga0070714_100011995 3300005435 Bacteria 6895
179 Ga0070714_100026401 3300005435 Bacteria 4800
180 Ga0070713_100002481 3300005436 Bacteria 12047
181 Ga0070713_100054342 3300005436 Bacteria 3322
182 Ga0070713_100060627 3300005436 Bacteria 3163
183 Ga0070710_10003504 3300005437 Bacteria 7436
184 Ga0070710_10040967 3300005437 Bacteria 2554
185 Ga0070710_10073005 3300005437 Bacteria 1983
186 Ga0070710_10268452 3300005437 Bacteria 1102
187 Ga0070701_10006890 3300005438 Bacteria 4810
188 Ga0070701_10139596 3300005438 Bacteria 1384
189 Ga0070711_100007004 3300005439 Bacteria 6841
190 Ga0070711_100019255 3300005439 Bacteria 4377
191 Ga0070711_100028570 3300005439 Bacteria 3671
192 Ga0070705_100158169 3300005440 Bacteria 1512
193 Ga0070705_100353643 3300005440 Bacteria 1072
194 Ga0070700_100018485 3300005441 Bacteria 4007
195 Ga0070700_100051512 3300005441 Bacteria 2562
196 Ga0070694_100119856 3300005444 Bacteria 1886
197 Ga0070694_100248560 3300005444 Bacteria 1344
198 Ga0070663_100034422 3300005455 Bacteria 3508
199 Ga0070663_100049929 3300005455 Bacteria 2974
200 Ga0070663_100191323 3300005455 Bacteria 1593
201 Ga0070663_100192581 3300005455 Bacteria 1587
202 Ga0070663_100225701 3300005455 Bacteria 1473
203 Ga0070678_100014091 3300005456 Bacteria 5032
204 Ga0070678_100019001 3300005456 Bacteria 4467
205 Ga0070678_100040966 3300005456 Bacteria 3280
206 Ga0070678_100081975 3300005456 Bacteria 2447
207 Ga0070678_100511482 3300005456 Bacteria 1061
208 Ga0070662_100000154 3300005457 Bacteria 39615
209 Ga0070662_100011694 3300005457 Bacteria 5793
210 Ga0070662_100058395 3300005457 Bacteria 2807
211 Ga0070662_100086920 3300005457 Bacteria 2339
212 Ga0070662_100138248 3300005457 Bacteria 1885
213 Ga0070662_100211246 3300005457 Bacteria 1544
214 Ga0070662_100246256 3300005457 Bacteria 1435
215 Ga0070662_100337751 3300005457 Bacteria 1232
216 Ga0070662_100443545 3300005457 Bacteria 1076
217 Ga0070681_10015986 3300005458 Bacteria 7483
218 Ga0070681_10021502 3300005458 Bacteria 6466
219 Ga0070681_10052696 3300005458 Bacteria 4059
220 Ga0070681_10058438 3300005458 Bacteria 3836
221 Ga0070681_10129893 3300005458 Bacteria 2451
222 Ga0068867_100048059 3300005459 Bacteria 3138
223 Ga0068867_100061339 3300005459 Bacteria 2792
224 Ga0068867_100134576 3300005459 Bacteria 1925
225 Ga0068867_100290212 3300005459 Bacteria 1345
226 Ga0068867_100587448 3300005459 Bacteria 969
227 Ga0070685_10003834 3300005466 Bacteria 7606
228 Ga0070685_10182691 3300005466 Bacteria 1351
229 Ga0070706_100021130 3300005467 Bacteria 5993
230 Ga0070706_100105723 3300005467 Bacteria 2619
231 Ga0070707_100049533 3300005468 Bacteria 4027
232 Ga0070707_100170353 3300005468 Bacteria 2122
233 Ga0070698_100030131 3300005471 Bacteria 5628
234 Ga0070699_100004728 3300005518 Bacteria 12040
235 Ga0070679_100008440 3300005530 Bacteria 9699
236 Ga0070679_100024275 3300005530 Bacteria 5940
237 Ga0070679_100034919 3300005530 Bacteria 4986
238 Ga0070679_100044049 3300005530 Bacteria 4445
239 Ga0070679_100094608 3300005530 Bacteria 2975
240 Ga0070679_100534679 3300005530 Bacteria 1116
241 Ga0070684_100017865 3300005535 Bacteria 5829
242 Ga0070684_100046721 3300005535 Bacteria 3751
243 Ga0070684_100176999 3300005535 Bacteria 1939
244 Ga0070684_100690126 3300005535 Bacteria 951
245 Ga0070697_100401147 3300005536 Bacteria 1190
246 Ga0068853_100001874 3300005539 Bacteria 15481
247 Ga0068853_100028199 3300005539 Bacteria 4720
248 Ga0068853_100081524 3300005539 Bacteria 2833
249 Ga0068853_100093245 3300005539 Bacteria 2651
250 Ga0068853_100160058 3300005539 Bacteria 2031
251 Ga0068853_100249740 3300005539 Bacteria 1627
252 Ga0070672_100053393 3300005543 Bacteria 3159
253 Ga0070672_100155219 3300005543 Bacteria 1895
254 Ga0070672_100316656 3300005543 Bacteria 1325
255 Ga0070672_100336844 3300005543 Bacteria 1284
256 Ga0070672_100463226 3300005543 Bacteria 1093
257 Ga0070686_100022186 3300005544 Bacteria 3778
258 Ga0070686_100033895 3300005544 Bacteria 3141
259 Ga0070686_100204794 3300005544 Bacteria 1417
260 Ga0070686_100225153 3300005544 Bacteria 1357
261 Ga0070695_100113078 3300005545 Bacteria 1846
262 Ga0070695_100238139 3300005545 Bacteria 1319
263 Ga0070696_100090121 3300005546 Bacteria 2181
264 Ga0070696_100123900 3300005546 Bacteria 1873
265 Ga0070696_100173584 3300005546 Bacteria 1595
266 Ga0070696_100230238 3300005546 Bacteria 1394
267 Ga0070696_100251474 3300005546 Bacteria 1337
268 Ga0070693_100011372 3300005547 Bacteria 4482
269 Ga0070693_100039644 3300005547 Bacteria 2640
270 Ga0070693_100065627 3300005547 Bacteria 2122
271 Ga0070693_100074709 3300005547 Bacteria 2005
272 Ga0070693_100093243 3300005547 Bacteria 1819
273 Ga0070665_100005999 3300005548 Bacteria 12427
274 Ga0070665_100073310 3300005548 Bacteria 3430
275 Ga0070665_100102428 3300005548 Bacteria 2866
276 Ga0070665_100156666 3300005548 Bacteria 2279
277 Ga0070665_100167139 3300005548 Bacteria 2202
278 Ga0070665_100282628 3300005548 Bacteria 1661
279 Ga0070665_100432553 3300005548 Bacteria 1325
280 Ga0070665_100449237 3300005548 Bacteria 1298
281 Ga0070704_100015506 3300005549 Bacteria 4788
282 Ga0070704_100394314 3300005549 Bacteria 1179
283 Ga0068855_100001493 3300005563 Bacteria 29289
284 Ga0068855_100013724 3300005563 Bacteria 9767
285 Ga0068855_100036468 3300005563 Bacteria 5852
286 Ga0068855_100071740 3300005563 Bacteria 4026
287 Ga0068855_100076515 3300005563 Bacteria 3884
288 Ga0068855_100107846 3300005563 Bacteria 3199
289 Ga0068855_100110159 3300005563 Bacteria 3161
290 Ga0068855_100207537 3300005563 Bacteria 2203
291 Ga0068855_100339198 3300005563 Bacteria 1657
292 Ga0068855_100363999 3300005563 Bacteria 1591
293 Ga0068855_101058269 3300005563 Bacteria 850
294 Ga0070664_100001161 3300005564 Bacteria 20900
295 Ga0070664_100028499 3300005564 Bacteria 4646
296 Ga0070664_100107033 3300005564 Bacteria 2437
297 Ga0070664_100284511 3300005564 Bacteria 1492
298 Ga0070664_100505068 3300005564 Bacteria 1115
299 Ga0068857_100033556 3300005577 Bacteria 4540
300 Ga0068857_100039161 3300005577 Bacteria 4198
301 Ga0068857_100162097 3300005577 Bacteria 2029
302 Ga0068857_100166767 3300005577 Bacteria 2000
303 Ga0068857_100260980 3300005577 Bacteria 1590
304 Ga0068857_100322436 3300005577 Bacteria 1427
305 Ga0068857_100430777 3300005577 Bacteria 1231
306 Ga0068854_100005558 3300005578 Bacteria 7966
307 Ga0068854_100019801 3300005578 Bacteria 4541
308 Ga0068854_100060161 3300005578 Bacteria 2747
309 Ga0068854_100118535 3300005578 Bacteria 2006
310 Ga0068854_100261066 3300005578 Bacteria 1387
311 Ga0068854_100314614 3300005578 Bacteria 1271
312 Ga0068854_100526461 3300005578 Bacteria 999
313 Ga0068856_100000712 3300005614 Bacteria 36113
314 Ga0068856_100001030 3300005614 Bacteria 29686
315 Ga0068856_100001092 3300005614 Bacteria 28600
316 Ga0068856_100016942 3300005614 Bacteria 7061
317 Ga0068856_100026984 3300005614 Bacteria 5602
318 Ga0068856_100064365 3300005614 Bacteria 3623
319 Ga0068856_100142882 3300005614 Bacteria 2401
320 Ga0068856_100291474 3300005614 Bacteria 1649
321 Ga0068856_100298408 3300005614 Bacteria 1629
322 Ga0070702_100007463 3300005615 Bacteria 5238
323 Ga0070702_100052076 3300005615 Bacteria 2346
324 Ga0070702_100160574 3300005615 Bacteria 1452
325 Ga0068852_100002266 3300005616 Bacteria 13211
326 Ga0068852_100062643 3300005616 Bacteria 3236
327 Ga0068852_100062844 3300005616 Bacteria 3231
328 Ga0068852_100066412 3300005616 Bacteria 3150
329 Ga0068852_100071661 3300005616 Bacteria 3044
330 Ga0068852_100089737 3300005616 Bacteria 2748
331 Ga0068852_100103481 3300005616 Bacteria 2575
332 Ga0068852_100115565 3300005616 Bacteria 2447
333 Ga0068852_100248392 3300005616 Bacteria 1703
334 Ga0068852_100587149 3300005616 Bacteria 1117
335 Ga0068852_100876833 3300005616 Bacteria 914
336 Ga0068859_100187181 3300005617 Bacteria 2154
337 Ga0068859_100538161 3300005617 Bacteria 1263
338 Ga0068864_100055636 3300005618 Bacteria 3417
339 Ga0068864_100436688 3300005618 Bacteria 1250
340 Ga0068866_10001434 3300005718 Bacteria 10183
341 Ga0068866_10078269 3300005718 Bacteria 1769
342 Ga0068866_10199930 3300005718 Bacteria 1193
343 Ga0068866_10344534 3300005718 Bacteria 945
344 Ga0068861_100067307 3300005719 Bacteria 2764
345 Ga0068861_100087889 3300005719 Bacteria 2446
346 Ga0068861_100116520 3300005719 Bacteria 2148
347 Ga0068861_100143144 3300005719 Bacteria 1954
348 Ga0068861_100165647 3300005719 Bacteria 1827
349 Ga0068861_100342371 3300005719 Bacteria 1309
350 Ga0068851_10024167 3300005834 Bacteria 2974
351 Ga0068851_10026083 3300005834 Bacteria 2869
352 Ga0068851_10067880 3300005834 Bacteria 1840
353 Ga0068870_10004209 3300005840 Bacteria 6180
354 Ga0068870_10099514 3300005840 Bacteria 1640
355 Ga0068870_10401178 3300005840 Bacteria 892
356 Ga0068863_100036811 3300005841 Bacteria 4660
357 Ga0068863_100057358 3300005841 Bacteria 3686
358 Ga0068863_100067666 3300005841 Bacteria 3378
359 Ga0068863_100376497 3300005841 Bacteria 1386
360 Ga0068863_100749321 3300005841 Bacteria 972
361 Ga0068858_100025105 3300005842 Bacteria 5546
362 Ga0068858_100050743 3300005842 Bacteria 3840
363 Ga0068858_100164795 3300005842 Bacteria 2088
364 Ga0068858_100574056 3300005842 Bacteria 1093
365 Ga0068860_100000222 3300005843 Bacteria 88724
366 Ga0068860_100055470 3300005843 Bacteria 3767
367 Ga0068860_100288779 3300005843 Bacteria 1604
368 Ga0068862_100081042 3300005844 Bacteria 2815
369 Ga0068862_100480955 3300005844 Bacteria 1175
370 Ga0068862_100927348 3300005844 Bacteria 857
371 Ga0081455_10004820 3300005937 Bacteria 14989
372 Ga0081455_10060036 3300005937 Bacteria 3208
373 Ga0081455_10064985 3300005937 Bacteria 3054
374 Ga0081455_10096044 3300005937 Bacteria 2391
375 Ga0081455_10169039 3300005937 Bacteria 1668
376 Ga0081455_10452069 3300005937 Bacteria 877
377 Ga0081538_10013011 3300005981 Bacteria 6619
378 Ga0081538_10030420 3300005981 Bacteria 3666
379 Ga0081538_10032378 3300005981 Bacteria 3504
380 Ga0081538_10037147 3300005981 Bacteria 3166
381 Ga0081540_1000462 3300005983 Bacteria 40336
382 Ga0081540_1000514 3300005983 Bacteria 37986
383 Ga0081540_1004620 3300005983 Bacteria 10416
384 Ga0081540_1005105 3300005983 Bacteria 9847
385 Ga0081540_1008349 3300005983 Bacteria 7239
386 Ga0081540_1016874 3300005983 Bacteria 4547
387 Ga0081540_1017756 3300005983 Bacteria 4393
388 Ga0081540_1018379 3300005983 Bacteria 4290
389 Ga0081540_1032930 3300005983 Bacteria 2821
390 Ga0081540_1034051 3300005983 Bacteria 2755
391 Ga0081540_1043310 3300005983 Bacteria 2311
392 Ga0081540_1051530 3300005983 Bacteria 2034
393 Ga0081540_1077600 3300005983 Bacteria 1509
394 Ga0081540_1136876 3300005983 Bacteria 990
395 Ga0081539_10000099 3300005985 Bacteria 201018
396 Ga0081539_10000540 3300005985 Bacteria 78243
397 Ga0081539_10039792 3300005985 Bacteria 2769
398 Ga0081539_10093141 3300005985 Bacteria 1553
399 Ga0070717_10000329 3300006028 Bacteria 30746
400 Ga0070717_10003491 3300006028 Bacteria 11254
401 Ga0070717_10005721 3300006028 Bacteria 9092
402 Ga0070717_10276685 3300006028 Bacteria 1488
403 Ga0075365_10014849 3300006038 Bacteria 4693
404 Ga0075365_10039350 3300006038 Bacteria 3078
405 Ga0075365_10121443 3300006038 Bacteria 1802
406 Ga0075365_10131630 3300006038 Bacteria 1731
407 Ga0075365_10190712 3300006038 Bacteria 1434
408 Ga0075365_10254593 3300006038 Bacteria 1234
409 Ga0075365_10275600 3300006038 Bacteria 1183
410 Ga0075368_10004558 3300006042 Bacteria 4708
411 Ga0075368_10014412 3300006042 Bacteria 2919
412 Ga0075368_10015875 3300006042 Bacteria 2799
413 Ga0075368_10020133 3300006042 Bacteria 2523
414 Ga0075363_100011478 3300006048 Bacteria 4243
415 Ga0075363_100014493 3300006048 Bacteria 3855
416 Ga0075363_100102926 3300006048 Bacteria 1582
417 Ga0075363_100159815 3300006048 Bacteria 1275
418 Ga0075364_10026215 3300006051 Bacteria 3716
419 Ga0075364_10063358 3300006051 Bacteria 2427
420 Ga0075364_10099783 3300006051 Bacteria 1933
421 Ga0075364_10114887 3300006051 Bacteria 1799
422 Ga0070715_10001538 3300006163 Bacteria 6749
423 Ga0070715_10042345 3300006163 Bacteria 1914
424 Ga0070716_100002810 3300006173 Bacteria 8106
425 Ga0070716_100004252 3300006173 Bacteria 6816
426 Ga0070716_100088929 3300006173 Bacteria 1864
427 Ga0070716_100153236 3300006173 Bacteria 1485
428 Ga0070716_100181172 3300006173 Bacteria 1383
429 Ga0070712_100088469 3300006175 Bacteria 2263
430 Ga0070712_100114656 3300006175 Bacteria 2018
431 Ga0070712_100224529 3300006175 Bacteria 1488
432 Ga0070712_100424356 3300006175 Bacteria 1103
433 Ga0075362_10015370 3300006177 Bacteria 3112
434 Ga0075362_10019441 3300006177 Bacteria 2824
435 Ga0075362_10043878 3300006177 Bacteria 1981
436 Ga0075362_10062555 3300006177 Bacteria 1686
437 Ga0075367_10027145 3300006178 Bacteria 3254
438 Ga0075367_10062626 3300006178 Bacteria 2222
439 Ga0075367_10064356 3300006178 Bacteria 2193
440 Ga0075367_10078528 3300006178 Bacteria 1993
441 Ga0075369_10031432 3300006186 Bacteria 2241
442 Ga0075369_10032212 3300006186 Bacteria 2217
443 Ga0075369_10032487 3300006186 Bacteria 2208
444 Ga0075369_10041686 3300006186 Bacteria 1966
445 Ga0075369_10042556 3300006186 Bacteria 1947
446 Ga0075369_10048905 3300006186 Bacteria 1826
447 Ga0075369_10076409 3300006186 Bacteria 1480
448 Ga0075369_10108220 3300006186 Bacteria 1252
449 Ga0075369_10154411 3300006186 Bacteria 1050
450 Ga0075366_10001879 3300006195 Bacteria 10594
451 Ga0075366_10002171 3300006195 Bacteria 10008
452 Ga0075366_10005769 3300006195 Bacteria 6724
453 Ga0075366_10022411 3300006195 Bacteria 3674
454 Ga0075366_10064747 3300006195 Bacteria 2174
455 Ga0075366_10109182 3300006195 Bacteria 1664
456 Ga0097621_100079020 3300006237 Bacteria 2734
457 Ga0097621_100134886 3300006237 Bacteria 2105
458 Ga0097621_100169050 3300006237 Bacteria 1883
459 Ga0097621_100395864 3300006237 Bacteria 1236
460 Ga0097621_100447410 3300006237 Bacteria 1163
461 Ga0097621_100590816 3300006237 Bacteria 1014
462 Ga0075370_10003312 3300006353 Bacteria 7648
463 Ga0075370_10059447 3300006353 Bacteria 2175
464 Ga0075370_10082078 3300006353 Bacteria 1853
465 Ga0075370_10113754 3300006353 Bacteria 1572
466 Ga0075370_10140751 3300006353 Bacteria 1410
467 Ga0075370_10190057 3300006353 Bacteria 1210
468 Ga0075370_10378085 3300006353 Bacteria 848
469 Ga0068871_100047370 3300006358 Bacteria 3467
470 Ga0068871_100059250 3300006358 Bacteria 3119
471 Ga0075428_100000165 3300006844 Bacteria 60894
472 Ga0075428_100385931 3300006844 Bacteria 1502
473 Ga0075430_100162732 3300006846 Bacteria 1858
474 Ga0075431_100005327 3300006847 Bacteria 12685
475 Ga0075431_100074428 3300006847 Bacteria 3504
476 Ga0075431_100098559 3300006847 Bacteria 3018
477 Ga0075431_100608554 3300006847 Bacteria 1076
478 Ga0075433_10062410 3300006852 Bacteria 3263
479 Ga0075433_10144738 3300006852 Bacteria 2113
480 Ga0075433_10242925 3300006852 Bacteria 1598
481 Ga0075434_100002775 3300006871 Bacteria 15493
482 Ga0075434_100126572 3300006871 Bacteria 2572
483 Ga0075434_100166174 3300006871 Bacteria 2227
484 Ga0075434_100325424 3300006871 Bacteria 1558
485 Ga0075434_100337009 3300006871 Bacteria 1529
486 Ga0075434_100418849 3300006871 Bacteria 1360
487 Ga0075434_100617231 3300006871 Bacteria 1103
488 Ga0075429_100061945 3300006880 Bacteria 3259
489 Ga0075429_100148348 3300006880 Bacteria 2053
490 Ga0075429_100185389 3300006880 Bacteria 1823
491 Ga0075429_100342155 3300006880 Bacteria 1309
492 Ga0068865_100041192 3300006881 Bacteria 3141
493 Ga0068865_100141536 3300006881 Bacteria 1814
494 Ga0068865_100198339 3300006881 Bacteria 1557
495 Ga0068865_100329957 3300006881 Bacteria 1230
496 Ga0068865_100450398 3300006881 Bacteria 1064
497 Ga0075436_100067348 3300006914 Bacteria 2475
498 Ga0075436_100455706 3300006914 Bacteria 932
499 Ga0097620_100187176 3300006931 Bacteria 2154
500 Ga0097620_100538088 3300006931 Bacteria 1263
501 Ga0099824_1015072 3300006942 Bacteria 7459
502 Ga0099824_1036663 3300006942 Bacteria 1410
503 Ga0099823_1009032 3300006944 Bacteria 10121
504 Ga0075435_100111899 3300007076 Bacteria 2271
505 Ga0075435_100295365 3300007076 Bacteria 1385
506 Ga0099794_10016216 3300007265 Bacteria 3300
507 Ga0099794_10074622 3300007265 Bacteria 1666
508 Ga0099795_10011172 3300007788 Bacteria 2673
509 Ga0099795_10047861 3300007788 Bacteria 1546
510 Ga0105251_10161385 3300009011 Bacteria 1010
511 Ga0105244_10017280 3300009036 Bacteria 4081
512 Ga0105240_10001180 3300009093 Bacteria 45755
513 Ga0105240_10001823 3300009093 Bacteria 35764
514 Ga0105240_10008737 3300009093 Bacteria 14441
515 Ga0105240_10011568 3300009093 Bacteria 12276
516 Ga0105240_10038483 3300009093 Bacteria 6135
517 Ga0105240_10040108 3300009093 Bacteria 5992
518 Ga0105240_10057598 3300009093 Bacteria 4854
519 Ga0105240_10192851 3300009093 Bacteria 2394
520 Ga0105240_10194410 3300009093 Bacteria 2383
521 Ga0105240_10317770 3300009093 Bacteria 1776
522 Ga0105240_10464469 3300009093 Bacteria 1414
523 Ga0105240_10647400 3300009093 Bacteria 1159
524 Ga0105240_10797804 3300009093 Bacteria 1023
525 Ga0111539_10001811 3300009094 Bacteria 28459
526 Ga0111539_10036985 3300009094 Bacteria 5899
527 Ga0111539_10071980 3300009094 Bacteria 4078
528 Ga0111539_10174238 3300009094 Bacteria 2513
529 Ga0111539_10412734 3300009094 Bacteria 1572
530 Ga0111539_10471264 3300009094 Bacteria 1462
531 Ga0111539_11046015 3300009094 Bacteria 949
532 Ga0105245_10047123 3300009098 Bacteria 3852
533 Ga0105245_10137353 3300009098 Bacteria 2299
534 Ga0105245_10155546 3300009098 Bacteria 2165
535 Ga0105245_10159099 3300009098 Bacteria 2142
536 Ga0105245_10411927 3300009098 Bacteria 1353
537 Ga0105245_10514782 3300009098 Bacteria 1214
538 Ga0105245_10669975 3300009098 Bacteria 1069
539 Ga0105247_10189883 3300009101 Bacteria 1375
540 Ga0105247_10217726 3300009101 Bacteria 1291
541 Ga0114129_10182254 3300009147 Bacteria 2857
542 Ga0114129_10197285 3300009147 Bacteria 2729
543 Ga0114129_10272486 3300009147 Bacteria 2264
544 Ga0114129_10610090 3300009147 Bacteria 1413
545 Ga0114129_11011372 3300009147 Bacteria 1046
546 Ga0105243_10097617 3300009148 Bacteria 2432
547 Ga0105243_10327102 3300009148 Bacteria 1399
548 Ga0105243_10413343 3300009148 Bacteria 1256
549 Ga0105243_10533993 3300009148 Bacteria 1118
550 Ga0105243_10657352 3300009148 Bacteria 1016
551 Ga0105241_10019365 3300009174 Bacteria 5018
552 Ga0105241_10040441 3300009174 Bacteria 3520
553 Ga0105241_10058725 3300009174 Bacteria 2955
554 Ga0105241_10223960 3300009174 Bacteria 1582
555 Ga0105241_10277688 3300009174 Bacteria 1429
556 Ga0105241_10330645 3300009174 Bacteria 1317
557 Ga0105242_10002333 3300009176 Bacteria 14972
558 Ga0105242_10059311 3300009176 Bacteria 3139
559 Ga0105242_10123809 3300009176 Bacteria 2223
560 Ga0105242_10246725 3300009176 Bacteria 1607
561 Ga0105242_10306856 3300009176 Bacteria 1451
562 Ga0105248_10091172 3300009177 Bacteria 3432
563 Ga0105248_10249507 3300009177 Bacteria 1998
564 Ga0105248_10274177 3300009177 Bacteria 1899
565 Ga0105248_10312213 3300009177 Bacteria 1771
566 Ga0105248_10423466 3300009177 Bacteria 1499
567 Ga0105248_10568230 3300009177 Bacteria 1279
568 Ga0105237_10003792 3300009545 Bacteria 17768
569 Ga0105237_10009810 3300009545 Bacteria 10238
570 Ga0105237_10015336 3300009545 Bacteria 7980
571 Ga0105237_10022629 3300009545 Bacteria 6446
572 Ga0105237_10115255 3300009545 Bacteria 2680
573 Ga0105237_10209393 3300009545 Bacteria 1950
574 Ga0105237_10263489 3300009545 Bacteria 1726
575 Ga0105237_10296450 3300009545 Bacteria 1620
576 Ga0105237_10434732 3300009545 Bacteria 1318
577 Ga0105237_10676629 3300009545 Bacteria 1039
578 Ga0105238_10001573 3300009551 Bacteria 22875
579 Ga0105238_10015729 3300009551 Bacteria 7660
580 Ga0105238_10020731 3300009551 Bacteria 6694
581 Ga0105238_10032944 3300009551 Bacteria 5274
582 Ga0105238_10042461 3300009551 Bacteria 4604
583 Ga0105238_10070942 3300009551 Bacteria 3482
584 Ga0105238_10202979 3300009551 Bacteria 1958
585 Ga0105238_10442534 3300009551 Bacteria 1296
586 Ga0105238_10495914 3300009551 Bacteria 1221
587 Ga0105249_10063570 3300009553 Bacteria 3391
588 Ga0105249_10085965 3300009553 Bacteria 2932
589 Ga0105249_10210860 3300009553 Bacteria 1906
590 Ga0105249_10834327 3300009553 Bacteria 987
591 Ga0099796_10002520 3300010159 Bacteria 4040
592 Ga0099796_10008928 3300010159 Bacteria 2691
593 Ga0099796_10132624 3300010159 Bacteria 967
594 Ga0105239_10012109 3300010375 Bacteria 9617
595 Ga0105239_10014050 3300010375 Bacteria 8889
596 Ga0105239_10020094 3300010375 Bacteria 7368
597 Ga0105239_10024037 3300010375 Bacteria 6712
598 Ga0105239_10175057 3300010375 Bacteria 2400
599 Ga0105239_10248442 3300010375 Bacteria 1998
600 Ga0105239_10325213 3300010375 Bacteria 1734
601 Ga0105239_10374367 3300010375 Bacteria 1610
602 Ga0105239_10503483 3300010375 Bacteria 1377
603 Ga0105246_10012990 3300011119 Bacteria 5211
604 Ga0105246_10035445 3300011119 Bacteria 3335
605 Ga0105246_10217891 3300011119 Bacteria 1494
606 Ga0157373_10087865 3300013100 Bacteria 2190
607 Ga0157373_10089953 3300013100 Bacteria 2162
608 Ga0157373_10120416 3300013100 Bacteria 1845
609 Ga0157373_10197884 3300013100 Bacteria 1417
610 Ga0157371_10000313 3300013102 Bacteria 63085
611 Ga0157370_10002820 3300013104 Bacteria 20763
612 Ga0157370_10008939 3300013104 Bacteria 10762
613 Ga0157370_10024986 3300013104 Bacteria 5912
614 Ga0157370_10029928 3300013104 Bacteria 5337
615 Ga0157370_10192754 3300013104 Bacteria 1892
616 Ga0157370_10576303 3300013104 Bacteria 1031
617 Ga0157369_10008890 3300013105 Bacteria 11508
618 Ga0157369_10034521 3300013105 Bacteria 5551
619 Ga0157369_10046568 3300013105 Bacteria 4713
620 Ga0157369_10064420 3300013105 Bacteria 3947
621 Ga0157369_10124870 3300013105 Bacteria 2729
622 Ga0157369_10295550 3300013105 Bacteria 1686
623 Ga0157369_10329440 3300013105 Bacteria 1587
624 Ga0157369_10347282 3300013105 Bacteria 1541
625 Ga0157374_10006868 3300013296 Bacteria 9681
626 Ga0157374_10039570 3300013296 Bacteria 4339
627 Ga0157374_10091943 3300013296 Bacteria 2894
628 Ga0157374_10443435 3300013296 Bacteria 1299
629 Ga0157374_10540886 3300013296 Bacteria 1172
630 Ga0157374_10817208 3300013296 Bacteria 948
631 Ga0157378_10001069 3300013297 Bacteria 25077
632 Ga0157378_10119566 3300013297 Bacteria 2426
633 Ga0157378_10183717 3300013297 Bacteria 1968
634 Ga0157378_10269237 3300013297 Bacteria 1638
635 Ga0157378_10534381 3300013297 Bacteria 1176
636 Ga0163162_10010390 3300013306 Bacteria 9048
637 Ga0163162_10044782 3300013306 Bacteria 4433
638 Ga0163162_10071039 3300013306 Bacteria 3533
639 Ga0163162_10256925 3300013306 Bacteria 1879
640 Ga0163162_10528282 3300013306 Bacteria 1309
641 Ga0163162_10657887 3300013306 Bacteria 1171
642 Ga0157372_10001513 3300013307 Bacteria 25249
643 Ga0157372_10123333 3300013307 Bacteria 2978
644 Ga0157372_10175882 3300013307 Bacteria 2477
645 Ga0157372_10278262 3300013307 Bacteria 1945
646 Ga0157372_10280050 3300013307 Bacteria 1939
647 Ga0157372_10346205 3300013307 Bacteria 1731
648 Ga0157372_10352466 3300013307 Bacteria 1715
649 Ga0157372_10479713 3300013307 Bacteria 1450
650 Ga0157372_10633607 3300013307 Bacteria 1245
651 Ga0157375_10011246 3300013308 Bacteria 7898
652 Ga0157375_10076221 3300013308 Bacteria 3380
653 Ga0157375_10510254 3300013308 Bacteria 1366
654 Ga0157375_10575121 3300013308 Bacteria 1287
655 Ga0157375_10604791 3300013308 Bacteria 1255
656 Ga0157375_11294954 3300013308 Bacteria 857
657 Ga0163163_10009543 3300014325 Bacteria 8669
658 Ga0163163_10043695 3300014325 Bacteria 4394
659 Ga0163163_10253274 3300014325 Bacteria 1811
660 Ga0163163_10286580 3300014325 Bacteria 1699
661 Ga0163163_10380136 3300014325 Bacteria 1470
662 Ga0157380_10009769 3300014326 Bacteria 6885
663 Ga0157380_10011298 3300014326 Bacteria 6448
664 Ga0157380_10039122 3300014326 Bacteria 3686
665 Ga0157380_10083378 3300014326 Bacteria 2619
666 Ga0157380_10090401 3300014326 Bacteria 2525
667 Ga0157380_10382035 3300014326 Bacteria 1329
668 Ga0182008_10049953 3300014497 Bacteria 2076
669 Ga0182008_10111937 3300014497 Bacteria 1353
670 Ga0182008_10119251 3300014497 Bacteria 1311
671 Ga0182008_10173109 3300014497 Bacteria 1090
672 Ga0157377_10002988 3300014745 Bacteria 7574
673 Ga0157377_10179848 3300014745 Bacteria 1329
674 Ga0157379_10010105 3300014968 Bacteria 8227
675 Ga0157379_10025051 3300014968 Bacteria 5297
676 Ga0157379_10119384 3300014968 Bacteria 2372
677 Ga0157379_10127366 3300014968 Bacteria 2291
678 Ga0157379_10226579 3300014968 Bacteria 1694
679 Ga0157379_10667240 3300014968 Bacteria 974
680 Ga0157376_10049928 3300014969 Bacteria 3468
681 Ga0157376_10071388 3300014969 Bacteria 2951
682 Ga0157376_10072220 3300014969 Bacteria 2935
683 Ga0157376_10150526 3300014969 Bacteria 2098
684 Ga0182006_1000010 3300015261 Bacteria 413414
685 Ga0182006_1003655 3300015261 Bacteria 7806
686 Ga0182006_1009857 3300015261 Bacteria 4272
687 Ga0182006_1015766 3300015261 Bacteria 3234
688 Ga0182007_10000021 3300015262 Bacteria 193408
689 Ga0182007_10000965 3300015262 Bacteria 15786
690 Ga0182007_10006430 3300015262 Bacteria 5040
691 Ga0182005_1000009 3300015265 Bacteria 455334
692 Ga0182005_1000289 3300015265 Bacteria 31434
693 Ga0163161_10018193 3300017792 Bacteria 4926
694 Ga0163161_10186882 3300017792 Bacteria 1591
695 Ga0163161_10193734 3300017792 Bacteria 1563
696 Ga0214544_1000003 3300021320 Bacteria 643752
697 Ga0214544_1026121 3300021320 Bacteria 2656
698 Ga0214542_1000022 3300021321 Bacteria 193578
699 Ga0214542_1027283 3300021321 Bacteria 2636
700 Ga0214542_1031454 3300021321 Bacteria 1968
701 Ga0214545_1000010 3300021324 Bacteria 193578
702 Ga0214545_1019663 3300021324 Bacteria 5700
703 Ga0214545_1035403 3300021324 Bacteria 1655
704 Ga0214543_1000035 3300021327 Bacteria 183100
705 Ga0214543_1019719 3300021327 Bacteria 5699
706 Ga0214543_1032039 3300021327 Bacteria 2028
707 Ga0213873_10003009 3300021358 Bacteria 2993
708 Ga0213872_10066318 3300021361 Bacteria 1629
709 Ga0213872_10069702 3300021361 Bacteria 1586
710 Ga0213876_10027632 3300021384 Bacteria 2993
711 Ga0213871_10013400 3300021441 Bacteria 1925
712 Ga0209435_100018 3300025206 Bacteria 274625
713 Ga0209435_100106 3300025206 Bacteria 32841
714 Ga0209435_100375 3300025206 Bacteria 9989
715 Ga0209760_104196 3300025207 Bacteria 1245
716 Ga0209436_100322 3300025208 Bacteria 21971
717 Ga0209784_100009 3300025224 Bacteria 688031
718 Ga0209784_100049 3300025224 Bacteria 195512
719 Ga0209566_100007 3300025225 Bacteria 688031
720 Ga0209566_100061 3300025225 Bacteria 195512
721 Ga0209674_100018 3300025226 Bacteria 688031
722 Ga0209674_100069 3300025226 Bacteria 243948
723 Ga0209672_103669 3300025228 Bacteria 3094
724 Ga0209672_114680 3300025228 Bacteria 898
725 Ga0209147_100051 3300025229 Bacteria 274605
726 Ga0209563_100020 3300025230 Bacteria 688031
727 Ga0209563_100083 3300025230 Bacteria 195512
728 Ga0207427_100638 3300025231 Bacteria 16992
729 Ga0209437_100091 3300025233 Bacteria 243344
730 Ga0209437_100117 3300025233 Bacteria 209271
731 Ga0209437_100307 3300025233 Bacteria 66935
732 Ga0209258_100324 3300025242 Bacteria 72141
733 Ga0209258_103788 3300025242 Bacteria 3106
734 Ga0207425_1000354 3300025245 Bacteria 31834
735 Ga0207425_1001911 3300025245 Bacteria 7893
736 Ga0209646_1000143 3300025246 Bacteria 105906
737 Ga0209646_1000172 3300025246 Bacteria 84840
738 Ga0209646_1000186 3300025246 Bacteria 77615
739 Ga0209026_1000042 3300025250 Bacteria 273111
740 Ga0209026_1000629 3300025250 Bacteria 22159
741 Ga0209026_1002393 3300025250 Bacteria 7075
742 Ga0209677_100010 3300025253 Bacteria 688031
743 Ga0209677_100039 3300025253 Bacteria 243974
744 Ga0209677_101351 3300025253 Bacteria 10771
745 Ga0209677_101442 3300025253 Bacteria 10282
746 Ga0209759_1000273 3300025256 Bacteria 73308
747 Ga0209759_1000343 3300025256 Bacteria 61236
748 Ga0209759_1000470 3300025256 Bacteria 45282
749 Ga0209129_1002425 3300025258 Bacteria 9165
750 Ga0209233_1000115 3300025261 Bacteria 243344
751 Ga0209233_1002586 3300025261 Bacteria 6579
752 Ga0209565_1000080 3300025263 Bacteria 156999
753 Ga0209565_1000459 3300025263 Bacteria 31365
754 Ga0209565_1000488 3300025263 Bacteria 29101
755 Ga0209565_1003784 3300025263 Bacteria 4786
756 Ga0209565_1015061 3300025263 Bacteria 1754
757 Ga0209455_1000821 3300025272 Bacteria 16875
758 Ga0209455_1003274 3300025272 Bacteria 5828
759 Ga0209455_1009949 3300025272 Bacteria 2453
760 Ga0209673_1000088 3300025273 Bacteria 204629
761 Ga0209673_1002584 3300025273 Bacteria 12254
762 Ga0209673_1030651 3300025273 Bacteria 1689
763 Ga0209130_1000122 3300025284 Bacteria 126935
764 Ga0209130_1000238 3300025284 Bacteria 70723
765 Ga0209130_1000493 3300025284 Bacteria 40544
766 Ga0207673_1000293 3300025290 Bacteria 5058
767 Ga0209675_1002650 3300025291 Bacteria 9037
768 Ga0209675_1005953 3300025291 Bacteria 4998
769 Ga0209676_1000073 3300025292 Bacteria 305947
770 Ga0209676_1000286 3300025292 Bacteria 103478
771 Ga0209025_1001379 3300025294 Bacteria 32535
772 Ga0209564_1000098 3300025295 Bacteria 228906
773 Ga0209564_1000313 3300025295 Bacteria 95224
774 Ga0209564_1007889 3300025295 Bacteria 5384
775 Ga0209564_1007991 3300025295 Bacteria 5316
776 Ga0209564_1036990 3300025295 Bacteria 1383
777 Ga0209758_1000106 3300025297 Bacteria 218450
778 Ga0209758_1000344 3300025297 Bacteria 85133
779 Ga0209758_1000727 3300025297 Bacteria 48235
780 Ga0209758_1001688 3300025297 Bacteria 24860
781 Ga0209758_1002307 3300025297 Bacteria 19725
782 Ga0209758_1008565 3300025297 Bacteria 6585
783 Ga0209758_1009770 3300025297 Bacteria 5883
784 Ga0209758_1013940 3300025297 Bacteria 4326
785 Ga0209050_1000008 3300025298 Bacteria 1144179
786 Ga0209050_1000183 3300025298 Bacteria 142357
787 Ga0209050_1001801 3300025298 Bacteria 20967
788 Ga0209256_1000096 3300025299 Bacteria 204629
789 Ga0209256_1001704 3300025299 Bacteria 21157
790 Ga0209256_1005569 3300025299 Bacteria 7173
791 Ga0209256_1008037 3300025299 Bacteria 4998
792 Ga0207426_1000083 3300025302 Bacteria 298770
793 Ga0207426_1000374 3300025302 Bacteria 78498
794 Ga0207426_1000440 3300025302 Bacteria 66997
795 Ga0207426_1001049 3300025302 Bacteria 26249
796 Ga0207426_1001712 3300025302 Bacteria 16832
797 Ga0207426_1007090 3300025302 Bacteria 4740
798 Ga0209051_1000005 3300025303 Bacteria 1142353
799 Ga0209051_1017007 3300025303 Bacteria 3265
800 Ga0209257_1000010 3300025304 Bacteria 1158682
801 Ga0209257_1000031 3300025304 Bacteria 688770
802 Ga0209257_1001077 3300025304 Bacteria 35853
803 Ga0207697_10001101 3300025315 Bacteria 14905
804 Ga0207656_10021626 3300025321 Bacteria 2572
805 Ga0207656_10030665 3300025321 Bacteria 2223
806 Ga0207656_10059774 3300025321 Bacteria 1669
807 Ga0207656_10223699 3300025321 Bacteria 915
808 Ga0207713_1023954 3300025735 Bacteria 2858
809 Ga0207653_10060604 3300025885 Bacteria 1275
810 Ga0207682_10000163 3300025893 Bacteria 30371
811 Ga0207682_10047823 3300025893 Bacteria 1762
812 Ga0207682_10051739 3300025893 Bacteria 1702
813 Ga0207682_10129362 3300025893 Bacteria 1126
814 Ga0207692_10002984 3300025898 Bacteria 6554
815 Ga0207692_10012527 3300025898 Bacteria 3645
816 Ga0207692_10015463 3300025898 Bacteria 3359
817 Ga0207692_10149598 3300025898 Bacteria 1336
818 Ga0207688_10000238 3300025901 Bacteria 24983
819 Ga0207688_10045907 3300025901 Bacteria 2438
820 Ga0207688_10090797 3300025901 Bacteria 1754
821 Ga0207680_10043645 3300025903 Bacteria 2631
822 Ga0207680_10417872 3300025903 Bacteria 949
823 Ga0207647_10050472 3300025904 Bacteria 2575
824 Ga0207685_10002297 3300025905 Bacteria 4345
825 Ga0207685_10156310 3300025905 Bacteria 1037
826 Ga0207699_10012272 3300025906 Bacteria 4355
827 Ga0207699_10084388 3300025906 Bacteria 1978
828 Ga0207645_10001001 3300025907 Bacteria 23330
829 Ga0207645_10069412 3300025907 Bacteria 2254
830 Ga0207645_10106716 3300025907 Bacteria 1811
831 Ga0207643_10000208 3300025908 Bacteria 40933
832 Ga0207643_10030888 3300025908 Bacteria 2985
833 Ga0207643_10094100 3300025908 Bacteria 1750
834 Ga0207705_10030592 3300025909 Bacteria 3842
835 Ga0207705_10191491 3300025909 Bacteria 1547
836 Ga0207705_10201144 3300025909 Bacteria 1509
837 Ga0207684_10029380 3300025910 Bacteria 4682
838 Ga0207684_10054995 3300025910 Bacteria 3377
839 Ga0207684_10254511 3300025910 Bacteria 1515
840 Ga0207654_10008295 3300025911 Bacteria 5248
841 Ga0207654_10053403 3300025911 Bacteria 2332
842 Ga0207654_10085835 3300025911 Bacteria 1906
843 Ga0207654_10229725 3300025911 Bacteria 1235
844 Ga0207707_10000275 3300025912 Bacteria 55480
845 Ga0207707_10001341 3300025912 Bacteria 22930
846 Ga0207707_10034261 3300025912 Bacteria 4442
847 Ga0207707_10035892 3300025912 Bacteria 4335
848 Ga0207707_10035901 3300025912 Bacteria 4334
849 Ga0207707_10047665 3300025912 Bacteria 3731
850 Ga0207707_10069602 3300025912 Bacteria 3067
851 Ga0207707_10505514 3300025912 Bacteria 1030
852 Ga0207695_10000123 3300025913 Bacteria 232059
853 Ga0207695_10000564 3300025913 Bacteria 75954
854 Ga0207695_10001159 3300025913 Bacteria 45736
855 Ga0207695_10001901 3300025913 Bacteria 32585
856 Ga0207695_10008797 3300025913 Bacteria 12583
857 Ga0207695_10038571 3300025913 Bacteria 5141
858 Ga0207695_10073999 3300025913 Bacteria 3469
859 Ga0207695_10086151 3300025913 Bacteria 3169
860 Ga0207695_10242832 3300025913 Bacteria 1702
861 Ga0207671_10021253 3300025914 Bacteria 4927
862 Ga0207671_10028018 3300025914 Bacteria 4210
863 Ga0207671_10039283 3300025914 Bacteria 3505
864 Ga0207671_10120548 3300025914 Bacteria 2005
865 Ga0207671_10144036 3300025914 Bacteria 1837
866 Ga0207671_10220339 3300025914 Bacteria 1486
867 Ga0207671_10371994 3300025914 Bacteria 1135
868 Ga0207671_10734335 3300025914 Bacteria 785
869 Ga0207693_10004235 3300025915 Bacteria 12167
870 Ga0207693_10018459 3300025915 Bacteria 5556
871 Ga0207693_10029805 3300025915 Bacteria 4307
872 Ga0207693_10044259 3300025915 Bacteria 3499
873 Ga0207693_10072822 3300025915 Bacteria 2690
874 Ga0207693_10197376 3300025915 Bacteria 1583
875 Ga0207693_10265259 3300025915 Bacteria 1346
876 Ga0207693_10295051 3300025915 Bacteria 1270
877 Ga0207663_10001982 3300025916 Bacteria 9709
878 Ga0207663_10021715 3300025916 Bacteria 3658
879 Ga0207663_10028851 3300025916 Bacteria 3253
880 Ga0207660_10006121 3300025917 Bacteria 7810
881 Ga0207660_10032603 3300025917 Bacteria 3597
882 Ga0207660_10089610 3300025917 Bacteria 2277
883 Ga0207660_10160520 3300025917 Bacteria 1734
884 Ga0207660_10331328 3300025917 Bacteria 1217
885 Ga0207660_10345289 3300025917 Bacteria 1192
886 Ga0207660_10526790 3300025917 Bacteria 960
887 Ga0207662_10039113 3300025918 Bacteria 2781
888 Ga0207662_10049518 3300025918 Bacteria 2493
889 Ga0207662_10124444 3300025918 Bacteria 1620
890 Ga0207657_10000410 3300025919 Bacteria 45335
891 Ga0207657_10006234 3300025919 Bacteria 12397
892 Ga0207657_10008209 3300025919 Bacteria 10632
893 Ga0207657_10039462 3300025919 Bacteria 4195
894 Ga0207657_10103303 3300025919 Bacteria 2362
895 Ga0207657_10404275 3300025919 Bacteria 1074
896 Ga0207657_10427179 3300025919 Bacteria 1041
897 Ga0207649_10056098 3300025920 Bacteria 2458
898 Ga0207649_10064534 3300025920 Bacteria 2315
899 Ga0207649_10466753 3300025920 Bacteria 955
900 Ga0207652_10003913 3300025921 Bacteria 12177
901 Ga0207652_10006466 3300025921 Bacteria 9450
902 Ga0207652_10062273 3300025921 Bacteria 3224
903 Ga0207652_10093987 3300025921 Bacteria 2640
904 Ga0207652_10096614 3300025921 Bacteria 2603
905 Ga0207652_10106458 3300025921 Bacteria 2482
906 Ga0207652_10467542 3300025921 Bacteria 1136
907 Ga0207652_10513397 3300025921 Bacteria 1078
908 Ga0207646_10109521 3300025922 Bacteria 2478
909 Ga0207646_10123418 3300025922 Bacteria 2328
910 Ga0207646_10281407 3300025922 Bacteria 1503
911 Ga0207681_10016556 3300025923 Bacteria 4614
912 Ga0207681_10027132 3300025923 Bacteria 3700
913 Ga0207681_10039690 3300025923 Bacteria 3127
914 Ga0207694_10004032 3300025924 Bacteria 11561
915 Ga0207694_10091002 3300025924 Bacteria 2408
916 Ga0207694_10185968 3300025924 Bacteria 1686
917 Ga0207694_10573391 3300025924 Bacteria 948
918 Ga0207650_10009001 3300025925 Bacteria 6825
919 Ga0207650_10018808 3300025925 Bacteria 4851
920 Ga0207650_10023150 3300025925 Bacteria 4404
921 Ga0207650_10239831 3300025925 Bacteria 1465
922 Ga0207659_10009964 3300025926 Bacteria 5952
923 Ga0207659_10281546 3300025926 Bacteria 1359
924 Ga0207659_10285657 3300025926 Bacteria 1350
925 Ga0207659_10659709 3300025926 Bacteria 894
926 Ga0207687_10025694 3300025927 Bacteria 3941
927 Ga0207687_10205185 3300025927 Bacteria 1543
928 Ga0207687_10354409 3300025927 Bacteria 1196
929 Ga0207687_10485563 3300025927 Bacteria 1029
930 Ga0207700_10007850 3300025928 Bacteria 6562
931 Ga0207700_10051441 3300025928 Bacteria 3075
932 Ga0207700_10223254 3300025928 Bacteria 1598
933 Ga0207700_10309823 3300025928 Bacteria 1365
934 Ga0207664_10031959 3300025929 Bacteria 4031
935 Ga0207664_10162582 3300025929 Bacteria 1905
936 Ga0207664_10180536 3300025929 Bacteria 1812
937 Ga0207644_10013321 3300025931 Bacteria 5480
938 Ga0207644_10015088 3300025931 Bacteria 5183
939 Ga0207644_10045977 3300025931 Bacteria 3107
940 Ga0207644_10053864 3300025931 Bacteria 2896
941 Ga0207644_10301598 3300025931 Bacteria 1291
942 Ga0207690_10000529 3300025932 Bacteria 24831
943 Ga0207690_10034333 3300025932 Bacteria 3268
944 Ga0207690_10065485 3300025932 Bacteria 2485
945 Ga0207690_10135850 3300025932 Bacteria 1805
946 Ga0207690_10294941 3300025932 Bacteria 1267
947 Ga0207690_10369322 3300025932 Bacteria 1138
948 Ga0207706_10000508 3300025933 Bacteria 41431
949 Ga0207706_10001419 3300025933 Bacteria 23975
950 Ga0207706_10023481 3300025933 Bacteria 5538
951 Ga0207706_10034439 3300025933 Bacteria 4505
952 Ga0207706_10056999 3300025933 Bacteria 3443
953 Ga0207706_10128044 3300025933 Bacteria 2232
954 Ga0207706_10396807 3300025933 Bacteria 1196
955 Ga0207686_10002221 3300025934 Bacteria 10670
956 Ga0207686_10045715 3300025934 Bacteria 2695
957 Ga0207686_10134108 3300025934 Bacteria 1702
958 Ga0207686_10154728 3300025934 Bacteria 1600
959 Ga0207709_10041313 3300025935 Bacteria 2767
960 Ga0207709_10248414 3300025935 Bacteria 1298
961 Ga0207709_10291369 3300025935 Bacteria 1210
962 Ga0207670_10004294 3300025936 Bacteria 7656
963 Ga0207670_10057664 3300025936 Bacteria 2634
964 Ga0207669_10002100 3300025937 Bacteria 8448
965 Ga0207669_10009239 3300025937 Bacteria 4681
966 Ga0207669_10416559 3300025937 Bacteria 1056
967 Ga0207704_10006126 3300025938 Bacteria 5578
968 Ga0207704_10252282 3300025938 Bacteria 1325
969 Ga0207704_10697353 3300025938 Bacteria 840
970 Ga0207665_10003307 3300025939 Bacteria 10801
971 Ga0207665_10030953 3300025939 Bacteria 3539
972 Ga0207665_10164841 3300025939 Bacteria 1597
973 Ga0207665_10185587 3300025939 Bacteria 1508
974 Ga0207665_10680326 3300025939 Bacteria 808
975 Ga0207691_10008516 3300025940 Bacteria 9851
976 Ga0207691_10078008 3300025940 Bacteria 2982
977 Ga0207691_10132801 3300025940 Bacteria 2198
978 Ga0207691_10172521 3300025940 Bacteria 1893
979 Ga0207691_10429681 3300025940 Bacteria 1125
980 Ga0207691_10478152 3300025940 Bacteria 1059
981 Ga0207711_10003709 3300025941 Bacteria 13166
982 Ga0207711_10040597 3300025941 Bacteria 3959
983 Ga0207711_10090394 3300025941 Bacteria 2691
984 Ga0207711_10115974 3300025941 Bacteria 2387
985 Ga0207711_10233755 3300025941 Bacteria 1684
986 Ga0207711_10390799 3300025941 Bacteria 1292
987 Ga0207689_10003747 3300025942 Bacteria 13859
988 Ga0207689_10022508 3300025942 Bacteria 5298
989 Ga0207689_10087761 3300025942 Bacteria 2555
990 Ga0207661_10000159 3300025944 Bacteria 43412
991 Ga0207661_10015998 3300025944 Bacteria 5529
992 Ga0207661_10041503 3300025944 Bacteria 3622
993 Ga0207679_10053840 3300025945 Bacteria 2960
994 Ga0207679_10222186 3300025945 Bacteria 1590
995 Ga0207679_10256840 3300025945 Bacteria 1488
996 Ga0207667_10000283 3300025949 Bacteria 69727
997 Ga0207667_10002513 3300025949 Bacteria 22867
998 Ga0207667_10014992 3300025949 Bacteria 8816
999 Ga0207667_10027249 3300025949 Bacteria 6225
1000 Ga0207667_10043798 3300025949 Bacteria 4748
1001 Ga0207667_10057334 3300025949 Bacteria 4088
1002 Ga0207667_10065863 3300025949 Bacteria 3777
1003 Ga0207667_10154895 3300025949 Bacteria 2358
1004 Ga0207667_10162408 3300025949 Bacteria 2297
1005 Ga0207667_10312965 3300025949 Bacteria 1604
1006 Ga0207667_10330075 3300025949 Bacteria 1557
1007 Ga0207651_10047078 3300025960 Bacteria 2905
1008 Ga0207651_10069078 3300025960 Bacteria 2493
1009 Ga0207651_10144346 3300025960 Bacteria 1843
1010 Ga0207651_10278802 3300025960 Bacteria 1380
1011 Ga0207651_10337441 3300025960 Bacteria 1265
1012 Ga0207651_10466635 3300025960 Bacteria 1086
1013 Ga0207712_10019967 3300025961 Bacteria 4383
1014 Ga0207712_10020536 3300025961 Bacteria 4326
1015 Ga0207712_10157955 3300025961 Bacteria 1759
1016 Ga0207712_10750139 3300025961 Bacteria 855
1017 Ga0207668_10049007 3300025972 Bacteria 2901
1018 Ga0207668_10068101 3300025972 Bacteria 2529
1019 Ga0207668_10080992 3300025972 Bacteria 2354
1020 Ga0207668_10117361 3300025972 Bacteria 2008
1021 Ga0207668_10298988 3300025972 Bacteria 1327
1022 Ga0207668_10714617 3300025972 Bacteria 881
1023 Ga0207668_10905459 3300025972 Bacteria 785
1024 Ga0207640_10054786 3300025981 Bacteria 2609
1025 Ga0207640_10087980 3300025981 Bacteria 2143
1026 Ga0207640_10256821 3300025981 Bacteria 1359
1027 Ga0207640_10480049 3300025981 Bacteria 1031
1028 Ga0207658_10062247 3300025986 Bacteria 2792
1029 Ga0207658_10472060 3300025986 Bacteria 1113
1030 Ga0207677_10013644 3300026023 Bacteria 4715
1031 Ga0207677_10130918 3300026023 Bacteria 1904
1032 Ga0207703_10013794 3300026035 Bacteria 6298
1033 Ga0207703_10018896 3300026035 Bacteria 5384
1034 Ga0207703_10085690 3300026035 Bacteria 2637
1035 Ga0207703_10115981 3300026035 Bacteria 2292
1036 Ga0207703_10146825 3300026035 Bacteria 2052
1037 Ga0207703_10399273 3300026035 Bacteria 1275
1038 Ga0207639_10001750 3300026041 Bacteria 14618
1039 Ga0207639_10005335 3300026041 Bacteria 8683
1040 Ga0207639_10077597 3300026041 Bacteria 2619
1041 Ga0207639_10092480 3300026041 Bacteria 2424
1042 Ga0207639_10131549 3300026041 Bacteria 2072
1043 Ga0207639_10504502 3300026041 Bacteria 1106
1044 Ga0207639_10709250 3300026041 Bacteria 934
1045 Ga0207639_10828846 3300026041 Bacteria 863
1046 Ga0207678_10000623 3300026067 Bacteria 32400
1047 Ga0207678_10009569 3300026067 Bacteria 8524
1048 Ga0207678_10018537 3300026067 Bacteria 6112
1049 Ga0207678_10155054 3300026067 Bacteria 1955
1050 Ga0207678_10273443 3300026067 Bacteria 1449
1051 Ga0207678_10321833 3300026067 Bacteria 1331
1052 Ga0207678_10390096 3300026067 Bacteria 1204
1053 Ga0207708_10021210 3300026075 Bacteria 4898
1054 Ga0207708_10105657 3300026075 Bacteria 2182
1055 Ga0207708_10249905 3300026075 Bacteria 1429
1056 Ga0207702_10000014 3300026078 Bacteria 253304
1057 Ga0207702_10001424 3300026078 Bacteria 23888
1058 Ga0207702_10047626 3300026078 Bacteria 3613
1059 Ga0207702_10078326 3300026078 Bacteria 2861
1060 Ga0207702_10202487 3300026078 Bacteria 1841
1061 Ga0207702_10238954 3300026078 Bacteria 1701
1062 Ga0207702_10431658 3300026078 Bacteria 1275
1063 Ga0207702_10436151 3300026078 Bacteria 1269
1064 Ga0207702_10469895 3300026078 Bacteria 1223
1065 Ga0207702_10515704 3300026078 Bacteria 1167
1066 Ga0207702_10517577 3300026078 Bacteria 1164
1067 Ga0207702_10538379 3300026078 Bacteria 1141
1068 Ga0207641_10028937 3300026088 Bacteria 4581
1069 Ga0207641_10097542 3300026088 Bacteria 2583
1070 Ga0207641_10099073 3300026088 Bacteria 2564
1071 Ga0207641_10254463 3300026088 Bacteria 1641
1072 Ga0207641_10620474 3300026088 Bacteria 1060
1073 Ga0207648_10004140 3300026089 Bacteria 15006
1074 Ga0207648_10035691 3300026089 Bacteria 4381
1075 Ga0207648_10051413 3300026089 Bacteria 3601
1076 Ga0207648_10081011 3300026089 Bacteria 2832
1077 Ga0207648_10108508 3300026089 Bacteria 2437
1078 Ga0207676_10039899 3300026095 Bacteria 3595
1079 Ga0207676_10121661 3300026095 Bacteria 2202
1080 Ga0207674_10007147 3300026116 Bacteria 13044
1081 Ga0207674_10039704 3300026116 Bacteria 4878
1082 Ga0207674_10044389 3300026116 Bacteria 4577
1083 Ga0207674_10246901 3300026116 Bacteria 1732
1084 Ga0207674_10312281 3300026116 Bacteria 1521
1085 Ga0207674_10363162 3300026116 Bacteria 1400
1086 Ga0207675_100075636 3300026118 Bacteria 3152
1087 Ga0207675_100112274 3300026118 Bacteria 2572
1088 Ga0207675_100172253 3300026118 Bacteria 2069
1089 Ga0207675_100206117 3300026118 Bacteria 1890
1090 Ga0207683_10001208 3300026121 Bacteria 23398
1091 Ga0207683_10015816 3300026121 Bacteria 6423
1092 Ga0207683_10041093 3300026121 Bacteria 4036
1093 Ga0207683_10059597 3300026121 Bacteria 3353
1094 Ga0207683_10070273 3300026121 Bacteria 3093
1095 Ga0207683_10170298 3300026121 Bacteria 1972
1096 Ga0207683_10178824 3300026121 Bacteria 1923
1097 Ga0207683_10378275 3300026121 Bacteria 1301
1098 Ga0207698_10016348 3300026142 Bacteria 4998
1099 Ga0207698_10068709 3300026142 Bacteria 2799
1100 Ga0207698_10118374 3300026142 Bacteria 2237
1101 Ga0207698_10133231 3300026142 Bacteria 2128
1102 Ga0207698_10191475 3300026142 Bacteria 1822
1103 Ga0207698_10196118 3300026142 Bacteria 1804
1104 Ga0207698_10204745 3300026142 Bacteria 1770
1105 Ga0207698_10293104 3300026142 Bacteria 1511
1106 Ga0209389_1000016 3300027296 Bacteria 184844
1107 Ga0209389_1000027 3300027296 Bacteria 146917
1108 Ga0209589_1000031 3300027357 Bacteria 147054
1109 Ga0209489_100057 3300027361 Bacteria 147398
1110 Ga0209489_100063 3300027361 Bacteria 144408
1111 Ga0209700_100012 3300027363 Bacteria 357892
1112 Ga0209984_1002309 3300027424 Bacteria 2127
1113 Ga0209179_1002827 3300027512 Bacteria 2412
1114 Ga0209970_1026517 3300027614 Bacteria 995
1115 Ga0210002_1012248 3300027617 Bacteria 1330
1116 Ga0209983_1001703 3300027665 Bacteria 4856
1117 Ga0209588_1001152 3300027671 Bacteria 6826
1118 Ga0209971_1004558 3300027682 Bacteria 3288
1119 Ga0209971_1004901 3300027682 Bacteria 3180
1120 Ga0209971_1015051 3300027682 Bacteria 1833
1121 Ga0209974_10006362 3300027876 Bacteria 4123
1122 Ga0207428_10000176 3300027907 Bacteria 89634
1123 Ga0207428_10020049 3300027907 Bacteria 5689
1124 Ga0207428_10109083 3300027907 Bacteria 2131
1125 Ga0207428_10292166 3300027907 Bacteria 1208
1126 Ga0207428_10448711 3300027907 Bacteria 940
1127 Ga0268266_10004934 3300028379 Bacteria 12639
1128 Ga0268266_10090737 3300028379 Bacteria 2678
1129 Ga0268266_10097804 3300028379 Bacteria 2582
1130 Ga0268266_10116547 3300028379 Bacteria 2372
1131 Ga0268266_10117809 3300028379 Bacteria 2360
1132 Ga0268266_10132641 3300028379 Bacteria 2229
1133 Ga0268266_10205895 3300028379 Bacteria 1802
1134 Ga0268266_10283729 3300028379 Bacteria 1540
1135 Ga0268266_10290486 3300028379 Bacteria 1522
1136 Ga0268266_10310639 3300028379 Bacteria 1473
1137 Ga0268266_10628794 3300028379 Bacteria 1032
1138 Ga0268265_10043509 3300028380 Bacteria 3339
1139 Ga0268265_10109269 3300028380 Bacteria 2253
1140 Ga0268265_10165438 3300028380 Bacteria 1884
1141 Ga0268264_10000042 3300028381 Bacteria 372069
1142 Ga0268264_10056533 3300028381 Bacteria 3280
1143 Ga0268264_10077215 3300028381 Bacteria 2836
1144 Ga0268264_10138072 3300028381 Bacteria 2170
1145 Ga0268264_10483459 3300028381 Bacteria 1205
1146 Ga0268264_10853454 3300028381 Bacteria 912
1147 Ga0265334_10009853 3300028573 Bacteria 4039
1148 Ga0307517_10000176 3300028786 Bacteria 105402
1149 Ga0307515_10000734 3300028794 Bacteria 75701
1150 Ga0307515_10135617 3300028794 Bacteria 2679
1151 Ga0307515_10341040 3300028794 Bacteria 1151
1152 Ga0307511_10038227 3300030521 Bacteria 4126
1153 Ga0307511_10096556 3300030521 Bacteria 1968
1154 Ga0316177_1120927 3300030731 Bacteria 5109
1155 Ga0316180_1146035 3300030736 Bacteria 2993
1156 Ga0316183_1005661 3300030742 Bacteria 2296
1157 Ga0316182_1315656 3300030745 Bacteria 4112
1158 Ga0265763_1000019 3300030763 Bacteria 6532
1159 Ga0265330_10005692 3300031235 Bacteria 6194
1160 Ga0265328_10168126 3300031239 Bacteria 828
1161 Ga0265340_10043423 3300031247 Bacteria 2204
1162 Ga0265339_10005071 3300031249 Bacteria 8846
1163 Ga0265331_10184920 3300031250 Bacteria 941
1164 Ga0307509_10186904 3300031507 Bacteria 1928
1165 Ga0307408_100001191 3300031548 Bacteria 19661
1166 Ga0307408_100006654 3300031548 Bacteria 7663
1167 Ga0307408_100011257 3300031548 Bacteria 5908
1168 Ga0307408_100029039 3300031548 Bacteria 3828
1169 Ga0307408_100095977 3300031548 Bacteria 2248
1170 Ga0307408_100109209 3300031548 Bacteria 2122
1171 Ga0307408_100220214 3300031548 Bacteria 1548
1172 Ga0307408_100570158 3300031548 Bacteria 1001
1173 Ga0307408_100617675 3300031548 Bacteria 965
1174 Ga0307508_10040384 3300031616 Bacteria 4189
1175 Ga0307508_10154948 3300031616 Bacteria 1894
1176 Ga0265314_10006820 3300031711 Bacteria 10008
1177 Ga0265342_10055660 3300031712 Bacteria 2347
1178 Ga0265342_10196527 3300031712 Bacteria 1098
1179 Ga0316576_10077416 3300031727 Bacteria 2463
1180 Ga0307516_10067084 3300031730 Bacteria 3458
1181 Ga0307516_10101603 3300031730 Bacteria 2691
1182 Ga0307516_10119426 3300031730 Bacteria 2429
1183 Ga0307405_10012653 3300031731 Bacteria 4477
1184 Ga0307413_10288290 3300031824 Bacteria 1238
1185 Ga0307518_10222878 3300031838 Bacteria 1229
1186 Ga0307410_10001818 3300031852 Bacteria 9908
1187 Ga0307406_10009696 3300031901 Bacteria 5414
1188 Ga0307406_10057929 3300031901 Bacteria 2487
1189 Ga0307406_10123109 3300031901 Bacteria 1807
1190 Ga0307407_10346698 3300031903 Bacteria 1050
1191 Ga0307412_10075800 3300031911 Bacteria 2308
1192 Ga0307409_100007584 3300031995 Bacteria 6503
1193 Ga0307416_100001693 3300032002 Bacteria 12206
1194 Ga0307416_100545466 3300032002 Bacteria 1232
1195 Ga0307416_100798787 3300032002 Bacteria 1039
1196 Ga0307414_10017677 3300032004 Bacteria 4370
1197 Ga0307411_10003428 3300032005 Bacteria 7352
1198 Ga0307411_10043483 3300032005 Bacteria 2874
1199 Ga0307415_100059947 3300032126 Bacteria 2627
1200 Ga0307415_100125460 3300032126 Bacteria 1934
1201 Ga0307415_100140018 3300032126 Bacteria 1846
1202 Ga0307415_100350567 3300032126 Bacteria 1242
1203 Ga0307507_10066258 3300033179 Bacteria 3313
1204 Ga0307510_10006120 3300033180 Bacteria 14338
1205 Ga0307510_10123753 3300033180 Bacteria 2282
1206 Ga0373930_0004586 3300034816 Bacteria 2259
1207 Ga0373926_0041629 3300035083 Bacteria 1642
1208 Ga0373926_0057320 3300035083 Bacteria 1415
1209 Ga0373934_0001254 3300035086 Bacteria 9244
1210 Ga0373934_0124205 3300035086 Bacteria 1051
1211 Ga0373944_0062476 3300035089 Bacteria 1198
1212 Ga0373923_0002592 3300035111 Bacteria 5606
1213 Ga0373923_0018203 3300035111 Bacteria 2700
1214 Ga0373936_0021347 3300035113 Bacteria 2518
1215 Ga0373936_0089339 3300035113 Bacteria 1290
1216 Ga0373953_0018343 3300035117 Bacteria 2587
1217 Ga0373953_0060534 3300035117 Bacteria 1547
1218 Ga0373954_0004535 3300035118 Bacteria 5979
1219 Ga0373954_0038488 3300035118 Bacteria 2224
1220 Ga0373956_0001441 3300035119 Bacteria 9830
1221 Ga0373956_0125664 3300035119 Bacteria 1199
1222 Ga0373957_0005751 3300035120 Bacteria 3865
1223 Ga0373943_0048150 3300035170 Bacteria 2087
1224 Ga0373946_0014771 3300035171 Bacteria 2950
1225 Ga0373946_0018863 3300035171 Bacteria 2652
1226 Ga0373955_0008330 3300035172 Bacteria 4812
1227 Ga0373955_0018229 3300035172 Bacteria 3488
1228 Ga0373962_0041079 3300035242 Bacteria 1303
1229 Ga0316574_0129881 3300035398 Bacteria 1621
1230 Ga0373924_0002729 3300035410 Bacteria 5962
1231 Ga0373924_0029465 3300035410 Bacteria 2194
1232 Ga0373931_0118538 3300035691 Bacteria 1510
1233 Ga0373931_0191821 3300035691 Bacteria 1216
1234 Ga0373927_0006315 3300035695 Bacteria 8077
1235 Ga0373927_0023086 3300035695 Bacteria 4074
1236 Ga0373927_0051292 3300035695 Bacteria 2668
1237 Ga0373927_0057205 3300035695 Bacteria 2522
1238 Ga0373927_0068665 3300035695 Bacteria 2293
1239 Ga0373927_0146027 3300035695 Bacteria 1548
1240 Ga0373927_0170377 3300035695 Bacteria 1427
1241 Ga0373927_0227426 3300035695 Bacteria 1226
1242 Ga0373933_0000017 3300035724 Bacteria 100816
1243 Ga0373933_0035762 3300035724 Bacteria 2903
1244 Ga0373933_0064932 3300035724 Bacteria 2209
1245 Ga0373933_0076256 3300035724 Bacteria 2048
1246 Ga0373933_0326489 3300035724 Bacteria 995
1247 Ga0373947_0154131 3300035725 Bacteria 1482
1248 Ga0373947_0337315 3300035725 Bacteria 1010
1249 Ga0373937_0057801 3300036401 Bacteria 3563
1250 Ga0373937_0159572 3300036401 Bacteria 2114
1251 Ga0373937_0179399 3300036401 Bacteria 1988
1252 Ga0373937_0360068 3300036401 Bacteria 1378
1253 Ga0373937_0403807 3300036401 Bacteria 1296
1254 Ga0373937_0464103 3300036401 Bacteria 1203
1255 Ga0373937_0878040 3300036401 Bacteria 845
1256 Ga0316584_0051940 3300036712 Bacteria 3066
1257 Ga0373925_0008382 3300037068 Bacteria 7525
1258 Ga0373925_0209074 3300037068 Bacteria 1554
1259 Ga0373925_0300387 3300037068 Bacteria 1296
1260 Ga0395899_0000470 3300037312 Bacteria 45611
1261 Ga0395899_0013177 3300037312 Bacteria 6324
1262 Ga0395899_0058237 3300037312 Bacteria 2850
1263 Ga0395899_0367449 3300037312 Bacteria 959
1264 Ga0395900_0001648 3300037418 Bacteria 26192
1265 Ga0395900_0029779 3300037418 Bacteria 5603
1266 Ga0395900_0113344 3300037418 Bacteria 2783
1267 Ga0395900_0304319 3300037418 Bacteria 1579
1268 Ga0395900_0358565 3300037418 Bacteria 1430
1269 Ga0395900_0423048 3300037418 Bacteria 1293
1270 Ga0395898_0036730 3300037466 Bacteria 4863
1271 Ga0395898_0086534 3300037466 Bacteria 3020
1272 Ga0395898_0095681 3300037466 Bacteria 2853
1273 Ga0395905_0002724 3300037471 Bacteria 19358
1274 Ga0395905_0008349 3300037471 Bacteria 10213
1275 Ga0395905_0023299 3300037471 Bacteria 5854
1276 Ga0395905_0023332 3300037471 Bacteria 5849
1277 Ga0395905_0029515 3300037471 Bacteria 5167
1278 Ga0395905_0053940 3300037471 Bacteria 3762
1279 Ga0395905_0101083 3300037471 Bacteria 2707
1280 Ga0395905_0112837 3300037471 Bacteria 2553
1281 Ga0395905_0324779 3300037471 Bacteria 1429
1282 Ga0395905_0426126 3300037471 Bacteria 1223
1283 Ga0395905_0840207 3300037471 Bacteria 821
1284 Ga0436364_0084869 3300037853 Bacteria 2395
1285 Ga0395901_0014698 3300038443 Bacteria 7955
1286 Ga0395901_0103394 3300038443 Bacteria 2989
1287 Ga0395901_0163626 3300038443 Bacteria 2336
1288 Ga0395901_0236141 3300038443 Bacteria 1908
1289 Ga0395901_0260784 3300038443 Bacteria 1804
1290 Ga0395901_0457148 3300038443 Bacteria 1305
1291 Ga0395901_0796894 3300038443 Bacteria 934
1292 Ga0400490_00582 3300038726 Bacteria 1005
1293 Ga0400485_22416 3300038735 Bacteria 2238
1294 Ga0400486_16027 3300038742 Bacteria 3975
1295 Ga0400486_19684 3300038742 Bacteria 1484
1296 Ga0400483_200011 3300039062 Bacteria 1148
1297 Ga0436365_0633843 3300039437 Bacteria 1994
1298 Ga0436365_0870351 3300039437 Bacteria 926
1299 Ga0436365_1365486 3300039437 Bacteria 1012
1300 Ga0436365_1452548 3300039437 Bacteria 3109
1301 Ga0436365_1865479 3300039437 Bacteria 1508
1302 Ga0436360_0887353 3300039438 Bacteria 2362
1303 Ga0436360_1044005 3300039438 Bacteria 1242
1304 Ga0436360_1294194 3300039438 Bacteria 2056
1305 Ga0436361_0102464 3300039447 Bacteria 12229
1306 Ga0436361_0498744 3300039447 Bacteria 12478
1307 Ga0436361_0586765 3300039447 Bacteria 11422
1308 Ga0436361_0760753 3300039447 Bacteria 3412
1309 Ga0436361_1055349 3300039447 Bacteria 1009
1310 Ga0436363_0113284 3300039450 Bacteria 1315
1311 Ga0436363_0601760 3300039450 Bacteria 920
1312 Ga0436363_0958819 3300039450 Bacteria 1737
1313 Ga0436363_1579908 3300039450 Bacteria 1545
1314 Ga0436362_1125969 3300039453 Bacteria 824
1315 Ga0439465_0092193 3300041413 Bacteria 1038
1316 Ga0451797_1034786 3300041453 Bacteria 1263
1317 Ga0451853_0059932 3300041512 Bacteria 1225
1318 Ga0451853_0844724 3300041512 Bacteria 1636
1319 Ga0451853_1647381 3300041512 Bacteria 1421
1320 Ga0451853_3119863 3300041512 Bacteria 1001
1321 Ga0439458_0049683 3300042157 Bacteria 1033
1322 Ga0451577_0103229 3300042876 Bacteria 2548
1323 Ga0466969_0157158 3300044656 Bacteria 1046
1324 Ga0466972_0000179 3300044658 Bacteria 49010
1325 Ga0466972_0006460 3300044658 Bacteria 5889
1326 Ga0466965_0261780 3300044683 Unclassified 930
1327 Ga0466966_0000830 3300044684 Bacteria 19703
1328 Ga0466966_0044447 3300044684 Bacteria 2844
1329 Ga0466961_0000023 3300044693 Bacteria 97134
1330 Ga0466963_0086578 3300044694 Bacteria 2129
1331 Ga0466963_0114508 3300044694 Bacteria 1852
1332 Ga0466964_0130421 3300044706 Bacteria 1144
1333 Ga0466968_0067778 3300044735 Bacteria 1548
1334 Ga0466970_0085049 3300044765 Bacteria 1713
1335 Ga0466957_0323537 3300044842 Bacteria 1041
1336 Ga0466959_0032575 3300045049 Bacteria 3858
1337 Ga0466959_0217757 3300045049 Bacteria 1325
1338 Ga0466967_0032265 3300045976 Bacteria 4420
1339 Ga0466967_0104727 3300045976 Bacteria 2590
1340 Ga0466967_0249352 3300045976 Bacteria 1696
1341 Ga0495617_000443 3300046452 Bacteria 22346
1342 Ga0495592_0043175 3300046454 Bacteria 3374
1343 Ga0495592_0103478 3300046454 Bacteria 2025
1344 Ga0495592_0181956 3300046454 Bacteria 1431
1345 Ga0495592_0190479 3300046454 Bacteria 1390
1346 Ga0495592_0271110 3300046454 Bacteria 1113
1347 Ga0495603_0031770 3300046455 Bacteria 3178
1348 Ga0495603_0045648 3300046455 Bacteria 2612
1349 Ga0495603_0054409 3300046455 Bacteria 2372
1350 Ga0495603_0098125 3300046455 Bacteria 1711
1351 Ga0495603_0145979 3300046455 Bacteria 1375
1352 Ga0495590_0000005 3300046457 Bacteria 384276
1353 Ga0495590_0015153 3300046457 Bacteria 2803
1354 Ga0495590_0035250 3300046457 Bacteria 1747
1355 Ga0495629_0001206 3300046459 Bacteria 20341
1356 Ga0495629_0001925 3300046459 Bacteria 16181
1357 Ga0495629_0075888 3300046459 Bacteria 2347
1358 Ga0495629_0466270 3300046459 Bacteria 854
1359 Ga0495638_0000027 3300046460 Bacteria 337569
1360 Ga0495638_0024282 3300046460 Bacteria 3955
1361 Ga0495638_0117355 3300046460 Bacteria 1575
1362 Ga0495638_0133941 3300046460 Bacteria 1453
1363 Ga0495641_0014458 3300046461 Bacteria 4267
1364 Ga0495641_0079541 3300046461 Bacteria 1469
1365 Ga0495651_0015326 3300046462 Bacteria 5926
1366 Ga0495651_0019968 3300046462 Bacteria 5198
1367 Ga0495651_0022000 3300046462 Bacteria 4958
1368 Ga0495651_0034303 3300046462 Bacteria 3956
1369 Ga0495651_0043603 3300046462 Bacteria 3480
1370 Ga0495651_0050526 3300046462 Bacteria 3207
1371 Ga0495653_0020946 3300046463 Bacteria 5298
1372 Ga0495653_0026426 3300046463 Bacteria 4654
1373 Ga0495653_0080367 3300046463 Bacteria 2412
1374 Ga0495653_0105718 3300046463 Bacteria 2031
1375 Ga0495650_0000777 3300046471 Bacteria 39323
1376 Ga0495650_0048226 3300046471 Bacteria 1777
1377 Ga0495580_0018723 3300046472 Bacteria 5153
1378 Ga0495582_0018041 3300046473 Bacteria 3859
1379 Ga0495582_0038107 3300046473 Bacteria 2644
1380 Ga0495582_0171032 3300046473 Bacteria 1237
1381 Ga0495605_0012906 3300046474 Bacteria 4623
1382 Ga0495605_0026314 3300046474 Bacteria 3025
1383 Ga0495605_0078996 3300046474 Bacteria 1541
1384 Ga0495605_0082558 3300046474 Bacteria 1501
1385 Ga0495639_0007882 3300046475 Bacteria 4578
1386 Ga0495639_0008211 3300046475 Bacteria 4483
1387 Ga0495639_0077627 3300046475 Bacteria 1542
1388 Ga0495639_0078913 3300046475 Bacteria 1530
1389 Ga0495662_0006209 3300046476 Bacteria 5975
1390 Ga0495662_0039530 3300046476 Bacteria 2279
1391 Ga0495662_0056776 3300046476 Bacteria 1891
1392 Ga0495664_0007694 3300046477 Bacteria 5993
1393 Ga0495664_0039451 3300046477 Bacteria 2790
1394 Ga0495664_0065943 3300046477 Bacteria 2159
1395 Ga0495664_0229110 3300046477 Bacteria 1124
1396 Ga0495664_0258294 3300046477 Bacteria 1053
1397 Ga0495584_0134031 3300046491 Bacteria 1257
1398 Ga0495585_0029970 3300046492 Bacteria 3095
1399 Ga0495585_0075196 3300046492 Bacteria 1837
1400 Ga0495585_0153567 3300046492 Bacteria 1199
1401 Ga0495585_0228375 3300046492 Bacteria 936
1402 Ga0495585_0258162 3300046492 Bacteria 867
1403 Ga0495594_0033287 3300046499 Bacteria 2801
1404 Ga0495594_0145227 3300046499 Bacteria 1346
1405 Ga0495607_0000026 3300046501 Bacteria 158900
1406 Ga0495607_0000357 3300046501 Bacteria 47227
1407 Ga0495607_0000399 3300046501 Bacteria 44071
1408 Ga0495607_0094525 3300046501 Bacteria 1612
1409 Ga0495607_0096189 3300046501 Bacteria 1595
1410 Ga0495583_0000989 3300046506 Bacteria 32582
1411 Ga0495583_0036163 3300046506 Bacteria 2351
1412 Ga0495583_0126428 3300046506 Bacteria 1072
1413 Ga0495606_0000357 3300046507 Bacteria 78015
1414 Ga0495606_0000807 3300046507 Bacteria 47620
1415 Ga0495606_0047144 3300046507 Bacteria 2843
1416 Ga0495606_0057831 3300046507 Bacteria 2495
1417 Ga0495606_0107761 3300046507 Bacteria 1685
1418 Ga0495606_0117007 3300046507 Bacteria 1600
1419 Ga0495606_0126804 3300046507 Bacteria 1521
1420 Ga0495606_0169161 3300046507 Bacteria 1269
1421 Ga0495606_0210620 3300046507 Bacteria 1101
1422 Ga0495608_0008777 3300046511 Bacteria 7072
1423 Ga0495608_0012240 3300046511 Bacteria 5959
1424 Ga0495608_0068581 3300046511 Bacteria 2319
1425 Ga0495608_0071569 3300046511 Bacteria 2262
1426 Ga0495608_0182644 3300046511 Bacteria 1326
1427 Ga0495616_0012903 3300046513 Bacteria 4726
1428 Ga0495616_0072337 3300046513 Bacteria 1665
1429 Ga0495618_0031260 3300046514 Bacteria 3330
1430 Ga0495618_0057258 3300046514 Bacteria 2468
1431 Ga0495618_0094598 3300046514 Bacteria 1910
1432 Ga0495618_0107787 3300046514 Bacteria 1784
1433 Ga0495620_0082137 3300046515 Bacteria 1302
1434 Ga0495628_0002925 3300046516 Bacteria 15306
1435 Ga0495628_0005950 3300046516 Bacteria 10674
1436 Ga0495628_0031953 3300046516 Bacteria 4254
1437 Ga0495628_0046395 3300046516 Bacteria 3451
1438 Ga0495628_0054023 3300046516 Bacteria 3167
1439 Ga0495628_0066501 3300046516 Bacteria 2818
1440 Ga0495628_0154162 3300046516 Bacteria 1748
1441 Ga0495628_0167411 3300046516 Bacteria 1668
1442 Ga0495628_0460370 3300046516 Bacteria 923
1443 Ga0495630_0059924 3300046517 Bacteria 2856
1444 Ga0495630_0101844 3300046517 Bacteria 2172
1445 Ga0495630_0121464 3300046517 Bacteria 1982
1446 Ga0495630_0234227 3300046517 Bacteria 1403
1447 Ga0495631_0031198 3300046518 Bacteria 2413
1448 Ga0495631_0136225 3300046518 Bacteria 1054
1449 Ga0495631_0150093 3300046518 Bacteria 1000
1450 Ga0495632_0066590 3300046519 Bacteria 1738
1451 Ga0495637_0011639 3300046520 Bacteria 4223
1452 Ga0495637_0024460 3300046520 Bacteria 2733
1453 Ga0495643_0000167 3300046522 Bacteria 104447
1454 Ga0495643_0015807 3300046522 Bacteria 4448
1455 Ga0495643_0029940 3300046522 Bacteria 3043
1456 Ga0495643_0127855 3300046522 Bacteria 1278
1457 Ga0495643_0144787 3300046522 Bacteria 1181
1458 Ga0495644_0130271 3300046523 Bacteria 958
1459 Ga0495648_0000002 3300046524 Bacteria 593972
1460 Ga0495648_0001972 3300046524 Bacteria 19495
1461 Ga0495648_0006734 3300046524 Bacteria 9297
1462 Ga0495648_0015112 3300046524 Bacteria 5621
1463 Ga0495648_0024566 3300046524 Bacteria 4101
1464 Ga0495648_0132312 3300046524 Bacteria 1325
1465 Ga0495663_0028154 3300046525 Bacteria 1652
1466 Ga0495666_0019612 3300046526 Bacteria 3354
1467 Ga0495666_0110371 3300046526 Bacteria 1292
1468 Ga0495666_0122061 3300046526 Bacteria 1220
1469 Ga0495642_0008146 3300046528 Bacteria 4010
1470 Ga0495642_0011728 3300046528 Bacteria 3374
1471 Ga0495642_0032670 3300046528 Bacteria 2089
1472 Ga0495652_0003201 3300046529 Bacteria 16320
1473 Ga0495652_0021794 3300046529 Bacteria 5696
1474 Ga0495652_0023745 3300046529 Bacteria 5434
1475 Ga0495652_0110709 3300046529 Bacteria 2208
1476 Ga0495652_0183632 3300046529 Bacteria 1602
1477 Ga0495652_0309634 3300046529 Bacteria 1145
1478 Ga0495652_0388856 3300046529 Bacteria 990
1479 Ga0495654_0000582 3300046530 Bacteria 29318
1480 Ga0495665_0011144 3300046531 Bacteria 4866
1481 Ga0495665_0036939 3300046531 Bacteria 2607
1482 Ga0495640_0015232 3300046533 Bacteria 5789
1483 Ga0495640_0016148 3300046533 Bacteria 5591
1484 Ga0495640_0024101 3300046533 Bacteria 4427
1485 Ga0495640_0027942 3300046533 Bacteria 4064
1486 Ga0495640_0052256 3300046533 Bacteria 2807
1487 Ga0495640_0062063 3300046533 Bacteria 2536
1488 Ga0495586_0158707 3300046535 Bacteria 1275
1489 Ga0495598_0038719 3300046537 Bacteria 1382
1490 Ga0495609_0000441 3300046538 Bacteria 34283
1491 Ga0495609_0002146 3300046538 Bacteria 12411
1492 Ga0495609_0019080 3300046538 Bacteria 3174
1493 Ga0495597_0000074 3300046542 Bacteria 86697
1494 Ga0495597_0000285 3300046542 Bacteria 45720
1495 Ga0495597_0013722 3300046542 Bacteria 3874
1496 Ga0495645_0018524 3300046543 Bacteria 5003
1497 Ga0495645_0048632 3300046543 Bacteria 3088
1498 Ga0495645_0051953 3300046543 Bacteria 2982
1499 Ga0495645_0102550 3300046543 Bacteria 2033
1500 Ga0495645_0109999 3300046543 Bacteria 1951
1501 Ga0495622_0000200 3300046557 Bacteria 47745
1502 Ga0495622_0011694 3300046557 Bacteria 4057
1503 Ga0495622_0023709 3300046557 Bacteria 2862
1504 Ga0495622_0031724 3300046557 Bacteria 2468
1505 Ga0495622_0043843 3300046557 Bacteria 2079
1506 Ga0495622_0053371 3300046557 Bacteria 1875
1507 Ga0495622_0123293 3300046557 Bacteria 1182
1508 Ga0495622_0159506 3300046557 Bacteria 1018
1509 Ga0495633_0067805 3300046558 Bacteria 1665
1510 Ga0495633_0071502 3300046558 Bacteria 1618
1511 Ga0495633_0118672 3300046558 Bacteria 1225
1512 Ga0495667_0004813 3300046559 Bacteria 9127
1513 Ga0495667_0027311 3300046559 Bacteria 3847
1514 Ga0495667_0072620 3300046559 Bacteria 2242
1515 Ga0495656_0001245 3300046615 Bacteria 8290
1516 Ga0495656_0014562 3300046615 Bacteria 2950
1517 Ga0495656_0099960 3300046615 Bacteria 1340
1518 Ga0495668_0000065 3300046616 Bacteria 178985
1519 Ga0495668_0029895 3300046616 Bacteria 3078
1520 Ga0495668_0071192 3300046616 Bacteria 1911
1521 Ga0495668_0103118 3300046616 Bacteria 1561
1522 Ga0495634_0003016 3300046642 Bacteria 13704
1523 Ga0495634_0025562 3300046642 Bacteria 4129
1524 Ga0495634_0088885 3300046642 Bacteria 2009
1525 Ga0495611_0090570 3300046648 Bacteria 1413
1526 Ga0495611_0129838 3300046648 Bacteria 1175
1527 Ga0495625_0000448 3300046660 Bacteria 61902
1528 Ga0495625_0002719 3300046660 Bacteria 18757
1529 Ga0495625_0006080 3300046660 Bacteria 10831
1530 Ga0495625_0007076 3300046660 Bacteria 9859
1531 Ga0495625_0098906 3300046660 Bacteria 2006
1532 Ga0495625_0161949 3300046660 Bacteria 1498
1533 Ga0495625_0176999 3300046660 Bacteria 1421
1534 Ga0495635_0001663 3300046663 Bacteria 14979
1535 Ga0495635_0002216 3300046663 Bacteria 13218
1536 Ga0495635_0062259 3300046663 Bacteria 2562
1537 Ga0495659_0000741 3300046664 Bacteria 11717
1538 Ga0495659_0086726 3300046664 Bacteria 1196
1539 Ga0495661_0005792 3300046665 Bacteria 8736
1540 Ga0495661_0071339 3300046665 Bacteria 2030
1541 Ga0495588_0001390 3300046674 Bacteria 10343
1542 Ga0495588_0037416 3300046674 Bacteria 2465
1543 Ga0495588_0083585 3300046674 Bacteria 1668
1544 Ga0495657_0003474 3300046675 Bacteria 12853
1545 Ga0495599_0012568 3300046678 Bacteria 5222
1546 Ga0495599_0018392 3300046678 Bacteria 4354
1547 Ga0495599_0042203 3300046678 Bacteria 2862
1548 Ga0495623_0084776 3300046679 Bacteria 1954
1549 Ga0495623_0087939 3300046679 Bacteria 1913
1550 Ga0495646_0019235 3300046680 Bacteria 4325
1551 Ga0495646_0025175 3300046680 Bacteria 3744
1552 Ga0495646_0055660 3300046680 Bacteria 2374
1553 Ga0495646_0112675 3300046680 Bacteria 1547
1554 Ga0495646_0221172 3300046680 Bacteria 1024
1555 Ga0495647_0014637 3300046681 Bacteria 2736
1556 Ga0495647_0024147 3300046681 Bacteria 2211
1557 Ga0495658_0028933 3300046683 Bacteria 2994
1558 Ga0495658_0083029 3300046683 Bacteria 1883
1559 Ga0495669_0012169 3300046684 Bacteria 3659
1560 Ga0495669_0062058 3300046684 Bacteria 1693
1561 Ga0495613_0004714 3300046689 Bacteria 10235
1562 Ga0495613_0028419 3300046689 Bacteria 4159
1563 Ga0495613_0081477 3300046689 Bacteria 2351
1564 Ga0495613_0081585 3300046689 Bacteria 2349
1565 Ga0495613_0138316 3300046689 Bacteria 1741
1566 Ga0495624_0005122 3300046690 Bacteria 9470
1567 Ga0495624_0006495 3300046690 Bacteria 8291
1568 Ga0495624_0302358 3300046690 Bacteria 964
1569 Ga0495670_0021300 3300046691 Bacteria 3197
1570 Ga0495670_0024018 3300046691 Bacteria 3010
1571 Ga0495670_0181650 3300046691 Bacteria 1111
1572 Ga0495671_0069398 3300046692 Bacteria 1732
1573 Ga0495671_0124968 3300046692 Bacteria 1254
1574 Ga0495649_0007278 3300046694 Bacteria 6772
1575 Ga0495649_0012603 3300046694 Bacteria 4908
1576 Ga0495649_0067664 3300046694 Bacteria 1916
1577 Ga0495589_0064436 3300046794 Bacteria 1797
1578 Ga0495600_0002113 3300046809 Bacteria 11241
1579 Ga0495600_0006479 3300046809 Bacteria 7124
1580 Ga0495600_0129464 3300046809 Bacteria 1641
1581 Ga0495660_0001759 3300046810 Bacteria 14426
1582 Ga0495660_0008519 3300046810 Bacteria 6004
1583 Ga0495660_0041608 3300046810 Bacteria 2542
1584 Ga0495660_0069914 3300046810 Bacteria 1865
1585 Ga0495581_0010897 3300047315 Bacteria 5257
1586 Ga0495604_0005104 3300047317 Bacteria 10396
1587 Ga0495604_0008499 3300047317 Bacteria 8106
1588 Ga0495604_0023050 3300047317 Bacteria 4968
1589 Ga0495604_0047483 3300047317 Bacteria 3343
1590 Ga0495604_0073316 3300047317 Bacteria 2584
1591 Ga0495604_0402478 3300047317 Bacteria 901
1592 Ga0495636_0007159 3300047318 Bacteria 4391
1593 Ga0495636_0021328 3300047318 Bacteria 2616
1594 Ga0495674_0001841 3300047319 Bacteria 20895
1595 Ga0495674_0012054 3300047319 Bacteria 8148
1596 Ga0495674_0028067 3300047319 Bacteria 5137
1597 Ga0495674_0183750 3300047319 Bacteria 1740
1598 Ga0495674_0538488 3300047319 Bacteria 931
1599 Ga0495672_0000014 3300047320 Bacteria 505636
1600 Ga0495672_0031936 3300047320 Bacteria 3282
1601 Ga0495672_0181908 3300047320 Bacteria 1064
1602 Ga0495676_0067445 3300047321 Bacteria 2768
1603 Ga0495676_0107722 3300047321 Bacteria 2051
1604 Ga0495680_0001322 3300047322 Bacteria 27035
1605 Ga0495680_0028729 3300047322 Bacteria 4558
1606 Ga0495680_0113541 3300047322 Bacteria 2005
1607 Ga0495680_0158392 3300047322 Bacteria 1646
1608 Ga0495680_0299469 3300047322 Bacteria 1129
1609 Ga0495683_0000033 3300047323 Bacteria 149031
1610 Ga0495683_0059931 3300047323 Bacteria 1887
1611 Ga0495683_0134162 3300047323 Bacteria 1165
1612 Ga0495687_000369 3300047443 Bacteria 56056
1613 Ga0495687_000481 3300047443 Bacteria 48401
1614 Ga0495687_000548 3300047443 Bacteria 44802
1615 Ga0495687_001324 3300047443 Bacteria 23105
1616 Ga0495687_003369 3300047443 Bacteria 11662
1617 Ga0495687_021501 3300047443 Bacteria 3118
1618 Ga0495687_078390 3300047443 Bacteria 1301
1619 Ga0495675_0002252 3300047444 Bacteria 11525
1620 Ga0495675_0004442 3300047444 Bacteria 8487
1621 Ga0495675_0020634 3300047444 Bacteria 4194
1622 Ga0495677_0010538 3300047445 Bacteria 3392
1623 Ga0495677_0064168 3300047445 Bacteria 1364
1624 Ga0495677_0112422 3300047445 Bacteria 1036
1625 Ga0495685_018083 3300047447 Bacteria 2416
1626 Ga0495685_043071 3300047447 Bacteria 1540
1627 Ga0495673_0000376 3300047469 Bacteria 53499
1628 Ga0495673_0000525 3300047469 Bacteria 40095
1629 Ga0495673_0029487 3300047469 Bacteria 2589
1630 Ga0495681_0040249 3300047470 Bacteria 2277
1631 Ga0495684_0000954 3300047471 Bacteria 23525
1632 Ga0495684_0065461 3300047471 Bacteria 2763
1633 Ga0495684_0124558 3300047471 Bacteria 1939
1634 Ga0495684_0126099 3300047471 Bacteria 1926
1635 Ga0495593_0003081 3300047673 Bacteria 10023
1636 Ga0495593_0003267 3300047673 Bacteria 9722
1637 Ga0495593_0011754 3300047673 Bacteria 5021
1638 Ga0495593_0234982 3300047673 Bacteria 919
1639 Ga0495602_0001522 3300048088 Bacteria 23067
1640 Ga0495602_0049438 3300048088 Bacteria 3766
1641 Ga0495602_0120798 3300048088 Bacteria 2108
1642 Ga0495614_0083062 3300048089 Bacteria 1389
1643 Ga0495626_0065698 3300048091 Bacteria 1641
1644 Ga0495626_0074073 3300048091 Bacteria 1524
1645 Ga0495626_0102724 3300048091 Bacteria 1245
1646 Ga0496100_0001892 3300048903 Bacteria 10506
1647 Ga0496100_0025939 3300048903 Bacteria 3588
1648 Ga0496100_0418854 3300048903 Bacteria 1022
1649 Ga0496101_0004251 3300048904 Bacteria 8984
1650 Ga0496101_0013436 3300048904 Bacteria 5486
1651 Ga0496101_0013897 3300048904 Bacteria 5404
1652 Ga0496101_0102541 3300048904 Bacteria 2143
1653 Ga0496101_0166228 3300048904 Bacteria 1694
1654 Ga0496101_0573936 3300048904 Bacteria 892
1655 Ga0496102_0001172 3300048905 Bacteria 23912
1656 Ga0496102_0002100 3300048905 Bacteria 17132
1657 Ga0496102_0095294 3300048905 Bacteria 2758
1658 Ga0496102_0126129 3300048905 Bacteria 2393
1659 Ga0496102_0185046 3300048905 Bacteria 1963
1660 Ga0496102_0241421 3300048905 Bacteria 1703
1661 Ga0496102_0352992 3300048905 Bacteria 1384
1662 Ga0496102_0424906 3300048905 Bacteria 1248
1663 Ga0496102_0427310 3300048905 Bacteria 1244
1664 Ga0496102_0654800 3300048905 Bacteria 973
1665 Ga0496102_0831563 3300048905 Bacteria 846
1666 Ga0496103_0022306 3300048906 Bacteria 3812
1667 Ga0496103_0029262 3300048906 Bacteria 3347
1668 Ga0496103_0052043 3300048906 Bacteria 2536
1669 Ga0496103_0056759 3300048906 Bacteria 2431
1670 Ga0496103_0069861 3300048906 Bacteria 2197
1671 Ga0496103_0283714 3300048906 Bacteria 1065
1672 Ga0496104_0018887 3300048907 Bacteria 6296
1673 Ga0496104_0023109 3300048907 Bacteria 5715
1674 Ga0496104_0052425 3300048907 Bacteria 3853
1675 Ga0496104_0072227 3300048907 Bacteria 3281
1676 Ga0496104_0075521 3300048907 Bacteria 3209
1677 Ga0496104_0092607 3300048907 Bacteria 2890
1678 Ga0496104_0156331 3300048907 Bacteria 2188
1679 Ga0496105_0003309 3300048908 Bacteria 11905
1680 Ga0496105_0019607 3300048908 Bacteria 5455
1681 Ga0496105_0040611 3300048908 Bacteria 3836
1682 Ga0496105_0042979 3300048908 Bacteria 3727
1683 Ga0496105_0231827 3300048908 Bacteria 1500
1684 Ga0496106_0002880 3300048909 Bacteria 12787
1685 Ga0496106_0012589 3300048909 Bacteria 6248
1686 Ga0496106_0013014 3300048909 Bacteria 6138
1687 Ga0496106_0055829 3300048909 Bacteria 2985
1688 Ga0496106_0094802 3300048909 Bacteria 2308
1689 Ga0496106_0114167 3300048909 Bacteria 2106
1690 Ga0496106_0154299 3300048909 Bacteria 1812
1691 Ga0496106_0268071 3300048909 Bacteria 1367
1692 Ga0496106_0736322 3300048909 Bacteria 784
1693 Ga0496107_0004424 3300048910 Bacteria 9523
1694 Ga0496107_0017191 3300048910 Bacteria 5088
1695 Ga0496107_0046877 3300048910 Bacteria 3111
1696 Ga0496107_0076307 3300048910 Bacteria 2441
1697 Ga0496107_0198420 3300048910 Bacteria 1491
1698 Ga0496107_0222466 3300048910 Bacteria 1404
1699 Ga0496108_0000392 3300048911 Bacteria 36249
1700 Ga0496108_0002033 3300048911 Bacteria 16202
1701 Ga0496108_0007768 3300048911 Bacteria 8689
1702 Ga0496108_0031803 3300048911 Bacteria 4380
1703 Ga0496108_0177617 3300048911 Bacteria 1844
1704 Ga0496108_0270540 3300048911 Bacteria 1479
1705 Ga0496108_0418302 3300048911 Bacteria 1170
1706 Ga0496108_0520744 3300048911 Bacteria 1038
1707 Ga0496109_0004557 3300048912 Bacteria 11579
1708 Ga0496109_0005498 3300048912 Bacteria 10609
1709 Ga0496109_0010137 3300048912 Bacteria 8042
1710 Ga0496109_0093976 3300048912 Bacteria 2775
1711 Ga0496109_0226271 3300048912 Bacteria 1759
1712 Ga0496109_0391579 3300048912 Bacteria 1313
1713 Ga0496109_0684599 3300048912 Bacteria 963
1714 Ga0496110_0004336 3300048913 Bacteria 10979
1715 Ga0496110_0006020 3300048913 Bacteria 9552
1716 Ga0496110_0011625 3300048913 Bacteria 7217
1717 Ga0496110_0013454 3300048913 Bacteria 6766
1718 Ga0496110_0068064 3300048913 Bacteria 3152
1719 Ga0496110_0140607 3300048913 Bacteria 2182
1720 Ga0496110_0206945 3300048913 Bacteria 1783
1721 Ga0496110_0290695 3300048913 Bacteria 1488
1722 Ga0496110_0679334 3300048913 Bacteria 930
1723 Ga0496111_0002199 3300048914 Bacteria 11692
1724 Ga0496111_0007494 3300048914 Bacteria 7158
1725 Ga0496111_0021330 3300048914 Bacteria 4522
1726 Ga0496111_0035786 3300048914 Bacteria 3550
1727 Ga0496111_0039106 3300048914 Bacteria 3400
1728 Ga0496111_0100404 3300048914 Bacteria 2125
1729 Ga0496111_0115267 3300048914 Bacteria 1981
1730 Ga0496111_0123543 3300048914 Bacteria 1913
1731 Ga0496112_0000022 3300048915 Bacteria 156255
1732 Ga0496112_0001604 3300048915 Bacteria 17489
1733 Ga0496112_0012228 3300048915 Bacteria 7880
1734 Ga0496112_0015303 3300048915 Bacteria 7153
1735 Ga0496112_0039352 3300048915 Bacteria 4620
1736 Ga0496112_0067770 3300048915 Bacteria 3523
1737 Ga0496112_0150238 3300048915 Bacteria 2297
1738 Ga0496112_0154943 3300048915 Bacteria 2258
1739 Ga0496112_0196732 3300048915 Bacteria 1976
1740 Ga0496112_0230517 3300048915 Bacteria 1806
1741 Ga0496112_0358299 3300048915 Bacteria 1401
1742 Ga0496112_0776931 3300048915 Bacteria 883
1743 Ga0496113_0005324 3300048916 Bacteria 8011
1744 Ga0496113_0013025 3300048916 Bacteria 5613
1745 Ga0496113_0096372 3300048916 Bacteria 2287
1746 Ga0496113_0098211 3300048916 Bacteria 2266
1747 Ga0496113_0128968 3300048916 Bacteria 1983
1748 Ga0496113_0148931 3300048916 Bacteria 1845
1749 Ga0496113_0185329 3300048916 Bacteria 1651
1750 Ga0496113_0320443 3300048916 Bacteria 1242
1751 Ga0496114_0007179 3300048917 Bacteria 8791
1752 Ga0496114_0055275 3300048917 Bacteria 3311
1753 Ga0496114_0062448 3300048917 Bacteria 3117
1754 Ga0496114_0158043 3300048917 Bacteria 1969
1755 Ga0496115_0008912 3300048918 Bacteria 7438
1756 Ga0496115_0035259 3300048918 Bacteria 3958
1757 Ga0496115_0039349 3300048918 Bacteria 3755
1758 Ga0496115_0087048 3300048918 Bacteria 2549
1759 Ga0496115_0143588 3300048918 Bacteria 1969
1760 Ga0496115_0224661 3300048918 Bacteria 1549
1761 Ga0496115_0278896 3300048918 Bacteria 1372
1762 Ga0496116_0003473 3300048919 Bacteria 15512
1763 Ga0496116_0013520 3300048919 Bacteria 6573
1764 Ga0496116_0017629 3300048919 Bacteria 5534
1765 Ga0496116_0086191 3300048919 Bacteria 1928
1766 Ga0496117_0000010 3300048920 Bacteria 611954
1767 Ga0496117_0025790 3300048920 Bacteria 4611
1768 Ga0496117_0076542 3300048920 Bacteria 2218
1769 Ga0496117_0079088 3300048920 Bacteria 2168
1770 Ga0496117_0104374 3300048920 Bacteria 1784
1771 Ga0496117_0218710 3300048920 Bacteria 1062
1772 Ga0496118_0000009 3300048921 Bacteria 611954
1773 Ga0496118_0019784 3300048921 Bacteria 6004
1774 Ga0496118_0025820 3300048921 Bacteria 5025
1775 Ga0496118_0042073 3300048921 Bacteria 3609
1776 Ga0496118_0070597 3300048921 Bacteria 2521
1777 Ga0496118_0094892 3300048921 Bacteria 2038
1778 Ga0496118_0125772 3300048921 Bacteria 1660
1779 Ga0496118_0146934 3300048921 Bacteria 1483
1780 Ga0496118_0154541 3300048921 Bacteria 1430
1781 Ga0496118_0367321 3300048921 Bacteria 760
1782 Ga0496119_0033850 3300048922 Bacteria 3378
1783 Ga0496119_0105480 3300048922 Bacteria 1574
1784 Ga0496119_0109106 3300048922 Bacteria 1539
1785 Ga0496119_0116473 3300048922 Bacteria 1475
1786 Ga0496120_0030010 3300048923 Bacteria 3312
1787 Ga0496121_0003573 3300048924 Bacteria 21976
1788 Ga0496121_0005384 3300048924 Bacteria 16445
1789 Ga0496121_0008714 3300048924 Bacteria 11840
1790 Ga0496121_0010559 3300048924 Bacteria 10384
1791 Ga0496121_0019117 3300048924 Bacteria 6870
1792 Ga0496121_0026869 3300048924 Bacteria 5405
1793 Ga0496121_0031853 3300048924 Bacteria 4808
1794 Ga0496121_0041119 3300048924 Bacteria 4046
1795 Ga0496121_0056700 3300048924 Bacteria 3252
1796 Ga0496121_0063515 3300048924 Bacteria 3016
1797 Ga0496121_0067062 3300048924 Bacteria 2909
1798 Ga0496121_0103010 3300048924 Bacteria 2197
1799 Ga0496121_0138181 3300048924 Bacteria 1812
1800 Ga0496121_0175687 3300048924 Bacteria 1551
1801 Ga0496121_0180595 3300048924 Bacteria 1523
1802 Ga0496121_0212535 3300048924 Bacteria 1369
1803 Ga0496121_0230590 3300048924 Bacteria 1297
1804 Ga0496121_0361476 3300048924 Bacteria 963
1805 Ga0496121_0400699 3300048924 Bacteria 899
1806 Ga0496122_0000471 3300048925 Bacteria 83983
1807 Ga0496122_0000757 3300048925 Bacteria 62588
1808 Ga0496122_0003066 3300048925 Bacteria 22532
1809 Ga0496122_0092642 3300048925 Bacteria 2053
1810 Ga0496123_0000259 3300048926 Bacteria 107355
1811 Ga0496123_0000523 3300048926 Bacteria 66280
1812 Ga0496123_0004181 3300048926 Bacteria 15427
1813 Ga0496124_0002457 3300048927 Bacteria 24235
1814 Ga0496124_0040925 3300048927 Bacteria 4003
1815 Ga0496124_0499367 3300048927 Bacteria 816
1816 Ga0496125_0001479 3300048928 Bacteria 33942
1817 Ga0496125_0019213 3300048928 Bacteria 6455
1818 Ga0496125_0047258 3300048928 Bacteria 3601
1819 Ga0496125_0083732 3300048928 Bacteria 2425
1820 Ga0496125_0089363 3300048928 Bacteria 2317
1821 Ga0496125_0208156 3300048928 Bacteria 1273
1822 Ga0496125_0238696 3300048928 Bacteria 1156
1823 Ga0496125_0241012 3300048928 Bacteria 1148
1824 Ga0496126_0006822 3300048929 Bacteria 12668
1825 Ga0496126_0016969 3300048929 Bacteria 7264
1826 Ga0496126_0021091 3300048929 Bacteria 6372
1827 Ga0496126_0029480 3300048929 Bacteria 5213
1828 Ga0496126_0036823 3300048929 Bacteria 4572
1829 Ga0496126_0081237 3300048929 Bacteria 2866
1830 Ga0496126_0106966 3300048929 Bacteria 2440
1831 Ga0496126_0135289 3300048929 Bacteria 2126
1832 Ga0496126_0170594 3300048929 Bacteria 1854
1833 Ga0496126_0177055 3300048929 Bacteria 1814
1834 Ga0496126_0240127 3300048929 Bacteria 1514
1835 Ga0496126_0254943 3300048929 Bacteria 1461
1836 Ga0496126_0342726 3300048929 Bacteria 1224
1837 Ga0496126_0348534 3300048929 Bacteria 1212
1838 Ga0496126_0502783 3300048929 Bacteria 968
1839 Ga0495678_001979 3300049459 Bacteria 14761
1840 Ga0495678_073355 3300049459 Bacteria 1248
1841 Ga0495682_0055291 3300049460 Bacteria 1439
1842 Ga0495682_0060306 3300049460 Bacteria 1370
1843 Ga0501031_0008748 3300049568 Bacteria 6584
1844 Ga0501031_0411671 3300049568 Bacteria 874
1845 Ga0501031_0496936 3300049568 Bacteria 787
1846 Ga0501032_0000017 3300049569 Bacteria 158303
1847 Ga0501032_0027373 3300049569 Bacteria 3917
1848 Ga0501033_0000029 3300049570 Bacteria 158294
1849 Ga0501033_0002889 3300049570 Bacteria 14376
1850 Ga0501034_0000102 3300049571 Bacteria 158302
1851 Ga0501034_0004358 3300049571 Bacteria 15776
1852 Ga0501036_0000011 3300049572 Bacteria 158302
1853 Ga0501036_0070613 3300049572 Bacteria 2953
1854 Ga0501036_0460445 3300049572 Bacteria 1059
1855 Ga0501037_0000015 3300049573 Bacteria 161311
1856 Ga0501037_0063017 3300049573 Bacteria 2703
1857 Ga0501037_0068814 3300049573 Bacteria 2578
1858 Ga0501037_0080883 3300049573 Bacteria 2356
1859 Ga0501038_0000016 3300049574 Bacteria 159150
1860 Ga0501038_0032182 3300049574 Bacteria 4629
1861 Ga0501038_0374652 3300049574 Bacteria 1105
1862 Ga0501038_0656955 3300049574 Bacteria 789
1863 Ga0501039_0000023 3300049575 Bacteria 158026
1864 Ga0501039_0023535 3300049575 Bacteria 4727
1865 Ga0501039_0154928 3300049575 Bacteria 1800
1866 Ga0501039_0293293 3300049575 Bacteria 1279
1867 Ga0501040_0000697 3300049576 Bacteria 20746
1868 Ga0501040_0002784 3300049576 Bacteria 11281
1869 Ga0501040_0040726 3300049576 Bacteria 3162
1870 Ga0501040_0130443 3300049576 Bacteria 1767
1871 Ga0501040_0245761 3300049576 Bacteria 1276
1872 Ga0501040_0354449 3300049576 Bacteria 1051
1873 Ga0501041_0072591 3300049577 Bacteria 2114
1874 Ga0501041_0098276 3300049577 Bacteria 1810
1875 Ga0501042_0000118 3300049578 Bacteria 33749
1876 Ga0501042_0089744 3300049578 Bacteria 2205
1877 Ga0501043_0001694 3300049579 Bacteria 19128
1878 Ga0501043_0017400 3300049579 Bacteria 5635
1879 Ga0501043_0088181 3300049579 Bacteria 2438
1880 Ga0501046_0037870 3300049580 Bacteria 3874
1881 Ga0501046_0435128 3300049580 Bacteria 944
1882 Ga0501047_0004523 3300049581 Bacteria 13074
1883 Ga0501047_0047731 3300049581 Bacteria 4136
1884 Ga0501047_0111208 3300049581 Bacteria 2622
1885 Ga0501048_0093477 3300049582 Bacteria 2121
1886 Ga0501048_0207315 3300049582 Bacteria 1390
1887 Ga0501068_0043517 3300049584 Bacteria 2702
1888 Ga0501068_0467825 3300049584 Bacteria 816
1889 Ga0501070_0026870 3300049586 Bacteria 4828
1890 Ga0501070_0058952 3300049586 Bacteria 3182
1891 Ga0501071_0112715 3300049587 Bacteria 2011
1892 Ga0501072_0059642 3300049588 Bacteria 3009
1893 Ga0501072_0294013 3300049588 Bacteria 1291
1894 Ga0501072_0527218 3300049588 Bacteria 934
1895 Ga0501073_0023184 3300049589 Bacteria 4461
1896 Ga0501073_0361811 3300049589 Bacteria 1002
1897 Ga0501074_0061535 3300049590 Bacteria 2705
1898 Ga0501074_0235232 3300049590 Bacteria 1304
1899 Ga0501074_0354922 3300049590 Bacteria 1040
1900 Ga0501075_0000888 3300049591 Bacteria 18899
1901 Ga0501075_0007178 3300049591 Bacteria 7718
1902 Ga0501075_0122849 3300049591 Bacteria 1976
1903 Ga0501075_0478499 3300049591 Bacteria 950
1904 Ga0501076_0004337 3300049592 Bacteria 10066
1905 Ga0501076_0033611 3300049592 Bacteria 4004
1906 Ga0501076_0066200 3300049592 Bacteria 2883
1907 Ga0501076_0090533 3300049592 Bacteria 2461
1908 Ga0501077_0112623 3300049593 Bacteria 1725
1909 Ga0501077_0263992 3300049593 Bacteria 1095
1910 Ga0501079_0004666 3300049741 Bacteria 10151
1911 Ga0501079_0033734 3300049741 Bacteria 3938
1912 Ga0501079_0224031 3300049741 Bacteria 1469
1913 Ga0501079_0442751 3300049741 Bacteria 1020
1914 Ga0501080_0003722 3300049742 Bacteria 13453
1915 Ga0501080_0021885 3300049742 Bacteria 5921
1916 Ga0501080_0032138 3300049742 Bacteria 4893
1917 Ga0501080_0078566 3300049742 Bacteria 3069
1918 Ga0501080_0093877 3300049742 Bacteria 2786
1919 Ga0501080_0158684 3300049742 Bacteria 2089
1920 Ga0501080_0760678 3300049742 Bacteria 851
1921 Ga0501081_0007011 3300049743 Bacteria 7329
1922 Ga0501081_0435444 3300049743 Bacteria 973
1923 Ga0501083_0068530 3300049744 Bacteria 2361
1924 Ga0501083_0218532 3300049744 Bacteria 1242
1925 Ga0501279_007348 3300049775 Bacteria 1463
1926 Ga0501035_0000038 3300049822 Bacteria 158818
1927 Ga0501035_0018078 3300049822 Bacteria 6496
1928 Ga0501035_0018125 3300049822 Bacteria 6487
1929 Ga0501035_0071603 3300049822 Bacteria 3069
1930 Ga0501035_0194833 3300049822 Bacteria 1741
1931 Ga0501035_0554796 3300049822 Bacteria 941
1932 Ga0501044_0000022 3300049823 Bacteria 201689
1933 Ga0501044_0003435 3300049823 Bacteria 17851
1934 Ga0501044_0004489 3300049823 Bacteria 15605
1935 Ga0501044_0008000 3300049823 Bacteria 11617
1936 Ga0501044_0051163 3300049823 Bacteria 4260
1937 Ga0501045_0023900 3300049824 Bacteria 4387
1938 nmdc:mga03683_159155_c1 3300050489 Bacteria 1022
1939 nmdc:mga03683_27233_c1 3300050489 Bacteria 2261
1940 nmdc:mga03683_97921_c1 3300050489 Bacteria 1286
1941 nmdc:mga03n38_43181_c1 3300050490 Bacteria 1975
1942 nmdc:mga03n38_84732_c1 3300050490 Bacteria 1497
1943 nmdc:mga03n38_85292_c1 3300050490 Bacteria 1493
1944 nmdc:mga00v17_107239_c1 3300050491 Bacteria 1769
1945 nmdc:mga00v17_196701_c1 3300050491 Bacteria 1303
1946 nmdc:mga00v17_77862_c1 3300050491 Bacteria 2065
1947 nmdc:mga0yw44_140738_c1 3300050492 Bacteria 1568
1948 nmdc:mga0yw44_14514_c1 3300050492 Bacteria 4187
1949 nmdc:mga0yw44_20053_c1 3300050492 Bacteria 3702
1950 nmdc:mga0yw44_350459_c1 3300050492 Bacteria 994
1951 nmdc:mga0yw44_45730_c1 3300050492 Bacteria 2626
1952 nmdc:mga0yw44_492520_c1 3300050492 Bacteria 832
1953 nmdc:mga0yw44_68185_c1 3300050492 Bacteria 2200
1954 nmdc:mga0k408_109555_c1 3300050493 Bacteria 1632
1955 nmdc:mga0k408_127250_c1 3300050493 Bacteria 1511
1956 nmdc:mga0k408_26665_c1 3300050493 Bacteria 3278
1957 nmdc:mga0k408_3218_c1 3300050493 Bacteria 8640
1958 nmdc:mga0k408_3880_c1 3300050493 Bacteria 7926
1959 nmdc:mga0k408_52875_c1 3300050493 Bacteria 2354
1960 nmdc:mga0k408_8117_c1 3300050493 Bacteria 5627
1961 nmdc:mga0k408_94375_c1 3300050493 Bacteria 1760
1962 nmdc:mga06z11_10443_c1 3300050494 Bacteria 3960
1963 nmdc:mga06z11_10573_c1 3300050494 Bacteria 3940
1964 nmdc:mga06z11_30650_c1 3300050494 Bacteria 2605
1965 nmdc:mga06z11_96257_c1 3300050494 Bacteria 1617
1966 nmdc:mga04h51_1867_c1 3300050495 Bacteria 4922
1967 nmdc:mga04h51_22772_c1 3300050495 Bacteria 1900
1968 nmdc:mga04h51_31619_c1 3300050495 Bacteria 1674
1969 nmdc:mga07m45_204217_c1 3300050496 Bacteria 1150
1970 nmdc:mga07m45_20986_c1 3300050496 Bacteria 3552
1971 nmdc:mga07m45_52842_c1 3300050496 Bacteria 2295
1972 nmdc:mga05p37_29281_c1 3300050507 Bacteria 6721
1973 nmdc:mga05p37_32260_c1 3300050507 Bacteria 6406
1974 nmdc:mga05p37_497346_c1 3300050507 Bacteria 1400
1975 nmdc:mga05p37_539442_c1 3300050507 Bacteria 1330
1976 nmdc:mga05p37_734746_c1 3300050507 Bacteria 1091
1977 nmdc:mga05p37_82199_c1 3300050507 Bacteria 3969
1978 nmdc:mga09592_14281_c1 3300050508 Bacteria 6482
1979 nmdc:mga09592_47913_c1 3300050508 Bacteria 3602
1980 nmdc:mga09592_680285_c1 3300050508 Bacteria 877
1981 nmdc:mga0qj67_252696_c1 3300050509 Bacteria 1430
1982 nmdc:mga0qj67_45836_c1 3300050509 Bacteria 3449
1983 nmdc:mga0qj67_76254_c1 3300050509 Bacteria 2681
1984 nmdc:mga0qj67_8273_c1 3300050509 Bacteria 7712
1985 nmdc:mga06r32_1267_c1 3300050510 Bacteria 22709
1986 nmdc:mga06r32_204187_c1 3300050510 Bacteria 1964
1987 nmdc:mga06r32_415880_c1 3300050510 Bacteria 1326
1988 nmdc:mga06r32_46348_c1 3300050510 Bacteria 4148
1989 nmdc:mga08y16_11195_c1 3300050511 Bacteria 9423
1990 nmdc:mga08y16_121923_c1 3300050511 Bacteria 2713
1991 nmdc:mga08y16_164563_c1 3300050511 Bacteria 2304
1992 nmdc:mga08y16_27260_c1 3300050511 Bacteria 6019
1993 nmdc:mga08y16_36399_c1 3300050511 Bacteria 4124
1994 nmdc:mga08y16_72310_c1 3300050511 Bacteria 3594
1995 nmdc:mga08y16_917660_c1 3300050511 Bacteria 861
1996 nmdc:mga0n895_119838_c1 3300050512 Bacteria 2652
1997 nmdc:mga0n895_154932_c1 3300050512 Bacteria 2321
1998 nmdc:mga0n895_216795_c1 3300050512 Bacteria 1943
1999 nmdc:mga0n895_2429_c1 3300050512 Bacteria 14534
2000 nmdc:mga0n895_484681_c1 3300050512 Bacteria 1247
2001 nmdc:mga0n895_87597_c1 3300050512 Bacteria 3112
2002 nmdc:mga0rr50_360500_c1 3300050513 Bacteria 1223
2003 nmdc:mga08x19_78211_c1 3300050514 Bacteria 2167
2004 nmdc:mga0a205_119665_c1 3300050515 Bacteria 2533
2005 nmdc:mga0a205_185931_c1 3300050515 Bacteria 1971
2006 nmdc:mga0a205_250175_c1 3300050515 Bacteria 1652
2007 nmdc:mga0a205_371_c1 3300050515 Bacteria 33954
2008 nmdc:mga0sz30_116923_c1 3300050516 Bacteria 1171
2009 nmdc:mga0sz30_16712_c2 3300050516 Bacteria 2172
2010 nmdc:mga0sz30_17797_c1 3300050516 Bacteria 2837
2011 nmdc:mga0sz30_25341_c1 3300050516 Bacteria 2425
2012 nmdc:mga0sz30_6607_c2 3300050516 Bacteria 3502
2013 nmdc:mga0sz30_67783_c1 3300050516 Bacteria 1533
2014 Ga0495601_0065900 3300053077 Bacteria 2305
2015 Ga0495601_0082177 3300053077 Bacteria 2068
2016 Ga0495601_0176026 3300053077 Bacteria 1398
2017 Ga0500610_0068549 3300053079 Bacteria 1850
2018 Ga0500610_0172374 3300053079 Bacteria 1067
2019 Ga0500635_0000979 3300053080 Bacteria 6867
2020 Ga0500635_0007194 3300053080 Bacteria 3011
2021 Ga0495655_0005449 3300053083 Bacteria 2247
2022 Ga0495655_0008570 3300053083 Bacteria 1948
2023 Ga0495595_0006014 3300053084 Bacteria 4930
2024 Ga0495595_0055642 3300053084 Bacteria 1842
2025 Ga0495595_0112976 3300053084 Bacteria 1318
2026 Ga0495619_0030652 3300053085 Bacteria 3481
2027 Ga0495619_0102071 3300053085 Bacteria 1953
2028 Ga0500578_0173951 3300053086 Bacteria 1330
2029 Ga0500578_0252786 3300053086 Bacteria 1061
2030 Ga0500643_000052 3300053087 Bacteria 144656
2031 Ga0500643_027137 3300053087 Bacteria 1784
2032 Ga0500647_0119995 3300053091 Bacteria 1245
2033 Ga0500651_0003743 3300053093 Bacteria 8380
2034 Ga0500651_0243518 3300053093 Bacteria 1048
2035 Ga0500566_0000181 3300053094 Bacteria 32381
2036 Ga0500566_0000809 3300053094 Bacteria 17792
2037 Ga0500566_0026932 3300053094 Bacteria 3365
2038 Ga0500566_0053494 3300053094 Bacteria 2304
2039 Ga0500566_0057395 3300053094 Bacteria 2211
2040 Ga0500566_0067942 3300053094 Bacteria 2005
2041 Ga0500566_0146176 3300053094 Bacteria 1249
2042 Ga0500640_006447 3300053095 Bacteria 4482
2043 Ga0500640_056383 3300053095 Bacteria 1710
2044 Ga0500640_066323 3300053095 Bacteria 1556
2045 Ga0500641_0012011 3300053096 Bacteria 3156
2046 Ga0500641_0030645 3300053096 Bacteria 2115
2047 Ga0500648_234140 3300053097 Bacteria 884
2048 Ga0500650_0053166 3300053098 Bacteria 1884
2049 Ga0500650_0208243 3300053098 Bacteria 889
2050 Ga0500554_002768 3300053102 Bacteria 3493
2051 Ga0500556_0083363 3300053104 Bacteria 1211
2052 Ga0500557_000046 3300053105 Bacteria 59508
2053 Ga0500569_076622 3300053109 Bacteria 1062
2054 Ga0500569_083805 3300053109 Bacteria 1023
2055 Ga0500572_001605 3300053111 Bacteria 5970
2056 Ga0500591_014440 3300053115 Bacteria 3796
2057 Ga0500593_000061 3300053117 Bacteria 40152
2058 Ga0500594_0005284 3300053118 Bacteria 2862
2059 Ga0500594_0084666 3300053118 Bacteria 954
2060 Ga0500595_000436 3300053119 Bacteria 25986
2061 Ga0500595_004916 3300053119 Bacteria 5909
2062 Ga0500595_008290 3300053119 Bacteria 4252
2063 Ga0500595_014551 3300053119 Bacteria 2982
2064 Ga0500595_017928 3300053119 Bacteria 2600
2065 Ga0500595_019542 3300053119 Bacteria 2456
2066 Ga0500595_022350 3300053119 Bacteria 2242
2067 Ga0500595_036353 3300053119 Bacteria 1613
2068 Ga0500597_105025 3300053120 Bacteria 1228
2069 Ga0500607_033998 3300053121 Bacteria 2792
2070 Ga0500607_127518 3300053121 Bacteria 1219
2071 Ga0500608_015000 3300053122 Bacteria 3471
2072 Ga0500608_056146 3300053122 Bacteria 1887
2073 Ga0500618_001833 3300053125 Bacteria 8885
2074 Ga0500618_003890 3300053125 Bacteria 4970
2075 Ga0500618_013717 3300053125 Bacteria 2087
2076 Ga0500618_013924 3300053125 Bacteria 2067
2077 Ga0500642_0000038 3300053130 Bacteria 98299
2078 Ga0500559_0000713 3300053136 Bacteria 21844
2079 Ga0500559_0022574 3300053136 Bacteria 2668
2080 Ga0500559_0030345 3300053136 Bacteria 2317
2081 Ga0500564_068772 3300053138 Bacteria 1599
2082 Ga0500564_168102 3300053138 Bacteria 923
2083 Ga0500568_0000005 3300053139 Bacteria 614296
2084 Ga0500568_0074848 3300053139 Bacteria 1292
2085 Ga0500577_0001496 3300053142 Bacteria 5960
2086 Ga0500577_0037014 3300053142 Bacteria 1751
2087 Ga0500577_0088443 3300053142 Bacteria 1248
2088 Ga0500590_031550 3300053148 Bacteria 2748
2089 Ga0500590_127463 3300053148 Bacteria 1183
2090 Ga0500590_135385 3300053148 Bacteria 1134
2091 Ga0500603_002928 3300053150 Bacteria 3695
2092 Ga0500616_0134442 3300053153 Bacteria 1164
2093 Ga0500619_001415 3300053154 Bacteria 4240
2094 Ga0500620_009430 3300053155 Bacteria 2521
2095 Ga0500622_0008750 3300053156 Bacteria 5639
2096 Ga0500622_0105597 3300053156 Bacteria 1382
2097 Ga0500622_0112082 3300053156 Bacteria 1332
2098 Ga0500627_0008124 3300053158 Bacteria 3707
2099 Ga0500630_005801 3300053159 Bacteria 6036
2100 Ga0500634_0052269 3300053161 Bacteria 2195
2101 Ga0500638_133738 3300053162 Bacteria 1121
2102 Ga0500638_151193 3300053162 Bacteria 1032
2103 Ga0500639_000035 3300053163 Bacteria 66883
2104 Ga0500639_003323 3300053163 Bacteria 8118
2105 Ga0500636_0000275 3300053177 Bacteria 28487
2106 Ga0500636_0004059 3300053177 Bacteria 8265
2107 Ga0500636_0057434 3300053177 Bacteria 2278
2108 Ga0500636_0059047 3300053177 Bacteria 2241
2109 Ga0500636_0067309 3300053177 Bacteria 2081
2110 Ga0500636_0092555 3300053177 Bacteria 1729
2111 Ga0500637_0000068 3300053178 Bacteria 37212
2112 Ga0500637_0078495 3300053178 Bacteria 1905
2113 Ga0500625_022280 3300053729 Bacteria 2991
2114 Ga0500645_015954 3300053730 Bacteria 2373
2115 Ga0500645_020250 3300053730 Bacteria 2063
2116 Ga0500609_003220 3300053731 Bacteria 2308
2117 Ga0500552_001241 3300053733 Bacteria 2420
2118 Ga0500596_000368 3300053735 Bacteria 8162
2119 Ga0500596_001567 3300053735 Bacteria 4640
2120 Ga0500596_025345 3300053735 Bacteria 904
2121 Ga0500599_001055 3300053736 Bacteria 3112
2122 Ga0500601_000575 3300053737 Bacteria 5284
2123 Ga0500601_002196 3300053737 Bacteria 2096
2124 Ga0501084_0014644 3300054114 Bacteria 6502
2125 Ga0501084_0059181 3300054114 Bacteria 3206
2126 Ga0501084_0093182 3300054114 Bacteria 2529
2127 Ga0501084_0118577 3300054114 Bacteria 2225
2128 Ga0500661_004938 3300055283 Bacteria 2498
2129 Ga0500661_028815 3300055283 Bacteria 979
2130 Ga0587077_000034 3300059493 Bacteria 6115
2131 Ga0587077_000440 3300059493 Bacteria 3528
2132 Ga0587090_007717 3300059510 Bacteria 1421
2133 Ga0587101_022402 3300059623 Bacteria 921
2134 Ga0587076_015118 3300059645 Bacteria 1198
2135 Ga0587076_021814 3300059645 Bacteria 1064
2136 Ga0587078_012541 3300059646 Bacteria 995
2137 Ga0587079_065523 3300059647 Bacteria 798
2138 Ga0587102_005692 3300059649 Bacteria 1109
2139 Ga0501082_0002452 3300060353 Bacteria 16281
2140 Ga0501082_0019165 3300060353 Bacteria 5895
2141 Ga0466962_0144758 3300061719 Bacteria 1152
2142 Ga0530510_0000505 3300061734 Bacteria 24760
2143 Ga0530510_0078363 3300061734 Bacteria 2402
2144 Ga0530510_0088675 3300061734 Bacteria 2255
2145 Ga0530510_0179068 3300061734 Bacteria 1572

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005546 Ga0070696_100123900 Ga0070696_1001239002 179
2 3300009176 Ga0105242_10002333 Ga0105242_100023338 190
3 3300009551 Ga0105238_10442534 Ga0105238_104425342 190
4 3300013297 Ga0157378_10183717 Ga0157378_101837172 190
5 3300013306 Ga0163162_10044782 Ga0163162_100447823 190
6 3300034816 Ga0373930_0004586 Ga0373930_0004586_961_1686 190
7 3300035691 Ga0373931_0118538 Ga0373931_0118538_277_1002 190
8 3300050493 nmdc:mga0k408_3218_c1 nmdc:mga0k408_3218_c1_4895_5620 190
9 3300009098 Ga0105245_10155546 Ga0105245_101555462 191
10 3300009174 Ga0105241_10277688 Ga0105241_102776882 191
11 3300050509 nmdc:mga0qj67_252696_c1 nmdc:mga0qj67_252696_c1_790_1404 192
12 3300050516 nmdc:mga0sz30_6607_c2 nmdc:mga0sz30_6607_c2_20_742 192
13 3300005336 Ga0070680_100262877 Ga0070680_1002628771 194
14 3300014326 Ga0157380_10011298 Ga0157380_100112985 194
15 3300009094 Ga0111539_10412734 Ga0111539_104127342 196
16 3300050511 nmdc:mga08y16_36399_c1 nmdc:mga08y16_36399_c1_3282_4040 196
17 3300009094 Ga0111539_11046015 Ga0111539_110460151 198
18 3300046810 Ga0495660_0041608 Ga0495660_0041608_620_1369 199
19 3300042876 Ga0451577_0103229 Ga0451577_0103229_809_1576 202
20 3300049459 Ga0495678_073355 Ga0495678_073355_180_1058 202
21 3300049568 Ga0501031_0411671 Ga0501031_0411671_24_719 202
22 3300050509 nmdc:mga0qj67_45836_c1 nmdc:mga0qj67_45836_c1_620_1378 202
23 3300005459 Ga0068867_100290212 Ga0068867_1002902122 203
24 3300005544 Ga0070686_100204794 Ga0070686_1002047942 203
25 3300006195 Ga0075366_10002171 Ga0075366_100021715 203
26 3300025924 Ga0207694_10185968 Ga0207694_101859682 203
27 3300025934 Ga0207686_10002221 Ga0207686_100022219 203
28 3300026035 Ga0207703_10018896 Ga0207703_100188963 203
29 3300026089 Ga0207648_10108508 Ga0207648_101085082 203
30 3300005341 Ga0070691_10172761 Ga0070691_101727612 204
31 3300005354 Ga0070675_100228826 Ga0070675_1002288262 204
32 3300005364 Ga0070673_100181623 Ga0070673_1001816232 204
33 3300005456 Ga0070678_100019001 Ga0070678_1000190013 204
34 3300005543 Ga0070672_100336844 Ga0070672_1003368442 204
35 3300005547 Ga0070693_100011372 Ga0070693_1000113723 204
36 3300005578 Ga0068854_100060161 Ga0068854_1000601612 204
37 3300005719 Ga0068861_100143144 Ga0068861_1001431442 204
38 3300006881 Ga0068865_100198339 Ga0068865_1001983392 204
39 3300009036 Ga0105244_10017280 Ga0105244_100172803 204
40 3300015261 Ga0182006_1000010 Ga0182006_1000010369 204
41 3300015262 Ga0182007_10000021 Ga0182007_10000021158 204
42 3300015265 Ga0182005_1000009 Ga0182005_100000914 204
43 3300025911 Ga0207654_10053403 Ga0207654_100534032 204
44 3300025938 Ga0207704_10697353 Ga0207704_106973531 204
45 3300025981 Ga0207640_10054786 Ga0207640_100547863 204
46 3300026075 Ga0207708_10105657 Ga0207708_101056572 204
47 3300026089 Ga0207648_10035691 Ga0207648_100356913 204
48 3300026118 Ga0207675_100172253 Ga0207675_1001722533 204
49 3300026121 Ga0207683_10041093 Ga0207683_100410933 204
50 3300048914 Ga0496111_0039106 Ga0496111_0039106_525_1280 204
51 3300048919 Ga0496116_0086191 Ga0496116_0086191_333_1088 204
52 3300048920 Ga0496117_0000010 Ga0496117_0000010_593413_594168 204
53 3300048921 Ga0496118_0000009 Ga0496118_0000009_17787_18542 204
54 3300048924 Ga0496121_0026869 Ga0496121_0026869_4600_5355 204
55 3300048925 Ga0496122_0003066 Ga0496122_0003066_12990_13745 204
56 3300048926 Ga0496123_0004181 Ga0496123_0004181_13845_14600 204
57 3300048928 Ga0496125_0047258 Ga0496125_0047258_2121_2876 204
58 3300005548 Ga0070665_100102428 Ga0070665_1001024282 205
59 3300006051 Ga0075364_10114887 Ga0075364_101148872 205
60 3300006186 Ga0075369_10041686 Ga0075369_100416862 205
61 3300006195 Ga0075366_10001879 Ga0075366_100018792 205
62 3300017792 Ga0163161_10186882 Ga0163161_101868822 205
63 3300026041 Ga0207639_10828846 Ga0207639_108288461 205
64 3300028379 Ga0268266_10117809 Ga0268266_101178093 205
65 3300049573 Ga0501037_0068814 Ga0501037_0068814_1890_2546 205
66 3300049574 Ga0501038_0374652 Ga0501038_0374652_10_666 205
67 3300050491 nmdc:mga00v17_107239_c1 nmdc:mga00v17_107239_c1_848_1612 205
68 3300050493 nmdc:mga0k408_3880_c1 nmdc:mga0k408_3880_c1_499_1263 205
69 3300005347 Ga0070668_100118852 Ga0070668_1001188522 206
70 3300005444 Ga0070694_100119856 Ga0070694_1001198563 206
71 3300005545 Ga0070695_100113078 Ga0070695_1001130783 206
72 3300005549 Ga0070704_100394314 Ga0070704_1003943142 206
73 3300005563 Ga0068855_101058269 Ga0068855_1010582691 206
74 3300006881 Ga0068865_100450398 Ga0068865_1004503982 206
75 3300013306 Ga0163162_10071039 Ga0163162_100710394 206
76 3300013308 Ga0157375_10604791 Ga0157375_106047912 206
77 3300025885 Ga0207653_10060604 Ga0207653_100606041 206
78 3300025910 Ga0207684_10254511 Ga0207684_102545112 206
79 3300025922 Ga0207646_10123418 Ga0207646_101234183 206
80 3300025939 Ga0207665_10030953 Ga0207665_100309533 206
81 3300048904 Ga0496101_0102541 Ga0496101_0102541_395_1144 206
82 3300048905 Ga0496102_0654800 Ga0496102_0654800_186_935 206
83 3300048909 Ga0496106_0154299 Ga0496106_0154299_276_1025 206
84 3300048911 Ga0496108_0270540 Ga0496108_0270540_279_1028 206
85 3300048913 Ga0496110_0290695 Ga0496110_0290695_228_1034 206
86 3300009553 Ga0105249_10210860 Ga0105249_102108602 207
87 3300006846 Ga0075430_100162732 Ga0075430_1001627322 210
88 3300006847 Ga0075431_100074428 Ga0075431_1000744285 210
89 3300050510 nmdc:mga06r32_46348_c1 nmdc:mga06r32_46348_c1_218_1030 210
90 3300002987 JGI25159J45721_1001744 JGI25159J45721_10017443 211
91 3300003187 JGI25151J46595_10002292 JGI25151J46595_100022929 211
92 3300003781 Ga0055536_1000782 Ga0055536_100078216 211
93 3300003791 Ga0055530_10000199 Ga0055530_1000019932 211
94 3300003792 Ga0055540_1000047 Ga0055540_100004766 211
95 3300003794 Ga0055531_10000848 Ga0055531_100008485 211
96 3300025245 Ga0207425_1001911 Ga0207425_10019113 211
97 3300025284 Ga0209130_1000238 Ga0209130_100023816 211
98 3300025292 Ga0209676_1000073 Ga0209676_1000073185 211
99 3300025294 Ga0209025_1001379 Ga0209025_10013798 211
100 3300025297 Ga0209758_1013940 Ga0209758_10139402 211
101 3300025298 Ga0209050_1000008 Ga0209050_1000008878 211
102 3300025302 Ga0207426_1001712 Ga0207426_10017129 211
103 3300025303 Ga0209051_1000005 Ga0209051_1000005878 211
104 3300025304 Ga0209257_1000031 Ga0209257_1000031468 211
105 3300046616 Ga0495668_0000065 Ga0495668_0000065_129422_130168 212
106 3300046460 Ga0495638_0000027 Ga0495638_0000027_82222_82968 213
107 3300046462 Ga0495651_0034303 Ga0495651_0034303_2647_3378 213
108 3300046522 Ga0495643_0000167 Ga0495643_0000167_34495_35241 213
109 3300046524 Ga0495648_0000002 Ga0495648_0000002_202348_203094 213
110 3300046538 Ga0495609_0000441 Ga0495609_0000441_31411_32157 213
111 3300046542 Ga0495597_0000074 Ga0495597_0000074_14050_14796 213
112 3300046557 Ga0495622_0000200 Ga0495622_0000200_19212_19958 213
113 3300046558 Ga0495633_0071502 Ga0495633_0071502_285_1031 213
114 3300046810 Ga0495660_0008519 Ga0495660_0008519_4832_5578 213
115 3300047443 Ga0495687_000369 Ga0495687_000369_24645_25391 213
116 3300047443 Ga0495687_000481 Ga0495687_000481_17875_18621 213
117 3300005336 Ga0070680_100117542 Ga0070680_1001175422 214
118 3300025917 Ga0207660_10331328 Ga0207660_103313282 214
119 3300031616 Ga0307508_10154948 Ga0307508_101549482 214
120 3300053158 Ga0500627_0008124 Ga0500627_0008124_165_917 214
121 3300032005 Ga0307411_10043483 Ga0307411_100434832 215
122 3300032126 Ga0307415_100125460 Ga0307415_1001254602 215
123 3300006175 Ga0070712_100114656 Ga0070712_1001146561 216
124 3300006844 Ga0075428_100000165 Ga0075428_10000016538 216
125 3300006880 Ga0075429_100061945 Ga0075429_1000619452 216
126 3300025261 Ga0209233_1002586 Ga0209233_10025865 216
127 3300025273 Ga0209673_1002584 Ga0209673_10025847 216
128 3300025915 Ga0207693_10265259 Ga0207693_102652592 216
129 3300025929 Ga0207664_10162582 Ga0207664_101625823 216
130 3300027907 Ga0207428_10020049 Ga0207428_100200493 216
131 3300046507 Ga0495606_0057831 Ga0495606_0057831_858_1574 216
132 3300046524 Ga0495648_0015112 Ga0495648_0015112_4403_5119 216
133 3300046616 Ga0495668_0103118 Ga0495668_0103118_213_929 216
134 3300046694 Ga0495649_0067664 Ga0495649_0067664_203_919 216
135 3300047320 Ga0495672_0000014 Ga0495672_0000014_16064_16885 216
136 3300047323 Ga0495683_0134162 Ga0495683_0134162_200_916 216
137 3300048921 Ga0496118_0367321 Ga0496118_0367321_29_745 216
138 3300049460 Ga0495682_0060306 Ga0495682_0060306_477_1193 216
139 3300050508 nmdc:mga09592_47913_c1 nmdc:mga09592_47913_c1_1470_2228 216
140 3300050511 nmdc:mga08y16_11195_c1 nmdc:mga08y16_11195_c1_5150_5908 216
141 3300053094 Ga0500566_0146176 Ga0500566_0146176_48_821 216
142 3300004625 Ga0055543_1012305 Ga0055543_10123052 217
143 3300005262 Ga0065165_1001013 Ga0065165_10010139 217
144 3300005617 Ga0068859_100187181 Ga0068859_1001871813 217
145 3300006038 Ga0075365_10254593 Ga0075365_102545931 217
146 3300006931 Ga0097620_100187176 Ga0097620_1001871763 217
147 3300025941 Ga0207711_10233755 Ga0207711_102337552 217
148 3300049742 Ga0501080_0158684 Ga0501080_0158684_823_1578 217
149 3300053094 Ga0500566_0026932 Ga0500566_0026932_2523_3239 217
150 3300053096 Ga0500641_0012011 Ga0500641_0012011_978_1742 217
151 3300053138 Ga0500564_168102 Ga0500564_168102_70_786 217
152 3300053155 Ga0500620_009430 Ga0500620_009430_273_989 217
153 3300002704 JGI25155J39150_1000686 JGI25155J39150_10006862 218
154 3300002705 JGI25156J39149_1003687 JGI25156J39149_10036874 218
155 3300002738 JGI25154J39366_1000261 JGI25154J39366_100026128 218
156 3300002741 JGI25157J39369_1005379 JGI25157J39369_10053792 218
157 3300003771 Ga0055526_1000226 Ga0055526_10002266 218
158 3300003773 Ga0055537_1000047 Ga0055537_100004770 218
159 3300003775 Ga0055524_1000039 Ga0055524_100003976 218
160 3300003784 Ga0055534_1002558 Ga0055534_10025582 218
161 3300005530 Ga0070679_100534679 Ga0070679_1005346792 218
162 3300005578 Ga0068854_100261066 Ga0068854_1002610662 218
163 3300005937 Ga0081455_10060036 Ga0081455_100600364 218
164 3300005983 Ga0081540_1077600 Ga0081540_10776002 218
165 3300006871 Ga0075434_100166174 Ga0075434_1001661743 218
166 3300007076 Ga0075435_100295365 Ga0075435_1002953652 218
167 3300009093 Ga0105240_10797804 Ga0105240_107978042 218
168 3300013100 Ga0157373_10120416 Ga0157373_101204162 218
169 3300013104 Ga0157370_10002820 Ga0157370_1000282010 218
170 3300013307 Ga0157372_10175882 Ga0157372_101758823 218
171 3300013307 Ga0157372_10352466 Ga0157372_103524662 218
172 3300025206 Ga0209435_100106 Ga0209435_10010627 218
173 3300025246 Ga0209646_1000186 Ga0209646_100018641 218
174 3300025250 Ga0209026_1002393 Ga0209026_10023934 218
175 3300025256 Ga0209759_1000470 Ga0209759_100047036 218
176 3300025263 Ga0209565_1000080 Ga0209565_100008071 218
177 3300025273 Ga0209673_1000088 Ga0209673_100008875 218
178 3300025295 Ga0209564_1000313 Ga0209564_100031313 218
179 3300025299 Ga0209256_1000096 Ga0209256_1000096132 218
180 3300025913 Ga0207695_10086151 Ga0207695_100861512 218
181 3300025921 Ga0207652_10467542 Ga0207652_104675421 218
182 3300025949 Ga0207667_10043798 Ga0207667_100437985 218
183 3300030763 Ga0265763_1000019 Ga0265763_10000194 218
184 3300048909 Ga0496106_0268071 Ga0496106_0268071_424_1179 218
185 3300050512 nmdc:mga0n895_119838_c1 nmdc:mga0n895_119838_c1_930_1685 218
186 3300005331 Ga0070670_100104898 Ga0070670_1001048982 219
187 3300005577 Ga0068857_100322436 Ga0068857_1003224362 219
188 3300005578 Ga0068854_100526461 Ga0068854_1005264611 219
189 3300005614 Ga0068856_100064365 Ga0068856_1000643654 219
190 3300005616 Ga0068852_100002266 Ga0068852_10000226612 219
191 3300005718 Ga0068866_10344534 Ga0068866_103445342 219
192 3300005842 Ga0068858_100050743 Ga0068858_1000507433 219
193 3300006237 Ga0097621_100134886 Ga0097621_1001348863 219
194 3300009093 Ga0105240_10001823 Ga0105240_100018237 219
195 3300009176 Ga0105242_10123809 Ga0105242_101238092 219
196 3300009545 Ga0105237_10115255 Ga0105237_101152552 219
197 3300009551 Ga0105238_10020731 Ga0105238_100207314 219
198 3300010375 Ga0105239_10024037 Ga0105239_100240376 219
199 3300013100 Ga0157373_10089953 Ga0157373_100899531 219
200 3300014497 Ga0182008_10111937 Ga0182008_101119371 219
201 3300025233 Ga0209437_100117 Ga0209437_100117177 219
202 3300025735 Ga0207713_1023954 Ga0207713_10239542 219
203 3300025913 Ga0207695_10001901 Ga0207695_1000190126 219
204 3300025924 Ga0207694_10091002 Ga0207694_100910023 219
205 3300025925 Ga0207650_10009001 Ga0207650_100090015 219
206 3300025949 Ga0207667_10162408 Ga0207667_101624082 219
207 3300026067 Ga0207678_10390096 Ga0207678_103900962 219
208 3300026078 Ga0207702_10078326 Ga0207702_100783263 219
209 3300026116 Ga0207674_10312281 Ga0207674_103122812 219
210 3300026142 Ga0207698_10016348 Ga0207698_100163485 219
211 3300046457 Ga0495590_0000005 Ga0495590_0000005_206674_207420 219
212 3300046660 Ga0495625_0006080 Ga0495625_0006080_6130_6879 219
213 3300048919 Ga0496116_0013520 Ga0496116_0013520_2469_3218 219
214 3300048925 Ga0496122_0000757 Ga0496122_0000757_30020_30769 219
215 3300048926 Ga0496123_0000523 Ga0496123_0000523_35005_35754 219
216 3300048928 Ga0496125_0019213 Ga0496125_0019213_4445_5194 219
217 3300049459 Ga0495678_001979 Ga0495678_001979_1665_2411 219
218 3300050515 nmdc:mga0a205_185931_c1 nmdc:mga0a205_185931_c1_41_796 219
219 3300053086 Ga0500578_0173951 Ga0500578_0173951_307_1023 219
220 3300053093 Ga0500651_0003743 Ga0500651_0003743_348_1064 219
221 3300053125 Ga0500618_013717 Ga0500618_013717_833_1582 219
222 3300053142 Ga0500577_0088443 Ga0500577_0088443_314_1030 219
223 3300053730 Ga0500645_020250 Ga0500645_020250_672_1388 219
224 3300005295 Ga0065707_10011328 Ga0065707_100113283 220
225 3300005344 Ga0070661_100082398 Ga0070661_1000823982 220
226 3300005347 Ga0070668_100187574 Ga0070668_1001875742 220
227 3300005366 Ga0070659_100229952 Ga0070659_1002299522 220
228 3300005435 Ga0070714_100009911 Ga0070714_1000099112 220
229 3300005458 Ga0070681_10058438 Ga0070681_100584384 220
230 3300005530 Ga0070679_100034919 Ga0070679_1000349194 220
231 3300005546 Ga0070696_100230238 Ga0070696_1002302382 220
232 3300005548 Ga0070665_100432553 Ga0070665_1004325532 220
233 3300005549 Ga0070704_100015506 Ga0070704_1000155065 220
234 3300005564 Ga0070664_100028499 Ga0070664_1000284993 220
235 3300005577 Ga0068857_100430777 Ga0068857_1004307772 220
236 3300005578 Ga0068854_100118535 Ga0068854_1001185352 220
237 3300005614 Ga0068856_100000712 Ga0068856_10000071219 220
238 3300005719 Ga0068861_100342371 Ga0068861_1003423711 220
239 3300005834 Ga0068851_10067880 Ga0068851_100678802 220
240 3300006038 Ga0075365_10190712 Ga0075365_101907122 220
241 3300006173 Ga0070716_100153236 Ga0070716_1001532362 220
242 3300006844 Ga0075428_100385931 Ga0075428_1003859312 220
243 3300006847 Ga0075431_100005327 Ga0075431_1000053271 220
244 3300006880 Ga0075429_100148348 Ga0075429_1001483482 220
245 3300006880 Ga0075429_100342155 Ga0075429_1003421552 220
246 3300009093 Ga0105240_10011568 Ga0105240_1001156811 220
247 3300009093 Ga0105240_10647400 Ga0105240_106474001 220
248 3300009094 Ga0111539_10071980 Ga0111539_100719802 220
249 3300009147 Ga0114129_10272486 Ga0114129_102724862 220
250 3300009147 Ga0114129_10610090 Ga0114129_106100902 220
251 3300009174 Ga0105241_10040441 Ga0105241_100404413 220
252 3300013100 Ga0157373_10087865 Ga0157373_100878652 220
253 3300013105 Ga0157369_10295550 Ga0157369_102955502 220
254 3300013296 Ga0157374_10443435 Ga0157374_104434352 220
255 3300025893 Ga0207682_10047823 Ga0207682_100478232 220
256 3300025903 Ga0207680_10417872 Ga0207680_104178721 220
257 3300025911 Ga0207654_10229725 Ga0207654_102297252 220
258 3300025912 Ga0207707_10035901 Ga0207707_100359014 220
259 3300025913 Ga0207695_10038571 Ga0207695_100385715 220
260 3300025915 Ga0207693_10295051 Ga0207693_102950512 220
261 3300025917 Ga0207660_10032603 Ga0207660_100326034 220
262 3300025919 Ga0207657_10404275 Ga0207657_104042751 220
263 3300025921 Ga0207652_10093987 Ga0207652_100939872 220
264 3300025921 Ga0207652_10106458 Ga0207652_101064583 220
265 3300025928 Ga0207700_10309823 Ga0207700_103098232 220
266 3300025929 Ga0207664_10031959 Ga0207664_100319594 220
267 3300025945 Ga0207679_10222186 Ga0207679_102221861 220
268 3300025949 Ga0207667_10065863 Ga0207667_100658633 220
269 3300025972 Ga0207668_10080992 Ga0207668_100809922 220
270 3300026078 Ga0207702_10047626 Ga0207702_100476264 220
271 3300026116 Ga0207674_10039704 Ga0207674_100397043 220
272 3300026116 Ga0207674_10246901 Ga0207674_102469012 220
273 3300026118 Ga0207675_100206117 Ga0207675_1002061171 220
274 3300026121 Ga0207683_10170298 Ga0207683_101702983 220
275 3300027424 Ga0209984_1002309 Ga0209984_10023092 220
276 3300027614 Ga0209970_1026517 Ga0209970_10265171 220
277 3300027682 Ga0209971_1015051 Ga0209971_10150512 220
278 3300027876 Ga0209974_10006362 Ga0209974_100063622 220
279 3300028379 Ga0268266_10310639 Ga0268266_103106392 220
280 3300031548 Ga0307408_100011257 Ga0307408_1000112573 220
281 3300031731 Ga0307405_10012653 Ga0307405_100126533 220
282 3300031824 Ga0307413_10288290 Ga0307413_102882902 220
283 3300031852 Ga0307410_10001818 Ga0307410_100018182 220
284 3300031901 Ga0307406_10009696 Ga0307406_100096966 220
285 3300031903 Ga0307407_10346698 Ga0307407_103466981 220
286 3300031911 Ga0307412_10075800 Ga0307412_100758002 220
287 3300031995 Ga0307409_100007584 Ga0307409_1000075845 220
288 3300032002 Ga0307416_100001693 Ga0307416_10000169314 220
289 3300032004 Ga0307414_10017677 Ga0307414_100176773 220
290 3300032005 Ga0307411_10003428 Ga0307411_100034282 220
291 3300032126 Ga0307415_100140018 Ga0307415_1001400182 220
292 3300037312 Ga0395899_0367449 Ga0395899_0367449_174_920 220
293 3300038443 Ga0395901_0796894 Ga0395901_0796894_68_814 220
294 3300048911 Ga0496108_0520744 Ga0496108_0520744_122_871 220
295 3300048921 Ga0496118_0070597 Ga0496118_0070597_13_711 220
296 3300048924 Ga0496121_0056700 Ga0496121_0056700_216_965 220
297 3300048929 Ga0496126_0254943 Ga0496126_0254943_242_991 220
298 3300049574 Ga0501038_0656955 Ga0501038_0656955_15_749 220
299 3300049592 Ga0501076_0090533 Ga0501076_0090533_512_1246 220
300 3300050507 nmdc:mga05p37_539442_c1 nmdc:mga05p37_539442_c1_271_1005 220
301 3300050507 nmdc:mga05p37_82199_c1 nmdc:mga05p37_82199_c1_1355_2110 220
302 3300050508 nmdc:mga09592_14281_c1 nmdc:mga09592_14281_c1_3462_4217 220
303 3300050509 nmdc:mga0qj67_8273_c1 nmdc:mga0qj67_8273_c1_5882_6616 220
304 3300050510 nmdc:mga06r32_1267_c1 nmdc:mga06r32_1267_c1_12590_13324 220
305 3300050510 nmdc:mga06r32_204187_c1 nmdc:mga06r32_204187_c1_935_1669 220
306 3300050511 nmdc:mga08y16_72310_c1 nmdc:mga08y16_72310_c1_1629_2384 220
307 3300053086 Ga0500578_0252786 Ga0500578_0252786_219_935 220
308 3300053095 Ga0500640_066323 Ga0500640_066323_322_1038 220
309 3300053119 Ga0500595_019542 Ga0500595_019542_1471_2187 220
310 3300053121 Ga0500607_127518 Ga0500607_127518_278_994 220
311 3300053122 Ga0500608_056146 Ga0500608_056146_817_1533 220
312 3300053153 Ga0500616_0134442 Ga0500616_0134442_202_951 220
313 3300053177 Ga0500636_0000275 Ga0500636_0000275_14928_15644 220
314 3300053737 Ga0500601_000575 Ga0500601_000575_2703_3419 220
315 3300055283 Ga0500661_028815 Ga0500661_028815_44_760 220
316 iso_pu_bacteria 2881101125 2881103493 220
317 iso_pu_bacteria 2923510766 2923513551 220
318 iso_pu_bacteria 2928130867 2928135608 220
319 3300002704 JGI25155J39150_1000695 JGI25155J39150_10006952 221
320 3300002705 JGI25156J39149_1000283 JGI25156J39149_100028329 221
321 3300002738 JGI25154J39366_1000252 JGI25154J39366_10002526 221
322 3300002741 JGI25157J39369_1000319 JGI25157J39369_100031929 221
323 3300002741 JGI25157J39369_1000831 JGI25157J39369_10008319 221
324 3300003758 Ga0055532_1000136 Ga0055532_100013637 221
325 3300005455 Ga0070663_100191323 Ga0070663_1001913232 221
326 3300005981 Ga0081538_10013011 Ga0081538_100130113 221
327 3300005983 Ga0081540_1136876 Ga0081540_11368761 221
328 3300006195 Ga0075366_10109182 Ga0075366_101091822 221
329 3300014497 Ga0182008_10173109 Ga0182008_101731091 221
330 3300025206 Ga0209435_100018 Ga0209435_10001836 221
331 3300025229 Ga0209147_100051 Ga0209147_10005136 221
332 3300025242 Ga0209258_100324 Ga0209258_10032437 221
333 3300025246 Ga0209646_1000172 Ga0209646_100017236 221
334 3300025250 Ga0209026_1000042 Ga0209026_1000042209 221
335 3300025256 Ga0209759_1000273 Ga0209759_100027337 221
336 3300025272 Ga0209455_1003274 Ga0209455_10032742 221
337 3300025927 Ga0207687_10485563 Ga0207687_104855631 221
338 3300030731 Ga0316177_1120927 Ga0316177_11209274 221
339 3300030736 Ga0316180_1146035 Ga0316180_11460354 221
340 3300030742 Ga0316183_1005661 Ga0316183_10056613 221
341 3300030745 Ga0316182_1315656 Ga0316182_13156563 221
342 3300031548 Ga0307408_100029039 Ga0307408_1000290393 221
343 3300031730 Ga0307516_10119426 Ga0307516_101194262 221
344 3300037312 Ga0395899_0013177 Ga0395899_0013177_4819_5565 221
345 3300037418 Ga0395900_0304319 Ga0395900_0304319_101_847 221
346 3300037471 Ga0395905_0023332 Ga0395905_0023332_5082_5828 221
347 3300037853 Ga0436364_0084869 Ga0436364_0084869_994_1743 221
348 3300049589 Ga0501073_0361811 Ga0501073_0361811_129_878 221
349 3300050493 nmdc:mga0k408_52875_c1 nmdc:mga0k408_52875_c1_617_1393 221
350 iso_pu_bacteria 2738541337 2739056139 221
351 3300001991 JGI24743J22301_10002879 JGI24743J22301_100028794 222
352 3300002070 JGI24750J21931_1002501 JGI24750J21931_10025012 222
353 3300002074 JGI24748J21848_1000640 JGI24748J21848_10006404 222
354 3300002076 JGI24749J21850_1002027 JGI24749J21850_10020273 222
355 3300002239 JGI24034J26672_10002470 JGI24034J26672_100024702 222
356 3300002459 JGI24751J29686_10008937 JGI24751J29686_100089371 222
357 3300005293 Ga0065715_10101969 Ga0065715_101019692 222
358 3300005293 Ga0065715_10106988 Ga0065715_101069883 222
359 3300005328 Ga0070676_10038738 Ga0070676_100387383 222
360 3300005329 Ga0070683_100056278 Ga0070683_1000562783 222
361 3300005330 Ga0070690_100007910 Ga0070690_1000079104 222
362 3300005330 Ga0070690_100419967 Ga0070690_1004199671 222
363 3300005333 Ga0070677_10002360 Ga0070677_100023604 222
364 3300005334 Ga0068869_100046383 Ga0068869_1000463832 222
365 3300005335 Ga0070666_10007112 Ga0070666_100071125 222
366 3300005339 Ga0070660_100074555 Ga0070660_1000745553 222
367 3300005343 Ga0070687_100058540 Ga0070687_1000585402 222
368 3300005344 Ga0070661_100066892 Ga0070661_1000668922 222
369 3300005344 Ga0070661_100134546 Ga0070661_1001345462 222
370 3300005347 Ga0070668_100075105 Ga0070668_1000751052 222
371 3300005353 Ga0070669_100048709 Ga0070669_1000487092 222
372 3300005353 Ga0070669_100210526 Ga0070669_1002105262 222
373 3300005354 Ga0070675_100017595 Ga0070675_1000175952 222
374 3300005355 Ga0070671_100078165 Ga0070671_1000781652 222
375 3300005355 Ga0070671_100259298 Ga0070671_1002592982 222
376 3300005364 Ga0070673_100196405 Ga0070673_1001964052 222
377 3300005365 Ga0070688_100019262 Ga0070688_1000192623 222
378 3300005366 Ga0070659_100037158 Ga0070659_1000371584 222
379 3300005366 Ga0070659_100044112 Ga0070659_1000441123 222
380 3300005438 Ga0070701_10006890 Ga0070701_100068903 222
381 3300005441 Ga0070700_100018485 Ga0070700_1000184854 222
382 3300005455 Ga0070663_100034422 Ga0070663_1000344222 222
383 3300005456 Ga0070678_100040966 Ga0070678_1000409663 222
384 3300005457 Ga0070662_100086920 Ga0070662_1000869202 222
385 3300005466 Ga0070685_10003834 Ga0070685_100038344 222
386 3300005535 Ga0070684_100017865 Ga0070684_1000178654 222
387 3300005539 Ga0068853_100093245 Ga0068853_1000932453 222
388 3300005539 Ga0068853_100249740 Ga0068853_1002497402 222
389 3300005543 Ga0070672_100463226 Ga0070672_1004632261 222
390 3300005544 Ga0070686_100033895 Ga0070686_1000338952 222
391 3300005548 Ga0070665_100156666 Ga0070665_1001566662 222
392 3300005564 Ga0070664_100107033 Ga0070664_1001070332 222
393 3300005577 Ga0068857_100039161 Ga0068857_1000391613 222
394 3300005578 Ga0068854_100019801 Ga0068854_1000198013 222
395 3300005578 Ga0068854_100314614 Ga0068854_1003146142 222
396 3300005614 Ga0068856_100142882 Ga0068856_1001428822 222
397 3300005615 Ga0070702_100007463 Ga0070702_1000074632 222
398 3300005616 Ga0068852_100062844 Ga0068852_1000628443 222
399 3300005718 Ga0068866_10001434 Ga0068866_1000143414 222
400 3300005719 Ga0068861_100067307 Ga0068861_1000673072 222
401 3300005834 Ga0068851_10024167 Ga0068851_100241673 222
402 3300005840 Ga0068870_10004209 Ga0068870_100042096 222
403 3300005841 Ga0068863_100036811 Ga0068863_1000368113 222
404 3300005841 Ga0068863_100057358 Ga0068863_1000573583 222
405 3300005842 Ga0068858_100025105 Ga0068858_1000251052 222
406 3300005842 Ga0068858_100574056 Ga0068858_1005740562 222
407 3300005843 Ga0068860_100055470 Ga0068860_1000554703 222
408 3300005844 Ga0068862_100081042 Ga0068862_1000810423 222
409 3300006038 Ga0075365_10121443 Ga0075365_101214432 222
410 3300006042 Ga0075368_10015875 Ga0075368_100158753 222
411 3300006048 Ga0075363_100014493 Ga0075363_1000144933 222
412 3300006051 Ga0075364_10026215 Ga0075364_100262152 222
413 3300006178 Ga0075367_10062626 Ga0075367_100626263 222
414 3300006186 Ga0075369_10048905 Ga0075369_100489052 222
415 3300006237 Ga0097621_100447410 Ga0097621_1004474101 222
416 3300006353 Ga0075370_10190057 Ga0075370_101900572 222
417 3300006358 Ga0068871_100059250 Ga0068871_1000592503 222
418 3300006881 Ga0068865_100041192 Ga0068865_1000411923 222
419 3300009094 Ga0111539_10036985 Ga0111539_100369854 222
420 3300009147 Ga0114129_11011372 Ga0114129_110113722 222
421 3300009176 Ga0105242_10059311 Ga0105242_100593112 222
422 3300009176 Ga0105242_10306856 Ga0105242_103068562 222
423 3300009177 Ga0105248_10091172 Ga0105248_100911722 222
424 3300009177 Ga0105248_10249507 Ga0105248_102495072 222
425 3300009177 Ga0105248_10423466 Ga0105248_104234662 222
426 3300009545 Ga0105237_10209393 Ga0105237_102093932 222
427 3300009553 Ga0105249_10063570 Ga0105249_100635703 222
428 3300011119 Ga0105246_10217891 Ga0105246_102178912 222
429 3300013104 Ga0157370_10024986 Ga0157370_100249862 222
430 3300013105 Ga0157369_10034521 Ga0157369_100345212 222
431 3300013296 Ga0157374_10091943 Ga0157374_100919432 222
432 3300013297 Ga0157378_10119566 Ga0157378_101195662 222
433 3300013297 Ga0157378_10534381 Ga0157378_105343812 222
434 3300013307 Ga0157372_10278262 Ga0157372_102782622 222
435 3300013308 Ga0157375_10011246 Ga0157375_100112465 222
436 3300014325 Ga0163163_10009543 Ga0163163_1000954311 222
437 3300014326 Ga0157380_10009769 Ga0157380_100097694 222
438 3300014326 Ga0157380_10090401 Ga0157380_100904012 222
439 3300014745 Ga0157377_10002988 Ga0157377_100029884 222
440 3300014968 Ga0157379_10010105 Ga0157379_100101052 222
441 3300014969 Ga0157376_10072220 Ga0157376_100722202 222
442 3300017792 Ga0163161_10018193 Ga0163161_100181934 222
443 3300025290 Ga0207673_1000293 Ga0207673_10002933 222
444 3300025315 Ga0207697_10001101 Ga0207697_100011013 222
445 3300025893 Ga0207682_10000163 Ga0207682_1000016326 222
446 3300025901 Ga0207688_10000238 Ga0207688_1000023819 222
447 3300025903 Ga0207680_10043645 Ga0207680_100436452 222
448 3300025907 Ga0207645_10001001 Ga0207645_1000100127 222
449 3300025908 Ga0207643_10000208 Ga0207643_100002089 222
450 3300025909 Ga0207705_10201144 Ga0207705_102011442 222
451 3300025918 Ga0207662_10039113 Ga0207662_100391132 222
452 3300025919 Ga0207657_10008209 Ga0207657_1000820910 222
453 3300025920 Ga0207649_10056098 Ga0207649_100560983 222
454 3300025923 Ga0207681_10027132 Ga0207681_100271323 222
455 3300025923 Ga0207681_10039690 Ga0207681_100396903 222
456 3300025925 Ga0207650_10018808 Ga0207650_100188083 222
457 3300025926 Ga0207659_10009964 Ga0207659_100099648 222
458 3300025931 Ga0207644_10015088 Ga0207644_100150884 222
459 3300025931 Ga0207644_10045977 Ga0207644_100459773 222
460 3300025931 Ga0207644_10053864 Ga0207644_100538642 222
461 3300025932 Ga0207690_10034333 Ga0207690_100343333 222
462 3300025932 Ga0207690_10294941 Ga0207690_102949411 222
463 3300025933 Ga0207706_10001419 Ga0207706_1000141927 222
464 3300025933 Ga0207706_10056999 Ga0207706_100569994 222
465 3300025934 Ga0207686_10045715 Ga0207686_100457152 222
466 3300025936 Ga0207670_10004294 Ga0207670_100042945 222
467 3300025937 Ga0207669_10002100 Ga0207669_100021004 222
468 3300025938 Ga0207704_10006126 Ga0207704_100061263 222
469 3300025939 Ga0207665_10185587 Ga0207665_101855872 222
470 3300025940 Ga0207691_10008516 Ga0207691_1000851612 222
471 3300025940 Ga0207691_10429681 Ga0207691_104296812 222
472 3300025941 Ga0207711_10003709 Ga0207711_100037096 222
473 3300025941 Ga0207711_10040597 Ga0207711_100405972 222
474 3300025941 Ga0207711_10390799 Ga0207711_103907992 222
475 3300025942 Ga0207689_10003747 Ga0207689_1000374721 222
476 3300025944 Ga0207661_10041503 Ga0207661_100415033 222
477 3300025945 Ga0207679_10053840 Ga0207679_100538402 222
478 3300025949 Ga0207667_10154895 Ga0207667_101548952 222
479 3300025960 Ga0207651_10069078 Ga0207651_100690782 222
480 3300025960 Ga0207651_10144346 Ga0207651_101443462 222
481 3300025960 Ga0207651_10337441 Ga0207651_103374412 222
482 3300025961 Ga0207712_10019967 Ga0207712_100199672 222
483 3300025972 Ga0207668_10068101 Ga0207668_100681012 222
484 3300025981 Ga0207640_10087980 Ga0207640_100879802 222
485 3300025981 Ga0207640_10480049 Ga0207640_104800491 222
486 3300025986 Ga0207658_10472060 Ga0207658_104720602 222
487 3300026035 Ga0207703_10013794 Ga0207703_100137943 222
488 3300026035 Ga0207703_10115981 Ga0207703_101159811 222
489 3300026041 Ga0207639_10131549 Ga0207639_101315492 222
490 3300026067 Ga0207678_10000623 Ga0207678_1000062333 222
491 3300026088 Ga0207641_10028937 Ga0207641_100289374 222
492 3300026088 Ga0207641_10097542 Ga0207641_100975422 222
493 3300026089 Ga0207648_10004140 Ga0207648_100041403 222
494 3300026116 Ga0207674_10007147 Ga0207674_100071473 222
495 3300026121 Ga0207683_10001208 Ga0207683_100012082 222
496 3300027617 Ga0210002_1012248 Ga0210002_10122482 222
497 3300027665 Ga0209983_1001703 Ga0209983_10017034 222
498 3300027682 Ga0209971_1004558 Ga0209971_10045583 222
499 3300027682 Ga0209971_1004901 Ga0209971_10049013 222
500 3300028379 Ga0268266_10116547 Ga0268266_101165472 222
501 3300028380 Ga0268265_10043509 Ga0268265_100435092 222
502 3300028381 Ga0268264_10138072 Ga0268264_101380722 222
503 3300035725 Ga0373947_0337315 Ga0373947_0337315_38_796 222
504 3300036401 Ga0373937_0878040 Ga0373937_0878040_46_804 222
505 3300037068 Ga0373925_0300387 Ga0373925_0300387_166_891 222
506 3300046660 Ga0495625_0002719 Ga0495625_0002719_6900_7631 222
507 3300048903 Ga0496100_0025939 Ga0496100_0025939_12_770 222
508 3300048904 Ga0496101_0004251 Ga0496101_0004251_2437_3195 222
509 3300048905 Ga0496102_0185046 Ga0496102_0185046_930_1688 222
510 3300048905 Ga0496102_0241421 Ga0496102_0241421_500_1258 222
511 3300048907 Ga0496104_0156331 Ga0496104_0156331_1050_1808 222
512 3300048909 Ga0496106_0012589 Ga0496106_0012589_4911_5669 222
513 3300048910 Ga0496107_0198420 Ga0496107_0198420_220_978 222
514 3300048912 Ga0496109_0010137 Ga0496109_0010137_192_950 222
515 3300048913 Ga0496110_0004336 Ga0496110_0004336_9073_9831 222
516 3300048914 Ga0496111_0035786 Ga0496111_0035786_937_1695 222
517 3300048917 Ga0496114_0007179 Ga0496114_0007179_6136_6894 222
518 3300049575 Ga0501039_0154928 Ga0501039_0154928_648_1451 222
519 3300049576 Ga0501040_0354449 Ga0501040_0354449_277_1011 222
520 3300049580 Ga0501046_0435128 Ga0501046_0435128_47_781 222
521 3300049588 Ga0501072_0059642 Ga0501072_0059642_801_1604 222
522 3300049591 Ga0501075_0122849 Ga0501075_0122849_1148_1882 222
523 3300049741 Ga0501079_0224031 Ga0501079_0224031_40_774 222
524 3300050494 nmdc:mga06z11_96257_c1 nmdc:mga06z11_96257_c1_390_1139 222
525 3300050495 nmdc:mga04h51_1867_c1 nmdc:mga04h51_1867_c1_1801_2550 222
526 3300050496 nmdc:mga07m45_52842_c1 nmdc:mga07m45_52842_c1_298_1047 222
527 3300050511 nmdc:mga08y16_27260_c1 nmdc:mga08y16_27260_c1_3453_4211 222
528 3300053098 Ga0500650_0053166 Ga0500650_0053166_435_1184 222
529 3300059493 Ga0587077_000440 Ga0587077_000440_661_1395 222
530 3300059510 Ga0587090_007717 Ga0587090_007717_627_1361 222
531 3300059645 Ga0587076_015118 Ga0587076_015118_374_1108 222
532 3300061734 Ga0530510_0078363 Ga0530510_0078363_422_1225 222
533 iso_pu_bacteria 2513237161 2514014792 222
534 3300005340 Ga0070689_100063112 Ga0070689_1000631121 223
535 3300005347 Ga0070668_100232862 Ga0070668_1002328621 223
536 3300005457 Ga0070662_100443545 Ga0070662_1004435451 223
537 3300005544 Ga0070686_100225153 Ga0070686_1002251532 223
538 3300005548 Ga0070665_100449237 Ga0070665_1004492372 223
539 3300005616 Ga0068852_100587149 Ga0068852_1005871492 223
540 3300009148 Ga0105243_10533993 Ga0105243_105339932 223
541 3300025932 Ga0207690_10369322 Ga0207690_103693222 223
542 3300025933 Ga0207706_10023481 Ga0207706_100234814 223
543 3300025972 Ga0207668_10049007 Ga0207668_100490072 223
544 3300026142 Ga0207698_10204745 Ga0207698_102047452 223
545 3300028379 Ga0268266_10628794 Ga0268266_106287942 223
546 3300037312 Ga0395899_0000470 Ga0395899_0000470_6607_7359 223
547 3300037418 Ga0395900_0029779 Ga0395900_0029779_1072_1824 223
548 3300037471 Ga0395905_0008349 Ga0395905_0008349_8231_8983 223
549 3300041512 Ga0451853_3119863 Ga0451853_3119863_12_761 223
550 3300046491 Ga0495584_0134031 Ga0495584_0134031_200_949 223
551 3300046492 Ga0495585_0153567 Ga0495585_0153567_311_1060 223
552 3300046492 Ga0495585_0258162 Ga0495585_0258162_21_770 223
553 3300046518 Ga0495631_0150093 Ga0495631_0150093_87_836 223
554 3300046523 Ga0495644_0130271 Ga0495644_0130271_163_912 223
555 3300046543 Ga0495645_0109999 Ga0495645_0109999_376_1131 223
556 3300046684 Ga0495669_0062058 Ga0495669_0062058_916_1665 223
557 3300046691 Ga0495670_0021300 Ga0495670_0021300_439_1188 223
558 3300049572 Ga0501036_0070613 Ga0501036_0070613_2178_2936 223
559 3300049575 Ga0501039_0023535 Ga0501039_0023535_1741_2499 223
560 3300049576 Ga0501040_0130443 Ga0501040_0130443_893_1651 223
561 3300049577 Ga0501041_0098276 Ga0501041_0098276_144_902 223
562 3300049584 Ga0501068_0467825 Ga0501068_0467825_37_795 223
563 3300049591 Ga0501075_0000888 Ga0501075_0000888_8269_9027 223
564 3300049592 Ga0501076_0004337 Ga0501076_0004337_6438_7196 223
565 3300049593 Ga0501077_0112623 Ga0501077_0112623_557_1315 223
566 3300049741 Ga0501079_0033734 Ga0501079_0033734_2939_3697 223
567 3300049741 Ga0501079_0442751 Ga0501079_0442751_25_783 223
568 3300049742 Ga0501080_0021885 Ga0501080_0021885_5004_5762 223
569 3300053136 Ga0500559_0000713 Ga0500559_0000713_19035_19766 223
570 3300053163 Ga0500639_003323 Ga0500639_003323_3441_4172 223
571 3300053735 Ga0500596_025345 Ga0500596_025345_49_780 223
572 3300060353 Ga0501082_0002452 Ga0501082_0002452_6429_7187 223
573 3300061734 Ga0530510_0000505 Ga0530510_0000505_14216_14974 223
574 3300005327 Ga0070658_10240001 Ga0070658_102400011 224
575 3300005328 Ga0070676_10070256 Ga0070676_100702562 224
576 3300005336 Ga0070680_100462462 Ga0070680_1004624621 224
577 3300005339 Ga0070660_100014684 Ga0070660_1000146845 224
578 3300005344 Ga0070661_100022805 Ga0070661_1000228054 224
579 3300005354 Ga0070675_100016993 Ga0070675_1000169937 224
580 3300005364 Ga0070673_100293048 Ga0070673_1002930482 224
581 3300005366 Ga0070659_100018058 Ga0070659_1000180583 224
582 3300005436 Ga0070713_100060627 Ga0070713_1000606274 224
583 3300005439 Ga0070711_100019255 Ga0070711_1000192552 224
584 3300005455 Ga0070663_100049929 Ga0070663_1000499292 224
585 3300005456 Ga0070678_100511482 Ga0070678_1005114821 224
586 3300005457 Ga0070662_100000154 Ga0070662_10000015440 224
587 3300005539 Ga0068853_100001874 Ga0068853_1000018747 224
588 3300005543 Ga0070672_100053393 Ga0070672_1000533932 224
589 3300005563 Ga0068855_100013724 Ga0068855_10001372412 224
590 3300005564 Ga0070664_100001161 Ga0070664_1000011617 224
591 3300005577 Ga0068857_100162097 Ga0068857_1001620972 224
592 3300005614 Ga0068856_100001030 Ga0068856_10000103012 224
593 3300005616 Ga0068852_100115565 Ga0068852_1001155652 224
594 3300005981 Ga0081538_10032378 Ga0081538_100323782 224
595 3300006042 Ga0075368_10004558 Ga0075368_100045582 224
596 3300006048 Ga0075363_100011478 Ga0075363_1000114783 224
597 3300006175 Ga0070712_100424356 Ga0070712_1004243561 224
598 3300006177 Ga0075362_10019441 Ga0075362_100194413 224
599 3300006186 Ga0075369_10031432 Ga0075369_100314323 224
600 3300006195 Ga0075366_10064747 Ga0075366_100647472 224
601 3300006237 Ga0097621_100395864 Ga0097621_1003958641 224
602 3300006353 Ga0075370_10059447 Ga0075370_100594472 224
603 3300006871 Ga0075434_100126572 Ga0075434_1001265723 224
604 3300009098 Ga0105245_10514782 Ga0105245_105147822 224
605 3300013102 Ga0157371_10000313 Ga0157371_1000031347 224
606 3300013105 Ga0157369_10064420 Ga0157369_100644203 224
607 3300013105 Ga0157369_10124870 Ga0157369_101248702 224
608 3300013307 Ga0157372_10001513 Ga0157372_1000151313 224
609 3300013307 Ga0157372_10123333 Ga0157372_101233332 224
610 3300025907 Ga0207645_10069412 Ga0207645_100694122 224
611 3300025912 Ga0207707_10505514 Ga0207707_105055142 224
612 3300025915 Ga0207693_10044259 Ga0207693_100442593 224
613 3300025917 Ga0207660_10345289 Ga0207660_103452892 224
614 3300025917 Ga0207660_10526790 Ga0207660_105267902 224
615 3300025919 Ga0207657_10000410 Ga0207657_1000041022 224
616 3300025919 Ga0207657_10039462 Ga0207657_100394623 224
617 3300025921 Ga0207652_10513397 Ga0207652_105133972 224
618 3300025923 Ga0207681_10016556 Ga0207681_100165563 224
619 3300025932 Ga0207690_10000529 Ga0207690_100005294 224
620 3300025933 Ga0207706_10000508 Ga0207706_100005089 224
621 3300025949 Ga0207667_10002513 Ga0207667_100025133 224
622 3300025960 Ga0207651_10047078 Ga0207651_100470783 224
623 3300026041 Ga0207639_10001750 Ga0207639_1000175010 224
624 3300026067 Ga0207678_10009569 Ga0207678_100095697 224
625 3300026078 Ga0207702_10001424 Ga0207702_1000142420 224
626 3300026121 Ga0207683_10378275 Ga0207683_103782751 224
627 3300026142 Ga0207698_10133231 Ga0207698_101332312 224
628 3300031548 Ga0307408_100095977 Ga0307408_1000959772 224
629 3300037418 Ga0395900_0113344 Ga0395900_0113344_1922_2674 224
630 3300037466 Ga0395898_0086534 Ga0395898_0086534_2166_2918 224
631 3300037471 Ga0395905_0029515 Ga0395905_0029515_1599_2333 224
632 3300037471 Ga0395905_0426126 Ga0395905_0426126_48_800 224
633 3300038443 Ga0395901_0014698 Ga0395901_0014698_5424_6176 224
634 3300038443 Ga0395901_0236141 Ga0395901_0236141_1101_1835 224
635 3300046460 Ga0495638_0024282 Ga0495638_0024282_3213_3944 224
636 3300048905 Ga0496102_0352992 Ga0496102_0352992_557_1315 224
637 3300048906 Ga0496103_0056759 Ga0496103_0056759_1327_2085 224
638 3300048909 Ga0496106_0055829 Ga0496106_0055829_568_1326 224
639 3300048910 Ga0496107_0017191 Ga0496107_0017191_1671_2429 224
640 3300048929 Ga0496126_0502783 Ga0496126_0502783_171_902 224
641 3300049575 Ga0501039_0293293 Ga0501039_0293293_246_995 224
642 3300049576 Ga0501040_0245761 Ga0501040_0245761_461_1210 224
643 3300049586 Ga0501070_0026870 Ga0501070_0026870_1901_2644 224
644 3300049590 Ga0501074_0354922 Ga0501074_0354922_72_815 224
645 3300049591 Ga0501075_0478499 Ga0501075_0478499_37_786 224
646 3300049742 Ga0501080_0078566 Ga0501080_0078566_243_986 224
647 3300050490 nmdc:mga03n38_43181_c1 nmdc:mga03n38_43181_c1_53_796 224
648 3300050492 nmdc:mga0yw44_20053_c1 nmdc:mga0yw44_20053_c1_2293_3036 224
649 3300050493 nmdc:mga0k408_94375_c1 nmdc:mga0k408_94375_c1_958_1701 224
650 3300050494 nmdc:mga06z11_30650_c1 nmdc:mga06z11_30650_c1_668_1411 224
651 3300050495 nmdc:mga04h51_22772_c1 nmdc:mga04h51_22772_c1_1105_1848 224
652 3300050496 nmdc:mga07m45_204217_c1 nmdc:mga07m45_204217_c1_270_1013 224
653 3300050516 nmdc:mga0sz30_116923_c1 nmdc:mga0sz30_116923_c1_359_1102 224
654 3300053130 Ga0500642_0000038 Ga0500642_0000038_31570_32301 224
655 3300054114 Ga0501084_0118577 Ga0501084_0118577_367_1116 224
656 3300059493 Ga0587077_000034 Ga0587077_000034_3580_4314 224
657 3300059623 Ga0587101_022402 Ga0587101_022402_148_882 224
658 3300059645 Ga0587076_021814 Ga0587076_021814_239_973 224
659 3300059646 Ga0587078_012541 Ga0587078_012541_77_811 224
660 3300059647 Ga0587079_065523 Ga0587079_065523_44_778 224
661 3300059649 Ga0587102_005692 Ga0587102_005692_151_885 224
662 iso_pu_bacteria 2511231003 2511250731 224
663 iso_pu_bacteria 2513237094 2513645007 224
664 iso_pu_bacteria 2874628541 2874630784 224
665 iso_pu_bacteria 2932794094 2932798702 224
666 iso_pu_bacteria 2932801729 2932806603 224
667 iso_pu_bacteria 2935883170 2935889432 224
668 iso_pu_bacteria 2935959822 2935964754 224
669 iso_pu_bacteria 8019678201 8019678458 224
670 3300003911 JGI25405J52794_10005134 JGI25405J52794_100051343 225
671 3300005328 Ga0070676_10068294 Ga0070676_100682942 225
672 3300005937 Ga0081455_10064985 Ga0081455_100649853 225
673 3300005981 Ga0081538_10037147 Ga0081538_100371472 225
674 3300005983 Ga0081540_1016874 Ga0081540_10168743 225
675 3300006871 Ga0075434_100418849 Ga0075434_1004188491 225
676 3300021361 Ga0213872_10066318 Ga0213872_100663182 225
677 3300026041 Ga0207639_10504502 Ga0207639_105045022 225
678 3300031548 Ga0307408_100570158 Ga0307408_1005701582 225
679 3300031901 Ga0307406_10057929 Ga0307406_100579293 225
680 3300039447 Ga0436361_0102464 Ga0436361_0102464_9767_10516 225
681 3300048905 Ga0496102_0424906 Ga0496102_0424906_488_1219 225
682 3300049573 Ga0501037_0063017 Ga0501037_0063017_455_1213 225
683 3300049576 Ga0501040_0040726 Ga0501040_0040726_2108_2866 225
684 3300049577 Ga0501041_0072591 Ga0501041_0072591_1085_1843 225
685 3300049579 Ga0501043_0088181 Ga0501043_0088181_96_854 225
686 3300049582 Ga0501048_0093477 Ga0501048_0093477_962_1720 225
687 3300049584 Ga0501068_0043517 Ga0501068_0043517_1318_2076 225
688 3300049588 Ga0501072_0294013 Ga0501072_0294013_252_1010 225
689 3300049591 Ga0501075_0007178 Ga0501075_0007178_6227_6985 225
690 3300049592 Ga0501076_0033611 Ga0501076_0033611_697_1455 225
691 3300049741 Ga0501079_0004666 Ga0501079_0004666_3251_4009 225
692 3300049742 Ga0501080_0032138 Ga0501080_0032138_682_1440 225
693 3300049743 Ga0501081_0007011 Ga0501081_0007011_5906_6664 225
694 3300049744 Ga0501083_0218532 Ga0501083_0218532_463_1221 225
695 3300049822 Ga0501035_0194833 Ga0501035_0194833_949_1707 225
696 3300049824 Ga0501045_0023900 Ga0501045_0023900_3298_4056 225
697 3300050489 nmdc:mga03683_159155_c1 nmdc:mga03683_159155_c1_120_872 225
698 3300050509 nmdc:mga0qj67_76254_c1 nmdc:mga0qj67_76254_c1_1611_2363 225
699 3300050512 nmdc:mga0n895_154932_c1 nmdc:mga0n895_154932_c1_113_865 225
700 3300054114 Ga0501084_0093182 Ga0501084_0093182_1333_2091 225
701 3300005615 Ga0070702_100052076 Ga0070702_1000520762 226
702 3300006237 Ga0097621_100079020 Ga0097621_1000790203 226
703 3300009148 Ga0105243_10327102 Ga0105243_103271022 226
704 3300014326 Ga0157380_10382035 Ga0157380_103820352 226
705 3300014969 Ga0157376_10071388 Ga0157376_100713882 226
706 3300025961 Ga0207712_10750139 Ga0207712_107501391 226
707 3300026121 Ga0207683_10070273 Ga0207683_100702734 226
708 3300035695 Ga0373927_0057205 Ga0373927_0057205_1462_2193 226
709 3300046507 Ga0495606_0210620 Ga0495606_0210620_331_1062 226
710 3300046660 Ga0495625_0098906 Ga0495625_0098906_738_1469 226
711 3300048929 Ga0496126_0021091 Ga0496126_0021091_3977_4708 226
712 3300049576 Ga0501040_0000697 Ga0501040_0000697_14174_14893 226
713 3300049578 Ga0501042_0000118 Ga0501042_0000118_3347_4066 226
714 3300049578 Ga0501042_0089744 Ga0501042_0089744_519_1238 226
715 3300050513 nmdc:mga0rr50_360500_c1 nmdc:mga0rr50_360500_c1_134_892 226
716 3300053077 Ga0495601_0082177 Ga0495601_0082177_177_908 226
717 iso_pu_bacteria 2511231003 2511250945 226
718 iso_pu_bacteria 2548876994 2550696944 226
719 iso_pu_bacteria 2884811622 2884811726 226
720 iso_pu_bacteria 2884836552 2884841019 226
721 iso_pu_bacteria 2884852848 2884857385 226
722 iso_pu_bacteria 2896154374 2896158325 226
723 3300001979 JGI24740J21852_10009976 JGI24740J21852_100099763 227
724 3300005563 Ga0068855_100076515 Ga0068855_1000765152 227
725 3300006942 Ga0099824_1036663 Ga0099824_10366632 227
726 3300021320 Ga0214544_1026121 Ga0214544_10261212 227
727 3300021321 Ga0214542_1027283 Ga0214542_10272832 227
728 3300021324 Ga0214545_1019663 Ga0214545_10196639 227
729 3300021327 Ga0214543_1019719 Ga0214543_10197192 227
730 3300025914 Ga0207671_10144036 Ga0207671_101440362 227
731 3300037466 Ga0395898_0095681 Ga0395898_0095681_1161_1910 227
732 3300037471 Ga0395905_0324779 Ga0395905_0324779_402_1151 227
733 3300038443 Ga0395901_0163626 Ga0395901_0163626_1183_1932 227
734 3300039447 Ga0436361_0498744 Ga0436361_0498744_8589_9365 227
735 3300045049 Ga0466959_0217757 Ga0466959_0217757_98_829 227
736 3300047317 Ga0495604_0402478 Ga0495604_0402478_37_768 227
737 3300003354 JGI25160J50197_1000092 JGI25160J50197_100009241 228
738 3300003374 JGI25161J50226_1000069 JGI25161J50226_100006955 228
739 3300003374 JGI25161J50226_1014814 JGI25161J50226_10148141 228
740 3300004625 Ga0055543_1000131 Ga0055543_100013154 228
741 3300004625 Ga0055543_1006488 Ga0055543_10064884 228
742 3300005262 Ga0065165_1000054 Ga0065165_100005440 228
743 3300005262 Ga0065165_1000369 Ga0065165_100036941 228
744 3300005336 Ga0070680_100143235 Ga0070680_1001432352 228
745 3300005343 Ga0070687_100029279 Ga0070687_1000292792 228
746 3300005364 Ga0070673_100614225 Ga0070673_1006142252 228
747 3300005458 Ga0070681_10015986 Ga0070681_100159863 228
748 3300005530 Ga0070679_100008440 Ga0070679_1000084402 228
749 3300005563 Ga0068855_100363999 Ga0068855_1003639992 228
750 3300005616 Ga0068852_100876833 Ga0068852_1008768331 228
751 3300006353 Ga0075370_10113754 Ga0075370_101137542 228
752 3300007265 Ga0099794_10074622 Ga0099794_100746223 228
753 3300009177 Ga0105248_10568230 Ga0105248_105682301 228
754 3300009551 Ga0105238_10202979 Ga0105238_102029792 228
755 3300010159 Ga0099796_10002520 Ga0099796_100025203 228
756 3300010375 Ga0105239_10248442 Ga0105239_102484422 228
757 3300013104 Ga0157370_10008939 Ga0157370_100089398 228
758 3300021361 Ga0213872_10069702 Ga0213872_100697022 228
759 3300025284 Ga0209130_1000122 Ga0209130_100012294 228
760 3300025302 Ga0207426_1000083 Ga0207426_1000083212 228
761 3300025912 Ga0207707_10034261 Ga0207707_100342612 228
762 3300025914 Ga0207671_10120548 Ga0207671_101205483 228
763 3300025918 Ga0207662_10124444 Ga0207662_101244441 228
764 3300025921 Ga0207652_10006466 Ga0207652_1000646610 228
765 3300031727 Ga0316576_10077416 Ga0316576_100774162 228
766 3300032126 Ga0307415_100059947 Ga0307415_1000599473 228
767 3300035083 Ga0373926_0057320 Ga0373926_0057320_153_875 228
768 3300035398 Ga0316574_0129881 Ga0316574_0129881_675_1397 228
769 3300036712 Ga0316584_0051940 Ga0316584_0051940_1744_2466 228
770 3300039437 Ga0436365_1865479 Ga0436365_1865479_488_1210 228
771 3300039447 Ga0436361_0760753 Ga0436361_0760753_1984_2721 228
772 3300044842 Ga0466957_0323537 Ga0466957_0323537_302_1018 228
773 3300046471 Ga0495650_0048226 Ga0495650_0048226_700_1416 228
774 3300046501 Ga0495607_0000026 Ga0495607_0000026_69587_70306 228
775 3300046506 Ga0495583_0000989 Ga0495583_0000989_10500_11249 228
776 3300046520 Ga0495637_0011639 Ga0495637_0011639_3444_4211 228
777 3300048924 Ga0496121_0031853 Ga0496121_0031853_2761_3483 228
778 3300048925 Ga0496122_0092642 Ga0496122_0092642_242_973 228
779 3300048927 Ga0496124_0040925 Ga0496124_0040925_1477_2208 228
780 3300048928 Ga0496125_0208156 Ga0496125_0208156_183_905 228
781 3300048929 Ga0496126_0016969 Ga0496126_0016969_909_1640 228
782 3300053094 Ga0500566_0000809 Ga0500566_0000809_14486_15202 228
783 3300053125 Ga0500618_003890 Ga0500618_003890_357_1133 228
784 3300054114 Ga0501084_0014644 Ga0501084_0014644_693_1424 228
785 iso_pu_bacteria 3003665799 3003667218 228
786 3300002773 JGI25152J39213_1020960 JGI25152J39213_10209602 229
787 3300025245 Ga0207425_1000354 Ga0207425_100035426 229
788 3300025258 Ga0209129_1002425 Ga0209129_10024259 229
789 3300047323 Ga0495683_0000033 Ga0495683_0000033_147918_148685 229
790 3300047469 Ga0495673_0000525 Ga0495673_0000525_30496_31263 229
791 3300053125 Ga0500618_013924 Ga0500618_013924_758_1600 229
792 iso_pu_bacteria 2507262055 2507512057 229
793 iso_pu_bacteria 2508501009 2508545718 229
794 iso_pu_bacteria 2508501042 2508694541 229
795 iso_pu_bacteria 2508501128 2509151270 229
796 iso_pu_bacteria 2511231028 2511401146 229
797 iso_pu_bacteria 2513237087 2513590909 229
798 iso_pu_bacteria 2513237092 2513624546 229
799 iso_pu_bacteria 2513237094 2513638593 229
800 iso_pu_bacteria 2513237095 2513650024 229
801 iso_pu_bacteria 2513237096 2513655520 229
802 iso_pu_bacteria 2513237098 2513678481 229
803 iso_pu_bacteria 2513237101 2513697487 229
804 iso_pu_bacteria 2513237102 2513704171 229
805 iso_pu_bacteria 2513237104 2513720175 229
806 iso_pu_bacteria 2513237137 2513859795 229
807 iso_pu_bacteria 2513237139 2513874309 229
808 iso_pu_bacteria 2513237141 2513892335 229
809 iso_pu_bacteria 2513237145 2513916402 229
810 iso_pu_bacteria 2513237161 2514016801 229
811 iso_pu_bacteria 2515154112 2515624529 229
812 iso_pu_bacteria 2517093001 2517104542 229
813 iso_pu_bacteria 2517572143 2517889985 229
814 iso_pu_bacteria 2524023205 2524438501 229
815 iso_pu_bacteria 2524023210 2524466285 229
816 iso_pu_bacteria 2524023228 2524534971 229
817 iso_pu_bacteria 2528768022 2528850202 229
818 iso_pu_bacteria 2545555834 2545679226 229
819 iso_pu_bacteria 2595698237 2596374090 229
820 iso_pu_bacteria 2602042107 2603860600 229
821 iso_pu_bacteria 2617270735 2617353160 229
822 iso_pu_bacteria 2617270741 2617374515 229
823 iso_pu_bacteria 2643221623 2644131912 229
824 iso_pu_bacteria 2721755755 2723842624 229
825 iso_pu_bacteria 2738541281 2738744860 229
826 iso_pu_bacteria 2738543032 2739354090 229
827 iso_pu_bacteria 2744054633 2745077278 229
828 iso_pu_bacteria 2791355196 2793059447 229
829 iso_pu_bacteria 2791355197 2793068047 229
830 iso_pu_bacteria 2791355199 2793080511 229
831 iso_pu_bacteria 2802429603 2805916075 229
832 iso_pu_bacteria 2816332527 2818242989 229
833 iso_pu_bacteria 2824600985 2824604467 229
834 iso_pu_bacteria 2824609381 2824614992 229
835 iso_pu_bacteria 2824617872 2824624296 229
836 iso_pu_bacteria 2824626560 2824633069 229
837 iso_pu_bacteria 2824635225 2824640659 229
838 iso_pu_bacteria 2824644064 2824650122 229
839 iso_pu_bacteria 2824653114 2824657485 229
840 iso_pu_bacteria 2824661429 2824665170 229
841 iso_pu_bacteria 2824671348 2824674022 229
842 iso_pu_bacteria 2824679649 2824680216 229
843 iso_pu_bacteria 2824687955 2824691235 229
844 iso_pu_bacteria 2824696289 2824700924 229
845 iso_pu_bacteria 2824704595 2824709733 229
846 iso_pu_bacteria 2824714736 2824720020 229
847 iso_pu_bacteria 2824723954 2824728148 229
848 iso_pu_bacteria 2824732956 2824736147 229
849 iso_pu_bacteria 2824746037 2824748023 229
850 iso_pu_bacteria 2824753945 2824759310 229
851 iso_pu_bacteria 2824763712 2824768574 229
852 iso_pu_bacteria 2824773399 2824778295 229
853 iso_pu_bacteria 2829745981 2829747099 229
854 iso_pu_bacteria 2838122688 2838128578 229
855 iso_pu_bacteria 2841941048 2841942434 229
856 iso_pu_bacteria 2841949485 2841952058 229
857 iso_pu_bacteria 2841949485 2841953220 229
858 iso_pu_bacteria 2841957949 2841960750 229
859 iso_pu_bacteria 2841966195 2841973891 229
860 iso_pu_bacteria 2841974524 2841982956 229
861 iso_pu_bacteria 2841983080 2841984451 229
862 iso_pu_bacteria 2842038055 2842041826 229
863 iso_pu_bacteria 2842045827 2842049868 229
864 iso_pu_bacteria 2842698319 2842699189 229
865 iso_pu_bacteria 2844315083 2844321285 229
866 iso_pu_bacteria 2847930680 2847932124 229
867 iso_pu_bacteria 2847939898 2847943355 229
868 iso_pu_bacteria 2849076700 2849077079 229
869 iso_pu_bacteria 2857509624 2857514628 229
870 iso_pu_bacteria 2861691609 2861694356 229
871 iso_pu_bacteria 2874590934 2874595762 229
872 iso_pu_bacteria 2874604998 2874606690 229
873 iso_pu_bacteria 2874612657 2874614964 229
874 iso_pu_bacteria 2874620515 2874624185 229
875 iso_pu_bacteria 2874628541 2874630361 229
876 iso_pu_bacteria 2874645413 2874651606 229
877 iso_pu_bacteria 2876761206 2876767611 229
878 iso_pu_bacteria 2876771140 2876775959 229
879 iso_pu_bacteria 2876818435 2876821167 229
880 iso_pu_bacteria 2879074833 2879080048 229
881 iso_pu_bacteria 2879083081 2879083521 229
882 iso_pu_bacteria 2879099564 2879106476 229
883 iso_pu_bacteria 2879110137 2879111960 229
884 iso_pu_bacteria 2879127579 2879132724 229
885 iso_pu_bacteria 2879142872 2879146509 229
886 iso_pu_bacteria 2881364244 2881367559 229
887 iso_pu_bacteria 2881665667 2881669272 229
888 iso_pu_bacteria 2885366525 2885369717 229
889 iso_pu_bacteria 2885366525 2885374557 229
890 iso_pu_bacteria 2885374607 2885378685 229
891 iso_pu_bacteria 2885383462 2885392400 229
892 iso_pu_bacteria 2885409591 2885417343 229
893 iso_pu_bacteria 2888378607 2888387583 229
894 iso_pu_bacteria 2888388044 2888391621 229
895 iso_pu_bacteria 2888419890 2888426803 229
896 iso_pu_bacteria 2889033259 2889034086 229
897 iso_pu_bacteria 2889306138 2889311533 229
898 iso_pu_bacteria 2895511927 2895513629 229
899 iso_pu_bacteria 2902330777 2902334062 229
900 iso_pu_bacteria 2902405164 2902411842 229
901 iso_pu_bacteria 2903727486 2903731524 229
902 iso_pu_bacteria 2903748898 2903751784 229
903 iso_pu_bacteria 2904666416 2904670896 229
904 iso_pu_bacteria 2904690495 2904697692 229
905 iso_pu_bacteria 2904699407 2904711031 229
906 iso_pu_bacteria 2904711408 2904713491 229
907 iso_pu_bacteria 2906602504 2906607899 229
908 iso_pu_bacteria 2906610324 2906612260 229
909 iso_pu_bacteria 2906626472 2906633118 229
910 iso_pu_bacteria 2906635258 2906638397 229
911 iso_pu_bacteria 2906643746 2906645694 229
912 iso_pu_bacteria 2906660503 2906663318 229
913 iso_pu_bacteria 2908739725 2908740207 229
914 iso_pu_bacteria 2908756301 2908757798 229
915 iso_pu_bacteria 2908775508 2908776994 229
916 iso_pu_bacteria 2922361189 2922367487 229
917 iso_pu_bacteria 2922368715 2922376560 229
918 iso_pu_bacteria 2922386360 2922391463 229
919 iso_pu_bacteria 2922393267 2922393388 229
920 iso_pu_bacteria 2922425934 2922427042 229
921 iso_pu_bacteria 2928125067 2928130094 229
922 iso_pu_bacteria 2929615660 2929619939 229
923 iso_pu_bacteria 2929624759 2929629251 229
924 iso_pu_bacteria 2932784394 2932789623 229
925 iso_pu_bacteria 2932794094 2932796702 229
926 iso_pu_bacteria 2932801729 2932802516 229
927 iso_pu_bacteria 2932809354 2932814871 229
928 iso_pu_bacteria 2932818245 2932824272 229
929 iso_pu_bacteria 2932828146 2932834000 229
930 iso_pu_bacteria 2933577622 2933581857 229
931 iso_pu_bacteria 2935608549 2935613300 229
932 iso_pu_bacteria 2935616580 2935623610 229
933 iso_pu_bacteria 2935630451 2935633187 229
934 iso_pu_bacteria 2935638405 2935644997 229
935 iso_pu_bacteria 2935648319 2935653826 229
936 iso_pu_bacteria 2935656913 2935662575 229
937 iso_pu_bacteria 2935665750 2935672046 229
938 iso_pu_bacteria 2935675223 2935683028 229
939 iso_pu_bacteria 2935684952 2935689198 229
940 iso_pu_bacteria 2935694250 2935697544 229
941 iso_pu_bacteria 2935703347 2935711121 229
942 iso_pu_bacteria 2935713505 2935720144 229
943 iso_pu_bacteria 2935722832 2935728239 229
944 iso_pu_bacteria 2935732158 2935737164 229
945 iso_pu_bacteria 2935741537 2935746775 229
946 iso_pu_bacteria 2935750917 2935757742 229
947 iso_pu_bacteria 2935760218 2935764122 229
948 iso_pu_bacteria 2935769743 2935776405 229
949 iso_pu_bacteria 2935777560 2935784334 229
950 iso_pu_bacteria 2935785616 2935792370 229
951 iso_pu_bacteria 2935793552 2935800533 229
952 iso_pu_bacteria 2935801545 2935808710 229
953 iso_pu_bacteria 2935810662 2935817506 229
954 iso_pu_bacteria 2935819856 2935824846 229
955 iso_pu_bacteria 2935827899 2935834157 229
956 iso_pu_bacteria 2935837841 2935844759 229
957 iso_pu_bacteria 2935847175 2935852066 229
958 iso_pu_bacteria 2935855204 2935861783 229
959 iso_pu_bacteria 2935864058 2935868581 229
960 iso_pu_bacteria 2935873716 2935879355 229
961 iso_pu_bacteria 2935883170 2935887043 229
962 iso_pu_bacteria 2935908558 2935911413 229
963 iso_pu_bacteria 2935916978 2935920947 229
964 iso_pu_bacteria 2935926038 2935928442 229
965 iso_pu_bacteria 2935934488 2935938087 229
966 iso_pu_bacteria 2935942939 2935945369 229
967 iso_pu_bacteria 2935951376 2935954125 229
968 iso_pu_bacteria 2935967501 2935971607 229
969 iso_pu_bacteria 2935975950 2935980010 229
970 iso_pu_bacteria 2935984226 2935989436 229
971 iso_pu_bacteria 2935992306 2935998477 229
972 iso_pu_bacteria 2936002035 2936009062 229
973 iso_pu_bacteria 2936011229 2936016777 229
974 iso_pu_bacteria 2936019824 2936025410 229
975 iso_pu_bacteria 2936028420 2936034352 229
976 iso_pu_bacteria 2936037263 2936044303 229
977 iso_pu_bacteria 2936046547 2936052409 229
978 iso_pu_bacteria 2936055302 2936060691 229
979 iso_pu_bacteria 2940556831 2940563436 229
980 iso_pu_bacteria 2941507105 2941509511 229
981 iso_pu_bacteria 2941515067 2941517340 229
982 iso_pu_bacteria 2941523033 2941526707 229
983 iso_pu_bacteria 2941531003 2941531865 229
984 iso_pu_bacteria 2941538514 2941545346 229
985 iso_pu_bacteria 3005474847 3005476222 229
986 iso_pu_bacteria 3005483717 3005485851 229
987 iso_pu_bacteria 3005506211 3005506716 229
988 iso_pu_bacteria 3005587118 3005588842 229
989 iso_pu_bacteria 3005594810 3005601622 229
990 iso_pu_bacteria 3005710791 3005717357 229
991 iso_pu_bacteria 3005718088 3005724316 229
992 iso_pu_bacteria 641522639 641644684 229
993 iso_pu_bacteria 643348564 643602123 229
994 iso_pu_bacteria 8006933436 8006937525 229
995 iso_pu_bacteria 8006964411 8006965930 229
996 iso_pu_bacteria 8006973647 8006977553 229
997 iso_pu_bacteria 8006984368 8006989951 229
998 iso_pu_bacteria 8006994254 8006998288 229
999 iso_pu_bacteria 8016511872 8016519277 229
1000 iso_pu_bacteria 8016522445 8016525061 229
1001 iso_pu_bacteria 8016539877 8016542927 229
1002 iso_pu_bacteria 8016548790 8016550364 229
1003 iso_pu_bacteria 8016557553 8016558774 229
1004 iso_pu_bacteria 8016566248 8016568320 229
1005 iso_pu_bacteria 8016583857 8016587765 229
1006 iso_pu_bacteria 8016613128 8016619428 229
1007 iso_pu_bacteria 8016622563 8016630177 229
1008 iso_pu_bacteria 8016630954 8016636987 229
1009 iso_pu_bacteria 8017057580 8017066235 229
1010 iso_pu_bacteria 8019547302 8019549116 229
1011 iso_pu_bacteria 8019565922 8019571169 229
1012 iso_pu_bacteria 8019576017 8019578389 229
1013 iso_pu_bacteria 8019586578 8019596427 229
1014 iso_pu_bacteria 8019597564 8019605274 229
1015 iso_pu_bacteria 8019608314 8019613274 229
1016 iso_pu_bacteria 8019619141 8019623945 229
1017 iso_pu_bacteria 8019629233 8019638091 229
1018 iso_pu_bacteria 8019638758 8019641546 229
1019 iso_pu_bacteria 8019648815 8019653459 229
1020 iso_pu_bacteria 8019659431 8019666009 229
1021 iso_pu_bacteria 8019668869 8019675527 229
1022 iso_pu_bacteria 8019678201 8019680571 229
1023 iso_pu_bacteria 8019687851 8019695186 229
1024 iso_pu_bacteria 8055742211 8055750309 229
1025 iso_pu_bacteria 8056673599 8056677909 229
1026 iso_pu_bacteria 8056681323 8056686017 229
1027 iso_pu_bacteria 8056689827 8056694794 229
1028 iso_pu_bacteria 8056967851 8056976084 229
1029 3300002704 JGI25155J39150_1000361 JGI25155J39150_10003617 230
1030 3300002705 JGI25156J39149_1002023 JGI25156J39149_10020237 230
1031 3300002738 JGI25154J39366_1000370 JGI25154J39366_100037024 230
1032 3300005331 Ga0070670_100010833 Ga0070670_1000108338 230
1033 3300005539 Ga0068853_100160058 Ga0068853_1001600583 230
1034 3300005563 Ga0068855_100110159 Ga0068855_1001101596 230
1035 3300009011 Ga0105251_10161385 Ga0105251_101613851 230
1036 3300009093 Ga0105240_10001180 Ga0105240_1000118021 230
1037 3300009093 Ga0105240_10008737 Ga0105240_100087379 230
1038 3300009551 Ga0105238_10042461 Ga0105238_100424614 230
1039 3300013100 Ga0157373_10197884 Ga0157373_101978842 230
1040 3300014497 Ga0182008_10049953 Ga0182008_100499533 230
1041 3300015261 Ga0182006_1015766 Ga0182006_10157662 230
1042 3300025206 Ga0209435_100375 Ga0209435_1003757 230
1043 3300025233 Ga0209437_100307 Ga0209437_10030741 230
1044 3300025246 Ga0209646_1000143 Ga0209646_100014353 230
1045 3300025250 Ga0209026_1000629 Ga0209026_100062917 230
1046 3300025256 Ga0209759_1000343 Ga0209759_100034332 230
1047 3300025913 Ga0207695_10001159 Ga0207695_1000115921 230
1048 3300025913 Ga0207695_10008797 Ga0207695_100087979 230
1049 3300025925 Ga0207650_10023150 Ga0207650_100231503 230
1050 3300026041 Ga0207639_10077597 Ga0207639_100775972 230
1051 3300026078 Ga0207702_10202487 Ga0207702_102024872 230
1052 3300037471 Ga0395905_0002724 Ga0395905_0002724_9505_10251 230
1053 3300046660 Ga0495625_0000448 Ga0495625_0000448_35187_35921 230
1054 3300048919 Ga0496116_0003473 Ga0496116_0003473_10778_11512 230
1055 3300048921 Ga0496118_0125772 Ga0496118_0125772_700_1434 230
1056 3300048924 Ga0496121_0010559 Ga0496121_0010559_894_1628 230
1057 3300048924 Ga0496121_0138181 Ga0496121_0138181_519_1253 230
1058 3300048924 Ga0496121_0400699 Ga0496121_0400699_58_792 230
1059 3300048925 Ga0496122_0000471 Ga0496122_0000471_26363_27097 230
1060 3300048926 Ga0496123_0000259 Ga0496123_0000259_57006_57740 230
1061 3300048928 Ga0496125_0001479 Ga0496125_0001479_22888_23622 230
1062 3300048929 Ga0496126_0348534 Ga0496126_0348534_304_1038 230
1063 iso_pu_bacteria 2821443989 2821444199 230
1064 3300005467 Ga0070706_100021130 Ga0070706_1000211303 231
1065 3300028381 Ga0268264_10853454 Ga0268264_108534541 231
1066 iso_pu_bacteria 2738541277 2738718340 231
1067 iso_pu_bacteria 2738543019 2739281527 231
1068 iso_pu_bacteria 2842711865 2842714075 231
1069 iso_pu_bacteria 2857558681 2857562536 231
1070 iso_pu_bacteria 2857576091 2857580044 231
1071 iso_pu_bacteria 2881927736 2881929203 231
1072 iso_pu_bacteria 2904424332 2904430683 231
1073 iso_pu_bacteria 2919476304 2919481329 231
1074 iso_pu_bacteria 2511231003 2511248813 232
1075 iso_pu_bacteria 2511231026 2511385922 232
1076 iso_pu_bacteria 2521172590 2521559780 232
1077 iso_pu_bacteria 2548876994 2550693103 232
1078 iso_pu_bacteria 2551306416 2553006189 232
1079 iso_pu_bacteria 2600255292 2601666793 232
1080 iso_pu_bacteria 2643221554 2643790204 232
1081 iso_pu_bacteria 2643221638 2644215200 232
1082 iso_pu_bacteria 2765235838 2765571035 232
1083 iso_pu_bacteria 2808606386 2808984797 232
1084 iso_pu_bacteria 2808606415 2809128203 232
1085 iso_pu_bacteria 2808606419 2809147824 232
1086 iso_pu_bacteria 2818991445 2819595435 232
1087 iso_pu_bacteria 2818991449 2819616000 232
1088 iso_pu_bacteria 2839094727 2839099271 232
1089 iso_pu_bacteria 2852618963 2852620767 232
1090 iso_pu_bacteria 2857547612 2857548559 232
1091 iso_pu_bacteria 2884811622 2884813096 232
1092 iso_pu_bacteria 2884836552 2884841374 232
1093 iso_pu_bacteria 2884852848 2884856248 232
1094 iso_pu_bacteria 2885080285 2885083245 232
1095 iso_pu_bacteria 2896154374 2896156826 232
1096 iso_pu_bacteria 2904439833 2904443414 232
1097 iso_pu_bacteria 2904530477 2904533124 232
1098 iso_pu_bacteria 2904584206 2904585677 232
1099 iso_pu_bacteria 2904589729 2904594027 232
1100 iso_pu_bacteria 2904601388 2904603818 232
1101 iso_pu_bacteria 2919046199 2919047528 232
1102 iso_pu_bacteria 2919079590 2919081941 232
1103 iso_pu_bacteria 2932410948 2932413154 232
1104 iso_pu_bacteria 2932416698 2932420669 232
1105 3300000549 LJQas_1004228 LJQas_10042282 233
1106 3300002077 JGI24744J21845_10001437 JGI24744J21845_100014373 233
1107 3300003203 JGI25406J46586_10000055 JGI25406J46586_1000005541 233
1108 3300003203 JGI25406J46586_10004826 JGI25406J46586_100048266 233
1109 3300003215 JGI25153J46596_10002315 JGI25153J46596_1000231511 233
1110 3300003215 JGI25153J46596_10013885 JGI25153J46596_100138853 233
1111 3300003215 JGI25153J46596_10016150 JGI25153J46596_100161503 233
1112 3300003354 JGI25160J50197_1002807 JGI25160J50197_10028077 233
1113 3300003659 JGI25404J52841_10025716 JGI25404J52841_100257161 233
1114 3300003659 JGI25404J52841_10026484 JGI25404J52841_100264842 233
1115 3300003752 Ga0055539_1005431 Ga0055539_10054312 233
1116 3300003794 Ga0055531_10009445 Ga0055531_100094452 233
1117 3300003794 Ga0055531_10023954 Ga0055531_100239543 233
1118 3300005262 Ga0065165_1001177 Ga0065165_10011775 233
1119 3300005262 Ga0065165_1021076 Ga0065165_10210762 233
1120 3300005327 Ga0070658_10141682 Ga0070658_101416823 233
1121 3300005328 Ga0070676_10299708 Ga0070676_102997081 233
1122 3300005329 Ga0070683_100001874 Ga0070683_1000018743 233
1123 3300005329 Ga0070683_100003885 Ga0070683_1000038855 233
1124 3300005329 Ga0070683_100042654 Ga0070683_1000426542 233
1125 3300005331 Ga0070670_100380301 Ga0070670_1003803012 233
1126 3300005334 Ga0068869_100136372 Ga0068869_1001363722 233
1127 3300005334 Ga0068869_100178093 Ga0068869_1001780932 233
1128 3300005334 Ga0068869_100261861 Ga0068869_1002618611 233
1129 3300005335 Ga0070666_10216926 Ga0070666_102169262 233
1130 3300005336 Ga0070680_100029444 Ga0070680_1000294444 233
1131 3300005336 Ga0070680_100044693 Ga0070680_1000446932 233
1132 3300005336 Ga0070680_100288492 Ga0070680_1002884922 233
1133 3300005337 Ga0070682_100059731 Ga0070682_1000597313 233
1134 3300005337 Ga0070682_100063938 Ga0070682_1000639383 233
1135 3300005337 Ga0070682_100306991 Ga0070682_1003069912 233
1136 3300005338 Ga0068868_100023745 Ga0068868_1000237455 233
1137 3300005338 Ga0068868_100467690 Ga0068868_1004676901 233
1138 3300005339 Ga0070660_100000725 Ga0070660_10000072523 233
1139 3300005340 Ga0070689_100026934 Ga0070689_1000269343 233
1140 3300005341 Ga0070691_10110834 Ga0070691_101108342 233
1141 3300005341 Ga0070691_10165768 Ga0070691_101657681 233
1142 3300005344 Ga0070661_100261971 Ga0070661_1002619712 233
1143 3300005344 Ga0070661_100302635 Ga0070661_1003026351 233
1144 3300005347 Ga0070668_100090375 Ga0070668_1000903753 233
1145 3300005347 Ga0070668_100300230 Ga0070668_1003002301 233
1146 3300005353 Ga0070669_100042587 Ga0070669_1000425873 233
1147 3300005354 Ga0070675_100457232 Ga0070675_1004572322 233
1148 3300005354 Ga0070675_100513585 Ga0070675_1005135851 233
1149 3300005354 Ga0070675_100596324 Ga0070675_1005963241 233
1150 3300005355 Ga0070671_100626426 Ga0070671_1006264262 233
1151 3300005356 Ga0070674_100227375 Ga0070674_1002273752 233
1152 3300005356 Ga0070674_100346130 Ga0070674_1003461302 233
1153 3300005364 Ga0070673_100186597 Ga0070673_1001865971 233
1154 3300005366 Ga0070659_100069568 Ga0070659_1000695683 233
1155 3300005366 Ga0070659_100090480 Ga0070659_1000904803 233
1156 3300005366 Ga0070659_100860744 Ga0070659_1008607441 233
1157 3300005367 Ga0070667_100362738 Ga0070667_1003627382 233
1158 3300005367 Ga0070667_100462199 Ga0070667_1004621992 233
1159 3300005434 Ga0070709_10001276 Ga0070709_100012762 233
1160 3300005434 Ga0070709_10082232 Ga0070709_100822321 233
1161 3300005435 Ga0070714_100026401 Ga0070714_1000264011 233
1162 3300005436 Ga0070713_100002481 Ga0070713_1000024816 233
1163 3300005436 Ga0070713_100054342 Ga0070713_1000543422 233
1164 3300005437 Ga0070710_10040967 Ga0070710_100409672 233
1165 3300005437 Ga0070710_10073005 Ga0070710_100730052 233
1166 3300005437 Ga0070710_10268452 Ga0070710_102684522 233
1167 3300005438 Ga0070701_10139596 Ga0070701_101395961 233
1168 3300005439 Ga0070711_100007004 Ga0070711_1000070044 233
1169 3300005440 Ga0070705_100158169 Ga0070705_1001581691 233
1170 3300005440 Ga0070705_100353643 Ga0070705_1003536432 233
1171 3300005441 Ga0070700_100051512 Ga0070700_1000515122 233
1172 3300005444 Ga0070694_100248560 Ga0070694_1002485602 233
1173 3300005455 Ga0070663_100192581 Ga0070663_1001925812 233
1174 3300005455 Ga0070663_100225701 Ga0070663_1002257011 233
1175 3300005456 Ga0070678_100014091 Ga0070678_1000140912 233
1176 3300005456 Ga0070678_100081975 Ga0070678_1000819752 233
1177 3300005457 Ga0070662_100058395 Ga0070662_1000583952 233
1178 3300005457 Ga0070662_100138248 Ga0070662_1001382483 233
1179 3300005457 Ga0070662_100211246 Ga0070662_1002112461 233
1180 3300005457 Ga0070662_100246256 Ga0070662_1002462562 233
1181 3300005457 Ga0070662_100337751 Ga0070662_1003377512 233
1182 3300005458 Ga0070681_10021502 Ga0070681_100215027 233
1183 3300005458 Ga0070681_10052696 Ga0070681_100526963 233
1184 3300005458 Ga0070681_10129893 Ga0070681_101298933 233
1185 3300005459 Ga0068867_100061339 Ga0068867_1000613392 233
1186 3300005459 Ga0068867_100134576 Ga0068867_1001345761 233
1187 3300005459 Ga0068867_100587448 Ga0068867_1005874481 233
1188 3300005466 Ga0070685_10182691 Ga0070685_101826911 233
1189 3300005467 Ga0070706_100105723 Ga0070706_1001057232 233
1190 3300005468 Ga0070707_100049533 Ga0070707_1000495333 233
1191 3300005468 Ga0070707_100170353 Ga0070707_1001703532 233
1192 3300005471 Ga0070698_100030131 Ga0070698_1000301315 233
1193 3300005530 Ga0070679_100024275 Ga0070679_1000242755 233
1194 3300005530 Ga0070679_100044049 Ga0070679_1000440494 233
1195 3300005530 Ga0070679_100094608 Ga0070679_1000946082 233
1196 3300005535 Ga0070684_100046721 Ga0070684_1000467212 233
1197 3300005535 Ga0070684_100176999 Ga0070684_1001769993 233
1198 3300005535 Ga0070684_100690126 Ga0070684_1006901261 233
1199 3300005536 Ga0070697_100401147 Ga0070697_1004011472 233
1200 3300005539 Ga0068853_100028199 Ga0068853_1000281992 233
1201 3300005539 Ga0068853_100081524 Ga0068853_1000815242 233
1202 3300005543 Ga0070672_100155219 Ga0070672_1001552192 233
1203 3300005543 Ga0070672_100316656 Ga0070672_1003166561 233
1204 3300005544 Ga0070686_100022186 Ga0070686_1000221864 233
1205 3300005545 Ga0070695_100238139 Ga0070695_1002381391 233
1206 3300005546 Ga0070696_100090121 Ga0070696_1000901212 233
1207 3300005546 Ga0070696_100251474 Ga0070696_1002514742 233
1208 3300005547 Ga0070693_100039644 Ga0070693_1000396444 233
1209 3300005547 Ga0070693_100065627 Ga0070693_1000656272 233
1210 3300005547 Ga0070693_100074709 Ga0070693_1000747092 233
1211 3300005547 Ga0070693_100093243 Ga0070693_1000932432 233
1212 3300005548 Ga0070665_100005999 Ga0070665_10000599913 233
1213 3300005548 Ga0070665_100167139 Ga0070665_1001671392 233
1214 3300005548 Ga0070665_100282628 Ga0070665_1002826282 233
1215 3300005563 Ga0068855_100036468 Ga0068855_1000364685 233
1216 3300005563 Ga0068855_100071740 Ga0068855_1000717404 233
1217 3300005563 Ga0068855_100107846 Ga0068855_1001078464 233
1218 3300005563 Ga0068855_100339198 Ga0068855_1003391982 233
1219 3300005564 Ga0070664_100284511 Ga0070664_1002845112 233
1220 3300005564 Ga0070664_100505068 Ga0070664_1005050682 233
1221 3300005577 Ga0068857_100033556 Ga0068857_1000335564 233
1222 3300005577 Ga0068857_100166767 Ga0068857_1001667673 233
1223 3300005577 Ga0068857_100260980 Ga0068857_1002609801 233
1224 3300005614 Ga0068856_100001092 Ga0068856_1000010922 233
1225 3300005614 Ga0068856_100016942 Ga0068856_1000169424 233
1226 3300005614 Ga0068856_100291474 Ga0068856_1002914742 233
1227 3300005614 Ga0068856_100298408 Ga0068856_1002984081 233
1228 3300005615 Ga0070702_100160574 Ga0070702_1001605742 233
1229 3300005616 Ga0068852_100062643 Ga0068852_1000626432 233
1230 3300005616 Ga0068852_100066412 Ga0068852_1000664122 233
1231 3300005616 Ga0068852_100071661 Ga0068852_1000716614 233
1232 3300005616 Ga0068852_100089737 Ga0068852_1000897373 233
1233 3300005616 Ga0068852_100103481 Ga0068852_1001034812 233
1234 3300005616 Ga0068852_100248392 Ga0068852_1002483922 233
1235 3300005617 Ga0068859_100538161 Ga0068859_1005381612 233
1236 3300005618 Ga0068864_100055636 Ga0068864_1000556364 233
1237 3300005618 Ga0068864_100436688 Ga0068864_1004366882 233
1238 3300005718 Ga0068866_10078269 Ga0068866_100782692 233
1239 3300005718 Ga0068866_10199930 Ga0068866_101999301 233
1240 3300005719 Ga0068861_100087889 Ga0068861_1000878892 233
1241 3300005719 Ga0068861_100116520 Ga0068861_1001165202 233
1242 3300005719 Ga0068861_100165647 Ga0068861_1001656472 233
1243 3300005834 Ga0068851_10026083 Ga0068851_100260833 233
1244 3300005840 Ga0068870_10099514 Ga0068870_100995142 233
1245 3300005840 Ga0068870_10401178 Ga0068870_104011781 233
1246 3300005841 Ga0068863_100067666 Ga0068863_1000676665 233
1247 3300005841 Ga0068863_100749321 Ga0068863_1007493212 233
1248 3300005842 Ga0068858_100164795 Ga0068858_1001647952 233
1249 3300005843 Ga0068860_100000222 Ga0068860_10000022250 233
1250 3300005843 Ga0068860_100288779 Ga0068860_1002887792 233
1251 3300005844 Ga0068862_100480955 Ga0068862_1004809552 233
1252 3300005844 Ga0068862_100927348 Ga0068862_1009273481 233
1253 3300005937 Ga0081455_10004820 Ga0081455_100048204 233
1254 3300005937 Ga0081455_10096044 Ga0081455_100960443 233
1255 3300005937 Ga0081455_10169039 Ga0081455_101690392 233
1256 3300005937 Ga0081455_10452069 Ga0081455_104520691 233
1257 3300005981 Ga0081538_10030420 Ga0081538_100304202 233
1258 3300005983 Ga0081540_1000462 Ga0081540_100046232 233
1259 3300005983 Ga0081540_1000514 Ga0081540_10005143 233
1260 3300005983 Ga0081540_1005105 Ga0081540_100510510 233
1261 3300005983 Ga0081540_1008349 Ga0081540_10083493 233
1262 3300005983 Ga0081540_1018379 Ga0081540_10183792 233
1263 3300005983 Ga0081540_1032930 Ga0081540_10329304 233
1264 3300005983 Ga0081540_1034051 Ga0081540_10340512 233
1265 3300005983 Ga0081540_1043310 Ga0081540_10433102 233
1266 3300005983 Ga0081540_1051530 Ga0081540_10515302 233
1267 3300005985 Ga0081539_10000099 Ga0081539_1000009943 233
1268 3300005985 Ga0081539_10000540 Ga0081539_1000054063 233
1269 3300005985 Ga0081539_10039792 Ga0081539_100397922 233
1270 3300005985 Ga0081539_10093141 Ga0081539_100931412 233
1271 3300006028 Ga0070717_10000329 Ga0070717_1000032918 233
1272 3300006028 Ga0070717_10003491 Ga0070717_100034917 233
1273 3300006028 Ga0070717_10276685 Ga0070717_102766852 233
1274 3300006038 Ga0075365_10014849 Ga0075365_100148492 233
1275 3300006038 Ga0075365_10039350 Ga0075365_100393502 233
1276 3300006038 Ga0075365_10131630 Ga0075365_101316302 233
1277 3300006038 Ga0075365_10275600 Ga0075365_102756001 233
1278 3300006042 Ga0075368_10014412 Ga0075368_100144124 233
1279 3300006042 Ga0075368_10020133 Ga0075368_100201333 233
1280 3300006048 Ga0075363_100102926 Ga0075363_1001029262 233
1281 3300006048 Ga0075363_100159815 Ga0075363_1001598151 233
1282 3300006051 Ga0075364_10063358 Ga0075364_100633581 233
1283 3300006051 Ga0075364_10099783 Ga0075364_100997832 233
1284 3300006163 Ga0070715_10042345 Ga0070715_100423453 233
1285 3300006173 Ga0070716_100004252 Ga0070716_1000042525 233
1286 3300006173 Ga0070716_100088929 Ga0070716_1000889291 233
1287 3300006175 Ga0070712_100088469 Ga0070712_1000884692 233
1288 3300006175 Ga0070712_100224529 Ga0070712_1002245292 233
1289 3300006177 Ga0075362_10015370 Ga0075362_100153704 233
1290 3300006177 Ga0075362_10043878 Ga0075362_100438782 233
1291 3300006177 Ga0075362_10062555 Ga0075362_100625551 233
1292 3300006178 Ga0075367_10027145 Ga0075367_100271454 233
1293 3300006178 Ga0075367_10064356 Ga0075367_100643563 233
1294 3300006178 Ga0075367_10078528 Ga0075367_100785282 233
1295 3300006186 Ga0075369_10032212 Ga0075369_100322123 233
1296 3300006186 Ga0075369_10032487 Ga0075369_100324873 233
1297 3300006186 Ga0075369_10042556 Ga0075369_100425562 233
1298 3300006186 Ga0075369_10076409 Ga0075369_100764092 233
1299 3300006186 Ga0075369_10154411 Ga0075369_101544112 233
1300 3300006195 Ga0075366_10022411 Ga0075366_100224112 233
1301 3300006237 Ga0097621_100169050 Ga0097621_1001690502 233
1302 3300006237 Ga0097621_100590816 Ga0097621_1005908161 233
1303 3300006353 Ga0075370_10003312 Ga0075370_100033124 233
1304 3300006353 Ga0075370_10082078 Ga0075370_100820781 233
1305 3300006353 Ga0075370_10140751 Ga0075370_101407512 233
1306 3300006353 Ga0075370_10378085 Ga0075370_103780851 233
1307 3300006358 Ga0068871_100047370 Ga0068871_1000473704 233
1308 3300006852 Ga0075433_10144738 Ga0075433_101447383 233
1309 3300006852 Ga0075433_10242925 Ga0075433_102429252 233
1310 3300006871 Ga0075434_100337009 Ga0075434_1003370092 233
1311 3300006871 Ga0075434_100617231 Ga0075434_1006172312 233
1312 3300006881 Ga0068865_100141536 Ga0068865_1001415362 233
1313 3300006931 Ga0097620_100538088 Ga0097620_1005380882 233
1314 3300006942 Ga0099824_1015072 Ga0099824_10150727 233
1315 3300006944 Ga0099823_1009032 Ga0099823_10090326 233
1316 3300007788 Ga0099795_10011172 Ga0099795_100111723 233
1317 3300007788 Ga0099795_10047861 Ga0099795_100478612 233
1318 3300009093 Ga0105240_10040108 Ga0105240_100401083 233
1319 3300009093 Ga0105240_10057598 Ga0105240_100575981 233
1320 3300009093 Ga0105240_10192851 Ga0105240_101928512 233
1321 3300009093 Ga0105240_10194410 Ga0105240_101944102 233
1322 3300009093 Ga0105240_10317770 Ga0105240_103177702 233
1323 3300009093 Ga0105240_10464469 Ga0105240_104644692 233
1324 3300009094 Ga0111539_10471264 Ga0111539_104712642 233
1325 3300009098 Ga0105245_10047123 Ga0105245_100471233 233
1326 3300009098 Ga0105245_10137353 Ga0105245_101373532 233
1327 3300009098 Ga0105245_10159099 Ga0105245_101590991 233
1328 3300009098 Ga0105245_10669975 Ga0105245_106699752 233
1329 3300009101 Ga0105247_10189883 Ga0105247_101898832 233
1330 3300009101 Ga0105247_10217726 Ga0105247_102177261 233
1331 3300009148 Ga0105243_10097617 Ga0105243_100976173 233
1332 3300009148 Ga0105243_10413343 Ga0105243_104133432 233
1333 3300009148 Ga0105243_10657352 Ga0105243_106573522 233
1334 3300009174 Ga0105241_10019365 Ga0105241_100193654 233
1335 3300009174 Ga0105241_10058725 Ga0105241_100587253 233
1336 3300009174 Ga0105241_10223960 Ga0105241_102239602 233
1337 3300009174 Ga0105241_10330645 Ga0105241_103306452 233
1338 3300009176 Ga0105242_10246725 Ga0105242_102467252 233
1339 3300009177 Ga0105248_10274177 Ga0105248_102741772 233
1340 3300009177 Ga0105248_10312213 Ga0105248_103122133 233
1341 3300009545 Ga0105237_10009810 Ga0105237_100098107 233
1342 3300009545 Ga0105237_10015336 Ga0105237_100153364 233
1343 3300009545 Ga0105237_10022629 Ga0105237_100226294 233
1344 3300009545 Ga0105237_10263489 Ga0105237_102634892 233
1345 3300009545 Ga0105237_10296450 Ga0105237_102964502 233
1346 3300009545 Ga0105237_10434732 Ga0105237_104347322 233
1347 3300009545 Ga0105237_10676629 Ga0105237_106766291 233
1348 3300009551 Ga0105238_10015729 Ga0105238_100157292 233
1349 3300009551 Ga0105238_10032944 Ga0105238_100329444 233
1350 3300009551 Ga0105238_10070942 Ga0105238_100709423 233
1351 3300009551 Ga0105238_10495914 Ga0105238_104959142 233
1352 3300009553 Ga0105249_10085965 Ga0105249_100859652 233
1353 3300009553 Ga0105249_10834327 Ga0105249_108343272 233
1354 3300010159 Ga0099796_10008928 Ga0099796_100089282 233
1355 3300010159 Ga0099796_10132624 Ga0099796_101326242 233
1356 3300010375 Ga0105239_10012109 Ga0105239_100121096 233
1357 3300010375 Ga0105239_10014050 Ga0105239_100140507 233
1358 3300010375 Ga0105239_10175057 Ga0105239_101750573 233
1359 3300010375 Ga0105239_10325213 Ga0105239_103252132 233
1360 3300010375 Ga0105239_10374367 Ga0105239_103743672 233
1361 3300010375 Ga0105239_10503483 Ga0105239_105034832 233
1362 3300011119 Ga0105246_10012990 Ga0105246_100129904 233
1363 3300011119 Ga0105246_10035445 Ga0105246_100354454 233
1364 3300013104 Ga0157370_10029928 Ga0157370_100299285 233
1365 3300013104 Ga0157370_10192754 Ga0157370_101927542 233
1366 3300013104 Ga0157370_10576303 Ga0157370_105763031 233
1367 3300013105 Ga0157369_10008890 Ga0157369_1000889011 233
1368 3300013105 Ga0157369_10046568 Ga0157369_100465683 233
1369 3300013105 Ga0157369_10329440 Ga0157369_103294402 233
1370 3300013296 Ga0157374_10006868 Ga0157374_100068684 233
1371 3300013296 Ga0157374_10039570 Ga0157374_100395705 233
1372 3300013296 Ga0157374_10540886 Ga0157374_105408861 233
1373 3300013296 Ga0157374_10817208 Ga0157374_108172082 233
1374 3300013297 Ga0157378_10001069 Ga0157378_1000106910 233
1375 3300013297 Ga0157378_10269237 Ga0157378_102692372 233
1376 3300013306 Ga0163162_10010390 Ga0163162_100103904 233
1377 3300013306 Ga0163162_10256925 Ga0163162_102569252 233
1378 3300013306 Ga0163162_10528282 Ga0163162_105282822 233
1379 3300013306 Ga0163162_10657887 Ga0163162_106578872 233
1380 3300013307 Ga0157372_10280050 Ga0157372_102800503 233
1381 3300013307 Ga0157372_10346205 Ga0157372_103462052 233
1382 3300013307 Ga0157372_10479713 Ga0157372_104797132 233
1383 3300013308 Ga0157375_10076221 Ga0157375_100762212 233
1384 3300013308 Ga0157375_10510254 Ga0157375_105102541 233
1385 3300013308 Ga0157375_10575121 Ga0157375_105751212 233
1386 3300013308 Ga0157375_11294954 Ga0157375_112949541 233
1387 3300014325 Ga0163163_10043695 Ga0163163_100436952 233
1388 3300014325 Ga0163163_10253274 Ga0163163_102532743 233
1389 3300014325 Ga0163163_10286580 Ga0163163_102865802 233
1390 3300014325 Ga0163163_10380136 Ga0163163_103801361 233
1391 3300014326 Ga0157380_10039122 Ga0157380_100391224 233
1392 3300014326 Ga0157380_10083378 Ga0157380_100833782 233
1393 3300014497 Ga0182008_10119251 Ga0182008_101192512 233
1394 3300014745 Ga0157377_10179848 Ga0157377_101798482 233
1395 3300014968 Ga0157379_10025051 Ga0157379_100250517 233
1396 3300014968 Ga0157379_10119384 Ga0157379_101193842 233
1397 3300014968 Ga0157379_10127366 Ga0157379_101273662 233
1398 3300014968 Ga0157379_10226579 Ga0157379_102265792 233
1399 3300014968 Ga0157379_10667240 Ga0157379_106672402 233
1400 3300014969 Ga0157376_10049928 Ga0157376_100499283 233
1401 3300014969 Ga0157376_10150526 Ga0157376_101505262 233
1402 3300017792 Ga0163161_10193734 Ga0163161_101937342 233
1403 3300021320 Ga0214544_1000003 Ga0214544_1000003521 233
1404 3300021321 Ga0214542_1000022 Ga0214542_100002291 233
1405 3300021321 Ga0214542_1031454 Ga0214542_10314542 233
1406 3300021324 Ga0214545_1000010 Ga0214545_100001092 233
1407 3300021324 Ga0214545_1035403 Ga0214545_10354032 233
1408 3300021327 Ga0214543_1000035 Ga0214543_100003591 233
1409 3300021327 Ga0214543_1032039 Ga0214543_10320392 233
1410 3300021358 Ga0213873_10003009 Ga0213873_100030093 233
1411 3300021384 Ga0213876_10027632 Ga0213876_100276322 233
1412 3300021441 Ga0213871_10013400 Ga0213871_100134002 233
1413 3300025228 Ga0209672_103669 Ga0209672_1036692 233
1414 3300025242 Ga0209258_103788 Ga0209258_1037883 233
1415 3300025253 Ga0209677_101351 Ga0209677_1013514 233
1416 3300025253 Ga0209677_101442 Ga0209677_1014424 233
1417 3300025272 Ga0209455_1000821 Ga0209455_100082117 233
1418 3300025272 Ga0209455_1009949 Ga0209455_10099493 233
1419 3300025273 Ga0209673_1030651 Ga0209673_10306512 233
1420 3300025292 Ga0209676_1000286 Ga0209676_1000286110 233
1421 3300025295 Ga0209564_1007889 Ga0209564_10078894 233
1422 3300025297 Ga0209758_1000106 Ga0209758_100010686 233
1423 3300025297 Ga0209758_1000344 Ga0209758_100034455 233
1424 3300025297 Ga0209758_1000727 Ga0209758_100072722 233
1425 3300025297 Ga0209758_1001688 Ga0209758_10016889 233
1426 3300025297 Ga0209758_1002307 Ga0209758_10023075 233
1427 3300025297 Ga0209758_1008565 Ga0209758_10085658 233
1428 3300025297 Ga0209758_1009770 Ga0209758_10097705 233
1429 3300025299 Ga0209256_1005569 Ga0209256_10055696 233
1430 3300025302 Ga0207426_1000374 Ga0207426_100037453 233
1431 3300025302 Ga0207426_1000440 Ga0207426_100044028 233
1432 3300025302 Ga0207426_1007090 Ga0207426_10070905 233
1433 3300025321 Ga0207656_10021626 Ga0207656_100216263 233
1434 3300025321 Ga0207656_10030665 Ga0207656_100306651 233
1435 3300025321 Ga0207656_10059774 Ga0207656_100597742 233
1436 3300025321 Ga0207656_10223699 Ga0207656_102236991 233
1437 3300025893 Ga0207682_10051739 Ga0207682_100517392 233
1438 3300025893 Ga0207682_10129362 Ga0207682_101293622 233
1439 3300025898 Ga0207692_10002984 Ga0207692_100029845 233
1440 3300025898 Ga0207692_10015463 Ga0207692_100154634 233
1441 3300025898 Ga0207692_10149598 Ga0207692_101495982 233
1442 3300025901 Ga0207688_10045907 Ga0207688_100459072 233
1443 3300025901 Ga0207688_10090797 Ga0207688_100907972 233
1444 3300025904 Ga0207647_10050472 Ga0207647_100504723 233
1445 3300025905 Ga0207685_10156310 Ga0207685_101563101 233
1446 3300025906 Ga0207699_10012272 Ga0207699_100122723 233
1447 3300025906 Ga0207699_10084388 Ga0207699_100843882 233
1448 3300025907 Ga0207645_10106716 Ga0207645_101067162 233
1449 3300025908 Ga0207643_10030888 Ga0207643_100308883 233
1450 3300025908 Ga0207643_10094100 Ga0207643_100941003 233
1451 3300025909 Ga0207705_10030592 Ga0207705_100305923 233
1452 3300025909 Ga0207705_10191491 Ga0207705_101914912 233
1453 3300025910 Ga0207684_10054995 Ga0207684_100549953 233
1454 3300025911 Ga0207654_10008295 Ga0207654_100082952 233
1455 3300025911 Ga0207654_10085835 Ga0207654_100858352 233
1456 3300025912 Ga0207707_10000275 Ga0207707_1000027550 233
1457 3300025912 Ga0207707_10001341 Ga0207707_1000134117 233
1458 3300025912 Ga0207707_10035892 Ga0207707_100358922 233
1459 3300025912 Ga0207707_10047665 Ga0207707_100476654 233
1460 3300025912 Ga0207707_10069602 Ga0207707_100696023 233
1461 3300025913 Ga0207695_10000123 Ga0207695_10000123209 233
1462 3300025913 Ga0207695_10073999 Ga0207695_100739992 233
1463 3300025914 Ga0207671_10028018 Ga0207671_100280185 233
1464 3300025914 Ga0207671_10039283 Ga0207671_100392834 233
1465 3300025914 Ga0207671_10220339 Ga0207671_102203391 233
1466 3300025914 Ga0207671_10371994 Ga0207671_103719941 233
1467 3300025914 Ga0207671_10734335 Ga0207671_107343351 233
1468 3300025915 Ga0207693_10018459 Ga0207693_100184595 233
1469 3300025915 Ga0207693_10029805 Ga0207693_100298054 233
1470 3300025915 Ga0207693_10072822 Ga0207693_100728224 233
1471 3300025915 Ga0207693_10197376 Ga0207693_101973762 233
1472 3300025916 Ga0207663_10001982 Ga0207663_100019829 233
1473 3300025916 Ga0207663_10021715 Ga0207663_100217152 233
1474 3300025917 Ga0207660_10006121 Ga0207660_100061214 233
1475 3300025917 Ga0207660_10089610 Ga0207660_100896103 233
1476 3300025917 Ga0207660_10160520 Ga0207660_101605203 233
1477 3300025918 Ga0207662_10049518 Ga0207662_100495182 233
1478 3300025919 Ga0207657_10006234 Ga0207657_100062346 233
1479 3300025919 Ga0207657_10103303 Ga0207657_101033033 233
1480 3300025919 Ga0207657_10427179 Ga0207657_104271791 233
1481 3300025920 Ga0207649_10064534 Ga0207649_100645343 233
1482 3300025920 Ga0207649_10466753 Ga0207649_104667531 233
1483 3300025921 Ga0207652_10003913 Ga0207652_100039136 233
1484 3300025921 Ga0207652_10062273 Ga0207652_100622732 233
1485 3300025921 Ga0207652_10096614 Ga0207652_100966143 233
1486 3300025922 Ga0207646_10109521 Ga0207646_101095213 233
1487 3300025922 Ga0207646_10281407 Ga0207646_102814072 233
1488 3300025924 Ga0207694_10004032 Ga0207694_100040328 233
1489 3300025924 Ga0207694_10573391 Ga0207694_105733911 233
1490 3300025925 Ga0207650_10239831 Ga0207650_102398312 233
1491 3300025926 Ga0207659_10281546 Ga0207659_102815462 233
1492 3300025926 Ga0207659_10285657 Ga0207659_102856572 233
1493 3300025926 Ga0207659_10659709 Ga0207659_106597091 233
1494 3300025927 Ga0207687_10025694 Ga0207687_100256944 233
1495 3300025927 Ga0207687_10205185 Ga0207687_102051852 233
1496 3300025927 Ga0207687_10354409 Ga0207687_103544092 233
1497 3300025928 Ga0207700_10007850 Ga0207700_100078502 233
1498 3300025928 Ga0207700_10051441 Ga0207700_100514412 233
1499 3300025928 Ga0207700_10223254 Ga0207700_102232542 233
1500 3300025929 Ga0207664_10180536 Ga0207664_101805362 233
1501 3300025931 Ga0207644_10013321 Ga0207644_100133212 233
1502 3300025931 Ga0207644_10301598 Ga0207644_103015982 233
1503 3300025932 Ga0207690_10065485 Ga0207690_100654852 233
1504 3300025932 Ga0207690_10135850 Ga0207690_101358502 233
1505 3300025933 Ga0207706_10034439 Ga0207706_100344393 233
1506 3300025933 Ga0207706_10128044 Ga0207706_101280442 233
1507 3300025934 Ga0207686_10134108 Ga0207686_101341082 233
1508 3300025934 Ga0207686_10154728 Ga0207686_101547282 233
1509 3300025935 Ga0207709_10041313 Ga0207709_100413132 233
1510 3300025935 Ga0207709_10248414 Ga0207709_102484142 233
1511 3300025935 Ga0207709_10291369 Ga0207709_102913691 233
1512 3300025936 Ga0207670_10057664 Ga0207670_100576642 233
1513 3300025937 Ga0207669_10009239 Ga0207669_100092393 233
1514 3300025937 Ga0207669_10416559 Ga0207669_104165592 233
1515 3300025938 Ga0207704_10252282 Ga0207704_102522822 233
1516 3300025939 Ga0207665_10003307 Ga0207665_100033077 233
1517 3300025939 Ga0207665_10164841 Ga0207665_101648412 233
1518 3300025939 Ga0207665_10680326 Ga0207665_106803261 233
1519 3300025940 Ga0207691_10078008 Ga0207691_100780082 233
1520 3300025940 Ga0207691_10132801 Ga0207691_101328012 233
1521 3300025940 Ga0207691_10172521 Ga0207691_101725212 233
1522 3300025941 Ga0207711_10090394 Ga0207711_100903943 233
1523 3300025941 Ga0207711_10115974 Ga0207711_101159743 233
1524 3300025942 Ga0207689_10022508 Ga0207689_100225087 233
1525 3300025942 Ga0207689_10087761 Ga0207689_100877612 233
1526 3300025944 Ga0207661_10000159 Ga0207661_1000015926 233
1527 3300025944 Ga0207661_10015998 Ga0207661_100159983 233
1528 3300025945 Ga0207679_10256840 Ga0207679_102568402 233
1529 3300025949 Ga0207667_10014992 Ga0207667_100149926 233
1530 3300025949 Ga0207667_10057334 Ga0207667_100573342 233
1531 3300025949 Ga0207667_10312965 Ga0207667_103129652 233
1532 3300025949 Ga0207667_10330075 Ga0207667_103300752 233
1533 3300025960 Ga0207651_10278802 Ga0207651_102788022 233
1534 3300025960 Ga0207651_10466635 Ga0207651_104666352 233
1535 3300025961 Ga0207712_10020536 Ga0207712_100205363 233
1536 3300025961 Ga0207712_10157955 Ga0207712_101579552 233
1537 3300025972 Ga0207668_10117361 Ga0207668_101173612 233
1538 3300025972 Ga0207668_10298988 Ga0207668_102989882 233
1539 3300025972 Ga0207668_10714617 Ga0207668_107146171 233
1540 3300025981 Ga0207640_10256821 Ga0207640_102568212 233
1541 3300025986 Ga0207658_10062247 Ga0207658_100622473 233
1542 3300026023 Ga0207677_10013644 Ga0207677_100136443 233
1543 3300026023 Ga0207677_10130918 Ga0207677_101309182 233
1544 3300026035 Ga0207703_10085690 Ga0207703_100856902 233
1545 3300026035 Ga0207703_10146825 Ga0207703_101468251 233
1546 3300026035 Ga0207703_10399273 Ga0207703_103992732 233
1547 3300026041 Ga0207639_10005335 Ga0207639_100053359 233
1548 3300026041 Ga0207639_10092480 Ga0207639_100924802 233
1549 3300026041 Ga0207639_10709250 Ga0207639_107092502 233
1550 3300026067 Ga0207678_10018537 Ga0207678_100185374 233
1551 3300026067 Ga0207678_10155054 Ga0207678_101550542 233
1552 3300026067 Ga0207678_10273443 Ga0207678_102734431 233
1553 3300026067 Ga0207678_10321833 Ga0207678_103218331 233
1554 3300026075 Ga0207708_10021210 Ga0207708_100212103 233
1555 3300026075 Ga0207708_10249905 Ga0207708_102499052 233
1556 3300026078 Ga0207702_10000014 Ga0207702_10000014170 233
1557 3300026078 Ga0207702_10238954 Ga0207702_102389542 233
1558 3300026078 Ga0207702_10431658 Ga0207702_104316581 233
1559 3300026078 Ga0207702_10436151 Ga0207702_104361512 233
1560 3300026078 Ga0207702_10469895 Ga0207702_104698952 233
1561 3300026078 Ga0207702_10515704 Ga0207702_105157042 233
1562 3300026078 Ga0207702_10517577 Ga0207702_105175772 233
1563 3300026078 Ga0207702_10538379 Ga0207702_105383792 233
1564 3300026088 Ga0207641_10099073 Ga0207641_100990733 233
1565 3300026088 Ga0207641_10254463 Ga0207641_102544632 233
1566 3300026088 Ga0207641_10620474 Ga0207641_106204741 233
1567 3300026089 Ga0207648_10051413 Ga0207648_100514133 233
1568 3300026089 Ga0207648_10081011 Ga0207648_100810112 233
1569 3300026095 Ga0207676_10039899 Ga0207676_100398994 233
1570 3300026095 Ga0207676_10121661 Ga0207676_101216612 233
1571 3300026116 Ga0207674_10044389 Ga0207674_100443893 233
1572 3300026116 Ga0207674_10363162 Ga0207674_103631622 233
1573 3300026118 Ga0207675_100075636 Ga0207675_1000756362 233
1574 3300026118 Ga0207675_100112274 Ga0207675_1001122742 233
1575 3300026121 Ga0207683_10015816 Ga0207683_100158166 233
1576 3300026121 Ga0207683_10059597 Ga0207683_100595974 233
1577 3300026121 Ga0207683_10178824 Ga0207683_101788242 233
1578 3300026142 Ga0207698_10068709 Ga0207698_100687093 233
1579 3300026142 Ga0207698_10118374 Ga0207698_101183743 233
1580 3300026142 Ga0207698_10191475 Ga0207698_101914752 233
1581 3300026142 Ga0207698_10196118 Ga0207698_101961183 233
1582 3300026142 Ga0207698_10293104 Ga0207698_102931042 233
1583 3300027296 Ga0209389_1000016 Ga0209389_1000016123 233
1584 3300027296 Ga0209389_1000027 Ga0209389_100002738 233
1585 3300027357 Ga0209589_1000031 Ga0209589_100003150 233
1586 3300027361 Ga0209489_100057 Ga0209489_10005797 233
1587 3300027361 Ga0209489_100063 Ga0209489_10006381 233
1588 3300027363 Ga0209700_100012 Ga0209700_100012124 233
1589 3300027512 Ga0209179_1002827 Ga0209179_10028273 233
1590 3300027671 Ga0209588_1001152 Ga0209588_10011523 233
1591 3300027907 Ga0207428_10292166 Ga0207428_102921662 233
1592 3300028379 Ga0268266_10004934 Ga0268266_1000493413 233
1593 3300028379 Ga0268266_10090737 Ga0268266_100907373 233
1594 3300028379 Ga0268266_10132641 Ga0268266_101326412 233
1595 3300028379 Ga0268266_10205895 Ga0268266_102058951 233
1596 3300028379 Ga0268266_10283729 Ga0268266_102837292 233
1597 3300028379 Ga0268266_10290486 Ga0268266_102904862 233
1598 3300028380 Ga0268265_10109269 Ga0268265_101092693 233
1599 3300028380 Ga0268265_10165438 Ga0268265_101654382 233
1600 3300028381 Ga0268264_10000042 Ga0268264_10000042149 233
1601 3300028381 Ga0268264_10056533 Ga0268264_100565334 233
1602 3300028381 Ga0268264_10077215 Ga0268264_100772151 233
1603 3300028573 Ga0265334_10009853 Ga0265334_100098532 233
1604 3300028786 Ga0307517_10000176 Ga0307517_1000017665 233
1605 3300028794 Ga0307515_10135617 Ga0307515_101356172 233
1606 3300028794 Ga0307515_10341040 Ga0307515_103410402 233
1607 3300030521 Ga0307511_10038227 Ga0307511_100382272 233
1608 3300030521 Ga0307511_10096556 Ga0307511_100965562 233
1609 3300031235 Ga0265330_10005692 Ga0265330_100056923 233
1610 3300031239 Ga0265328_10168126 Ga0265328_101681261 233
1611 3300031247 Ga0265340_10043423 Ga0265340_100434232 233
1612 3300031249 Ga0265339_10005071 Ga0265339_100050717 233
1613 3300031250 Ga0265331_10184920 Ga0265331_101849202 233
1614 3300031507 Ga0307509_10186904 Ga0307509_101869042 233
1615 3300031548 Ga0307408_100109209 Ga0307408_1001092092 233
1616 3300031548 Ga0307408_100220214 Ga0307408_1002202142 233
1617 3300031548 Ga0307408_100617675 Ga0307408_1006176752 233
1618 3300031616 Ga0307508_10040384 Ga0307508_100403844 233
1619 3300031711 Ga0265314_10006820 Ga0265314_1000682010 233
1620 3300031712 Ga0265342_10055660 Ga0265342_100556602 233
1621 3300031712 Ga0265342_10196527 Ga0265342_101965271 233
1622 3300031730 Ga0307516_10067084 Ga0307516_100670843 233
1623 3300031730 Ga0307516_10101603 Ga0307516_101016032 233
1624 3300031838 Ga0307518_10222878 Ga0307518_102228782 233
1625 3300031901 Ga0307406_10123109 Ga0307406_101231092 233
1626 3300032002 Ga0307416_100545466 Ga0307416_1005454662 233
1627 3300032126 Ga0307415_100350567 Ga0307415_1003505672 233
1628 3300033179 Ga0307507_10066258 Ga0307507_100662583 233
1629 3300033180 Ga0307510_10006120 Ga0307510_1000612010 233
1630 3300033180 Ga0307510_10123753 Ga0307510_101237533 233
1631 3300035083 Ga0373926_0041629 Ga0373926_0041629_742_1473 233
1632 3300035086 Ga0373934_0001254 Ga0373934_0001254_6255_6986 233
1633 3300035086 Ga0373934_0124205 Ga0373934_0124205_245_976 233
1634 3300035111 Ga0373923_0002592 Ga0373923_0002592_3290_4021 233
1635 3300035111 Ga0373923_0018203 Ga0373923_0018203_198_929 233
1636 3300035113 Ga0373936_0021347 Ga0373936_0021347_353_1084 233
1637 3300035113 Ga0373936_0089339 Ga0373936_0089339_409_1140 233
1638 3300035117 Ga0373953_0018343 Ga0373953_0018343_434_1165 233
1639 3300035117 Ga0373953_0060534 Ga0373953_0060534_638_1369 233
1640 3300035118 Ga0373954_0004535 Ga0373954_0004535_788_1519 233
1641 3300035118 Ga0373954_0038488 Ga0373954_0038488_44_775 233
1642 3300035119 Ga0373956_0001441 Ga0373956_0001441_1951_2682 233
1643 3300035119 Ga0373956_0125664 Ga0373956_0125664_184_915 233
1644 3300035120 Ga0373957_0005751 Ga0373957_0005751_553_1284 233
1645 3300035170 Ga0373943_0048150 Ga0373943_0048150_107_838 233
1646 3300035171 Ga0373946_0014771 Ga0373946_0014771_1790_2521 233
1647 3300035171 Ga0373946_0018863 Ga0373946_0018863_740_1471 233
1648 3300035172 Ga0373955_0008330 Ga0373955_0008330_2039_2770 233
1649 3300035172 Ga0373955_0018229 Ga0373955_0018229_536_1267 233
1650 3300035242 Ga0373962_0041079 Ga0373962_0041079_491_1222 233
1651 3300035410 Ga0373924_0002729 Ga0373924_0002729_4164_4895 233
1652 3300035410 Ga0373924_0029465 Ga0373924_0029465_439_1170 233
1653 3300035691 Ga0373931_0191821 Ga0373931_0191821_75_806 233
1654 3300035695 Ga0373927_0006315 Ga0373927_0006315_96_827 233
1655 3300035695 Ga0373927_0023086 Ga0373927_0023086_3112_3843 233
1656 3300035695 Ga0373927_0051292 Ga0373927_0051292_1080_1811 233
1657 3300035695 Ga0373927_0068665 Ga0373927_0068665_456_1187 233
1658 3300035695 Ga0373927_0146027 Ga0373927_0146027_185_916 233
1659 3300035695 Ga0373927_0170377 Ga0373927_0170377_232_963 233
1660 3300035695 Ga0373927_0227426 Ga0373927_0227426_97_828 233
1661 3300035724 Ga0373933_0000017 Ga0373933_0000017_36645_37376 233
1662 3300035724 Ga0373933_0035762 Ga0373933_0035762_1248_1979 233
1663 3300035724 Ga0373933_0064932 Ga0373933_0064932_130_861 233
1664 3300035724 Ga0373933_0076256 Ga0373933_0076256_113_844 233
1665 3300035724 Ga0373933_0326489 Ga0373933_0326489_138_869 233
1666 3300035725 Ga0373947_0154131 Ga0373947_0154131_613_1344 233
1667 3300036401 Ga0373937_0057801 Ga0373937_0057801_2724_3455 233
1668 3300036401 Ga0373937_0159572 Ga0373937_0159572_595_1326 233
1669 3300036401 Ga0373937_0179399 Ga0373937_0179399_122_853 233
1670 3300036401 Ga0373937_0360068 Ga0373937_0360068_93_824 233
1671 3300036401 Ga0373937_0403807 Ga0373937_0403807_321_1052 233
1672 3300036401 Ga0373937_0464103 Ga0373937_0464103_437_1168 233
1673 3300037068 Ga0373925_0008382 Ga0373925_0008382_1752_2483 233
1674 3300037068 Ga0373925_0209074 Ga0373925_0209074_36_767 233
1675 3300037312 Ga0395899_0058237 Ga0395899_0058237_1767_2498 233
1676 3300037418 Ga0395900_0001648 Ga0395900_0001648_141_872 233
1677 3300037418 Ga0395900_0358565 Ga0395900_0358565_679_1410 233
1678 3300037418 Ga0395900_0423048 Ga0395900_0423048_93_824 233
1679 3300037466 Ga0395898_0036730 Ga0395898_0036730_1327_2058 233
1680 3300037471 Ga0395905_0023299 Ga0395905_0023299_1361_2092 233
1681 3300037471 Ga0395905_0053940 Ga0395905_0053940_2996_3727 233
1682 3300037471 Ga0395905_0101083 Ga0395905_0101083_1942_2673 233
1683 3300037471 Ga0395905_0112837 Ga0395905_0112837_150_881 233
1684 3300037471 Ga0395905_0840207 Ga0395905_0840207_37_768 233
1685 3300038443 Ga0395901_0103394 Ga0395901_0103394_1037_1768 233
1686 3300038443 Ga0395901_0260784 Ga0395901_0260784_339_1070 233
1687 3300038443 Ga0395901_0457148 Ga0395901_0457148_25_756 233
1688 3300038726 Ga0400490_00582 Ga0400490_00582_209_949 233
1689 3300038735 Ga0400485_22416 Ga0400485_22416_1092_1832 233
1690 3300038742 Ga0400486_16027 Ga0400486_16027_2436_3176 233
1691 3300038742 Ga0400486_19684 Ga0400486_19684_711_1451 233
1692 3300039062 Ga0400483_200011 Ga0400483_200011_96_836 233
1693 3300039437 Ga0436365_0633843 Ga0436365_0633843_412_1143 233
1694 3300039437 Ga0436365_0870351 Ga0436365_0870351_36_767 233
1695 3300039437 Ga0436365_1365486 Ga0436365_1365486_27_758 233
1696 3300039437 Ga0436365_1452548 Ga0436365_1452548_964_1695 233
1697 3300039438 Ga0436360_0887353 Ga0436360_0887353_78_809 233
1698 3300039438 Ga0436360_1294194 Ga0436360_1294194_488_1219 233
1699 3300039447 Ga0436361_1055349 Ga0436361_1055349_173_904 233
1700 3300039450 Ga0436363_0113284 Ga0436363_0113284_191_922 233
1701 3300039450 Ga0436363_0601760 Ga0436363_0601760_47_778 233
1702 3300039450 Ga0436363_0958819 Ga0436363_0958819_102_833 233
1703 3300041413 Ga0439465_0092193 Ga0439465_0092193_102_833 233
1704 3300041453 Ga0451797_1034786 Ga0451797_1034786_268_999 233
1705 3300041512 Ga0451853_0059932 Ga0451853_0059932_475_1206 233
1706 3300041512 Ga0451853_0844724 Ga0451853_0844724_47_820 233
1707 3300041512 Ga0451853_1647381 Ga0451853_1647381_188_919 233
1708 3300042157 Ga0439458_0049683 Ga0439458_0049683_194_925 233
1709 3300044656 Ga0466969_0157158 Ga0466969_0157158_112_843 233
1710 3300044658 Ga0466972_0000179 Ga0466972_0000179_1094_1825 233
1711 3300044658 Ga0466972_0006460 Ga0466972_0006460_443_1174 233
1712 3300044684 Ga0466966_0000830 Ga0466966_0000830_14555_15286 233
1713 3300044684 Ga0466966_0044447 Ga0466966_0044447_1164_1895 233
1714 3300044693 Ga0466961_0000023 Ga0466961_0000023_38680_39411 233
1715 3300044694 Ga0466963_0086578 Ga0466963_0086578_255_986 233
1716 3300044694 Ga0466963_0114508 Ga0466963_0114508_865_1596 233
1717 3300044706 Ga0466964_0130421 Ga0466964_0130421_69_800 233
1718 3300044735 Ga0466968_0067778 Ga0466968_0067778_599_1321 233
1719 3300044765 Ga0466970_0085049 Ga0466970_0085049_745_1476 233
1720 3300045049 Ga0466959_0032575 Ga0466959_0032575_1736_2467 233
1721 3300045976 Ga0466967_0032265 Ga0466967_0032265_2970_3701 233
1722 3300045976 Ga0466967_0104727 Ga0466967_0104727_56_787 233
1723 3300045976 Ga0466967_0249352 Ga0466967_0249352_477_1208 233
1724 3300046454 Ga0495592_0043175 Ga0495592_0043175_513_1244 233
1725 3300046454 Ga0495592_0103478 Ga0495592_0103478_740_1471 233
1726 3300046454 Ga0495592_0181956 Ga0495592_0181956_89_820 233
1727 3300046454 Ga0495592_0190479 Ga0495592_0190479_235_966 233
1728 3300046454 Ga0495592_0271110 Ga0495592_0271110_256_987 233
1729 3300046455 Ga0495603_0031770 Ga0495603_0031770_791_1522 233
1730 3300046455 Ga0495603_0045648 Ga0495603_0045648_1471_2202 233
1731 3300046455 Ga0495603_0054409 Ga0495603_0054409_1282_2013 233
1732 3300046455 Ga0495603_0098125 Ga0495603_0098125_620_1351 233
1733 3300046455 Ga0495603_0145979 Ga0495603_0145979_509_1240 233
1734 3300046457 Ga0495590_0015153 Ga0495590_0015153_1618_2349 233
1735 3300046459 Ga0495629_0001206 Ga0495629_0001206_19465_20196 233
1736 3300046459 Ga0495629_0001925 Ga0495629_0001925_10077_10808 233
1737 3300046459 Ga0495629_0075888 Ga0495629_0075888_1365_2096 233
1738 3300046459 Ga0495629_0466270 Ga0495629_0466270_75_806 233
1739 3300046460 Ga0495638_0117355 Ga0495638_0117355_277_1008 233
1740 3300046461 Ga0495641_0014458 Ga0495641_0014458_2904_3635 233
1741 3300046461 Ga0495641_0079541 Ga0495641_0079541_501_1232 233
1742 3300046462 Ga0495651_0015326 Ga0495651_0015326_4145_4876 233
1743 3300046462 Ga0495651_0043603 Ga0495651_0043603_1065_1796 233
1744 3300046462 Ga0495651_0050526 Ga0495651_0050526_1224_1955 233
1745 3300046463 Ga0495653_0020946 Ga0495653_0020946_3976_4707 233
1746 3300046463 Ga0495653_0080367 Ga0495653_0080367_572_1303 233
1747 3300046463 Ga0495653_0105718 Ga0495653_0105718_427_1158 233
1748 3300046472 Ga0495580_0018723 Ga0495580_0018723_2352_3083 233
1749 3300046473 Ga0495582_0018041 Ga0495582_0018041_390_1121 233
1750 3300046473 Ga0495582_0038107 Ga0495582_0038107_728_1459 233
1751 3300046473 Ga0495582_0171032 Ga0495582_0171032_201_932 233
1752 3300046474 Ga0495605_0026314 Ga0495605_0026314_1354_2085 233
1753 3300046474 Ga0495605_0078996 Ga0495605_0078996_426_1157 233
1754 3300046475 Ga0495639_0007882 Ga0495639_0007882_338_1069 233
1755 3300046475 Ga0495639_0008211 Ga0495639_0008211_305_1036 233
1756 3300046475 Ga0495639_0077627 Ga0495639_0077627_132_863 233
1757 3300046475 Ga0495639_0078913 Ga0495639_0078913_735_1466 233
1758 3300046476 Ga0495662_0006209 Ga0495662_0006209_4351_5082 233
1759 3300046476 Ga0495662_0039530 Ga0495662_0039530_673_1404 233
1760 3300046476 Ga0495662_0056776 Ga0495662_0056776_395_1126 233
1761 3300046477 Ga0495664_0007694 Ga0495664_0007694_3778_4509 233
1762 3300046477 Ga0495664_0039451 Ga0495664_0039451_985_1716 233
1763 3300046477 Ga0495664_0065943 Ga0495664_0065943_804_1535 233
1764 3300046477 Ga0495664_0229110 Ga0495664_0229110_306_1037 233
1765 3300046477 Ga0495664_0258294 Ga0495664_0258294_19_750 233
1766 3300046492 Ga0495585_0029970 Ga0495585_0029970_724_1455 233
1767 3300046492 Ga0495585_0075196 Ga0495585_0075196_696_1427 233
1768 3300046492 Ga0495585_0228375 Ga0495585_0228375_26_757 233
1769 3300046499 Ga0495594_0033287 Ga0495594_0033287_131_862 233
1770 3300046499 Ga0495594_0145227 Ga0495594_0145227_578_1309 233
1771 3300046501 Ga0495607_0096189 Ga0495607_0096189_325_1056 233
1772 3300046506 Ga0495583_0126428 Ga0495583_0126428_100_831 233
1773 3300046507 Ga0495606_0000357 Ga0495606_0000357_71630_72361 233
1774 3300046507 Ga0495606_0047144 Ga0495606_0047144_1343_2074 233
1775 3300046507 Ga0495606_0107761 Ga0495606_0107761_889_1620 233
1776 3300046507 Ga0495606_0117007 Ga0495606_0117007_375_1106 233
1777 3300046507 Ga0495606_0126804 Ga0495606_0126804_267_998 233
1778 3300046507 Ga0495606_0169161 Ga0495606_0169161_67_798 233
1779 3300046511 Ga0495608_0008777 Ga0495608_0008777_5120_5851 233
1780 3300046511 Ga0495608_0012240 Ga0495608_0012240_4324_5055 233
1781 3300046511 Ga0495608_0071569 Ga0495608_0071569_225_956 233
1782 3300046511 Ga0495608_0182644 Ga0495608_0182644_254_985 233
1783 3300046513 Ga0495616_0072337 Ga0495616_0072337_378_1109 233
1784 3300046514 Ga0495618_0031260 Ga0495618_0031260_2071_2802 233
1785 3300046514 Ga0495618_0057258 Ga0495618_0057258_1550_2281 233
1786 3300046514 Ga0495618_0094598 Ga0495618_0094598_1123_1854 233
1787 3300046514 Ga0495618_0107787 Ga0495618_0107787_231_962 233
1788 3300046515 Ga0495620_0082137 Ga0495620_0082137_335_1066 233
1789 3300046516 Ga0495628_0002925 Ga0495628_0002925_7781_8512 233
1790 3300046516 Ga0495628_0031953 Ga0495628_0031953_469_1200 233
1791 3300046516 Ga0495628_0054023 Ga0495628_0054023_2180_2911 233
1792 3300046516 Ga0495628_0066501 Ga0495628_0066501_775_1506 233
1793 3300046516 Ga0495628_0154162 Ga0495628_0154162_747_1478 233
1794 3300046516 Ga0495628_0460370 Ga0495628_0460370_45_776 233
1795 3300046517 Ga0495630_0059924 Ga0495630_0059924_803_1534 233
1796 3300046517 Ga0495630_0101844 Ga0495630_0101844_787_1518 233
1797 3300046517 Ga0495630_0121464 Ga0495630_0121464_451_1182 233
1798 3300046517 Ga0495630_0234227 Ga0495630_0234227_179_910 233
1799 3300046518 Ga0495631_0031198 Ga0495631_0031198_1218_1949 233
1800 3300046518 Ga0495631_0136225 Ga0495631_0136225_127_858 233
1801 3300046519 Ga0495632_0066590 Ga0495632_0066590_621_1352 233
1802 3300046520 Ga0495637_0024460 Ga0495637_0024460_409_1140 233
1803 3300046522 Ga0495643_0029940 Ga0495643_0029940_257_988 233
1804 3300046522 Ga0495643_0127855 Ga0495643_0127855_489_1220 233
1805 3300046522 Ga0495643_0144787 Ga0495643_0144787_13_744 233
1806 3300046524 Ga0495648_0001972 Ga0495648_0001972_3079_3810 233
1807 3300046524 Ga0495648_0006734 Ga0495648_0006734_3934_4665 233
1808 3300046524 Ga0495648_0024566 Ga0495648_0024566_2271_3002 233
1809 3300046524 Ga0495648_0132312 Ga0495648_0132312_494_1225 233
1810 3300046525 Ga0495663_0028154 Ga0495663_0028154_557_1288 233
1811 3300046526 Ga0495666_0019612 Ga0495666_0019612_2520_3251 233
1812 3300046526 Ga0495666_0110371 Ga0495666_0110371_234_965 233
1813 3300046526 Ga0495666_0122061 Ga0495666_0122061_252_983 233
1814 3300046529 Ga0495652_0003201 Ga0495652_0003201_14025_14756 233
1815 3300046529 Ga0495652_0023745 Ga0495652_0023745_4682_5413 233
1816 3300046529 Ga0495652_0183632 Ga0495652_0183632_492_1223 233
1817 3300046529 Ga0495652_0309634 Ga0495652_0309634_97_828 233
1818 3300046531 Ga0495665_0011144 Ga0495665_0011144_3340_4071 233
1819 3300046531 Ga0495665_0036939 Ga0495665_0036939_1148_1879 233
1820 3300046533 Ga0495640_0015232 Ga0495640_0015232_1278_2009 233
1821 3300046533 Ga0495640_0016148 Ga0495640_0016148_4263_4994 233
1822 3300046533 Ga0495640_0024101 Ga0495640_0024101_2067_2798 233
1823 3300046533 Ga0495640_0027942 Ga0495640_0027942_1150_1881 233
1824 3300046533 Ga0495640_0052256 Ga0495640_0052256_1319_2050 233
1825 3300046533 Ga0495640_0062063 Ga0495640_0062063_683_1414 233
1826 3300046535 Ga0495586_0158707 Ga0495586_0158707_365_1096 233
1827 3300046537 Ga0495598_0038719 Ga0495598_0038719_19_750 233
1828 3300046538 Ga0495609_0019080 Ga0495609_0019080_689_1420 233
1829 3300046543 Ga0495645_0018524 Ga0495645_0018524_1032_1763 233
1830 3300046543 Ga0495645_0048632 Ga0495645_0048632_1074_1805 233
1831 3300046543 Ga0495645_0051953 Ga0495645_0051953_1625_2356 233
1832 3300046543 Ga0495645_0102550 Ga0495645_0102550_89_820 233
1833 3300046557 Ga0495622_0011694 Ga0495622_0011694_793_1524 233
1834 3300046557 Ga0495622_0031724 Ga0495622_0031724_1675_2406 233
1835 3300046557 Ga0495622_0043843 Ga0495622_0043843_889_1620 233
1836 3300046557 Ga0495622_0053371 Ga0495622_0053371_335_1066 233
1837 3300046557 Ga0495622_0123293 Ga0495622_0123293_216_947 233
1838 3300046557 Ga0495622_0159506 Ga0495622_0159506_180_911 233
1839 3300046558 Ga0495633_0067805 Ga0495633_0067805_408_1139 233
1840 3300046558 Ga0495633_0118672 Ga0495633_0118672_84_815 233
1841 3300046559 Ga0495667_0004813 Ga0495667_0004813_5861_6592 233
1842 3300046559 Ga0495667_0027311 Ga0495667_0027311_2143_2874 233
1843 3300046559 Ga0495667_0072620 Ga0495667_0072620_1132_1863 233
1844 3300046615 Ga0495656_0001245 Ga0495656_0001245_5073_5804 233
1845 3300046615 Ga0495656_0014562 Ga0495656_0014562_1396_2127 233
1846 3300046615 Ga0495656_0099960 Ga0495656_0099960_48_830 233
1847 3300046616 Ga0495668_0029895 Ga0495668_0029895_553_1284 233
1848 3300046642 Ga0495634_0003016 Ga0495634_0003016_8679_9410 233
1849 3300046642 Ga0495634_0025562 Ga0495634_0025562_2210_2941 233
1850 3300046642 Ga0495634_0088885 Ga0495634_0088885_674_1405 233
1851 3300046648 Ga0495611_0090570 Ga0495611_0090570_278_1009 233
1852 3300046648 Ga0495611_0129838 Ga0495611_0129838_315_1046 233
1853 3300046660 Ga0495625_0161949 Ga0495625_0161949_329_1060 233
1854 3300046660 Ga0495625_0176999 Ga0495625_0176999_378_1109 233
1855 3300046663 Ga0495635_0001663 Ga0495635_0001663_5515_6246 233
1856 3300046663 Ga0495635_0002216 Ga0495635_0002216_10630_11361 233
1857 3300046663 Ga0495635_0062259 Ga0495635_0062259_448_1179 233
1858 3300046664 Ga0495659_0086726 Ga0495659_0086726_35_766 233
1859 3300046674 Ga0495588_0001390 Ga0495588_0001390_4533_5264 233
1860 3300046674 Ga0495588_0037416 Ga0495588_0037416_222_953 233
1861 3300046674 Ga0495588_0083585 Ga0495588_0083585_131_862 233
1862 3300046675 Ga0495657_0003474 Ga0495657_0003474_6120_6851 233
1863 3300046678 Ga0495599_0012568 Ga0495599_0012568_310_1041 233
1864 3300046678 Ga0495599_0042203 Ga0495599_0042203_2039_2770 233
1865 3300046679 Ga0495623_0084776 Ga0495623_0084776_319_1050 233
1866 3300046680 Ga0495646_0019235 Ga0495646_0019235_519_1250 233
1867 3300046680 Ga0495646_0025175 Ga0495646_0025175_2762_3493 233
1868 3300046680 Ga0495646_0055660 Ga0495646_0055660_521_1252 233
1869 3300046680 Ga0495646_0112675 Ga0495646_0112675_780_1511 233
1870 3300046680 Ga0495646_0221172 Ga0495646_0221172_259_990 233
1871 3300046681 Ga0495647_0014637 Ga0495647_0014637_749_1480 233
1872 3300046681 Ga0495647_0024147 Ga0495647_0024147_149_880 233
1873 3300046683 Ga0495658_0028933 Ga0495658_0028933_2196_2927 233
1874 3300046683 Ga0495658_0083029 Ga0495658_0083029_742_1473 233
1875 3300046689 Ga0495613_0004714 Ga0495613_0004714_8820_9551 233
1876 3300046689 Ga0495613_0028419 Ga0495613_0028419_1254_1985 233
1877 3300046689 Ga0495613_0081477 Ga0495613_0081477_799_1530 233
1878 3300046689 Ga0495613_0081585 Ga0495613_0081585_421_1152 233
1879 3300046689 Ga0495613_0138316 Ga0495613_0138316_588_1319 233
1880 3300046690 Ga0495624_0005122 Ga0495624_0005122_4783_5514 233
1881 3300046690 Ga0495624_0006495 Ga0495624_0006495_6270_7001 233
1882 3300046690 Ga0495624_0302358 Ga0495624_0302358_63_794 233
1883 3300046691 Ga0495670_0181650 Ga0495670_0181650_22_753 233
1884 3300046692 Ga0495671_0069398 Ga0495671_0069398_389_1120 233
1885 3300046692 Ga0495671_0124968 Ga0495671_0124968_64_795 233
1886 3300046694 Ga0495649_0012603 Ga0495649_0012603_3676_4407 233
1887 3300046794 Ga0495589_0064436 Ga0495589_0064436_580_1311 233
1888 3300046809 Ga0495600_0002113 Ga0495600_0002113_4524_5255 233
1889 3300046809 Ga0495600_0129464 Ga0495600_0129464_832_1563 233
1890 3300046810 Ga0495660_0069914 Ga0495660_0069914_1089_1820 233
1891 3300047315 Ga0495581_0010897 Ga0495581_0010897_3034_3765 233
1892 3300047317 Ga0495604_0005104 Ga0495604_0005104_1573_2304 233
1893 3300047317 Ga0495604_0023050 Ga0495604_0023050_3374_4105 233
1894 3300047317 Ga0495604_0047483 Ga0495604_0047483_1163_1894 233
1895 3300047317 Ga0495604_0073316 Ga0495604_0073316_612_1343 233
1896 3300047318 Ga0495636_0021328 Ga0495636_0021328_615_1346 233
1897 3300047319 Ga0495674_0001841 Ga0495674_0001841_10525_11256 233
1898 3300047319 Ga0495674_0012054 Ga0495674_0012054_355_1086 233
1899 3300047319 Ga0495674_0028067 Ga0495674_0028067_2095_2826 233
1900 3300047319 Ga0495674_0183750 Ga0495674_0183750_361_1092 233
1901 3300047319 Ga0495674_0538488 Ga0495674_0538488_73_804 233
1902 3300047320 Ga0495672_0031936 Ga0495672_0031936_1266_1997 233
1903 3300047321 Ga0495676_0067445 Ga0495676_0067445_1180_1911 233
1904 3300047321 Ga0495676_0107722 Ga0495676_0107722_534_1265 233
1905 3300047322 Ga0495680_0001322 Ga0495680_0001322_19063_19794 233
1906 3300047322 Ga0495680_0028729 Ga0495680_0028729_995_1726 233
1907 3300047322 Ga0495680_0113541 Ga0495680_0113541_146_877 233
1908 3300047322 Ga0495680_0158392 Ga0495680_0158392_326_1057 233
1909 3300047322 Ga0495680_0299469 Ga0495680_0299469_375_1106 233
1910 3300047323 Ga0495683_0059931 Ga0495683_0059931_615_1346 233
1911 3300047443 Ga0495687_078390 Ga0495687_078390_289_1020 233
1912 3300047444 Ga0495675_0002252 Ga0495675_0002252_1000_1731 233
1913 3300047444 Ga0495675_0004442 Ga0495675_0004442_6471_7202 233
1914 3300047444 Ga0495675_0020634 Ga0495675_0020634_2196_2927 233
1915 3300047445 Ga0495677_0064168 Ga0495677_0064168_126_857 233
1916 3300047445 Ga0495677_0112422 Ga0495677_0112422_55_786 233
1917 3300047447 Ga0495685_043071 Ga0495685_043071_344_1075 233
1918 3300047469 Ga0495673_0029487 Ga0495673_0029487_1436_2167 233
1919 3300047471 Ga0495684_0000954 Ga0495684_0000954_14569_15300 233
1920 3300047471 Ga0495684_0065461 Ga0495684_0065461_437_1168 233
1921 3300047471 Ga0495684_0124558 Ga0495684_0124558_422_1153 233
1922 3300047471 Ga0495684_0126099 Ga0495684_0126099_835_1566 233
1923 3300047673 Ga0495593_0003081 Ga0495593_0003081_8462_9193 233
1924 3300047673 Ga0495593_0003267 Ga0495593_0003267_4926_5657 233
1925 3300047673 Ga0495593_0011754 Ga0495593_0011754_2794_3525 233
1926 3300047673 Ga0495593_0234982 Ga0495593_0234982_51_782 233
1927 3300048088 Ga0495602_0001522 Ga0495602_0001522_14551_15282 233
1928 3300048088 Ga0495602_0120798 Ga0495602_0120798_774_1505 233
1929 3300048089 Ga0495614_0083062 Ga0495614_0083062_401_1132 233
1930 3300048091 Ga0495626_0065698 Ga0495626_0065698_513_1244 233
1931 3300048903 Ga0496100_0418854 Ga0496100_0418854_34_807 233
1932 3300048904 Ga0496101_0013436 Ga0496101_0013436_2794_3525 233
1933 3300048904 Ga0496101_0166228 Ga0496101_0166228_704_1435 233
1934 3300048905 Ga0496102_0095294 Ga0496102_0095294_1439_2170 233
1935 3300048905 Ga0496102_0126129 Ga0496102_0126129_284_1015 233
1936 3300048905 Ga0496102_0831563 Ga0496102_0831563_22_753 233
1937 3300048906 Ga0496103_0052043 Ga0496103_0052043_1588_2361 233
1938 3300048906 Ga0496103_0283714 Ga0496103_0283714_138_869 233
1939 3300048907 Ga0496104_0023109 Ga0496104_0023109_3402_4133 233
1940 3300048907 Ga0496104_0052425 Ga0496104_0052425_1310_2041 233
1941 3300048907 Ga0496104_0072227 Ga0496104_0072227_417_1148 233
1942 3300048907 Ga0496104_0092607 Ga0496104_0092607_1383_2114 233
1943 3300048908 Ga0496105_0003309 Ga0496105_0003309_10268_10999 233
1944 3300048908 Ga0496105_0019607 Ga0496105_0019607_1215_1946 233
1945 3300048908 Ga0496105_0040611 Ga0496105_0040611_1178_1909 233
1946 3300048908 Ga0496105_0042979 Ga0496105_0042979_1689_2462 233
1947 3300048909 Ga0496106_0013014 Ga0496106_0013014_2627_3358 233
1948 3300048909 Ga0496106_0094802 Ga0496106_0094802_1507_2238 233
1949 3300048909 Ga0496106_0114167 Ga0496106_0114167_816_1547 233
1950 3300048910 Ga0496107_0004424 Ga0496107_0004424_5151_5882 233
1951 3300048910 Ga0496107_0046877 Ga0496107_0046877_1026_1799 233
1952 3300048910 Ga0496107_0076307 Ga0496107_0076307_1652_2383 233
1953 3300048910 Ga0496107_0222466 Ga0496107_0222466_541_1272 233
1954 3300048911 Ga0496108_0000392 Ga0496108_0000392_27212_27943 233
1955 3300048911 Ga0496108_0007768 Ga0496108_0007768_5947_6720 233
1956 3300048911 Ga0496108_0177617 Ga0496108_0177617_570_1301 233
1957 3300048911 Ga0496108_0418302 Ga0496108_0418302_348_1079 233
1958 3300048912 Ga0496109_0005498 Ga0496109_0005498_6997_7728 233
1959 3300048912 Ga0496109_0226271 Ga0496109_0226271_740_1471 233
1960 3300048912 Ga0496109_0391579 Ga0496109_0391579_107_838 233
1961 3300048913 Ga0496110_0013454 Ga0496110_0013454_2086_2859 233
1962 3300048913 Ga0496110_0140607 Ga0496110_0140607_1397_2128 233
1963 3300048913 Ga0496110_0206945 Ga0496110_0206945_45_776 233
1964 3300048913 Ga0496110_0679334 Ga0496110_0679334_175_906 233
1965 3300048914 Ga0496111_0021330 Ga0496111_0021330_1018_1791 233
1966 3300048914 Ga0496111_0100404 Ga0496111_0100404_850_1581 233
1967 3300048914 Ga0496111_0115267 Ga0496111_0115267_1183_1914 233
1968 3300048914 Ga0496111_0123543 Ga0496111_0123543_339_1070 233
1969 3300048915 Ga0496112_0000022 Ga0496112_0000022_140872_141603 233
1970 3300048915 Ga0496112_0001604 Ga0496112_0001604_3889_4620 233
1971 3300048915 Ga0496112_0067770 Ga0496112_0067770_824_1555 233
1972 3300048915 Ga0496112_0150238 Ga0496112_0150238_900_1631 233
1973 3300048915 Ga0496112_0154943 Ga0496112_0154943_525_1256 233
1974 3300048915 Ga0496112_0230517 Ga0496112_0230517_525_1256 233
1975 3300048915 Ga0496112_0358299 Ga0496112_0358299_181_912 233
1976 3300048915 Ga0496112_0776931 Ga0496112_0776931_56_787 233
1977 3300048916 Ga0496113_0005324 Ga0496113_0005324_5942_6715 233
1978 3300048916 Ga0496113_0013025 Ga0496113_0013025_3071_3802 233
1979 3300048916 Ga0496113_0096372 Ga0496113_0096372_634_1365 233
1980 3300048916 Ga0496113_0098211 Ga0496113_0098211_1442_2173 233
1981 3300048916 Ga0496113_0148931 Ga0496113_0148931_300_1031 233
1982 3300048916 Ga0496113_0185329 Ga0496113_0185329_254_985 233
1983 3300048916 Ga0496113_0320443 Ga0496113_0320443_393_1124 233
1984 3300048917 Ga0496114_0055275 Ga0496114_0055275_1695_2426 233
1985 3300048917 Ga0496114_0062448 Ga0496114_0062448_461_1234 233
1986 3300048917 Ga0496114_0158043 Ga0496114_0158043_86_817 233
1987 3300048918 Ga0496115_0008912 Ga0496115_0008912_2928_3701 233
1988 3300048918 Ga0496115_0039349 Ga0496115_0039349_1973_2704 233
1989 3300048918 Ga0496115_0087048 Ga0496115_0087048_1554_2285 233
1990 3300048918 Ga0496115_0143588 Ga0496115_0143588_1003_1734 233
1991 3300048918 Ga0496115_0224661 Ga0496115_0224661_501_1232 233
1992 3300048918 Ga0496115_0278896 Ga0496115_0278896_214_945 233
1993 3300048919 Ga0496116_0017629 Ga0496116_0017629_860_1591 233
1994 3300048920 Ga0496117_0025790 Ga0496117_0025790_3323_4054 233
1995 3300048920 Ga0496117_0076542 Ga0496117_0076542_225_956 233
1996 3300048920 Ga0496117_0079088 Ga0496117_0079088_395_1126 233
1997 3300048920 Ga0496117_0104374 Ga0496117_0104374_777_1508 233
1998 3300048920 Ga0496117_0218710 Ga0496117_0218710_28_759 233
1999 3300048921 Ga0496118_0019784 Ga0496118_0019784_4506_5237 233
2000 3300048921 Ga0496118_0025820 Ga0496118_0025820_1274_2005 233
2001 3300048921 Ga0496118_0042073 Ga0496118_0042073_988_1719 233
2002 3300048921 Ga0496118_0094892 Ga0496118_0094892_167_898 233
2003 3300048921 Ga0496118_0146934 Ga0496118_0146934_540_1271 233
2004 3300048921 Ga0496118_0154541 Ga0496118_0154541_90_821 233
2005 3300048922 Ga0496119_0033850 Ga0496119_0033850_2572_3303 233
2006 3300048922 Ga0496119_0105480 Ga0496119_0105480_809_1540 233
2007 3300048922 Ga0496119_0109106 Ga0496119_0109106_235_966 233
2008 3300048922 Ga0496119_0116473 Ga0496119_0116473_313_1044 233
2009 3300048923 Ga0496120_0030010 Ga0496120_0030010_1844_2575 233
2010 3300048924 Ga0496121_0003573 Ga0496121_0003573_2267_2998 233
2011 3300048924 Ga0496121_0005384 Ga0496121_0005384_4249_4980 233
2012 3300048924 Ga0496121_0008714 Ga0496121_0008714_6944_7675 233
2013 3300048924 Ga0496121_0019117 Ga0496121_0019117_4833_5564 233
2014 3300048924 Ga0496121_0063515 Ga0496121_0063515_1146_1877 233
2015 3300048924 Ga0496121_0067062 Ga0496121_0067062_926_1657 233
2016 3300048924 Ga0496121_0103010 Ga0496121_0103010_815_1546 233
2017 3300048924 Ga0496121_0175687 Ga0496121_0175687_40_771 233
2018 3300048924 Ga0496121_0180595 Ga0496121_0180595_318_1049 233
2019 3300048924 Ga0496121_0212535 Ga0496121_0212535_395_1126 233
2020 3300048924 Ga0496121_0230590 Ga0496121_0230590_309_1040 233
2021 3300048924 Ga0496121_0361476 Ga0496121_0361476_44_775 233
2022 3300048927 Ga0496124_0002457 Ga0496124_0002457_6141_6872 233
2023 3300048928 Ga0496125_0083732 Ga0496125_0083732_920_1651 233
2024 3300048928 Ga0496125_0089363 Ga0496125_0089363_1197_1928 233
2025 3300048928 Ga0496125_0238696 Ga0496125_0238696_277_1008 233
2026 3300048928 Ga0496125_0241012 Ga0496125_0241012_383_1114 233
2027 3300048929 Ga0496126_0006822 Ga0496126_0006822_10355_11086 233
2028 3300048929 Ga0496126_0029480 Ga0496126_0029480_3489_4220 233
2029 3300048929 Ga0496126_0036823 Ga0496126_0036823_198_929 233
2030 3300048929 Ga0496126_0081237 Ga0496126_0081237_512_1243 233
2031 3300048929 Ga0496126_0106966 Ga0496126_0106966_1294_2025 233
2032 3300048929 Ga0496126_0135289 Ga0496126_0135289_614_1345 233
2033 3300048929 Ga0496126_0170594 Ga0496126_0170594_868_1599 233
2034 3300048929 Ga0496126_0177055 Ga0496126_0177055_473_1204 233
2035 3300048929 Ga0496126_0240127 Ga0496126_0240127_736_1467 233
2036 3300048929 Ga0496126_0342726 Ga0496126_0342726_53_784 233
2037 3300049460 Ga0495682_0055291 Ga0495682_0055291_600_1331 233
2038 3300049568 Ga0501031_0008748 Ga0501031_0008748_1233_1964 233
2039 3300049568 Ga0501031_0496936 Ga0501031_0496936_20_751 233
2040 3300049569 Ga0501032_0000017 Ga0501032_0000017_156615_157346 233
2041 3300049569 Ga0501032_0027373 Ga0501032_0027373_1886_2617 233
2042 3300049570 Ga0501033_0000029 Ga0501033_0000029_156606_157337 233
2043 3300049570 Ga0501033_0002889 Ga0501033_0002889_11763_12494 233
2044 3300049571 Ga0501034_0000102 Ga0501034_0000102_156614_157345 233
2045 3300049571 Ga0501034_0004358 Ga0501034_0004358_2039_2770 233
2046 3300049572 Ga0501036_0000011 Ga0501036_0000011_958_1689 233
2047 3300049572 Ga0501036_0460445 Ga0501036_0460445_13_744 233
2048 3300049573 Ga0501037_0000015 Ga0501037_0000015_3967_4698 233
2049 3300049573 Ga0501037_0080883 Ga0501037_0080883_105_836 233
2050 3300049574 Ga0501038_0000016 Ga0501038_0000016_156614_157345 233
2051 3300049574 Ga0501038_0032182 Ga0501038_0032182_1449_2180 233
2052 3300049575 Ga0501039_0000023 Ga0501039_0000023_156614_157345 233
2053 3300049576 Ga0501040_0002784 Ga0501040_0002784_10508_11239 233
2054 3300049579 Ga0501043_0001694 Ga0501043_0001694_4845_5576 233
2055 3300049579 Ga0501043_0017400 Ga0501043_0017400_958_1689 233
2056 3300049580 Ga0501046_0037870 Ga0501046_0037870_1614_2345 233
2057 3300049581 Ga0501047_0047731 Ga0501047_0047731_1619_2350 233
2058 3300049581 Ga0501047_0111208 Ga0501047_0111208_1624_2355 233
2059 3300049582 Ga0501048_0207315 Ga0501048_0207315_558_1289 233
2060 3300049586 Ga0501070_0058952 Ga0501070_0058952_219_950 233
2061 3300049587 Ga0501071_0112715 Ga0501071_0112715_734_1468 233
2062 3300049588 Ga0501072_0527218 Ga0501072_0527218_63_797 233
2063 3300049589 Ga0501073_0023184 Ga0501073_0023184_2285_3016 233
2064 3300049590 Ga0501074_0061535 Ga0501074_0061535_1306_2040 233
2065 3300049592 Ga0501076_0066200 Ga0501076_0066200_788_1522 233
2066 3300049593 Ga0501077_0263992 Ga0501077_0263992_175_909 233
2067 3300049742 Ga0501080_0003722 Ga0501080_0003722_4745_5476 233
2068 3300049742 Ga0501080_0093877 Ga0501080_0093877_850_1584 233
2069 3300049742 Ga0501080_0760678 Ga0501080_0760678_54_785 233
2070 3300049743 Ga0501081_0435444 Ga0501081_0435444_56_790 233
2071 3300049744 Ga0501083_0068530 Ga0501083_0068530_659_1393 233
2072 3300049822 Ga0501035_0000038 Ga0501035_0000038_1474_2205 233
2073 3300049822 Ga0501035_0018078 Ga0501035_0018078_67_807 233
2074 3300049822 Ga0501035_0018125 Ga0501035_0018125_3517_4248 233
2075 3300049822 Ga0501035_0071603 Ga0501035_0071603_1423_2157 233
2076 3300049822 Ga0501035_0554796 Ga0501035_0554796_91_822 233
2077 3300049823 Ga0501044_0000022 Ga0501044_0000022_133121_133855 233
2078 3300049823 Ga0501044_0003435 Ga0501044_0003435_14726_15457 233
2079 3300049823 Ga0501044_0004489 Ga0501044_0004489_9951_10691 233
2080 3300049823 Ga0501044_0008000 Ga0501044_0008000_9929_10660 233
2081 3300049823 Ga0501044_0051163 Ga0501044_0051163_120_851 233
2082 3300050489 nmdc:mga03683_27233_c1 nmdc:mga03683_27233_c1_493_1224 233
2083 3300050489 nmdc:mga03683_97921_c1 nmdc:mga03683_97921_c1_77_808 233
2084 3300050490 nmdc:mga03n38_84732_c1 nmdc:mga03n38_84732_c1_349_1080 233
2085 3300050490 nmdc:mga03n38_85292_c1 nmdc:mga03n38_85292_c1_646_1377 233
2086 3300050491 nmdc:mga00v17_196701_c1 nmdc:mga00v17_196701_c1_516_1247 233
2087 3300050491 nmdc:mga00v17_77862_c1 nmdc:mga00v17_77862_c1_353_1084 233
2088 3300050492 nmdc:mga0yw44_140738_c1 nmdc:mga0yw44_140738_c1_157_888 233
2089 3300050492 nmdc:mga0yw44_14514_c1 nmdc:mga0yw44_14514_c1_1473_2204 233
2090 3300050492 nmdc:mga0yw44_350459_c1 nmdc:mga0yw44_350459_c1_89_820 233
2091 3300050492 nmdc:mga0yw44_45730_c1 nmdc:mga0yw44_45730_c1_879_1610 233
2092 3300050492 nmdc:mga0yw44_492520_c1 nmdc:mga0yw44_492520_c1_31_762 233
2093 3300050492 nmdc:mga0yw44_68185_c1 nmdc:mga0yw44_68185_c1_772_1503 233
2094 3300050493 nmdc:mga0k408_109555_c1 nmdc:mga0k408_109555_c1_521_1252 233
2095 3300050493 nmdc:mga0k408_127250_c1 nmdc:mga0k408_127250_c1_247_978 233
2096 3300050493 nmdc:mga0k408_26665_c1 nmdc:mga0k408_26665_c1_386_1117 233
2097 3300050494 nmdc:mga06z11_10443_c1 nmdc:mga06z11_10443_c1_1247_1978 233
2098 3300050494 nmdc:mga06z11_10573_c1 nmdc:mga06z11_10573_c1_1849_2580 233
2099 3300050495 nmdc:mga04h51_31619_c1 nmdc:mga04h51_31619_c1_530_1261 233
2100 3300050496 nmdc:mga07m45_20986_c1 nmdc:mga07m45_20986_c1_2175_2906 233
2101 3300050507 nmdc:mga05p37_734746_c1 nmdc:mga05p37_734746_c1_297_1028 233
2102 3300050511 nmdc:mga08y16_164563_c1 nmdc:mga08y16_164563_c1_193_924 233
2103 3300050512 nmdc:mga0n895_2429_c1 nmdc:mga0n895_2429_c1_4093_4824 233
2104 3300050512 nmdc:mga0n895_484681_c1 nmdc:mga0n895_484681_c1_294_1025 233
2105 3300050515 nmdc:mga0a205_250175_c1 nmdc:mga0a205_250175_c1_227_958 233
2106 3300050516 nmdc:mga0sz30_16712_c2 nmdc:mga0sz30_16712_c2_261_992 233
2107 3300050516 nmdc:mga0sz30_17797_c1 nmdc:mga0sz30_17797_c1_407_1138 233
2108 3300050516 nmdc:mga0sz30_25341_c1 nmdc:mga0sz30_25341_c1_792_1523 233
2109 3300050516 nmdc:mga0sz30_67783_c1 nmdc:mga0sz30_67783_c1_159_890 233
2110 3300053077 Ga0495601_0176026 Ga0495601_0176026_611_1342 233
2111 3300053079 Ga0500610_0068549 Ga0500610_0068549_353_1084 233
2112 3300053079 Ga0500610_0172374 Ga0500610_0172374_55_786 233
2113 3300053080 Ga0500635_0000979 Ga0500635_0000979_1314_2045 233
2114 3300053080 Ga0500635_0007194 Ga0500635_0007194_784_1515 233
2115 3300053083 Ga0495655_0005449 Ga0495655_0005449_406_1137 233
2116 3300053083 Ga0495655_0008570 Ga0495655_0008570_348_1079 233
2117 3300053084 Ga0495595_0006014 Ga0495595_0006014_1032_1763 233
2118 3300053084 Ga0495595_0055642 Ga0495595_0055642_469_1200 233
2119 3300053084 Ga0495595_0112976 Ga0495595_0112976_341_1072 233
2120 3300053085 Ga0495619_0030652 Ga0495619_0030652_715_1446 233
2121 3300053085 Ga0495619_0102071 Ga0495619_0102071_723_1454 233
2122 3300053087 Ga0500643_000052 Ga0500643_000052_2661_3392 233
2123 3300053087 Ga0500643_027137 Ga0500643_027137_104_835 233
2124 3300053091 Ga0500647_0119995 Ga0500647_0119995_247_978 233
2125 3300053093 Ga0500651_0243518 Ga0500651_0243518_193_924 233
2126 3300053094 Ga0500566_0000181 Ga0500566_0000181_2547_3278 233
2127 3300053094 Ga0500566_0053494 Ga0500566_0053494_933_1664 233
2128 3300053094 Ga0500566_0057395 Ga0500566_0057395_1112_1843 233
2129 3300053094 Ga0500566_0067942 Ga0500566_0067942_535_1266 233
2130 3300053095 Ga0500640_006447 Ga0500640_006447_1198_1929 233
2131 3300053095 Ga0500640_056383 Ga0500640_056383_170_901 233
2132 3300053096 Ga0500641_0030645 Ga0500641_0030645_197_928 233
2133 3300053097 Ga0500648_234140 Ga0500648_234140_46_777 233
2134 3300053098 Ga0500650_0208243 Ga0500650_0208243_79_810 233
2135 3300053102 Ga0500554_002768 Ga0500554_002768_2587_3318 233
2136 3300053104 Ga0500556_0083363 Ga0500556_0083363_171_902 233
2137 3300053105 Ga0500557_000046 Ga0500557_000046_52085_52816 233
2138 3300053109 Ga0500569_076622 Ga0500569_076622_245_976 233
2139 3300053109 Ga0500569_083805 Ga0500569_083805_38_769 233
2140 3300053111 Ga0500572_001605 Ga0500572_001605_2732_3463 233
2141 3300053115 Ga0500591_014440 Ga0500591_014440_1869_2600 233
2142 3300053117 Ga0500593_000061 Ga0500593_000061_32482_33213 233
2143 3300053118 Ga0500594_0005284 Ga0500594_0005284_1001_1732 233
2144 3300053118 Ga0500594_0084666 Ga0500594_0084666_103_834 233
2145 3300053119 Ga0500595_000436 Ga0500595_000436_7011_7742 233
2146 3300053119 Ga0500595_004916 Ga0500595_004916_1620_2351 233
2147 3300053119 Ga0500595_014551 Ga0500595_014551_181_912 233
2148 3300053119 Ga0500595_017928 Ga0500595_017928_733_1464 233
2149 3300053119 Ga0500595_022350 Ga0500595_022350_1028_1759 233
2150 3300053119 Ga0500595_036353 Ga0500595_036353_634_1365 233
2151 3300053120 Ga0500597_105025 Ga0500597_105025_384_1115 233
2152 3300053121 Ga0500607_033998 Ga0500607_033998_1564_2295 233
2153 3300053122 Ga0500608_015000 Ga0500608_015000_1609_2340 233
2154 3300053136 Ga0500559_0022574 Ga0500559_0022574_1296_2027 233
2155 3300053136 Ga0500559_0030345 Ga0500559_0030345_1448_2179 233
2156 3300053138 Ga0500564_068772 Ga0500564_068772_68_799 233
2157 3300053139 Ga0500568_0000005 Ga0500568_0000005_596694_597425 233
2158 3300053139 Ga0500568_0074848 Ga0500568_0074848_143_874 233
2159 3300053142 Ga0500577_0001496 Ga0500577_0001496_110_844 233
2160 3300053142 Ga0500577_0037014 Ga0500577_0037014_451_1182 233
2161 3300053148 Ga0500590_031550 Ga0500590_031550_963_1694 233
2162 3300053148 Ga0500590_127463 Ga0500590_127463_22_753 233
2163 3300053148 Ga0500590_135385 Ga0500590_135385_55_786 233
2164 3300053150 Ga0500603_002928 Ga0500603_002928_2652_3383 233
2165 3300053156 Ga0500622_0008750 Ga0500622_0008750_3729_4460 233
2166 3300053156 Ga0500622_0105597 Ga0500622_0105597_387_1118 233
2167 3300053156 Ga0500622_0112082 Ga0500622_0112082_205_936 233
2168 3300053159 Ga0500630_005801 Ga0500630_005801_2511_3242 233
2169 3300053161 Ga0500634_0052269 Ga0500634_0052269_1209_1940 233
2170 3300053162 Ga0500638_133738 Ga0500638_133738_299_1030 233
2171 3300053162 Ga0500638_151193 Ga0500638_151193_102_833 233
2172 3300053163 Ga0500639_000035 Ga0500639_000035_9460_10191 233
2173 3300053177 Ga0500636_0004059 Ga0500636_0004059_1076_1807 233
2174 3300053177 Ga0500636_0057434 Ga0500636_0057434_448_1179 233
2175 3300053177 Ga0500636_0059047 Ga0500636_0059047_978_1709 233
2176 3300053177 Ga0500636_0067309 Ga0500636_0067309_474_1265 233
2177 3300053177 Ga0500636_0092555 Ga0500636_0092555_570_1301 233
2178 3300053178 Ga0500637_0000068 Ga0500637_0000068_12992_13723 233
2179 3300053178 Ga0500637_0078495 Ga0500637_0078495_440_1171 233
2180 3300053729 Ga0500625_022280 Ga0500625_022280_2047_2778 233
2181 3300053730 Ga0500645_015954 Ga0500645_015954_710_1441 233
2182 3300053731 Ga0500609_003220 Ga0500609_003220_1424_2155 233
2183 3300053733 Ga0500552_001241 Ga0500552_001241_968_1699 233
2184 3300053735 Ga0500596_000368 Ga0500596_000368_1791_2522 233
2185 3300053735 Ga0500596_001567 Ga0500596_001567_1195_1926 233
2186 3300053736 Ga0500599_001055 Ga0500599_001055_1581_2312 233
2187 3300053737 Ga0500601_002196 Ga0500601_002196_79_810 233
2188 3300054114 Ga0501084_0059181 Ga0501084_0059181_207_941 233
2189 3300055283 Ga0500661_004938 Ga0500661_004938_1436_2167 233
2190 3300060353 Ga0501082_0019165 Ga0501082_0019165_4022_4756 233
2191 3300061719 Ga0466962_0144758 Ga0466962_0144758_247_978 233
2192 3300061734 Ga0530510_0088675 Ga0530510_0088675_811_1545 233
2193 3300061734 Ga0530510_0179068 Ga0530510_0179068_16_747 233
2194 iso_pu_bacteria 2818991436 2819543530 233
2195 iso_pu_bacteria 2821123053 2821126632 233
2196 iso_pu_bacteria 2838736955 2838740240 233
2197 iso_pu_bacteria 2841840854 2841843635 233
2198 iso_pu_bacteria 2842140634 2842143355 233
2199 iso_pu_bacteria 2857531043 2857536724 233
2200 iso_pu_bacteria 2857576091 2857580830 233
2201 iso_pu_bacteria 8016595262 8016596749 233
2202 iso_pu_bacteria 8019538911 8019541668 233
2203 3300009551 Ga0105238_10001573 Ga0105238_1000157324 234
2204 3300025913 Ga0207695_10242832 Ga0207695_102428321 234
2205 3300028794 Ga0307515_10000734 Ga0307515_1000073444 234
2206 3300035089 Ga0373944_0062476 Ga0373944_0062476_228_962 234
2207 3300039453 Ga0436362_1125969 Ga0436362_1125969_19_753 234
2208 3300046452 Ga0495617_000443 Ga0495617_000443_3985_4743 234
2209 3300046507 Ga0495606_0000807 Ga0495606_0000807_17566_18312 234
2210 iso_pu_bacteria 2643221594 2643983182 234
2211 iso_pu_bacteria 2808606395 2809033293 234
2212 iso_pu_bacteria 2823421272 2823425253 234
2213 iso_pu_bacteria 2858950400 2858950842 234
2214 iso_pu_bacteria 8034962539 8034963249 234
2215 3300005457 Ga0070662_100011694 Ga0070662_1000116943 235
2216 3300005459 Ga0068867_100048059 Ga0068867_1000480593 235
2217 3300006195 Ga0075366_10005769 Ga0075366_100057696 235
2218 3300025940 Ga0207691_10478152 Ga0207691_104781522 235
2219 3300031548 Ga0307408_100006654 Ga0307408_1000066547 235
2220 3300032002 Ga0307416_100798787 Ga0307416_1007987872 235
2221 3300046460 Ga0495638_0133941 Ga0495638_0133941_454_1185 235
2222 3300046471 Ga0495650_0000777 Ga0495650_0000777_23644_24375 235
2223 3300046542 Ga0495597_0000285 Ga0495597_0000285_34636_35385 235
2224 3300046542 Ga0495597_0013722 Ga0495597_0013722_304_1038 235
2225 3300046691 Ga0495670_0024018 Ga0495670_0024018_1677_2405 235
2226 3300047443 Ga0495687_000548 Ga0495687_000548_30869_31603 235
2227 3300047443 Ga0495687_001324 Ga0495687_001324_11005_11736 235
2228 3300048091 Ga0495626_0074073 Ga0495626_0074073_366_1100 235
2229 3300048906 Ga0496103_0029262 Ga0496103_0029262_1713_2444 235
2230 3300050493 nmdc:mga0k408_8117_c1 nmdc:mga0k408_8117_c1_117_854 235
2231 3300003354 JGI25160J50197_1002292 JGI25160J50197_10022927 236
2232 3300003374 JGI25161J50226_1000568 JGI25161J50226_100056813 236
2233 3300003751 Ga0055538_1000084 Ga0055538_100008449 236
2234 3300003752 Ga0055539_1000125 Ga0055539_100012549 236
2235 3300003756 Ga0055533_1000132 Ga0055533_100013249 236
2236 3300003759 Ga0055525_1000171 Ga0055525_100017149 236
2237 3300003771 Ga0055526_1001304 Ga0055526_10013045 236
2238 3300003773 Ga0055537_1000853 Ga0055537_10008532 236
2239 3300003775 Ga0055524_1003008 Ga0055524_100300810 236
2240 3300003775 Ga0055524_1003701 Ga0055524_10037012 236
2241 3300003775 Ga0055524_1004101 Ga0055524_10041017 236
2242 3300003784 Ga0055534_1000803 Ga0055534_10008037 236
2243 3300003784 Ga0055534_1008291 Ga0055534_10082913 236
2244 3300003790 Ga0055528_1001770 Ga0055528_10017705 236
2245 3300003791 Ga0055530_10021636 Ga0055530_100216362 236
2246 3300003791 Ga0055530_10021637 Ga0055530_100216372 236
2247 3300003794 Ga0055531_10005239 Ga0055531_100052392 236
2248 3300003841 Ga0055541_1000083 Ga0055541_100008329 236
2249 3300005262 Ga0065165_1044585 Ga0065165_10445852 236
2250 3300005563 Ga0068855_100001493 Ga0068855_10000149324 236
2251 3300005563 Ga0068855_100207537 Ga0068855_1002075372 236
2252 3300005578 Ga0068854_100005558 Ga0068854_1000055586 236
2253 3300009093 Ga0105240_10038483 Ga0105240_100384836 236
2254 3300009545 Ga0105237_10003792 Ga0105237_1000379218 236
2255 3300010375 Ga0105239_10020094 Ga0105239_100200946 236
2256 3300015261 Ga0182006_1009857 Ga0182006_10098574 236
2257 3300025208 Ga0209436_100322 Ga0209436_10032210 236
2258 3300025224 Ga0209784_100009 Ga0209784_100009611 236
2259 3300025225 Ga0209566_100007 Ga0209566_100007611 236
2260 3300025226 Ga0209674_100018 Ga0209674_100018611 236
2261 3300025230 Ga0209563_100020 Ga0209563_100020611 236
2262 3300025253 Ga0209677_100010 Ga0209677_100010611 236
2263 3300025263 Ga0209565_1000459 Ga0209565_10004594 236
2264 3300025263 Ga0209565_1000488 Ga0209565_10004882 236
2265 3300025263 Ga0209565_1003784 Ga0209565_10037844 236
2266 3300025263 Ga0209565_1015061 Ga0209565_10150611 236
2267 3300025284 Ga0209130_1000493 Ga0209130_100049324 236
2268 3300025291 Ga0209675_1002650 Ga0209675_10026509 236
2269 3300025291 Ga0209675_1005953 Ga0209675_10059532 236
2270 3300025295 Ga0209564_1000098 Ga0209564_100009825 236
2271 3300025295 Ga0209564_1007991 Ga0209564_10079912 236
2272 3300025295 Ga0209564_1036990 Ga0209564_10369901 236
2273 3300025298 Ga0209050_1000183 Ga0209050_1000183116 236
2274 3300025298 Ga0209050_1001801 Ga0209050_100180120 236
2275 3300025299 Ga0209256_1001704 Ga0209256_10017044 236
2276 3300025299 Ga0209256_1008037 Ga0209256_10080375 236
2277 3300025302 Ga0207426_1001049 Ga0207426_100104924 236
2278 3300025303 Ga0209051_1017007 Ga0209051_10170073 236
2279 3300025304 Ga0209257_1000010 Ga0209257_100001025 236
2280 3300025304 Ga0209257_1001077 Ga0209257_100107735 236
2281 3300025913 Ga0207695_10000564 Ga0207695_1000056433 236
2282 3300025914 Ga0207671_10021253 Ga0207671_100212533 236
2283 3300025949 Ga0207667_10000283 Ga0207667_1000028328 236
2284 3300025949 Ga0207667_10027249 Ga0207667_100272494 236
2285 3300031548 Ga0307408_100001191 Ga0307408_10000119115 236
2286 3300046457 Ga0495590_0035250 Ga0495590_0035250_658_1395 236
2287 3300046474 Ga0495605_0082558 Ga0495605_0082558_198_935 236
2288 3300046501 Ga0495607_0094525 Ga0495607_0094525_804_1541 236
2289 3300046506 Ga0495583_0036163 Ga0495583_0036163_370_1107 236
2290 3300046513 Ga0495616_0012903 Ga0495616_0012903_3110_3847 236
2291 3300046522 Ga0495643_0015807 Ga0495643_0015807_601_1347 236
2292 3300046528 Ga0495642_0008146 Ga0495642_0008146_2148_2885 236
2293 3300046528 Ga0495642_0011728 Ga0495642_0011728_2180_2926 236
2294 3300046528 Ga0495642_0032670 Ga0495642_0032670_161_907 236
2295 3300046538 Ga0495609_0002146 Ga0495609_0002146_1169_1906 236
2296 3300046616 Ga0495668_0071192 Ga0495668_0071192_270_1007 236
2297 3300046660 Ga0495625_0007076 Ga0495625_0007076_8303_9040 236
2298 3300046664 Ga0495659_0000741 Ga0495659_0000741_3502_4239 236
2299 3300046665 Ga0495661_0005792 Ga0495661_0005792_6725_7471 236
2300 3300046665 Ga0495661_0071339 Ga0495661_0071339_276_1013 236
2301 3300046684 Ga0495669_0012169 Ga0495669_0012169_1957_2694 236
2302 3300046694 Ga0495649_0007278 Ga0495649_0007278_896_1633 236
2303 3300047318 Ga0495636_0007159 Ga0495636_0007159_3110_3847 236
2304 3300047443 Ga0495687_003369 Ga0495687_003369_8650_9396 236
2305 3300047443 Ga0495687_021501 Ga0495687_021501_2086_2823 236
2306 3300047445 Ga0495677_0010538 Ga0495677_0010538_1013_1750 236
2307 3300047447 Ga0495685_018083 Ga0495685_018083_428_1165 236
2308 3300047470 Ga0495681_0040249 Ga0495681_0040249_1140_1877 236
2309 3300048905 Ga0496102_0001172 Ga0496102_0001172_20877_21623 236
2310 3300048906 Ga0496103_0022306 Ga0496103_0022306_843_1589 236
2311 3300049775 Ga0501279_007348 Ga0501279_007348_143_889 236
2312 3300002737 JGI25162J39368_1000063 JGI25162J39368_100006324 237
2313 3300002772 JGI25164J39214_1008879 JGI25164J39214_10088791 237
2314 3300003214 JGI25165J46597_1000069 JGI25165J46597_100006924 237
2315 3300003751 Ga0055538_1000034 Ga0055538_100003423 237
2316 3300003752 Ga0055539_1000044 Ga0055539_100004423 237
2317 3300003756 Ga0055533_1000055 Ga0055533_100005523 237
2318 3300003759 Ga0055525_1000066 Ga0055525_1000066159 237
2319 3300003841 Ga0055541_1000032 Ga0055541_1000032160 237
2320 3300005435 Ga0070714_100011995 Ga0070714_1000119952 237
2321 3300005437 Ga0070710_10003504 Ga0070710_100035045 237
2322 3300005439 Ga0070711_100028570 Ga0070711_1000285702 237
2323 3300005518 Ga0070699_100004728 Ga0070699_1000047283 237
2324 3300005546 Ga0070696_100173584 Ga0070696_1001735842 237
2325 3300005548 Ga0070665_100073310 Ga0070665_1000733103 237
2326 3300005841 Ga0068863_100376497 Ga0068863_1003764972 237
2327 3300005983 Ga0081540_1004620 Ga0081540_10046202 237
2328 3300006028 Ga0070717_10005721 Ga0070717_100057216 237
2329 3300006163 Ga0070715_10001538 Ga0070715_100015382 237
2330 3300006173 Ga0070716_100002810 Ga0070716_1000028105 237
2331 3300006186 Ga0075369_10108220 Ga0075369_101082202 237
2332 3300006847 Ga0075431_100098559 Ga0075431_1000985592 237
2333 3300006871 Ga0075434_100325424 Ga0075434_1003254242 237
2334 3300006881 Ga0068865_100329957 Ga0068865_1003299572 237
2335 3300006914 Ga0075436_100067348 Ga0075436_1000673483 237
2336 3300007265 Ga0099794_10016216 Ga0099794_100162163 237
2337 3300009147 Ga0114129_10182254 Ga0114129_101822543 237
2338 3300009147 Ga0114129_10197285 Ga0114129_101972854 237
2339 3300013307 Ga0157372_10633607 Ga0157372_106336072 237
2340 3300015261 Ga0182006_1003655 Ga0182006_10036556 237
2341 3300015262 Ga0182007_10000965 Ga0182007_100009659 237
2342 3300015262 Ga0182007_10006430 Ga0182007_100064303 237
2343 3300015265 Ga0182005_1000289 Ga0182005_100028910 237
2344 3300025207 Ga0209760_104196 Ga0209760_1041962 237
2345 3300025224 Ga0209784_100049 Ga0209784_100049159 237
2346 3300025225 Ga0209566_100061 Ga0209566_100061159 237
2347 3300025226 Ga0209674_100069 Ga0209674_100069208 237
2348 3300025228 Ga0209672_114680 Ga0209672_1146801 237
2349 3300025230 Ga0209563_100083 Ga0209563_100083159 237
2350 3300025231 Ga0207427_100638 Ga0207427_10063815 237
2351 3300025233 Ga0209437_100091 Ga0209437_100091207 237
2352 3300025253 Ga0209677_100039 Ga0209677_100039208 237
2353 3300025261 Ga0209233_1000115 Ga0209233_1000115207 237
2354 3300025898 Ga0207692_10012527 Ga0207692_100125273 237
2355 3300025905 Ga0207685_10002297 Ga0207685_100022972 237
2356 3300025910 Ga0207684_10029380 Ga0207684_100293804 237
2357 3300025915 Ga0207693_10004235 Ga0207693_100042356 237
2358 3300025916 Ga0207663_10028851 Ga0207663_100288513 237
2359 3300025933 Ga0207706_10396807 Ga0207706_103968072 237
2360 3300025972 Ga0207668_10905459 Ga0207668_109054591 237
2361 3300028379 Ga0268266_10097804 Ga0268266_100978043 237
2362 3300028381 Ga0268264_10483459 Ga0268264_104834591 237
2363 3300039438 Ga0436360_1044005 Ga0436360_1044005_205_954 237
2364 3300039447 Ga0436361_0586765 Ga0436361_0586765_7251_8000 237
2365 3300039450 Ga0436363_1579908 Ga0436363_1579908_326_1075 237
2366 3300046462 Ga0495651_0019968 Ga0495651_0019968_3482_4234 237
2367 3300046462 Ga0495651_0022000 Ga0495651_0022000_1595_2347 237
2368 3300046463 Ga0495653_0026426 Ga0495653_0026426_1083_1835 237
2369 3300046501 Ga0495607_0000357 Ga0495607_0000357_4338_5090 237
2370 3300046511 Ga0495608_0068581 Ga0495608_0068581_953_1705 237
2371 3300046516 Ga0495628_0005950 Ga0495628_0005950_6395_7147 237
2372 3300046516 Ga0495628_0046395 Ga0495628_0046395_2606_3358 237
2373 3300046516 Ga0495628_0167411 Ga0495628_0167411_894_1646 237
2374 3300046529 Ga0495652_0021794 Ga0495652_0021794_3576_4328 237
2375 3300046529 Ga0495652_0110709 Ga0495652_0110709_116_868 237
2376 3300046529 Ga0495652_0388856 Ga0495652_0388856_218_970 237
2377 3300046557 Ga0495622_0023709 Ga0495622_0023709_531_1283 237
2378 3300046678 Ga0495599_0018392 Ga0495599_0018392_2585_3337 237
2379 3300046679 Ga0495623_0087939 Ga0495623_0087939_791_1543 237
2380 3300046809 Ga0495600_0006479 Ga0495600_0006479_1469_2221 237
2381 3300047317 Ga0495604_0008499 Ga0495604_0008499_578_1330 237
2382 3300048088 Ga0495602_0049438 Ga0495602_0049438_2257_3009 237
2383 3300048091 Ga0495626_0102724 Ga0495626_0102724_99_851 237
2384 3300048904 Ga0496101_0573936 Ga0496101_0573936_89_838 237
2385 3300048905 Ga0496102_0427310 Ga0496102_0427310_11_760 237
2386 3300048909 Ga0496106_0736322 Ga0496106_0736322_24_773 237
2387 3300048912 Ga0496109_0684599 Ga0496109_0684599_134_883 237
2388 3300048913 Ga0496110_0068064 Ga0496110_0068064_437_1186 237
2389 3300048915 Ga0496112_0196732 Ga0496112_0196732_376_1125 237
2390 3300048924 Ga0496121_0041119 Ga0496121_0041119_2121_2867 237
2391 3300048927 Ga0496124_0499367 Ga0496124_0499367_37_783 237
2392 3300049590 Ga0501074_0235232 Ga0501074_0235232_49_807 237
2393 3300050507 nmdc:mga05p37_29281_c1 nmdc:mga05p37_29281_c1_5284_6033 237
2394 3300050507 nmdc:mga05p37_497346_c1 nmdc:mga05p37_497346_c1_622_1371 237
2395 3300050512 nmdc:mga0n895_216795_c1 nmdc:mga0n895_216795_c1_486_1235 237
2396 3300050514 nmdc:mga08x19_78211_c1 nmdc:mga08x19_78211_c1_165_914 237
2397 3300053077 Ga0495601_0065900 Ga0495601_0065900_430_1182 237
2398 3300053119 Ga0500595_008290 Ga0500595_008290_2540_3292 237
2399 3300053154 Ga0500619_001415 Ga0500619_001415_2570_3322 237
2400 2162886007 SwRhRL2b_contig_742313 SwRhRL2b_0935.00002230 238
2401 3300005289 Ga0065704_10071994 Ga0065704_100719949 238
2402 3300005356 Ga0070674_100078979 Ga0070674_1000789792 238
2403 3300005614 Ga0068856_100026984 Ga0068856_1000269843 238
2404 3300005983 Ga0081540_1017756 Ga0081540_10177563 238
2405 3300006173 Ga0070716_100181172 Ga0070716_1001811722 238
2406 3300006847 Ga0075431_100608554 Ga0075431_1006085542 238
2407 3300006852 Ga0075433_10062410 Ga0075433_100624102 238
2408 3300006871 Ga0075434_100002775 Ga0075434_1000027752 238
2409 3300006880 Ga0075429_100185389 Ga0075429_1001853892 238
2410 3300006914 Ga0075436_100455706 Ga0075436_1004557062 238
2411 3300007076 Ga0075435_100111899 Ga0075435_1001118992 238
2412 3300009094 Ga0111539_10001811 Ga0111539_1000181111 238
2413 3300009094 Ga0111539_10174238 Ga0111539_101742383 238
2414 3300009098 Ga0105245_10411927 Ga0105245_104119271 238
2415 3300013105 Ga0157369_10347282 Ga0157369_103472822 238
2416 3300027907 Ga0207428_10000176 Ga0207428_1000017669 238
2417 3300027907 Ga0207428_10109083 Ga0207428_101090832 238
2418 3300027907 Ga0207428_10448711 Ga0207428_104487111 238
2419 3300044683 Ga0466965_0261780 Ga0466965_0261780_154_906 238
2420 3300046474 Ga0495605_0012906 Ga0495605_0012906_1927_2667 238
2421 3300046501 Ga0495607_0000399 Ga0495607_0000399_3804_4544 238
2422 3300046530 Ga0495654_0000582 Ga0495654_0000582_6465_7220 238
2423 3300046810 Ga0495660_0001759 Ga0495660_0001759_10830_11597 238
2424 3300047320 Ga0495672_0181908 Ga0495672_0181908_283_1023 238
2425 3300047469 Ga0495673_0000376 Ga0495673_0000376_45571_46311 238
2426 3300048903 Ga0496100_0001892 Ga0496100_0001892_7822_8574 238
2427 3300048904 Ga0496101_0013897 Ga0496101_0013897_1021_1773 238
2428 3300048905 Ga0496102_0002100 Ga0496102_0002100_7303_8055 238
2429 3300048906 Ga0496103_0069861 Ga0496103_0069861_1330_2082 238
2430 3300048907 Ga0496104_0018887 Ga0496104_0018887_2120_2872 238
2431 3300048907 Ga0496104_0075521 Ga0496104_0075521_2319_3071 238
2432 3300048908 Ga0496105_0231827 Ga0496105_0231827_345_1097 238
2433 3300048909 Ga0496106_0002880 Ga0496106_0002880_11281_12033 238
2434 3300048911 Ga0496108_0002033 Ga0496108_0002033_10921_11673 238
2435 3300048911 Ga0496108_0031803 Ga0496108_0031803_1164_1916 238
2436 3300048912 Ga0496109_0004557 Ga0496109_0004557_10673_11425 238
2437 3300048912 Ga0496109_0093976 Ga0496109_0093976_418_1170 238
2438 3300048913 Ga0496110_0006020 Ga0496110_0006020_7683_8435 238
2439 3300048913 Ga0496110_0011625 Ga0496110_0011625_5540_6292 238
2440 3300048914 Ga0496111_0002199 Ga0496111_0002199_8852_9604 238
2441 3300048914 Ga0496111_0007494 Ga0496111_0007494_5258_6010 238
2442 3300048915 Ga0496112_0012228 Ga0496112_0012228_6493_7245 238
2443 3300048915 Ga0496112_0015303 Ga0496112_0015303_4725_5477 238
2444 3300048915 Ga0496112_0039352 Ga0496112_0039352_3457_4209 238
2445 3300048916 Ga0496113_0128968 Ga0496113_0128968_477_1229 238
2446 3300048918 Ga0496115_0035259 Ga0496115_0035259_695_1447 238
2447 3300049581 Ga0501047_0004523 Ga0501047_0004523_1983_2744 238
2448 3300050507 nmdc:mga05p37_32260_c1 nmdc:mga05p37_32260_c1_602_1357 238
2449 3300050508 nmdc:mga09592_680285_c1 nmdc:mga09592_680285_c1_100_855 238
2450 3300050510 nmdc:mga06r32_415880_c1 nmdc:mga06r32_415880_c1_255_1052 238
2451 3300050511 nmdc:mga08y16_121923_c1 nmdc:mga08y16_121923_c1_1660_2457 238
2452 3300050511 nmdc:mga08y16_917660_c1 nmdc:mga08y16_917660_c1_58_813 238
2453 3300050512 nmdc:mga0n895_87597_c1 nmdc:mga0n895_87597_c1_817_1572 238
2454 3300050515 nmdc:mga0a205_119665_c1 nmdc:mga0a205_119665_c1_763_1518 238
2455 3300050515 nmdc:mga0a205_371_c1 nmdc:mga0a205_371_c1_1481_2236 238
2456 3300053125 Ga0500618_001833 Ga0500618_001833_3620_4369 238
2457 iso_pu_bacteria 2643221569 2643861783 238

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

82

279

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ymu-assembly1.cif.gz_C crystal structure of an amino acid abc transporter complex with arginines and atps 0.7999 21 233
3rlf-assembly1.cif.gz_F crystal structure of the maltose-binding protein/maltose transporter complex in an outward-facing conformation bound to mgamppnp 0.7842 22 176
4jbw-assembly2.cif.gz_H crystal structure of e. coli maltose transporter malfgk2 in complex with its regulatory protein eiiaglc 0.7682 21 176
3tuz-assembly2.cif.gz_F inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form 0.7634 23 234
4ymu-assembly1.cif.gz_C crystal structure of an amino acid abc transporter complex with arginines and atps 0.7598 21 233
ID Description Score Start End Superfamily
af_P0AER3_18_239_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9124 19 234 1.10.3720.10
af_P0AER3_18_239_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8848 19 234 1.10.3720.10
af_P0AEQ6_1_218_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8614 22 235 1.10.3720.10
af_P0AFT2_3_219_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.86 22 237 1.10.3720.10
af_P45768_144_364_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8466 31 234 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A087LWB3-F1-model_v4 deleted 0.9543 1 143
AF-A0A4Q3BPZ2-F1-model_v4 deleted 0.9541 1 159
AF-A0A087LWB3-F1-model_v4 deleted 0.9415 1 143
AF-A0A4Q3BPZ2-F1-model_v4 deleted 0.9369 1 159
AF-A0A376RNY9-F1-model_v4 Glutamate/aspartate transport system permease 0.9364 1 138 GO:0006865
GO:0022857
GO:0043190

Feature Viewer

pLDDT pTM Quality
87.51 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map