metagRoot

F496751

General Info

Members	Datasets	Scaffolds	Average Seq Length
2374	913	4748	374

Family's Representative Sequence

Representative Sequence	3300006058\|Ga0075432_10029480\|Ga0075432_100294801
Length	432
Sequence	MHARFGMPRGNPPDHRILHQFVKTLFVAYSAAPKMRNGPAEHNAKVAGRVFSVGTCMERDNMTDSKSPRRRNLLKGAAVAAGAMSAPMVSMAQTTSLRFQSTWPAKDIFHEYAQDFAKKVNDMAGNRLKIEVLPAGSVVPAFQLLDAVAKGTLDGGHGVVAYWYGKNSALALWGSGPGYGMDANMVLAWHNYGGGKALIEEIYKSLNLDVVSYLYGPMPTQPLGWFKKPVARVEDMKGLKFRTVGLAVDVFTDMGTAVNPLPGGEIVPALDRGLIDAAEFNNASSDRVLGFPDVAKNCMLQSFHQSGEQFEILFNKGKLAALAPELKSIIDYAVQASSADMSWKAIQRNSQDYIELKKAGIKFYKTPDAILRAQLASWDKTIAKKSAENPMFKKVLDSQKAFAERAGQWHNDYTVDFKMAYNHYFGAQAKKS

Samples

	Sample ID	Description	Type	Environment
1	3300006058	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1	Metagenome	Rhizosphere
2	2162886007	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1	Metagenome	Rhizosphere
3	3300000042	Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young	Metagenome	Rhizosphere
4	3300000044	Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old	Metagenome	Rhizosphere
5	3300001430	Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5	Metagenome	Rhizosphere
6	3300001977	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5	Metagenome	Rhizosphere
7	3300001979	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6	Metagenome	Rhizosphere
8	3300001989	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5	Metagenome	Rhizosphere
9	3300001990	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3	Metagenome	Rhizosphere
10	3300002070	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4	Metagenome	Rhizosphere
11	3300002073	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4	Metagenome	Rhizosphere
12	3300002074	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1	Metagenome	Rhizosphere
13	3300002075	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4	Metagenome	Rhizosphere
14	3300002076	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3	Metagenome	Rhizosphere
15	3300002077	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3	Metagenome	Rhizosphere
16	3300002126	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5	Metagenome	Rhizosphere
17	3300002239	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2	Metagenome	Rhizosphere
18	3300002244	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1	Metagenome	Rhizosphere
19	3300002704	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB	Metagenome	Unclassified
20	3300002705	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS	Metagenome	Unclassified
21	3300002738	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA	Metagenome	Unclassified
22	3300002739	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA	Metagenome	Endosphere
23	3300002741	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL	Metagenome	Unclassified
24	3300002774	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA	Metagenome	Endosphere
25	3300002987	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB	Metagenome	Endosphere
26	3300003187	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB	Metagenome	Endosphere
27	3300003215	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF	Metagenome	Endosphere
28	3300003316	Sugarcane root Sample L1	Metagenome	Unclassified
29	3300003322	Sugarcane root Sample L2	Metagenome	Unclassified
30	3300003354	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS	Metagenome	Endosphere
31	3300003374	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF	Metagenome	Endosphere
32	3300003659	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Metagenome	Rhizosphere
33	3300003761	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2	Metagenome	Endosphere
34	3300003762	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2	Metagenome	Endosphere
35	3300003771	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2	Metagenome	Endosphere
36	3300003773	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2	Metagenome	Endosphere
37	3300003775	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2	Metagenome	Endosphere
38	3300003781	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2	Metagenome	Endosphere
39	3300003784	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2	Metagenome	Endosphere
40	3300003790	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2	Metagenome	Endosphere
41	3300003791	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2	Metagenome	Endosphere
42	3300003792	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2	Metagenome	Endosphere
43	3300003794	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2	Metagenome	Endosphere
44	3300004625	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2	Metagenome	Endosphere
45	3300004798	Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome)	Metatranscriptome	Unclassified
46	3300004800	Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
47	3300004801	Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome)	Metatranscriptome	Unclassified
48	3300005262	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3)	Metagenome	Endosphere
49	3300005288	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2)	Metagenome	Rhizosphere
50	3300005289	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2)	Metagenome	Rhizosphere
51	3300005290	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3)	Metagenome	Rhizosphere
52	3300005293	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2)	Metagenome	Rhizosphere
53	3300005295	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2)	Metagenome	Rhizosphere
54	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
55	3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Metagenome	Rhizosphere
56	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
57	3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Metagenome	Rhizosphere
58	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
59	3300005333	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG	Metagenome	Rhizosphere
60	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
61	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
62	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
63	3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Metagenome	Rhizosphere
64	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
65	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
66	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
67	3300005341	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG	Metagenome	Rhizosphere
68	3300005343	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG	Metagenome	Rhizosphere
69	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
70	3300005345	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG	Metagenome	Rhizosphere
71	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
72	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
73	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
74	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
75	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
76	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
77	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
78	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
79	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
80	3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Metagenome	Rhizosphere
81	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
82	3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Metagenome	Rhizosphere
83	3300005437	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG	Metagenome	Rhizosphere
84	3300005438	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG	Metagenome	Rhizosphere
85	3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Metagenome	Rhizosphere
86	3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Metagenome	Rhizosphere
87	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
88	3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Metagenome	Rhizosphere
89	3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Metagenome	Rhizosphere
90	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
91	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
92	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
93	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
94	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
95	3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Metagenome	Rhizosphere
96	3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Metagenome	Rhizosphere
97	3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Metagenome	Rhizosphere
98	3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Metagenome	Rhizosphere
99	3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Metagenome	Rhizosphere
100	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
101	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
102	3300005536	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG	Metagenome	Rhizosphere
103	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
104	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
105	3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Metagenome	Rhizosphere
106	3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Metagenome	Rhizosphere
107	3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Metagenome	Rhizosphere
108	3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Metagenome	Rhizosphere
109	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
110	3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Metagenome	Rhizosphere
111	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
112	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
113	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
114	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
115	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
116	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
117	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
118	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
119	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
120	3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Metagenome	Rhizosphere
121	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
122	3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Metagenome	Rhizosphere
123	3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Metagenome	Rhizosphere
124	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
125	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
126	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
127	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
128	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
129	3300005981	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1	Metagenome	Rhizosphere
130	3300005983	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Metagenome	Rhizosphere
131	3300005985	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
132	3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Metagenome	Rhizosphere
133	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
134	3300006042	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3	Metagenome	Endosphere
135	3300006048	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3	Metagenome	Endosphere
136	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
137	3300006163	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG	Metagenome	Rhizosphere
138	3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Metagenome	Rhizosphere
139	3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Metagenome	Rhizosphere
140	3300006177	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2	Metagenome	Endosphere
141	3300006178	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Metagenome	Endosphere
142	3300006186	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4	Metagenome	Endosphere
143	3300006195	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1	Metagenome	Endosphere
144	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
145	3300006353	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5	Metagenome	Endosphere
146	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
147	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
148	3300006846	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Metagenome	Rhizosphere
149	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
150	3300006852	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Metagenome	Rhizosphere
151	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
152	3300006880	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Metagenome	Rhizosphere
153	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
154	3300006914	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Metagenome	Rhizosphere
155	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
156	3300006946	Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG	Metagenome	Nodule
157	3300006948	Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15	Metagenome	Nodule
158	3300007076	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Metagenome	Rhizosphere
159	3300007265	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1	Metagenome	Rhizosphere
160	3300007788	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2	Metagenome	Rhizosphere
161	3300009011	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG	Metagenome	Rhizosphere
162	3300009036	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG	Metagenome	Rhizosphere
163	3300009092	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG	Metagenome	Rhizosphere
164	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
165	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
166	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
167	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
168	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
169	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
170	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
171	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
172	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
173	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
174	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
175	3300009765	Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule	Metagenome	Nodule
176	3300009766	Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule	Metagenome	Nodule
177	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
178	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
179	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
180	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
181	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
182	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
183	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
184	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
185	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
186	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
187	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
188	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
189	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
190	3300014497	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG	Metagenome	Rhizosphere
191	3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Metagenome	Rhizosphere
192	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
193	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
194	3300015683	Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04	Metagenome	Rhizosphere
195	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
196	3300020070	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
197	3300020080	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
198	3300020081	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
199	3300020082	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
200	3300021321	Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1	Metagenome	Nodule
201	3300021327	Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2	Metagenome	Nodule
202	3300021384	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9	Metagenome	Unclassified
203	3300022467	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
204	3300022739	Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules	Metagenome	Nodule
205	3300022740	Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules	Metagenome	Nodule
206	3300025206	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2)	Metagenome	Unclassified
207	3300025208	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2)	Metagenome	Endosphere
208	3300025228	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
209	3300025229	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
210	3300025242	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
211	3300025245	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3)	Metagenome	Endosphere
212	3300025246	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2)	Metagenome	Unclassified
213	3300025250	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2)	Metagenome	Unclassified
214	3300025254	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2)	Metagenome	Endosphere
215	3300025256	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2)	Metagenome	Unclassified
216	3300025258	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3)	Metagenome	Endosphere
217	3300025263	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3)	Metagenome	Endosphere
218	3300025271	Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2)	Metagenome	Rhizosphere
219	3300025273	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3)	Metagenome	Endosphere
220	3300025284	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2)	Metagenome	Endosphere
221	3300025290	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2)	Metagenome	Rhizosphere
222	3300025291	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3)	Metagenome	Endosphere
223	3300025292	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
224	3300025294	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2)	Metagenome	Endosphere
225	3300025295	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3)	Metagenome	Endosphere
226	3300025297	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2)	Metagenome	Endosphere
227	3300025298	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
228	3300025299	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3)	Metagenome	Endosphere
229	3300025302	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2)	Metagenome	Endosphere
230	3300025303	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
231	3300025304	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
232	3300025315	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2)	Metagenome	Rhizosphere
233	3300025321	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
234	3300025728	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
235	3300025735	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
236	3300025893	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
237	3300025898	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
238	3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
239	3300025900	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
240	3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2)	Metagenome	Rhizosphere
241	3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
242	3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2)	Metagenome	Rhizosphere
243	3300025905	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
244	3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
245	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
246	3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
247	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
248	3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
249	3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
250	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
251	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
252	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
253	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
254	3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
255	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
256	3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
257	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
258	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
259	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
260	3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
261	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
262	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
263	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
264	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
265	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
266	3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
267	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
268	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
269	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
270	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
271	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
272	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
273	3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
274	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
275	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
276	3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
277	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
278	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
279	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
280	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
281	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
282	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
283	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
284	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
285	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
286	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
287	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
288	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
289	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
290	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
291	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
292	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
293	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
294	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
295	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
296	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
297	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
298	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
299	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
300	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
301	3300027111	Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2)	Metagenome	Nodule
302	3300027471	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2)	Metagenome	Rhizosphere
303	3300027526	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2)	Metagenome	Rhizosphere
304	3300027543	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2)	Metagenome	Rhizosphere
305	3300027614	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2)	Metagenome	Rhizosphere
306	3300027666	Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2)	Metagenome	Nodule
307	3300027671	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2)	Metagenome	Rhizosphere
308	3300027695	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2)	Metagenome	Rhizosphere
309	3300027866	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2)	Metagenome	Endosphere
310	3300027876	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2)	Metagenome	Rhizosphere
311	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
312	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
313	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
314	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
315	3300028786	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM	Metagenome	Unclassified
316	3300028794	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM	Metagenome	Unclassified
317	3300030521	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM	Metagenome	Unclassified
318	3300030522	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM	Metagenome	Unclassified
319	3300030732	Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1	Metagenome	Rhizosphere
320	3300030742	Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9	Metagenome	Rhizosphere
321	3300031241	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG	Metagenome	Rhizosphere
322	3300031250	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG	Metagenome	Rhizosphere
323	3300031251	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG	Metagenome	Rhizosphere
324	3300031456	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM	Metagenome	Unclassified
325	3300031507	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM	Metagenome	Unclassified
326	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
327	3300031595	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG	Metagenome	Rhizosphere
328	3300031616	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM	Metagenome	Unclassified
329	3300031649	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM	Metagenome	Unclassified
330	3300031711	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG	Metagenome	Rhizosphere
331	3300031730	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM	Metagenome	Unclassified
332	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
333	3300031824	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2	Metagenome	Rhizosphere
334	3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Metagenome	Rhizosphere
335	3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Metagenome	Rhizosphere
336	3300031903	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1	Metagenome	Rhizosphere
337	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
338	3300031967	Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules	Metagenome	Nodule
339	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
340	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
341	3300032004	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3	Metagenome	Rhizosphere
342	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
343	3300032126	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2	Metagenome	Rhizosphere
344	3300033430	Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules	Metagenome	Nodule
345	3300033442	Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1	Metagenome	Nodule
346	3300033464	Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules	Metagenome	Nodule
347	3300034817	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1	Metagenome	Rhizosphere
348	3300034819	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1	Metagenome	Rhizosphere
349	3300034957	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2	Metagenome	Rhizosphere
350	3300035083	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17	Metagenome	Rhizosphere
351	3300035084	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1	Metagenome	Rhizosphere
352	3300035085	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2	Metagenome	Rhizosphere
353	3300035086	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4	Metagenome	Rhizosphere
354	3300035088	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4	Metagenome	Rhizosphere
355	3300035090	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2	Metagenome	Rhizosphere
356	3300035092	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11	Metagenome	Rhizosphere
357	3300035112	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16	Metagenome	Rhizosphere
358	3300035113	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12	Metagenome	Rhizosphere
359	3300035114	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3	Metagenome	Rhizosphere
360	3300035115	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11	Metagenome	Rhizosphere
361	3300035116	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3	Metagenome	Rhizosphere
362	3300035117	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1	Metagenome	Rhizosphere
363	3300035118	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2	Metagenome	Rhizosphere
364	3300035119	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4	Metagenome	Rhizosphere
365	3300035120	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5	Metagenome	Rhizosphere
366	3300035121	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3	Metagenome	Rhizosphere
367	3300035170	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1	Metagenome	Rhizosphere
368	3300035171	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4	Metagenome	Rhizosphere
369	3300035172	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3	Metagenome	Rhizosphere
370	3300035207	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16	Metagenome	Rhizosphere
371	3300035241	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4	Metagenome	Rhizosphere
372	3300035242	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11	Metagenome	Rhizosphere
373	3300035410	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12	Metagenome	Rhizosphere
374	3300035691	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4	Metagenome	Rhizosphere
375	3300035692	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11	Metagenome	Rhizosphere
376	3300035695	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19	Metagenome	Rhizosphere
377	3300035724	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1	Metagenome	Rhizosphere
378	3300035725	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8	Metagenome	Rhizosphere
379	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
380	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
381	3300037312	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2	Metagenome	Rhizosphere
382	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
383	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
384	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
385	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
386	3300039437	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2	Metagenome	Unclassified
387	3300039438	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2	Metagenome	Rhizosphere
388	3300039447	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2	Metagenome	Rhizosphere
389	3300041404	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272	Metagenome	Rhizosphere
390	3300041406	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284	Metagenome	Rhizosphere
391	3300041407	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416	Metagenome	Rhizosphere
392	3300041413	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839	Metagenome	Rhizosphere
393	3300041458	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG	Metagenome	Rhizoplane
394	3300041486	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG	Metagenome	Rhizoplane
395	3300041999	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297	Metagenome	Rhizosphere
396	3300042004	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619	Metagenome	Rhizosphere
397	3300042005	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216	Metagenome	Rhizosphere
398	3300042006	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437	Metagenome	Rhizosphere
399	3300042007	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290	Metagenome	Rhizosphere
400	3300042015	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287	Metagenome	Rhizosphere
401	3300042122	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496	Metagenome	Rhizosphere
402	3300042126	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87	Metagenome	Rhizosphere
403	3300042156	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593	Metagenome	Rhizosphere
404	3300042184	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630	Metagenome	Rhizosphere
405	3300042435	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613	Metagenome	Rhizosphere
406	3300042461	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366	Metagenome	Rhizosphere
407	3300042531	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253	Metagenome	Rhizosphere
408	3300042532	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92	Metagenome	Rhizosphere
409	3300042876	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED	Metagenome	Rhizosphere
410	3300044673	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED	Metagenome	Rhizosphere
411	3300044684	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R	Metagenome	Rhizosphere
412	3300044693	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R	Metagenome	Rhizosphere
413	3300044712	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED	Metagenome	Rhizosphere
414	3300044842	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R	Metagenome	Rhizosphere
415	3300044901	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R	Metagenome	Rhizosphere
416	3300045051	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED	Metagenome	Rhizosphere
417	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
418	3300046454	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere	Metagenome	Rhizosphere
419	3300046455	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere	Metagenome	Rhizosphere
420	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
421	3300046460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere	Metagenome	Rhizosphere
422	3300046461	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere	Metagenome	Rhizosphere
423	3300046462	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere	Metagenome	Rhizosphere
424	3300046463	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere	Metagenome	Rhizosphere
425	3300046471	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere	Metagenome	Rhizosphere
426	3300046472	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere	Metagenome	Rhizosphere
427	3300046473	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere	Metagenome	Rhizosphere
428	3300046474	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere	Metagenome	Rhizosphere
429	3300046475	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere	Metagenome	Rhizosphere
430	3300046476	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere	Metagenome	Rhizosphere
431	3300046477	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere	Metagenome	Rhizosphere
432	3300046491	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere	Metagenome	Rhizosphere
433	3300046492	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere	Metagenome	Rhizosphere
434	3300046499	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere	Metagenome	Rhizosphere
435	3300046500	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere	Metagenome	Rhizosphere
436	3300046507	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere	Metagenome	Rhizosphere
437	3300046511	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere	Metagenome	Rhizosphere
438	3300046512	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere	Metagenome	Rhizosphere
439	3300046513	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere	Metagenome	Rhizosphere
440	3300046514	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere	Metagenome	Rhizosphere
441	3300046515	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere	Metagenome	Rhizosphere
442	3300046516	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere	Metagenome	Rhizosphere
443	3300046517	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere	Metagenome	Rhizosphere
444	3300046518	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere	Metagenome	Rhizosphere
445	3300046519	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere	Metagenome	Rhizosphere
446	3300046520	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere	Metagenome	Rhizosphere
447	3300046523	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere	Metagenome	Rhizosphere
448	3300046524	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere	Metagenome	Rhizosphere
449	3300046529	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere	Metagenome	Rhizosphere
450	3300046533	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere	Metagenome	Rhizosphere
451	3300046535	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere	Metagenome	Rhizosphere
452	3300046536	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere	Metagenome	Rhizosphere
453	3300046539	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere	Metagenome	Rhizosphere
454	3300046543	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere	Metagenome	Rhizosphere
455	3300046557	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere	Metagenome	Rhizosphere
456	3300046558	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere	Metagenome	Rhizosphere
457	3300046559	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere	Metagenome	Rhizosphere
458	3300046615	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere	Metagenome	Rhizosphere
459	3300046642	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere	Metagenome	Rhizosphere
460	3300046660	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere	Metagenome	Rhizosphere
461	3300046663	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere	Metagenome	Rhizosphere
462	3300046664	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere	Metagenome	Rhizosphere
463	3300046665	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere	Metagenome	Rhizosphere
464	3300046674	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere	Metagenome	Rhizosphere
465	3300046675	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere	Metagenome	Rhizosphere
466	3300046678	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere	Metagenome	Rhizosphere
467	3300046679	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere	Metagenome	Rhizosphere
468	3300046680	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere	Metagenome	Rhizosphere
469	3300046681	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere	Metagenome	Rhizosphere
470	3300046683	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere	Metagenome	Rhizosphere
471	3300046689	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere	Metagenome	Rhizosphere
472	3300046690	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere	Metagenome	Rhizosphere
473	3300046691	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere	Metagenome	Rhizosphere
474	3300046692	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere	Metagenome	Rhizosphere
475	3300046694	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere	Metagenome	Rhizosphere
476	3300046794	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere	Metagenome	Rhizosphere
477	3300046809	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere	Metagenome	Rhizosphere
478	3300046810	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere	Metagenome	Rhizosphere
479	3300047315	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere	Metagenome	Rhizosphere
480	3300047317	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere	Metagenome	Rhizosphere
481	3300047318	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere	Metagenome	Rhizosphere
482	3300047319	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere	Metagenome	Rhizosphere
483	3300047321	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere	Metagenome	Rhizosphere
484	3300047322	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere	Metagenome	Rhizosphere
485	3300047443	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere	Metagenome	Rhizosphere
486	3300047444	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere	Metagenome	Rhizosphere
487	3300047469	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere	Metagenome	Rhizosphere
488	3300047471	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere	Metagenome	Rhizosphere
489	3300047472	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere	Metagenome	Rhizosphere
490	3300047673	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere	Metagenome	Rhizosphere
491	3300048088	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere	Metagenome	Rhizosphere
492	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
493	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
494	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
495	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
496	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
497	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
498	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
499	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
500	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
501	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
502	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
503	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
504	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
505	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
506	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
507	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
508	3300048919	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled	Metagenome	Unclassified
509	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
510	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
511	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
512	3300048925	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled	Metagenome	Unclassified
513	3300048926	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled	Metagenome	Unclassified
514	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
515	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
516	3300049515	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought	Metagenome	Rhizosphere
517	3300049521	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought	Metagenome	Rhizosphere
518	3300049523	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control	Metagenome	Rhizosphere
519	3300049569	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02	Metagenome	Rhizosphere
520	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
521	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
522	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
523	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
524	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
525	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
526	3300049576	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01	Metagenome	Rhizosphere
527	3300049577	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02	Metagenome	Rhizosphere
528	3300049578	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03	Metagenome	Rhizosphere
529	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
530	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
531	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
532	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
533	3300049583	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01	Metagenome	Rhizosphere
534	3300049584	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02	Metagenome	Rhizosphere
535	3300049585	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03	Metagenome	Rhizosphere
536	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
537	3300049587	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02	Metagenome	Rhizosphere
538	3300049588	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03	Metagenome	Rhizosphere
539	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
540	3300049590	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02	Metagenome	Rhizosphere
541	3300049591	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03	Metagenome	Rhizosphere
542	3300049592	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01	Metagenome	Rhizosphere
543	3300049593	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02	Metagenome	Rhizosphere
544	3300049649	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought	Metagenome	Rhizosphere
545	3300049658	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought	Metagenome	Rhizosphere
546	3300049662	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control	Metagenome	Rhizosphere
547	3300049679	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought	Metagenome	Rhizosphere
548	3300049741	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01	Metagenome	Rhizosphere
549	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
550	3300049743	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03	Metagenome	Rhizosphere
551	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
552	3300049760	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control	Metagenome	Rhizosphere
553	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
554	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
555	3300049824	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03	Metagenome	Rhizosphere
556	3300050489	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation	Metagenome	Endosphere
557	3300050490	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation	Metagenome	Endosphere
558	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
559	3300050492	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation	Metagenome	Endosphere
560	3300050493	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation	Metagenome	Endosphere
561	3300050494	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation	Metagenome	Endosphere
562	3300050495	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation	Metagenome	Endosphere
563	3300050496	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation	Metagenome	Endosphere
564	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
565	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
566	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
567	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
568	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
569	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
570	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
571	3300050514	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation	Metagenome	Rhizosphere
572	3300050515	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation	Metagenome	Rhizosphere
573	3300050516	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation	Metagenome	Endosphere
574	3300053077	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere	Metagenome	Rhizosphere
575	3300053078	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere	Metagenome	Rhizosphere
576	3300053079	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere	Metagenome	Endosphere
577	3300053084	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere	Metagenome	Rhizosphere
578	3300053085	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere	Metagenome	Rhizosphere
579	3300053086	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere	Metagenome	Endosphere
580	3300053087	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere	Metagenome	Endosphere
581	3300053093	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere	Metagenome	Endosphere
582	3300053117	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere	Metagenome	Endosphere
583	3300053130	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere	Metagenome	Endosphere
584	3300053131	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere	Metagenome	Endosphere
585	3300053134	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere	Metagenome	Endosphere
586	3300053139	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere	Metagenome	Endosphere
587	3300053147	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere	Metagenome	Endosphere
588	3300053151	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere	Metagenome	Endosphere
589	3300053153	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere	Metagenome	Endosphere
590	3300053154	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere	Metagenome	Endosphere
591	3300053730	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere	Metagenome	Endosphere
592	3300053731	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere	Metagenome	Endosphere
593	3300054114	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03	Metagenome	Rhizosphere
594	3300059421	Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810	Metagenome	Rhizosphere
595	3300059503	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
596	3300059504	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
597	3300059505	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
598	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere
599	3300061719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1	Metagenome	Rhizosphere
600	3300061734	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2)	Metagenome	Rhizosphere
601	2508501122	Ensifer yinggardensis WSM1721	Isolate	Nodule
602	2509276019	Ensifer aridi TW10	Isolate	Nodule
603	2510065057	Sinorhizobium meliloti WSM1022	Isolate	Nodule
604	2510917028	Rhizobium sp. CF122	Isolate	Rhizosphere
605	2511231002	Polaromonas sp. CF318	Isolate	Rhizosphere
606	2511231052	Sinorhizobium meliloti AK58	Isolate	Nodule
607	2512047086	Sinorhizobium arboris LMG 14919	Isolate	Nodule
608	2512875026	Sinorhizobium medicae WSM1115	Isolate	Nodule
609	2513237086	Sinorhizobium meliloti MVII-I	Isolate	Nodule
610	2513237089	Sinorhizobium medicae DI28	Isolate	Nodule
611	2513237091	Sinorhizobium meliloti RRI128	Isolate	Nodule
612	2513237092	Bradyrhizobium sp. WSM1743	Isolate	Nodule
613	2513237137	Bradyrhizobium elkanii USDA 94	Isolate	Nodule
614	2513237140	Sinorhizobium meliloti GVPV12	Isolate	Nodule
615	2513237143	Sinorhizobium meliloti Mlalz-1	Isolate	Nodule
616	2513237144	Rhizobium sullae WSM1592	Isolate	Nodule
617	2513237146	Rhizobium mongolense USDA 1844 (Illumina)	Isolate	Nodule
618	2513237150	Cupriavidus taiwanensis STM6018	Isolate	Nodule
619	2513237156	Sinorhizobium medicae WSM1369	Isolate	Nodule
620	2513237160	Sinorhizobium medicae WSM244	Isolate	Nodule
621	2513237165	Cupriavidus neocaledonicus STM6070	Isolate	Nodule
622	2515154107	Sinorhizobium meliloti 4H41	Isolate	Nodule
623	2516143018	Ensifer sp. BR816	Isolate	Nodule
624	2516653046	Sinorhizobium meliloti BO21CC	Isolate	Nodule
625	2517487022	Sinorhizobium medicae WSM4191	Isolate	Nodule
626	2524023207	Ensifer sp. USDA 6670	Isolate	Nodule
627	2551306084	Sinorhizobium meliloti 5A14	Isolate	Nodule
628	2551306085	Sinorhizobium meliloti AE608H	Isolate	Nodule
629	2551306086	Sinorhizobium meliloti AK11	Isolate	Nodule
630	2551306087	Sinorhizobium meliloti A0643DD	Isolate	Nodule
631	2551306089	Sinorhizobium meliloti 1A42	Isolate	Nodule
632	2551306090	Sinorhizobium meliloti A0641M	Isolate	Nodule
633	2551306091	Sinorhizobium meliloti C0431A	Isolate	Nodule
634	2551306092	Sinorhizobium meliloti AK75	Isolate	Nodule
635	2551306093	Sinorhizobium meliloti C0438LL	Isolate	Nodule
636	2558860100	Sinorhizobium sp. PC2	Isolate	Nodule
637	2582581294	Rhizobium sp. CF394	Isolate	Rhizosphere
638	2582581867	Rhizobium sp. OV201	Isolate	Rhizosphere
639	2585427590	Rhizobium sp. CF048	Isolate	Rhizosphere
640	2599185170	Rhizobium mongolense USDA 1844 (PacBio)	Isolate	Nodule
641	2599185214	Variovorax sp. NFACC26	Isolate	Rhizoplane
642	2599185226	Variovorax sp. NFACC27	Isolate	Rhizoplane
643	2599185227	Variovorax sp. NFACC28	Isolate	Rhizoplane
644	2599185229	Variovorax sp. NFACC29	Isolate	Endosphere
645	2599185352	Sinorhizobium sp. NFACC03	Isolate	Rhizoplane
646	2643221544	Pelomonas sp. Root1444	Isolate	Unclassified
647	2643221585	Pelomonas sp. Root662	Isolate	Unclassified
648	2643221618	Ensifer sp. Root231	Isolate	Unclassified
649	2643221628	Variovorax sp. Root318D1	Isolate	Unclassified
650	2643221639	Pelomonas sp. Root1217	Isolate	Unclassified
651	2643221644	Rhizobacter sp. Root1221	Isolate	Unclassified
652	2643221646	Pelomonas sp. Root1237	Isolate	Unclassified
653	2643221655	Ensifer sp. Root1252	Isolate	Unclassified
654	2643221656	Pelomonas sp. Root405	Isolate	Unclassified
655	2643221658	Variovorax sp. Root411	Isolate	Unclassified
656	2643221659	Ensifer sp. Root127	Isolate	Unclassified
657	2643221660	Methylibium sp. Root1272	Isolate	Unclassified
658	2643221672	Variovorax sp. Root434	Isolate	Unclassified
659	2643221683	Variovorax sp. Root473	Isolate	Unclassified
660	2643221712	Ensifer sp. Root258	Isolate	Unclassified
661	2643221723	Ensifer sp. Root278	Isolate	Unclassified
662	2690316117	Sinorhizobium fredii CCBAU 45436	Isolate	Unclassified
663	2738541277	Variovorax sp. GV051	Isolate	Unclassified
664	2738541307	Variovorax sp. GV008	Isolate	Unclassified
665	2738541337	Pelomonas sp. BT06	Isolate	Unclassified
666	2738543013	Variovorax sp. BT01	Isolate	Unclassified
667	2738543019	Variovorax sp. GV040	Isolate	Unclassified
668	2751185821	Ensifer shofinae CCBAU 251167	Isolate	Unclassified
669	2765235802	Phyllobacterium bourgognense 31-25a	Isolate	Rhizoplane
670	2767802442	Phyllobacterium brassicacearum 29-15	Isolate	Rhizoplane
671	2775506902	Phyllobacterium zundukense Tri-48	Isolate	Unclassified
672	2775506904	Phyllobacterium zundukense Tri-38	Isolate	Unclassified
673	2791355091	Sinorhizobium sp. FG01	Isolate	Nodule
674	2791355092	Sinorhizobium sp. NG07B	Isolate	Nodule
675	2791355094	Sinorhizobium sp. BJ1	Isolate	Nodule
676	2802428858	Sinorhizobium medicae M14-1	Isolate	Nodule
677	2802428859	Sinorhizobium medicae SF3.41	Isolate	Nodule
678	2802428860	Sinorhizobium medicae M19-1	Isolate	Nodule
679	2802428861	Sinorhizobium medicae USDA1037	Isolate	Nodule
680	2802428862	Sinorhizobium medicae M7-4	Isolate	Nodule
681	2802428863	Sinorhizobium medicae M26-2	Isolate	Nodule
682	2818991446	Variovorax sp. 1180	Isolate	Unclassified
683	2829745981	Methylorubrum rhodinum DSM 2163	Isolate	Rhizosphere
684	2831265667	Variovorax guangxiensis DSM 27352	Isolate	Rhizosphere
685	2834641062	Cupriavidus gilardii JZ4	Isolate	Unclassified
686	2838035591	Rhizobium mongolense SEMIA 4087	Isolate	Nodule
687	2838054893	Variovorax guangxiensis 34/80	Isolate	Nodule
688	2838074704	Sinorhizobium terangae SEMIA 6460	Isolate	Unclassified
689	2838661181	Rhizobium mongolense SEMIA 402	Isolate	Nodule
690	2839993093	Phyllobacterium endophyticum PEPV15	Isolate	Unclassified
691	2840764183	Phyllobacterium sophorae CCBAU 03422	Isolate	Unclassified
692	2841734538	Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1	Isolate	Nodule
693	2841957949	Bradyrhizobium sp. CIR1	Isolate	Nodule
694	2842677519	Variovorax sp. R-72495	Isolate	Unclassified
695	2842733646	Variovorax sp. R-72446	Isolate	Unclassified
696	2844533157	Inquilinus sp. R-72501 v. 2	Isolate	Unclassified
697	2847417321	Sinorhizobium fredii CCBAU 45436	Isolate	Unclassified
698	2848992105	Sinorhizobium fredii CCBAU 25509	Isolate	Unclassified
699	2850079185	Ensifer aridi JNVU TP6	Isolate	Unclassified
700	2855825444	Sinorhizobium meliloti CXM1-105	Isolate	Nodule
701	2855839649	Sinorhizobium meliloti AK555	Isolate	Unclassified
702	2855872281	Sinorhizobium fredii PCH1	Isolate	Nodule
703	2858800743	Sinorhizobium meliloti AK170	Isolate	Unclassified
704	2871474448	Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1	Isolate	Nodule
705	2881101125	Ramlibacter rhizophilus CCTCC AB2015357	Isolate	Rhizosphere
706	2885192300	Variovorax sp. MHTC-1	Isolate	Rhizosphere
707	2885198086	Variovorax sp. 679	Isolate	Unclassified
708	2885211737	Variovorax sp. 553	Isolate	Unclassified
709	2896384573	Ensifer sp. MPMI2T	Isolate	Unclassified
710	2899924645	Variovorax sp. 369	Isolate	Unclassified
711	2904449895	Variovorax sp. 1763	Isolate	Rhizosphere
712	2904456579	Variovorax sp. 2002	Isolate	Unclassified
713	2904541872	Variovorax sp. 1615	Isolate	Rhizosphere
714	2909042592	Labrys sp. LIt4	Isolate	Nodule
715	2915980308	Sinorhizobium medicae USDA1149	Isolate	Nodule
716	2915986958	Sinorhizobium meliloti USDA1659	Isolate	Nodule
717	2915993759	Sinorhizobium meliloti USDA1336	Isolate	Nodule
718	2916000859	Sinorhizobium meliloti USDA1562	Isolate	Nodule
719	2916007675	Sinorhizobium meliloti USDA1289	Isolate	Nodule
720	2916014648	Sinorhizobium meliloti USDA1583	Isolate	Nodule
721	2916021584	Sinorhizobium meliloti USDA1550	Isolate	Nodule
722	2916028427	Sinorhizobium meliloti USDA1613	Isolate	Nodule
723	2916035215	Sinorhizobium meliloti 3011	Isolate	Nodule
724	2916041962	Sinorhizobium meliloti USDA1795	Isolate	Nodule
725	2916048683	Sinorhizobium meliloti USDA1796	Isolate	Nodule
726	2916055098	Sinorhizobium meliloti USDA1770	Isolate	Nodule
727	2916061851	Sinorhizobium medicae USDA1638	Isolate	Nodule
728	2916068649	Sinorhizobium meliloti USDA1220	Isolate	Nodule
729	2916076590	Sinorhizobium meliloti USDA1661	Isolate	Nodule
730	2919462493	Variovorax sp. 3319	Isolate	Rhizosphere
731	2920760137	Ensifer psoraleae CCBAU 65732	Isolate	Unclassified
732	2920822456	Ensifer sesbaniae CCBAU 65729	Isolate	Unclassified
733	2921201388	Sinorhizobium meliloti USDA1692	Isolate	Nodule
734	2921208531	Sinorhizobium meliloti USDA1660	Isolate	Nodule
735	2921237296	Sinorhizobium meliloti USDA1508	Isolate	Nodule
736	2921244191	Sinorhizobium meliloti 2119	Isolate	Nodule
737	2921250672	Sinorhizobium medicae USDA1169	Isolate	Nodule
738	2921257292	Sinorhizobium meliloti USDA1320	Isolate	Nodule
739	2921263974	Sinorhizobium meliloti USDA1107	Isolate	Nodule
740	2921282425	Sinorhizobium meliloti USDA1203	Isolate	Nodule
741	2921289301	Sinorhizobium meliloti USDA1730	Isolate	Nodule
742	2921296804	Sinorhizobium meliloti USDA1200	Isolate	Nodule
743	2923556063	Rhizobium tibeticum 3740	Isolate	Unclassified
744	2924144063	Sinorhizobium meliloti USDA1022	Isolate	Nodule
745	2924150972	Sinorhizobium meliloti USDA1700	Isolate	Nodule
746	2924158325	Sinorhizobium meliloti USDA1146	Isolate	Nodule
747	2924165586	Sinorhizobium meliloti USDA1264	Isolate	Nodule
748	2924172951	Sinorhizobium meliloti USDA1626	Isolate	Nodule
749	2924179722	Sinorhizobium meliloti USDA1280	Isolate	Nodule
750	2924186466	Sinorhizobium meliloti USDA1389	Isolate	Nodule
751	2924193448	Sinorhizobium meliloti USDA1158	Isolate	Nodule
752	2924200457	Sinorhizobium meliloti USDA1007	Isolate	Nodule
753	2924207177	Sinorhizobium meliloti USDA1589	Isolate	Nodule
754	2924214083	Sinorhizobium meliloti USDA1702	Isolate	Nodule
755	2924221636	Sinorhizobium meliloti USDA1416	Isolate	Nodule
756	2924228884	Sinorhizobium meliloti USDA1581	Isolate	Nodule
757	2928037797	Variovorax sp. 1126	Isolate	Unclassified
758	2928044640	Variovorax sp. 1128	Isolate	Unclassified
759	2928051484	Variovorax sp. 1133	Isolate	Unclassified
760	2928064002	Variovorax sp. 1140	Isolate	Rhizosphere
761	2928070936	Variovorax gossypii 1167	Isolate	Unclassified
762	2928084124	Variovorax paradoxus 1218	Isolate	Unclassified
763	2929160207	Variovorax sp. R-72349 Hybrid assembly	Isolate	Unclassified
764	2929520902	Variovorax beijingensis 502	Isolate	Unclassified
765	2933016740	Rhizobium sp. SEMIA 4085	Isolate	Nodule
766	2936996657	Sinorhizobium meliloti USDA1025	Isolate	Nodule
767	2937002841	Sinorhizobium meliloti USDA1006	Isolate	Nodule
768	2937009748	Sinorhizobium meliloti USDA1162	Isolate	Nodule
769	2937016420	Sinorhizobium meliloti USDA1027	Isolate	Nodule
770	2937023124	Sinorhizobium meliloti USDA1335	Isolate	Nodule
771	2937029754	Sinorhizobium medicae USDA1624	Isolate	Nodule
772	2937036028	Sinorhizobium medicae USDA1608	Isolate	Nodule
773	2937042894	Sinorhizobium meliloti USDA1687	Isolate	Nodule
774	2937049772	Sinorhizobium meliloti USDA1691	Isolate	Nodule
775	2937056579	Sinorhizobium meliloti USDA1357	Isolate	Nodule
776	2937063883	Sinorhizobium meliloti USDA1808	Isolate	Nodule
777	2937071275	Sinorhizobium meliloti USDA1623	Isolate	Nodule
778	2937078374	Sinorhizobium medicae USDA1004	Isolate	Nodule
779	2937084907	Sinorhizobium medicae USDA1664	Isolate	Nodule
780	2937091812	Sinorhizobium meliloti USDA1221	Isolate	Nodule
781	2937098957	Sinorhizobium meliloti USDA1519	Isolate	Nodule
782	2937106411	Sinorhizobium meliloti USDA1214	Isolate	Nodule
783	2937113482	Sinorhizobium meliloti USDA1180	Isolate	Nodule
784	2937119839	Sinorhizobium meliloti USDA1790	Isolate	Nodule
785	2937126314	Sinorhizobium meliloti USDA1612	Isolate	Nodule
786	2945909444	Variovorax sp. CRF3-Va-1 W1I1	Isolate	Rhizosphere
787	2945945610	Variovorax paradoxus W1I18	Isolate	Rhizosphere
788	2945972063	Variovorax paradoxus W2I8	Isolate	Rhizosphere
789	2945984333	Variovorax sp. W2I14	Isolate	Rhizosphere
790	2954767861	Variovorax sp. TBS-050B	Isolate	Rhizosphere
791	2957375807	Sinorhizobium medicae USDA1632	Isolate	Nodule
792	2957382221	Sinorhizobium meliloti USDA1919	Isolate	Nodule
793	2957388812	Sinorhizobium meliloti USDA1195	Isolate	Nodule
794	2957395598	Sinorhizobium meliloti USDA1237	Isolate	Nodule
795	2957402308	Sinorhizobium meliloti USDA1794	Isolate	Nodule
796	2957408893	Sinorhizobium meliloti USDA1163	Isolate	Nodule
797	2957415311	Sinorhizobium meliloti USDA1724	Isolate	Nodule
798	2957422303	Sinorhizobium meliloti USDA1497	Isolate	Nodule
799	2957430029	Sinorhizobium meliloti USDA1590	Isolate	Nodule
800	2957437181	Sinorhizobium medicae USDA1694	Isolate	Nodule
801	2957443900	Sinorhizobium meliloti USDA1734	Isolate	Nodule
802	2957450854	Sinorhizobium meliloti USDA1655	Isolate	Nodule
803	2957457609	Sinorhizobium meliloti USDA1751	Isolate	Nodule
804	2957464669	Sinorhizobium meliloti USDA1520	Isolate	Nodule
805	2957471148	Sinorhizobium meliloti USDA1204	Isolate	Nodule
806	2957478035	Sinorhizobium meliloti USDA1171	Isolate	Nodule
807	2957484790	Sinorhizobium meliloti USDA1464	Isolate	Nodule
808	2957491536	Sinorhizobium meliloti USDA1804	Isolate	Nodule
809	2957498199	Sinorhizobium meliloti USDA1561	Isolate	Nodule
810	2957505466	Sinorhizobium meliloti USDA1696	Isolate	Nodule
811	2958071322	Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1	Isolate	Nodule
812	2960584000	Sinorhizobium meliloti USDA1530	Isolate	Nodule
813	2960591022	Sinorhizobium medicae USDA1066	Isolate	Nodule
814	2960597568	Sinorhizobium meliloti 3085	Isolate	Nodule
815	2960603979	Sinorhizobium meliloti USDA1580	Isolate	Nodule
816	2960610863	Sinorhizobium meliloti USDA1792	Isolate	Nodule
817	2960617483	Sinorhizobium meliloti USDA1719	Isolate	Nodule
818	2960624210	Sinorhizobium meliloti USDA1415	Isolate	Nodule
819	2960631154	Sinorhizobium medicae USDA1629	Isolate	Nodule
820	2960637947	Sinorhizobium meliloti USDA1202	Isolate	Nodule
821	2960645483	Sinorhizobium meliloti USDA1703	Isolate	Nodule
822	2960652885	Sinorhizobium meliloti USDA1199	Isolate	Nodule
823	2960660292	Sinorhizobium meliloti USDA1883	Isolate	Nodule
824	2960667422	Sinorhizobium meliloti USDA1170	Isolate	Nodule
825	2960674078	Sinorhizobium meliloti USDA1666	Isolate	Nodule
826	2960680706	Sinorhizobium medicae USDA1150	Isolate	Nodule
827	2960687367	Sinorhizobium meliloti USDA1462	Isolate	Nodule
828	2960693952	Sinorhizobium medicae USDA1630	Isolate	Nodule
829	2964607997	Sinorhizobium meliloti USDA1212	Isolate	Nodule
830	2964615318	Sinorhizobium meliloti USDA1248	Isolate	Nodule
831	2964621998	Sinorhizobium meliloti USDA1235	Isolate	Nodule
832	2964628898	Sinorhizobium meliloti USDA1191	Isolate	Nodule
833	2964636051	Sinorhizobium meliloti USDA1594	Isolate	Nodule
834	2964643177	Sinorhizobium meliloti USDA1760	Isolate	Nodule
835	2964649959	Sinorhizobium meliloti USDA1591	Isolate	Nodule
836	2964656573	Sinorhizobium meliloti USDA1308	Isolate	Nodule
837	2964663802	Sinorhizobium meliloti USDA1688	Isolate	Nodule
838	2964670856	Sinorhizobium meliloti USDA1211	Isolate	Nodule
839	2964678106	Sinorhizobium meliloti USDA1210	Isolate	Nodule
840	2964685014	Sinorhizobium meliloti USDA1232	Isolate	Nodule
841	2964691889	Sinorhizobium meliloti USDA1379	Isolate	Nodule
842	2964698721	Sinorhizobium meliloti USDA1656	Isolate	Nodule
843	2964705432	Sinorhizobium meliloti USDA1614	Isolate	Nodule
844	2964712639	Sinorhizobium meliloti USDA1616	Isolate	Nodule
845	2964719344	Sinorhizobium meliloti USDA1456	Isolate	Nodule
846	2967664464	Sinorhizobium meliloti USDA1208	Isolate	Nodule
847	2967671571	Sinorhizobium meliloti USDA1496	Isolate	Nodule
848	2967678726	Sinorhizobium meliloti USDA1467	Isolate	Nodule
849	2967686174	Sinorhizobium medicae USDA1641	Isolate	Nodule
850	2967693043	Sinorhizobium meliloti USDA1183	Isolate	Nodule
851	2967699805	Sinorhizobium meliloti USDA1695	Isolate	Nodule
852	2967706974	Sinorhizobium meliloti USDA1206	Isolate	Nodule
853	2967714385	Sinorhizobium meliloti USDA1023	Isolate	Nodule
854	2967721400	Sinorhizobium meliloti USDA1742	Isolate	Nodule
855	2967728569	Sinorhizobium medicae USDA1607	Isolate	Nodule
856	2967735183	Sinorhizobium meliloti USDA1710	Isolate	Nodule
857	2967742019	Sinorhizobium meliloti USDA1676	Isolate	Nodule
858	2967748971	Sinorhizobium meliloti USDA1024A	Isolate	Nodule
859	2967755722	Sinorhizobium meliloti USDA1302	Isolate	Nodule
860	2967762386	Sinorhizobium meliloti USDA1397	Isolate	Nodule
861	2967769361	Sinorhizobium meliloti USDA1005	Isolate	Nodule
862	2967775926	Sinorhizobium meliloti USDA1678	Isolate	Nodule
863	2970019648	Sinorhizobium meliloti USDA1603	Isolate	Nodule
864	2970026789	Sinorhizobium medicae USDA1611	Isolate	Nodule
865	2970033650	Sinorhizobium meliloti USDA1565	Isolate	Nodule
866	2970040964	Sinorhizobium meliloti USDA1501	Isolate	Nodule
867	2970047711	Sinorhizobium meliloti USDA1793	Isolate	Nodule
868	2970054988	Sinorhizobium meliloti USDA1031	Isolate	Nodule
869	2970061556	Sinorhizobium meliloti USDA1810	Isolate	Nodule
870	2970068827	Sinorhizobium meliloti USDA1227	Isolate	Nodule
871	2970076120	Sinorhizobium meliloti USDA1706	Isolate	Nodule
872	2970082768	Sinorhizobium meliloti USDA1803	Isolate	Nodule
873	2970088815	Sinorhizobium meliloti USDA1819	Isolate	Nodule
874	2970095765	Sinorhizobium meliloti USDA1225	Isolate	Nodule
875	2970102677	Sinorhizobium meliloti USDA1325	Isolate	Nodule
876	2970109326	Sinorhizobium meliloti USDA1186	Isolate	Nodule
877	2970116247	Sinorhizobium meliloti USDA1566	Isolate	Nodule
878	2970122695	Sinorhizobium medicae 3082	Isolate	Nodule
879	2970129317	Sinorhizobium meliloti USDA1008	Isolate	Nodule
880	2970136068	Sinorhizobium meliloti USDA1699	Isolate	Nodule
881	2970143518	Sinorhizobium medicae USDA1652	Isolate	Nodule
882	2970149975	Sinorhizobium meliloti USDA1215	Isolate	Nodule
883	2970156795	Sinorhizobium meliloti USDA1491	Isolate	Nodule
884	2970164137	Sinorhizobium meliloti USDA1018	Isolate	Nodule
885	2970170962	Sinorhizobium meliloti USDA1571	Isolate	Nodule
886	2970177841	Sinorhizobium meliloti USDA1533	Isolate	Nodule
887	2970184632	Sinorhizobium meliloti USDA1593	Isolate	Nodule
888	2970191845	Sinorhizobium meliloti USDA1187	Isolate	Nodule
889	2977516862	Sinorhizobium meliloti USDA1791	Isolate	Nodule
890	2977523885	Sinorhizobium meliloti USDA1777	Isolate	Nodule
891	2977530762	Sinorhizobium medicae USDA1606	Isolate	Nodule
892	2977537788	Sinorhizobium meliloti USDA1184	Isolate	Nodule
893	2977544691	Sinorhizobium medicae USDA1631	Isolate	Nodule
894	2977551784	Sinorhizobium meliloti USDA1035	Isolate	Nodule
895	2977558990	Sinorhizobium meliloti USDA1222	Isolate	Nodule
896	2977565890	Sinorhizobium meliloti USDA1617	Isolate	Nodule
897	2977572785	Sinorhizobium meliloti USDA1767	Isolate	Nodule
898	2977579622	Sinorhizobium meliloti USDA1161	Isolate	Nodule
899	2977864932	Mesorhizobium tamadayense DSM 28320	Isolate	Nodule
900	2996887358	Rhizobium sp. R711	Isolate	Nodule
901	3005409236	Rhizobium sp. P32RR-XVIII	Isolate	Rhizosphere
902	3005483717	Bradyrhizobium agreste CNPSo 4010	Isolate	Unclassified
903	643692032	Sinorhizobium fredii NGR234	Isolate	Nodule
904	644736347	Cupriavidus taiwanensis LMG 19424	Isolate	Nodule
905	648276728	Sinorhizobium meliloti BL225C	Isolate	Nodule
906	8003400568	Cupriavidus gilardii USM5	Isolate	Rhizosphere
907	8003992118	Sinorhizobium meliloti RRI128	Isolate	Nodule
908	8003999396	Sinorhizobium medicae WSM1115	Isolate	Nodule
909	8004633249	Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1	Isolate	Nodule
910	8005321885	Rhizobium sp. R72	Isolate	Nodule
911	8016583857	Bradyrhizobium sp. LM2.7	Isolate	Nodule
912	8019648815	Bradyrhizobium sp. GM24.11	Isolate	Nodule
913	8055617313	Mesorhizobium onobrychidis OM4	Isolate	Nodule

Type Distribution

Type	Percentage (%)
Metagenomes	86.23
Metatranscriptomes	0.59
Isolates	13.18

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	15.04
Nodule	10.57
Rhizoplane	4.68
Rhizosphere	65.08
Stem	0
Stem Tuber	0
Unclassified	0.13

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	Ga0075432_10029480	3300006058	Bacteria	1895
2	SwRhRL2b_contig_3104459	2162886007	Bacteria	2695
3	ARSoilYngRDRAFT_c00306	3300000042	Bacteria	7095
4	ARSoilOldRDRAFT_c000414	3300000044	Bacteria	5167
5	JGI24032J14994_100039	3300001430	Bacteria	4955
6	JGI24746J21847_1001657	3300001977	Bacteria	3567
7	JGI24740J21852_10005549	3300001979	Bacteria	5315
8	JGI24739J22299_10000147	3300001989	Bacteria	22531
9	JGI24739J22299_10014355	3300001989	Bacteria	2882
10	JGI24737J22298_10007823	3300001990	Bacteria	3602
11	JGI24750J21931_1000071	3300002070	Bacteria	14849
12	JGI24745J21846_1000160	3300002073	Bacteria	5308
13	JGI24748J21848_1000327	3300002074	Bacteria	5486
14	JGI24738J21930_10000240	3300002075	Bacteria	14865
15	JGI24749J21850_1000221	3300002076	Bacteria	8897
16	JGI24744J21845_10003236	3300002077	Bacteria	3342
17	JGI24035J26624_1000043	3300002126	Bacteria	9367
18	JGI24034J26672_10000318	3300002239	Bacteria	6249
19	JGI24742J22300_10000076	3300002244	Bacteria	14060
20	JGI25155J39150_1000035	3300002704	Bacteria	99118
21	JGI25156J39149_1000012	3300002705	Bacteria	194393
22	JGI25154J39366_1000029	3300002738	Bacteria	194393
23	JGI25158J39367_1001450	3300002739	Bacteria	4148
24	JGI25157J39369_1000014	3300002741	Bacteria	194393
25	JGI25150J39212_1013502	3300002774	Bacteria	1412
26	JGI25159J45721_1000004	3300002987	Bacteria	215789
27	JGI25159J45721_1001438	3300002987	Bacteria	9833
28	JGI25159J45721_1003813	3300002987	Bacteria	5192
29	JGI25159J45721_1004878	3300002987	Bacteria	4324
30	JGI25159J45721_1018868	3300002987	Bacteria	1376
31	JGI25151J46595_10000246	3300003187	Bacteria	63372
32	JGI25151J46595_10000830	3300003187	Bacteria	24635
33	JGI25151J46595_10003554	3300003187	Bacteria	8556
34	JGI25151J46595_10004765	3300003187	Bacteria	7117
35	JGI25151J46595_10004933	3300003187	Bacteria	6965
36	JGI25151J46595_10008959	3300003187	Bacteria	4773
37	JGI25151J46595_10013212	3300003187	Bacteria	3724
38	JGI25153J46596_10001104	3300003215	Bacteria	16391
39	JGI25153J46596_10005082	3300003215	Bacteria	6954
40	JGI25153J46596_10005285	3300003215	Bacteria	6789
41	JGI25153J46596_10005877	3300003215	Bacteria	6344
42	JGI25153J46596_10020512	3300003215	Bacteria	2497
43	rootH1_10023711	3300003316	Bacteria	1683
44	rootL2_10042394	3300003322	Bacteria	2333
45	JGI25160J50197_1000021	3300003354	Bacteria	215789
46	JGI25160J50197_1000282	3300003354	Bacteria	36762
47	JGI25160J50197_1010318	3300003354	Bacteria	3388
48	JGI25161J50226_1000094	3300003374	Bacteria	72451
49	JGI25161J50226_1000218	3300003374	Bacteria	36216
50	JGI25404J52841_10002056	3300003659	Bacteria	3727
51	JGI25404J52841_10016867	3300003659	Bacteria	1584
52	Ga0055535_1000168	3300003761	Bacteria	70666
53	Ga0055542_1000214	3300003762	Bacteria	70682
54	Ga0055526_1001422	3300003771	Bacteria	17040
55	Ga0055526_1002738	3300003771	Bacteria	11703
56	Ga0055526_1004904	3300003771	Bacteria	7871
57	Ga0055526_1015053	3300003771	Bacteria	3129
58	Ga0055537_1000029	3300003773	Bacteria	101797
59	Ga0055537_1000092	3300003773	Bacteria	66301
60	Ga0055537_1000333	3300003773	Bacteria	32239
61	Ga0055537_1007396	3300003773	Bacteria	2653
62	Ga0055524_1000040	3300003775	Bacteria	157409
63	Ga0055524_1000488	3300003775	Bacteria	31194
64	Ga0055524_1014861	3300003775	Bacteria	2865
65	Ga0055536_1000269	3300003781	Bacteria	39889
66	Ga0055536_1000891	3300003781	Bacteria	19442
67	Ga0055536_1013542	3300003781	Bacteria	2931
68	Ga0055534_1000265	3300003784	Bacteria	36441
69	Ga0055534_1003597	3300003784	Bacteria	4819
70	Ga0055534_1003664	3300003784	Bacteria	4759
71	Ga0055534_1007699	3300003784	Bacteria	2528
72	Ga0055528_1000471	3300003790	Bacteria	32238
73	Ga0055528_1010020	3300003790	Bacteria	3898
74	Ga0055528_1032838	3300003790	Bacteria	1314
75	Ga0055530_10000605	3300003791	Bacteria	31102
76	Ga0055530_10001556	3300003791	Bacteria	16467
77	Ga0055530_10002560	3300003791	Bacteria	11547
78	Ga0055530_10029763	3300003791	Bacteria	1455
79	Ga0055540_1000030	3300003792	Bacteria	177871
80	Ga0055540_1000086	3300003792	Bacteria	102576
81	Ga0055540_1001142	3300003792	Bacteria	16576
82	Ga0055540_1002670	3300003792	Bacteria	9204
83	Ga0055531_10000158	3300003794	Bacteria	77918
84	Ga0055531_10000586	3300003794	Bacteria	31786
85	Ga0055531_10000983	3300003794	Bacteria	22683
86	Ga0055531_10007550	3300003794	Bacteria	5905
87	Ga0055531_10008595	3300003794	Bacteria	5354
88	Ga0055543_1000164	3300004625	Bacteria	55304
89	Ga0055543_1000406	3300004625	Bacteria	27293
90	Ga0058859_10012384	3300004798	Bacteria	1242
91	Ga0058861_12012918	3300004800	Bacteria	1212
92	Ga0058860_10003178	3300004801	Bacteria	1291
93	Ga0065165_1000033	3300005262	Bacteria	215827
94	Ga0065165_1007849	3300005262	Bacteria	5134
95	Ga0065165_1008614	3300005262	Bacteria	4734
96	Ga0065714_10004758	3300005288	Bacteria	4495
97	Ga0065704_10007501	3300005289	Bacteria	3529
98	Ga0065704_10081699	3300005289	Bacteria	3715
99	Ga0065712_10029757	3300005290	Bacteria	1523
100	Ga0065712_10068036	3300005290	Bacteria	16427
101	Ga0065712_10112590	3300005290	Bacteria	1797
102	Ga0065715_10000722	3300005293	Bacteria	10256
103	Ga0065715_10091985	3300005293	Bacteria	5415
104	Ga0065715_10124171	3300005293	Bacteria	2160
105	Ga0065715_10129898	3300005293	Bacteria	2033
106	Ga0065707_10084079	3300005295	Bacteria	7720
107	Ga0065707_10107230	3300005295	Bacteria	2563
108	Ga0065707_10181634	3300005295	Bacteria	1415
109	Ga0070658_10022444	3300005327	Bacteria	5064
110	Ga0070658_10188468	3300005327	Bacteria	1738
111	Ga0070676_10000008	3300005328	Bacteria	68426
112	Ga0070676_10138086	3300005328	Bacteria	1549
113	Ga0070683_100190298	3300005329	Bacteria	1948
114	Ga0070683_100319813	3300005329	Bacteria	1477
115	Ga0070690_100007387	3300005330	Bacteria	6294
116	Ga0070690_100023676	3300005330	Bacteria	3769
117	Ga0070670_100008967	3300005331	Bacteria	8544
118	Ga0070670_100012979	3300005331	Bacteria	7133
119	Ga0070670_100077716	3300005331	Bacteria	2851
120	Ga0070670_100122467	3300005331	Bacteria	2243
121	Ga0070677_10000012	3300005333	Bacteria	55279
122	Ga0070677_10034432	3300005333	Bacteria	1957
123	Ga0068869_100000008	3300005334	Bacteria	78682
124	Ga0068869_100003230	3300005334	Bacteria	9959
125	Ga0068869_100003935	3300005334	Bacteria	9173
126	Ga0068869_100028060	3300005334	Bacteria	3929
127	Ga0068869_100045523	3300005334	Bacteria	3159
128	Ga0068869_100090268	3300005334	Bacteria	2302
129	Ga0068869_100152887	3300005334	Bacteria	1791
130	Ga0070666_10021322	3300005335	Bacteria	4199
131	Ga0070666_10027669	3300005335	Bacteria	3715
132	Ga0070680_100000998	3300005336	Bacteria	20130
133	Ga0070680_100016488	3300005336	Bacteria	5814
134	Ga0070680_100050575	3300005336	Bacteria	3390
135	Ga0070680_100183292	3300005336	Bacteria	1764
136	Ga0070682_100000808	3300005337	Bacteria	18359
137	Ga0070682_100110337	3300005337	Bacteria	1832
138	Ga0068868_100002921	3300005338	Bacteria	11863
139	Ga0068868_100228391	3300005338	Bacteria	1560
140	Ga0070660_100002924	3300005339	Bacteria	11753
141	Ga0070660_100008802	3300005339	Bacteria	7072
142	Ga0070660_100015080	3300005339	Bacteria	5576
143	Ga0070660_100060417	3300005339	Bacteria	2942
144	Ga0070660_100312558	3300005339	Bacteria	1289
145	Ga0070689_100000092	3300005340	Bacteria	52157
146	Ga0070689_100106928	3300005340	Bacteria	2221
147	Ga0070691_10092521	3300005341	Bacteria	1492
148	Ga0070687_100000531	3300005343	Bacteria	12761
149	Ga0070687_100193299	3300005343	Bacteria	1228
150	Ga0070661_100000107	3300005344	Bacteria	68766
151	Ga0070661_100036888	3300005344	Bacteria	3554
152	Ga0070661_100041797	3300005344	Bacteria	3345
153	Ga0070661_100099125	3300005344	Bacteria	2165
154	Ga0070661_100114922	3300005344	Bacteria	2012
155	Ga0070692_10052189	3300005345	Bacteria	2129
156	Ga0070692_10126209	3300005345	Bacteria	1433
157	Ga0070668_100041647	3300005347	Bacteria	3519
158	Ga0070668_100054882	3300005347	Bacteria	3074
159	Ga0070668_100107345	3300005347	Bacteria	2219
160	Ga0070668_100189241	3300005347	Bacteria	1685
161	Ga0070669_100000191	3300005353	Bacteria	53889
162	Ga0070669_100005986	3300005353	Bacteria	8777
163	Ga0070669_100074359	3300005353	Bacteria	2519
164	Ga0070669_100124577	3300005353	Bacteria	1970
165	Ga0070675_100000032	3300005354	Bacteria	97014
166	Ga0070675_100008045	3300005354	Bacteria	8174
167	Ga0070675_100012879	3300005354	Bacteria	6564
168	Ga0070675_100015248	3300005354	Bacteria	6070
169	Ga0070675_100058396	3300005354	Bacteria	3182
170	Ga0070675_100084719	3300005354	Bacteria	2647
171	Ga0070675_100187970	3300005354	Bacteria	1788
172	Ga0070671_100018708	3300005355	Bacteria	5629
173	Ga0070671_100022704	3300005355	Bacteria	5126
174	Ga0070671_100034996	3300005355	Bacteria	4159
175	Ga0070671_100039875	3300005355	Bacteria	3899
176	Ga0070671_100072569	3300005355	Bacteria	2875
177	Ga0070671_100102092	3300005355	Bacteria	2406
178	Ga0070674_100004488	3300005356	Bacteria	7964
179	Ga0070674_100022489	3300005356	Bacteria	4067
180	Ga0070674_100031614	3300005356	Bacteria	3509
181	Ga0070673_100000024	3300005364	Bacteria	75170
182	Ga0070673_100015446	3300005364	Bacteria	5362
183	Ga0070673_100022682	3300005364	Bacteria	4573
184	Ga0070673_100024507	3300005364	Bacteria	4425
185	Ga0070673_100158136	3300005364	Bacteria	1925
186	Ga0070673_100199521	3300005364	Bacteria	1723
187	Ga0070673_100228513	3300005364	Bacteria	1613
188	Ga0070688_100007982	3300005365	Bacteria	5727
189	Ga0070659_100000238	3300005366	Bacteria	42955
190	Ga0070659_100001324	3300005366	Bacteria	17888
191	Ga0070659_100017962	3300005366	Bacteria	5330
192	Ga0070659_100100680	3300005366	Bacteria	2325
193	Ga0070667_100000593	3300005367	Bacteria	35471
194	Ga0070667_100016214	3300005367	Bacteria	6165
195	Ga0070667_100033667	3300005367	Bacteria	4286
196	Ga0070667_100080703	3300005367	Bacteria	2783
197	Ga0070667_100083239	3300005367	Bacteria	2741
198	Ga0070709_10039492	3300005434	Bacteria	2896
199	Ga0070714_100010319	3300005435	Bacteria	7380
200	Ga0070714_100060316	3300005435	Bacteria	3255
201	Ga0070714_100219172	3300005435	Bacteria	1748
202	Ga0070714_100261477	3300005435	Bacteria	1603
203	Ga0070713_100040498	3300005436	Bacteria	3788
204	Ga0070713_100099641	3300005436	Bacteria	2514
205	Ga0070710_10008971	3300005437	Bacteria	4884
206	Ga0070710_10014033	3300005437	Bacteria	4024
207	Ga0070710_10146543	3300005437	Bacteria	1452
208	Ga0070701_10000141	3300005438	Bacteria	21844
209	Ga0070711_100029199	3300005439	Bacteria	3637
210	Ga0070711_100029816	3300005439	Bacteria	3605
211	Ga0070711_100091171	3300005439	Bacteria	2196
212	Ga0070711_100178745	3300005439	Bacteria	1623
213	Ga0070711_100196905	3300005439	Bacteria	1552
214	Ga0070705_100001291	3300005440	Bacteria	13440
215	Ga0070705_100013827	3300005440	Bacteria	4136
216	Ga0070705_100147494	3300005440	Bacteria	1556
217	Ga0070700_100000181	3300005441	Bacteria	35797
218	Ga0070700_100012327	3300005441	Bacteria	4766
219	Ga0070700_100050267	3300005441	Bacteria	2591
220	Ga0070700_100050686	3300005441	Bacteria	2581
221	Ga0070700_100059161	3300005441	Bacteria	2411
222	Ga0070700_100092636	3300005441	Bacteria	1975
223	Ga0070700_100124587	3300005441	Bacteria	1731
224	Ga0070700_100238297	3300005441	Bacteria	1298
225	Ga0070694_100004013	3300005444	Bacteria	8813
226	Ga0070694_100142276	3300005444	Bacteria	1743
227	Ga0070708_100056710	3300005445	Bacteria	3486
228	Ga0070708_100304899	3300005445	Bacteria	1500
229	Ga0070663_100000390	3300005455	Bacteria	23042
230	Ga0070663_100010275	3300005455	Bacteria	5831
231	Ga0070663_100038999	3300005455	Bacteria	3317
232	Ga0070663_100045705	3300005455	Bacteria	3094
233	Ga0070663_100126378	3300005455	Bacteria	1937
234	Ga0070663_100282776	3300005455	Bacteria	1322
235	Ga0070678_100019298	3300005456	Bacteria	4441
236	Ga0070678_100030106	3300005456	Bacteria	3727
237	Ga0070678_100031702	3300005456	Bacteria	3651
238	Ga0070678_100095638	3300005456	Bacteria	2290
239	Ga0070662_100006468	3300005457	Bacteria	7555
240	Ga0070662_100050875	3300005457	Bacteria	2989
241	Ga0070662_100180112	3300005457	Bacteria	1665
242	Ga0070681_10000932	3300005458	Bacteria	24610
243	Ga0070681_10038897	3300005458	Bacteria	4769
244	Ga0070681_10191752	3300005458	Bacteria	1963
245	Ga0068867_100000648	3300005459	Bacteria	23048
246	Ga0068867_100002038	3300005459	Bacteria	14143
247	Ga0068867_100004592	3300005459	Bacteria	9712
248	Ga0068867_100009096	3300005459	Bacteria	7010
249	Ga0068867_100019300	3300005459	Bacteria	4860
250	Ga0068867_100090152	3300005459	Bacteria	2325
251	Ga0068867_100184026	3300005459	Bacteria	1663
252	Ga0068867_100213241	3300005459	Bacteria	1552
253	Ga0070685_10011870	3300005466	Bacteria	4566
254	Ga0070685_10013923	3300005466	Bacteria	4255
255	Ga0070706_100000751	3300005467	Bacteria	36305
256	Ga0070706_100126995	3300005467	Bacteria	2379
257	Ga0070706_100209189	3300005467	Bacteria	1822
258	Ga0070707_100015647	3300005468	Bacteria	7119
259	Ga0070707_100079760	3300005468	Bacteria	3160
260	Ga0070698_100001905	3300005471	Bacteria	23252
261	Ga0070698_100185255	3300005471	Bacteria	2020
262	Ga0070698_100383710	3300005471	Bacteria	1338
263	Ga0070698_100500144	3300005471	Bacteria	1153
264	Ga0070699_100018612	3300005518	Bacteria	5966
265	Ga0070679_100004826	3300005530	Bacteria	12433
266	Ga0070679_100033746	3300005530	Bacteria	5068
267	Ga0070679_100074328	3300005530	Bacteria	3389
268	Ga0070679_100122097	3300005530	Bacteria	2589
269	Ga0070679_100130454	3300005530	Bacteria	2495
270	Ga0070679_100139488	3300005530	Bacteria	2405
271	Ga0070679_100149559	3300005530	Bacteria	2312
272	Ga0070684_100000022	3300005535	Bacteria	128353
273	Ga0070684_100325225	3300005535	Bacteria	1413
274	Ga0070697_100009294	3300005536	Bacteria	7683
275	Ga0070697_100107505	3300005536	Bacteria	2321
276	Ga0070697_100250019	3300005536	Bacteria	1516
277	Ga0068853_100001716	3300005539	Bacteria	16057
278	Ga0068853_100012609	3300005539	Bacteria	6878
279	Ga0068853_100045630	3300005539	Bacteria	3755
280	Ga0068853_100047419	3300005539	Bacteria	3687
281	Ga0068853_100063920	3300005539	Bacteria	3189
282	Ga0068853_100100621	3300005539	Bacteria	2555
283	Ga0068853_100108256	3300005539	Bacteria	2465
284	Ga0068853_100184742	3300005539	Bacteria	1892
285	Ga0068853_100243848	3300005539	Bacteria	1648
286	Ga0070672_100000012	3300005543	Bacteria	78125
287	Ga0070672_100009288	3300005543	Bacteria	6774
288	Ga0070672_100011650	3300005543	Bacteria	6137
289	Ga0070672_100021278	3300005543	Bacteria	4744
290	Ga0070672_100023168	3300005543	Bacteria	4573
291	Ga0070672_100030868	3300005543	Bacteria	4030
292	Ga0070672_100049603	3300005543	Bacteria	3267
293	Ga0070686_100000087	3300005544	Bacteria	64591
294	Ga0070686_100004664	3300005544	Bacteria	7560
295	Ga0070686_100012980	3300005544	Bacteria	4756
296	Ga0070695_100000096	3300005545	Bacteria	37700
297	Ga0070695_100003939	3300005545	Bacteria	8670
298	Ga0070695_100025073	3300005545	Bacteria	3679
299	Ga0070696_100001044	3300005546	Bacteria	17902
300	Ga0070696_100007458	3300005546	Bacteria	7318
301	Ga0070696_100017960	3300005546	Bacteria	4777
302	Ga0070696_100019757	3300005546	Bacteria	4565
303	Ga0070696_100022494	3300005546	Bacteria	4283
304	Ga0070696_100058692	3300005546	Bacteria	2688
305	Ga0070693_100000401	3300005547	Bacteria	19703
306	Ga0070693_100005132	3300005547	Bacteria	6259
307	Ga0070693_100045559	3300005547	Bacteria	2487
308	Ga0070665_100002577	3300005548	Bacteria	19865
309	Ga0070665_100013258	3300005548	Bacteria	8301
310	Ga0070665_100087922	3300005548	Bacteria	3113
311	Ga0070665_100182326	3300005548	Bacteria	2100
312	Ga0070704_100002908	3300005549	Bacteria	9726
313	Ga0070704_100030404	3300005549	Bacteria	3618
314	Ga0070704_100035935	3300005549	Bacteria	3371
315	Ga0070704_100167320	3300005549	Bacteria	1745
316	Ga0068855_100004353	3300005563	Bacteria	17318
317	Ga0068855_100022311	3300005563	Bacteria	7585
318	Ga0068855_100033600	3300005563	Bacteria	6120
319	Ga0068855_100060876	3300005563	Bacteria	4412
320	Ga0068855_100102494	3300005563	Bacteria	3294
321	Ga0068855_100137398	3300005563	Bacteria	2788
322	Ga0068855_100173541	3300005563	Bacteria	2440
323	Ga0070664_100002097	3300005564	Bacteria	15933
324	Ga0070664_100005611	3300005564	Bacteria	10093
325	Ga0070664_100013090	3300005564	Bacteria	6750
326	Ga0070664_100043526	3300005564	Bacteria	3788
327	Ga0070664_100051539	3300005564	Bacteria	3485
328	Ga0070664_100067992	3300005564	Bacteria	3045
329	Ga0070664_100068085	3300005564	Bacteria	3043
330	Ga0070664_100264688	3300005564	Bacteria	1547
331	Ga0070664_100266272	3300005564	Bacteria	1543
332	Ga0068857_100000393	3300005577	Bacteria	30712
333	Ga0068857_100031299	3300005577	Bacteria	4701
334	Ga0068857_100037574	3300005577	Bacteria	4290
335	Ga0068857_100055384	3300005577	Bacteria	3520
336	Ga0068857_100059867	3300005577	Bacteria	3384
337	Ga0068857_100184903	3300005577	Bacteria	1897
338	Ga0068857_100191107	3300005577	Bacteria	1865
339	Ga0068857_100220904	3300005577	Bacteria	1731
340	Ga0068854_100019329	3300005578	Bacteria	4589
341	Ga0068854_100021374	3300005578	Bacteria	4391
342	Ga0068854_100103573	3300005578	Bacteria	2137
343	Ga0068854_100127946	3300005578	Bacteria	1936
344	Ga0068854_100162217	3300005578	Bacteria	1732
345	Ga0068856_100000214	3300005614	Bacteria	62372
346	Ga0068856_100009377	3300005614	Bacteria	9507
347	Ga0068856_100044405	3300005614	Bacteria	4374
348	Ga0068856_100190987	3300005614	Bacteria	2062
349	Ga0070702_100000013	3300005615	Bacteria	53762
350	Ga0068852_100000707	3300005616	Bacteria	21818
351	Ga0068852_100010699	3300005616	Bacteria	6868
352	Ga0068852_100218715	3300005616	Bacteria	1811
353	Ga0068859_100005210	3300005617	Bacteria	13210
354	Ga0068859_100028755	3300005617	Bacteria	5573
355	Ga0068859_100101230	3300005617	Bacteria	2938
356	Ga0068859_100156203	3300005617	Bacteria	2359
357	Ga0068859_100167454	3300005617	Bacteria	2277
358	Ga0068859_100205623	3300005617	Bacteria	2054
359	Ga0068864_100023061	3300005618	Bacteria	5225
360	Ga0068864_100025475	3300005618	Bacteria	4982
361	Ga0068864_100040947	3300005618	Bacteria	3962
362	Ga0068864_100045554	3300005618	Bacteria	3762
363	Ga0068864_100052265	3300005618	Bacteria	3521
364	Ga0068864_100065519	3300005618	Bacteria	3151
365	Ga0068864_100068050	3300005618	Bacteria	3093
366	Ga0068864_100242925	3300005618	Bacteria	1669
367	Ga0068866_10000455	3300005718	Bacteria	18716
368	Ga0068866_10006739	3300005718	Bacteria	4789
369	Ga0068861_100000425	3300005719	Bacteria	24515
370	Ga0068861_100002872	3300005719	Bacteria	11350
371	Ga0068861_100008807	3300005719	Bacteria	6950
372	Ga0068861_100136005	3300005719	Bacteria	2000
373	Ga0068851_10002550	3300005834	Bacteria	8016
374	Ga0068851_10137719	3300005834	Bacteria	1325
375	Ga0068870_10000001	3300005840	Bacteria	97513
376	Ga0068870_10015660	3300005840	Bacteria	3604
377	Ga0068870_10034018	3300005840	Bacteria	2605
378	Ga0068870_10160993	3300005840	Bacteria	1331
379	Ga0068863_100000313	3300005841	Bacteria	49176
380	Ga0068863_100029793	3300005841	Bacteria	5211
381	Ga0068863_100078080	3300005841	Bacteria	3134
382	Ga0068863_100104100	3300005841	Bacteria	2700
383	Ga0068858_100002484	3300005842	Bacteria	18613
384	Ga0068858_100051886	3300005842	Bacteria	3794
385	Ga0068858_100121341	3300005842	Bacteria	2444
386	Ga0068858_100397052	3300005842	Bacteria	1325
387	Ga0068860_100035393	3300005843	Bacteria	4789
388	Ga0068860_100059007	3300005843	Bacteria	3649
389	Ga0068860_100103623	3300005843	Bacteria	2716
390	Ga0068862_100002566	3300005844	Bacteria	16051
391	Ga0068862_100012043	3300005844	Bacteria	7147
392	Ga0068862_100020196	3300005844	Bacteria	5563
393	Ga0068862_100067143	3300005844	Bacteria	3091
394	Ga0068862_100091723	3300005844	Bacteria	2647
395	Ga0068862_100124757	3300005844	Bacteria	2272
396	Ga0081455_10000141	3300005937	Bacteria	84891
397	Ga0081455_10004492	3300005937	Bacteria	15607
398	Ga0081455_10010780	3300005937	Bacteria	9236
399	Ga0081455_10021897	3300005937	Bacteria	5986
400	Ga0081455_10039250	3300005937	Bacteria	4186
401	Ga0081455_10048994	3300005937	Unclassified	3645
402	Ga0081538_10003961	3300005981	Bacteria	13805
403	Ga0081538_10006100	3300005981	Bacteria	10708
404	Ga0081538_10007790	3300005981	Bacteria	9199
405	Ga0081538_10016308	3300005981	Bacteria	5704
406	Ga0081538_10048881	3300005981	Bacteria	2573
407	Ga0081538_10067155	3300005981	Unclassified	2004
408	Ga0081538_10098059	3300005981	Bacteria	1487
409	Ga0081540_1000922	3300005983	Bacteria	26453
410	Ga0081540_1001425	3300005983	Bacteria	20682
411	Ga0081540_1002287	3300005983	Bacteria	15734
412	Ga0081540_1007355	3300005983	Bacteria	7864
413	Ga0081540_1012177	3300005983	Bacteria	5687
414	Ga0081540_1014419	3300005983	Bacteria	5062
415	Ga0081540_1021474	3300005983	Bacteria	3842
416	Ga0081540_1030257	3300005983	Bacteria	3001
417	Ga0081540_1077224	3300005983	Bacteria	1514
418	Ga0081539_10000276	3300005985	Bacteria	117151
419	Ga0081539_10014863	3300005985	Bacteria	5715
420	Ga0081539_10114872	3300005985	Bacteria	1348
421	Ga0070717_10000215	3300006028	Bacteria	40202
422	Ga0070717_10239996	3300006028	Bacteria	1598
423	Ga0070717_10359196	3300006028	Bacteria	1303
424	Ga0075365_10000866	3300006038	Bacteria	12599
425	Ga0075365_10004579	3300006038	Bacteria	7353
426	Ga0075365_10010896	3300006038	Bacteria	5323
427	Ga0075365_10014307	3300006038	Bacteria	4771
428	Ga0075365_10017543	3300006038	Bacteria	4381
429	Ga0075365_10018634	3300006038	Bacteria	4272
430	Ga0075365_10029869	3300006038	Bacteria	3487
431	Ga0075365_10048544	3300006038	Bacteria	2794
432	Ga0075365_10051332	3300006038	Bacteria	2723
433	Ga0075365_10093439	3300006038	Bacteria	2052
434	Ga0075365_10110836	3300006038	Bacteria	1886
435	Ga0075365_10193278	3300006038	Bacteria	1425
436	Ga0075368_10001912	3300006042	Bacteria	6696
437	Ga0075368_10008829	3300006042	Bacteria	3609
438	Ga0075368_10078095	3300006042	Bacteria	1344
439	Ga0075363_100000268	3300006048	Bacteria	14984
440	Ga0075363_100009766	3300006048	Bacteria	4521
441	Ga0075363_100020013	3300006048	Bacteria	3352
442	Ga0075363_100021306	3300006048	Bacteria	3262
443	Ga0075363_100047706	3300006048	Bacteria	2276
444	Ga0075363_100082710	3300006048	Bacteria	1758
445	Ga0075364_10004279	3300006051	Bacteria	8197
446	Ga0075364_10011038	3300006051	Bacteria	5481
447	Ga0075364_10028707	3300006051	Bacteria	3562
448	Ga0075364_10031064	3300006051	Bacteria	3431
449	Ga0075364_10040507	3300006051	Bacteria	3021
450	Ga0075364_10047476	3300006051	Bacteria	2797
451	Ga0075364_10052470	3300006051	Bacteria	2664
452	Ga0075364_10064347	3300006051	Bacteria	2407
453	Ga0075364_10066321	3300006051	Bacteria	2371
454	Ga0075364_10075648	3300006051	Bacteria	2222
455	Ga0075432_10007884	3300006058	Bacteria	3630
456	Ga0075432_10064744	3300006058	Bacteria	1306
457	Ga0070715_10003840	3300006163	Bacteria	4849
458	Ga0070716_100010294	3300006173	Bacteria	4684
459	Ga0070716_100055164	3300006173	Bacteria	2273
460	Ga0070712_100027467	3300006175	Bacteria	3801
461	Ga0070712_100078095	3300006175	Bacteria	2389
462	Ga0070712_100118881	3300006175	Bacteria	1985
463	Ga0070712_100189476	3300006175	Bacteria	1608
464	Ga0075362_10003036	3300006177	Bacteria	5774
465	Ga0075362_10007757	3300006177	Bacteria	4077
466	Ga0075362_10012934	3300006177	Bacteria	3328
467	Ga0075362_10016189	3300006177	Bacteria	3049
468	Ga0075362_10017512	3300006177	Bacteria	2952
469	Ga0075362_10023007	3300006177	Bacteria	2631
470	Ga0075362_10023585	3300006177	Bacteria	2604
471	Ga0075362_10055026	3300006177	Bacteria	1789
472	Ga0075362_10059329	3300006177	Bacteria	1728
473	Ga0075362_10062645	3300006177	Bacteria	1685
474	Ga0075362_10064944	3300006177	Bacteria	1657
475	Ga0075367_10000458	3300006178	Bacteria	15161
476	Ga0075367_10001562	3300006178	Bacteria	9899
477	Ga0075367_10020611	3300006178	Bacteria	3674
478	Ga0075367_10026426	3300006178	Bacteria	3293
479	Ga0075367_10029070	3300006178	Bacteria	3158
480	Ga0075367_10042474	3300006178	Bacteria	2660
481	Ga0075367_10055851	3300006178	Bacteria	2344
482	Ga0075369_10000560	3300006186	Bacteria	11734
483	Ga0075369_10003922	3300006186	Bacteria	5455
484	Ga0075369_10004019	3300006186	Bacteria	5404
485	Ga0075369_10011267	3300006186	Bacteria	3516
486	Ga0075369_10011413	3300006186	Bacteria	3495
487	Ga0075366_10002850	3300006195	Bacteria	8958
488	Ga0075366_10006045	3300006195	Bacteria	6595
489	Ga0075366_10007752	3300006195	Bacteria	5944
490	Ga0075366_10008444	3300006195	Bacteria	5728
491	Ga0075366_10017650	3300006195	Bacteria	4110
492	Ga0075366_10018680	3300006195	Bacteria	4004
493	Ga0075366_10020283	3300006195	Bacteria	3855
494	Ga0075366_10020647	3300006195	Bacteria	3824
495	Ga0075366_10025598	3300006195	Bacteria	3448
496	Ga0075366_10028808	3300006195	Bacteria	3260
497	Ga0075366_10040972	3300006195	Bacteria	2740
498	Ga0075366_10042823	3300006195	Bacteria	2681
499	Ga0075366_10085776	3300006195	Bacteria	1884
500	Ga0075366_10091559	3300006195	Bacteria	1821
501	Ga0075366_10092283	3300006195	Bacteria	1814
502	Ga0075366_10151782	3300006195	Bacteria	1403
503	Ga0075366_10196424	3300006195	Bacteria	1226
504	Ga0097621_100000233	3300006237	Bacteria	37356
505	Ga0097621_100003286	3300006237	Bacteria	11119
506	Ga0097621_100055006	3300006237	Bacteria	3249
507	Ga0097621_100065032	3300006237	Bacteria	3000
508	Ga0075370_10000410	3300006353	Bacteria	15848
509	Ga0075370_10001220	3300006353	Bacteria	10875
510	Ga0075370_10003598	3300006353	Bacteria	7412
511	Ga0075370_10006565	3300006353	Bacteria	5860
512	Ga0075370_10008450	3300006353	Bacteria	5299
513	Ga0075370_10008825	3300006353	Bacteria	5205
514	Ga0075370_10013050	3300006353	Bacteria	4408
515	Ga0075370_10013843	3300006353	Bacteria	4292
516	Ga0075370_10033034	3300006353	Bacteria	2895
517	Ga0075370_10044894	3300006353	Bacteria	2498
518	Ga0075370_10049191	3300006353	Bacteria	2389
519	Ga0075370_10105152	3300006353	Bacteria	1636
520	Ga0068871_100000007	3300006358	Bacteria	115829
521	Ga0068871_100010086	3300006358	Bacteria	6873
522	Ga0068871_100012201	3300006358	Bacteria	6326
523	Ga0068871_100134753	3300006358	Bacteria	2097
524	Ga0068871_100215312	3300006358	Bacteria	1663
525	Ga0075428_100010917	3300006844	Bacteria	10104
526	Ga0075428_100017973	3300006844	Bacteria	7813
527	Ga0075428_100045633	3300006844	Bacteria	4814
528	Ga0075428_100060357	3300006844	Bacteria	4152
529	Ga0075428_100084158	3300006844	Bacteria	3471
530	Ga0075428_100157757	3300006844	Bacteria	2464
531	Ga0075428_100261600	3300006844	Bacteria	1863
532	Ga0075428_100528479	3300006844	Bacteria	1261
533	Ga0075430_100000126	3300006846	Bacteria	48056
534	Ga0075430_100000281	3300006846	Bacteria	35697
535	Ga0075430_100178260	3300006846	Bacteria	1768
536	Ga0075431_100000203	3300006847	Bacteria	43754
537	Ga0075431_100001584	3300006847	Bacteria	21166
538	Ga0075431_100007038	3300006847	Bacteria	11172
539	Ga0075431_100010580	3300006847	Bacteria	9276
540	Ga0075431_100016863	3300006847	Bacteria	7418
541	Ga0075431_100039393	3300006847	Bacteria	4867
542	Ga0075431_100084422	3300006847	Bacteria	3278
543	Ga0075433_10001874	3300006852	Bacteria	15800
544	Ga0075433_10023504	3300006852	Bacteria	5189
545	Ga0075433_10069863	3300006852	Bacteria	3085
546	Ga0075433_10152537	3300006852	Bacteria	2055
547	Ga0075433_10381560	3300006852	Bacteria	1244
548	Ga0075434_100001617	3300006871	Bacteria	19140
549	Ga0075434_100030612	3300006871	Bacteria	5301
550	Ga0075434_100042100	3300006871	Bacteria	4527
551	Ga0075434_100055229	3300006871	Bacteria	3946
552	Ga0075434_100064860	3300006871	Bacteria	3637
553	Ga0075434_100125017	3300006871	Bacteria	2589
554	Ga0075434_100278926	3300006871	Bacteria	1691
555	Ga0075429_100000246	3300006880	Bacteria	37274
556	Ga0075429_100002793	3300006880	Bacteria	14771
557	Ga0075429_100106469	3300006880	Bacteria	2450
558	Ga0068865_100000091	3300006881	Bacteria	47674
559	Ga0068865_100002621	3300006881	Bacteria	10696
560	Ga0068865_100053876	3300006881	Bacteria	2792
561	Ga0068865_100063199	3300006881	Bacteria	2601
562	Ga0068865_100116814	3300006881	Bacteria	1977
563	Ga0075436_100006889	3300006914	Bacteria	7772
564	Ga0075436_100006942	3300006914	Bacteria	7748
565	Ga0075436_100044740	3300006914	Bacteria	3053
566	Ga0075436_100051456	3300006914	Bacteria	2842
567	Ga0075436_100079638	3300006914	Bacteria	2269
568	Ga0097620_100005210	3300006931	Bacteria	13210
569	Ga0097620_100028754	3300006931	Bacteria	5573
570	Ga0097620_100101227	3300006931	Bacteria	2938
571	Ga0097620_100156203	3300006931	Bacteria	2359
572	Ga0097620_100167450	3300006931	Bacteria	2277
573	Ga0097620_100205615	3300006931	Bacteria	2054
574	Ga0079104_1020912	3300006946	Bacteria	1791
575	Ga0099826_10000050	3300006948	Bacteria	74241
576	Ga0099826_10008505	3300006948	Bacteria	7637
577	Ga0075435_100015059	3300007076	Bacteria	5805
578	Ga0075435_100034644	3300007076	Bacteria	4002
579	Ga0075435_100107262	3300007076	Bacteria	2319
580	Ga0075435_100144008	3300007076	Bacteria	2001
581	Ga0075435_100169790	3300007076	Bacteria	1840
582	Ga0075435_100204857	3300007076	Bacteria	1672
583	Ga0075435_100254332	3300007076	Bacteria	1496
584	Ga0099794_10022811	3300007265	Bacteria	2857
585	Ga0099795_10063856	3300007788	Bacteria	1373
586	Ga0105251_10024034	3300009011	Bacteria	3135
587	Ga0105244_10030917	3300009036	Bacteria	2845
588	Ga0105244_10054984	3300009036	Bacteria	2018
589	Ga0105250_10011840	3300009092	Bacteria	3616
590	Ga0105250_10020340	3300009092	Bacteria	2685
591	Ga0105240_10039796	3300009093	Bacteria	6017
592	Ga0105240_10110411	3300009093	Bacteria	3329
593	Ga0105240_10190790	3300009093	Bacteria	2410
594	Ga0111539_10000241	3300009094	Bacteria	65476
595	Ga0111539_10000336	3300009094	Bacteria	57798
596	Ga0111539_10001767	3300009094	Bacteria	28712
597	Ga0111539_10035683	3300009094	Bacteria	6020
598	Ga0111539_10037523	3300009094	Bacteria	5850
599	Ga0111539_10064142	3300009094	Bacteria	4348
600	Ga0111539_10065941	3300009094	Bacteria	4277
601	Ga0111539_10087300	3300009094	Bacteria	3665
602	Ga0111539_10126572	3300009094	Bacteria	2993
603	Ga0105245_10000187	3300009098	Bacteria	58607
604	Ga0105245_10085463	3300009098	Bacteria	2892
605	Ga0105245_10102055	3300009098	Bacteria	2656
606	Ga0105245_10242021	3300009098	Bacteria	1749
607	Ga0105245_10343362	3300009098	Bacteria	1477
608	Ga0114129_10004345	3300009147	Bacteria	20018
609	Ga0114129_10006933	3300009147	Bacteria	16118
610	Ga0114129_10007976	3300009147	Bacteria	15076
611	Ga0114129_10010074	3300009147	Bacteria	13473
612	Ga0114129_10015802	3300009147	Bacteria	10732
613	Ga0114129_10029076	3300009147	Bacteria	7828
614	Ga0114129_10040592	3300009147	Bacteria	6559
615	Ga0114129_10073185	3300009147	Bacteria	4774
616	Ga0114129_10168240	3300009147	Bacteria	2990
617	Ga0114129_10425993	3300009147	Bacteria	1744
618	Ga0105243_10002088	3300009148	Bacteria	16919
619	Ga0105243_10011004	3300009148	Bacteria	6841
620	Ga0105243_10013502	3300009148	Bacteria	6177
621	Ga0105243_10022158	3300009148	Bacteria	4827
622	Ga0105243_10034587	3300009148	Bacteria	3913
623	Ga0105243_10089698	3300009148	Bacteria	2528
624	Ga0105243_10150493	3300009148	Bacteria	1996
625	Ga0105243_10162935	3300009148	Bacteria	1924
626	Ga0105243_10304070	3300009148	Bacteria	1447
627	Ga0105241_10001147	3300009174	Bacteria	20184
628	Ga0105241_10013082	3300009174	Bacteria	6085
629	Ga0105241_10023453	3300009174	Bacteria	4577
630	Ga0105242_10000633	3300009176	Bacteria	27598
631	Ga0105242_10090738	3300009176	Bacteria	2571
632	Ga0105242_10125393	3300009176	Bacteria	2209
633	Ga0105248_10003122	3300009177	Bacteria	18333
634	Ga0105248_10035748	3300009177	Bacteria	5557
635	Ga0105248_10038151	3300009177	Bacteria	5376
636	Ga0105248_10060021	3300009177	Bacteria	4270
637	Ga0105248_10148531	3300009177	Bacteria	2644
638	Ga0105248_10159029	3300009177	Bacteria	2549
639	Ga0105248_10273812	3300009177	Bacteria	1901
640	Ga0105248_10347888	3300009177	Bacteria	1669
641	Ga0105248_10459502	3300009177	Bacteria	1435
642	Ga0105237_10004886	3300009545	Bacteria	15354
643	Ga0105237_10152282	3300009545	Bacteria	2309
644	Ga0105237_10173614	3300009545	Bacteria	2156
645	Ga0105237_10220466	3300009545	Bacteria	1897
646	Ga0105238_10007610	3300009551	Bacteria	10852
647	Ga0105238_10020792	3300009551	Bacteria	6685
648	Ga0105238_10038849	3300009551	Bacteria	4833
649	Ga0105238_10087449	3300009551	Bacteria	3103
650	Ga0105238_10260444	3300009551	Bacteria	1714
651	Ga0105249_10003785	3300009553	Bacteria	13066
652	Ga0105249_10005505	3300009553	Bacteria	10943
653	Ga0105249_10045236	3300009553	Bacteria	4003
654	Ga0105249_10081151	3300009553	Bacteria	3014
655	Ga0105249_10106002	3300009553	Bacteria	2651
656	Ga0105249_10201672	3300009553	Bacteria	1947
657	Ga0105249_10233879	3300009553	Bacteria	1813
658	Ga0105249_10242708	3300009553	Bacteria	1782
659	Ga0105249_10271190	3300009553	Bacteria	1691
660	Ga0123341_1044012	3300009765	Bacteria	2770
661	Ga0123341_1044321	3300009765	Bacteria	2747
662	Ga0123342_1003939	3300009766	Bacteria	23272
663	Ga0105239_10016888	3300010375	Bacteria	8066
664	Ga0105239_10022702	3300010375	Bacteria	6917
665	Ga0105239_10049097	3300010375	Bacteria	4627
666	Ga0105239_10053557	3300010375	Bacteria	4426
667	Ga0105239_10059788	3300010375	Bacteria	4182
668	Ga0105239_10090586	3300010375	Bacteria	3374
669	Ga0105239_10171775	3300010375	Bacteria	2424
670	Ga0105239_10194675	3300010375	Bacteria	2270
671	Ga0105239_10353836	3300010375	Bacteria	1658
672	Ga0105246_10000018	3300011119	Bacteria	64620
673	Ga0105246_10020609	3300011119	Bacteria	4231
674	Ga0157373_10006275	3300013100	Bacteria	8883
675	Ga0157373_10052769	3300013100	Bacteria	2892
676	Ga0157373_10089421	3300013100	Bacteria	2169
677	Ga0157371_10031563	3300013102	Bacteria	3816
678	Ga0157370_10005248	3300013104	Bacteria	14574
679	Ga0157370_10008445	3300013104	Bacteria	11109
680	Ga0157370_10080715	3300013104	Bacteria	3062
681	Ga0157370_10098507	3300013104	Bacteria	2742
682	Ga0157370_10109542	3300013104	Bacteria	2582
683	Ga0157369_10002895	3300013105	Bacteria	20503
684	Ga0157369_10019292	3300013105	Bacteria	7629
685	Ga0157369_10032739	3300013105	Bacteria	5713
686	Ga0157374_10001801	3300013296	Bacteria	18039
687	Ga0157374_10019084	3300013296	Bacteria	6067
688	Ga0157374_10122468	3300013296	Bacteria	2511
689	Ga0157374_10177495	3300013296	Bacteria	2079
690	Ga0157374_10218496	3300013296	Bacteria	1870
691	Ga0157378_10001922	3300013297	Bacteria	18635
692	Ga0157378_10037347	3300013297	Bacteria	4301
693	Ga0157378_10065285	3300013297	Bacteria	3258
694	Ga0157378_10130800	3300013297	Bacteria	2323
695	Ga0157378_10219848	3300013297	Bacteria	1805
696	Ga0163162_10001106	3300013306	Bacteria	25011
697	Ga0163162_10002702	3300013306	Bacteria	16820
698	Ga0163162_10015991	3300013306	Bacteria	7334
699	Ga0163162_10137899	3300013306	Bacteria	2551
700	Ga0163162_10140509	3300013306	Bacteria	2528
701	Ga0157372_10018149	3300013307	Bacteria	7564
702	Ga0157372_10028757	3300013307	Bacteria	6067
703	Ga0157372_10060311	3300013307	Bacteria	4245
704	Ga0157372_10066923	3300013307	Bacteria	4036
705	Ga0157372_10116308	3300013307	Bacteria	3066
706	Ga0157372_10272519	3300013307	Bacteria	1967
707	Ga0157375_10000982	3300013308	Bacteria	24672
708	Ga0157375_10049850	3300013308	Bacteria	4105
709	Ga0157375_10069157	3300013308	Bacteria	3536
710	Ga0157375_10086372	3300013308	Bacteria	3188
711	Ga0157375_10283168	3300013308	Bacteria	1821
712	Ga0163163_10004817	3300014325	Bacteria	11592
713	Ga0163163_10039332	3300014325	Bacteria	4616
714	Ga0163163_10059805	3300014325	Bacteria	3770
715	Ga0157380_10000203	3300014326	Bacteria	35045
716	Ga0157380_10010872	3300014326	Bacteria	6563
717	Ga0157380_10139732	3300014326	Bacteria	2079
718	Ga0182008_10021754	3300014497	Bacteria	3293
719	Ga0157377_10000086	3300014745	Bacteria	69604
720	Ga0157377_10051052	3300014745	Bacteria	2331
721	Ga0157377_10146472	3300014745	Bacteria	1456
722	Ga0157379_10015572	3300014968	Bacteria	6676
723	Ga0157379_10055959	3300014968	Bacteria	3525
724	Ga0157379_10075244	3300014968	Bacteria	3023
725	Ga0157379_10128410	3300014968	Bacteria	2281
726	Ga0157376_10000104	3300014969	Bacteria	61530
727	Ga0157376_10022178	3300014969	Bacteria	4944
728	Ga0157376_10044711	3300014969	Bacteria	3641
729	Ga0157376_10066769	3300014969	Bacteria	3041
730	Ga0157376_10314107	3300014969	Bacteria	1488
731	Ga0183362_10005	3300015683	Bacteria	437616
732	Ga0163161_10000669	3300017792	Bacteria	27400
733	Ga0163161_10000965	3300017792	Bacteria	22063
734	Ga0163161_10003970	3300017792	Bacteria	10368
735	Ga0163161_10107099	3300017792	Bacteria	2086
736	Ga0163161_10142226	3300017792	Bacteria	1817
737	Ga0206356_10177300	3300020070	Bacteria	1259
738	Ga0206356_10240664	3300020070	Bacteria	1212
739	Ga0206356_10244957	3300020070	Bacteria	1468
740	Ga0206350_10440167	3300020080	Bacteria	1389
741	Ga0206350_10540462	3300020080	Bacteria	1245
742	Ga0206354_10822350	3300020081	Bacteria	1257
743	Ga0206353_10954712	3300020082	Bacteria	1525
744	Ga0214542_1019223	3300021321	Bacteria	5461
745	Ga0214543_1002177	3300021327	Bacteria	38571
746	Ga0213876_10007987	3300021384	Bacteria	5737
747	Ga0224712_10018713	3300022467	Bacteria	2321
748	Ga0228711_1002116	3300022739	Bacteria	30198
749	Ga0228710_1011349	3300022740	Bacteria	11539
750	Ga0209435_100002	3300025206	Bacteria	794178
751	Ga0209436_103264	3300025208	Bacteria	4385
752	Ga0209436_105687	3300025208	Bacteria	2825
753	Ga0209436_109343	3300025208	Bacteria	1874
754	Ga0209672_101560	3300025228	Bacteria	7838
755	Ga0209147_101849	3300025229	Bacteria	6497
756	Ga0209258_100015	3300025242	Bacteria	706310
757	Ga0207425_1001050	3300025245	Bacteria	12778
758	Ga0207425_1001136	3300025245	Bacteria	11983
759	Ga0209646_1000001	3300025246	Bacteria	3092932
760	Ga0209026_1000040	3300025250	Bacteria	277470
761	Ga0209148_1000183	3300025254	Bacteria	122620
762	Ga0209759_1000001	3300025256	Bacteria	2799452
763	Ga0209129_1000049	3300025258	Bacteria	268086
764	Ga0209565_1000026	3300025263	Bacteria	365910
765	Ga0209565_1000357	3300025263	Bacteria	39887
766	Ga0209565_1000381	3300025263	Bacteria	37979
767	Ga0209565_1001334	3300025263	Bacteria	11239
768	Ga0209565_1002907	3300025263	Bacteria	5853
769	Ga0207666_1000008	3300025271	Bacteria	49296
770	Ga0209673_1000009	3300025273	Bacteria	620735
771	Ga0209673_1000012	3300025273	Bacteria	579480
772	Ga0209673_1000849	3300025273	Bacteria	39887
773	Ga0209673_1000949	3300025273	Bacteria	36252
774	Ga0209673_1001805	3300025273	Bacteria	17621
775	Ga0209673_1005062	3300025273	Bacteria	6787
776	Ga0209673_1019462	3300025273	Bacteria	2436
777	Ga0209673_1047189	3300025273	Bacteria	1170
778	Ga0209130_1000017	3300025284	Bacteria	388431
779	Ga0209130_1000123	3300025284	Bacteria	125840
780	Ga0209130_1000516	3300025284	Bacteria	38937
781	Ga0209130_1000591	3300025284	Bacteria	35327
782	Ga0209130_1004444	3300025284	Bacteria	5315
783	Ga0207673_1001932	3300025290	Bacteria	2317
784	Ga0209675_1000352	3300025291	Bacteria	39879
785	Ga0209675_1000360	3300025291	Bacteria	38963
786	Ga0209675_1001409	3300025291	Bacteria	13900
787	Ga0209675_1003382	3300025291	Bacteria	7609
788	Ga0209675_1005646	3300025291	Bacteria	5178
789	Ga0209676_1000051	3300025292	Bacteria	389016
790	Ga0209676_1000137	3300025292	Bacteria	179437
791	Ga0209676_1000873	3300025292	Bacteria	38608
792	Ga0209676_1000876	3300025292	Bacteria	38530
793	Ga0209676_1003390	3300025292	Bacteria	9878
794	Ga0209676_1004131	3300025292	Bacteria	8269
795	Ga0209025_1000145	3300025294	Bacteria	181436
796	Ga0209025_1000161	3300025294	Bacteria	166506
797	Ga0209025_1000265	3300025294	Bacteria	123182
798	Ga0209025_1000290	3300025294	Bacteria	113067
799	Ga0209025_1000594	3300025294	Bacteria	65297
800	Ga0209025_1001396	3300025294	Bacteria	32114
801	Ga0209025_1004020	3300025294	Bacteria	13181
802	Ga0209025_1004882	3300025294	Bacteria	11297
803	Ga0209025_1008607	3300025294	Bacteria	7305
804	Ga0209025_1009995	3300025294	Bacteria	6502
805	Ga0209025_1029096	3300025294	Bacteria	2686
806	Ga0209564_1000013	3300025295	Bacteria	775755
807	Ga0209564_1000211	3300025295	Bacteria	133277
808	Ga0209564_1000228	3300025295	Bacteria	125206
809	Ga0209564_1000303	3300025295	Bacteria	97431
810	Ga0209564_1000932	3300025295	Bacteria	37913
811	Ga0209564_1001504	3300025295	Bacteria	23379
812	Ga0209758_1000135	3300025297	Bacteria	177753
813	Ga0209758_1000251	3300025297	Bacteria	108814
814	Ga0209758_1000628	3300025297	Bacteria	54130
815	Ga0209758_1002358	3300025297	Bacteria	19467
816	Ga0209758_1006011	3300025297	Bacteria	8968
817	Ga0209758_1007019	3300025297	Bacteria	7826
818	Ga0209758_1011107	3300025297	Bacteria	5265
819	Ga0209758_1012024	3300025297	Bacteria	4913
820	Ga0209758_1019126	3300025297	Bacteria	3321
821	Ga0209758_1023130	3300025297	Bacteria	2821
822	Ga0209758_1024601	3300025297	Bacteria	2678
823	Ga0209758_1030742	3300025297	Bacteria	2218
824	Ga0209050_1000015	3300025298	Bacteria	759102
825	Ga0209050_1000044	3300025298	Bacteria	391114
826	Ga0209050_1000759	3300025298	Bacteria	46447
827	Ga0209050_1000808	3300025298	Bacteria	44058
828	Ga0209050_1002190	3300025298	Bacteria	17613
829	Ga0209050_1002533	3300025298	Bacteria	15297
830	Ga0209050_1015356	3300025298	Bacteria	3220
831	Ga0209050_1029943	3300025298	Bacteria	1727
832	Ga0209256_1000003	3300025299	Bacteria	1661127
833	Ga0209256_1000129	3300025299	Bacteria	163766
834	Ga0209256_1000196	3300025299	Bacteria	115576
835	Ga0209256_1000224	3300025299	Bacteria	104436
836	Ga0209256_1002058	3300025299	Bacteria	17780
837	Ga0209256_1003058	3300025299	Bacteria	12319
838	Ga0209256_1015037	3300025299	Bacteria	2736
839	Ga0209256_1019150	3300025299	Bacteria	2192
840	Ga0207426_1000006	3300025302	Bacteria	1025969
841	Ga0207426_1000062	3300025302	Bacteria	362040
842	Ga0207426_1000171	3300025302	Bacteria	163766
843	Ga0207426_1000185	3300025302	Bacteria	154146
844	Ga0207426_1000287	3300025302	Bacteria	100566
845	Ga0207426_1001827	3300025302	Bacteria	15741
846	Ga0207426_1028033	3300025302	Bacteria	1870
847	Ga0209051_1000010	3300025303	Bacteria	641298
848	Ga0209051_1000031	3300025303	Bacteria	391114
849	Ga0209051_1000210	3300025303	Bacteria	102629
850	Ga0209051_1000315	3300025303	Bacteria	73579
851	Ga0209051_1000773	3300025303	Bacteria	33955
852	Ga0209051_1000859	3300025303	Bacteria	30952
853	Ga0209051_1003896	3300025303	Bacteria	9525
854	Ga0209051_1006359	3300025303	Bacteria	6683
855	Ga0209051_1014927	3300025303	Bacteria	3602
856	Ga0209051_1015137	3300025303	Bacteria	3563
857	Ga0209257_1000026	3300025304	Bacteria	723225
858	Ga0209257_1000058	3300025304	Bacteria	381686
859	Ga0209257_1000061	3300025304	Bacteria	367698
860	Ga0209257_1000309	3300025304	Bacteria	104166
861	Ga0209257_1000314	3300025304	Bacteria	102629
862	Ga0209257_1003778	3300025304	Bacteria	12499
863	Ga0209257_1006709	3300025304	Bacteria	7278
864	Ga0209257_1007911	3300025304	Bacteria	6246
865	Ga0209257_1009716	3300025304	Bacteria	5062
866	Ga0207697_10000890	3300025315	Bacteria	16909
867	Ga0207697_10055827	3300025315	Bacteria	1638
868	Ga0207656_10020045	3300025321	Bacteria	2653
869	Ga0207656_10020569	3300025321	Bacteria	2625
870	Ga0207655_1024412	3300025728	Bacteria	2964
871	Ga0207713_1025539	3300025735	Bacteria	2725
872	Ga0207682_10000002	3300025893	Bacteria	132580
873	Ga0207682_10024245	3300025893	Bacteria	2401
874	Ga0207692_10002009	3300025898	Bacteria	7764
875	Ga0207692_10015104	3300025898	Bacteria	3390
876	Ga0207692_10029761	3300025898	Bacteria	2598
877	Ga0207642_10000045	3300025899	Bacteria	35570
878	Ga0207642_10002555	3300025899	Bacteria	5665
879	Ga0207642_10028824	3300025899	Bacteria	2291
880	Ga0207710_10005065	3300025900	Bacteria	5708
881	Ga0207710_10098337	3300025900	Bacteria	1377
882	Ga0207710_10104361	3300025900	Bacteria	1340
883	Ga0207688_10000111	3300025901	Bacteria	32690
884	Ga0207688_10001353	3300025901	Bacteria	12737
885	Ga0207688_10104720	3300025901	Bacteria	1637
886	Ga0207680_10035071	3300025903	Bacteria	2876
887	Ga0207680_10095235	3300025903	Bacteria	1902
888	Ga0207647_10011642	3300025904	Bacteria	6160
889	Ga0207685_10005783	3300025905	Bacteria	3303
890	Ga0207685_10033962	3300025905	Bacteria	1849
891	Ga0207699_10175077	3300025906	Bacteria	1438
892	Ga0207645_10000026	3300025907	Bacteria	97025
893	Ga0207645_10000424	3300025907	Bacteria	34978
894	Ga0207645_10057015	3300025907	Bacteria	2494
895	Ga0207645_10067046	3300025907	Bacteria	2294
896	Ga0207645_10123071	3300025907	Bacteria	1685
897	Ga0207645_10171377	3300025907	Bacteria	1423
898	Ga0207643_10000090	3300025908	Bacteria	60972
899	Ga0207643_10058384	3300025908	Bacteria	2199
900	Ga0207643_10072993	3300025908	Bacteria	1977
901	Ga0207705_10026021	3300025909	Bacteria	4175
902	Ga0207705_10078974	3300025909	Bacteria	2396
903	Ga0207684_10007960	3300025910	Bacteria	9473
904	Ga0207684_10029535	3300025910	Bacteria	4667
905	Ga0207684_10038233	3300025910	Bacteria	4072
906	Ga0207684_10124766	3300025910	Bacteria	2209
907	Ga0207654_10000296	3300025911	Bacteria	30110
908	Ga0207654_10053262	3300025911	Bacteria	2335
909	Ga0207707_10000652	3300025912	Bacteria	34321
910	Ga0207707_10007118	3300025912	Bacteria	9747
911	Ga0207707_10016505	3300025912	Bacteria	6439
912	Ga0207707_10201112	3300025912	Bacteria	1737
913	Ga0207695_10004829	3300025913	Bacteria	18197
914	Ga0207695_10058919	3300025913	Bacteria	3985
915	Ga0207695_10205985	3300025913	Bacteria	1880
916	Ga0207671_10012628	3300025914	Bacteria	6784
917	Ga0207671_10016074	3300025914	Bacteria	5831
918	Ga0207671_10019749	3300025914	Bacteria	5144
919	Ga0207671_10083807	3300025914	Bacteria	2394
920	Ga0207671_10350518	3300025914	Bacteria	1171
921	Ga0207693_10005410	3300025915	Bacteria	10666
922	Ga0207693_10007613	3300025915	Bacteria	8897
923	Ga0207693_10013053	3300025915	Bacteria	6704
924	Ga0207693_10031687	3300025915	Bacteria	4177
925	Ga0207693_10087937	3300025915	Bacteria	2435
926	Ga0207663_10047748	3300025916	Bacteria	2645
927	Ga0207663_10113105	3300025916	Bacteria	1845
928	Ga0207663_10141902	3300025916	Bacteria	1674
929	Ga0207660_10000070	3300025917	Bacteria	53365
930	Ga0207660_10016263	3300025917	Bacteria	4923
931	Ga0207660_10096372	3300025917	Bacteria	2202
932	Ga0207660_10171587	3300025917	Bacteria	1679
933	Ga0207662_10000617	3300025918	Bacteria	15932
934	Ga0207662_10002827	3300025918	Bacteria	8776
935	Ga0207662_10189125	3300025918	Bacteria	1328
936	Ga0207662_10238422	3300025918	Bacteria	1190
937	Ga0207657_10003460	3300025919	Bacteria	16845
938	Ga0207657_10014122	3300025919	Bacteria	7814
939	Ga0207657_10020697	3300025919	Bacteria	6211
940	Ga0207657_10138724	3300025919	Bacteria	1988
941	Ga0207649_10000878	3300025920	Bacteria	19012
942	Ga0207649_10019621	3300025920	Bacteria	3867
943	Ga0207649_10054369	3300025920	Bacteria	2491
944	Ga0207649_10055966	3300025920	Bacteria	2461
945	Ga0207649_10062557	3300025920	Bacteria	2347
946	Ga0207649_10209718	3300025920	Bacteria	1381
947	Ga0207652_10001231	3300025921	Bacteria	22925
948	Ga0207652_10016979	3300025921	Bacteria	5954
949	Ga0207652_10042076	3300025921	Bacteria	3887
950	Ga0207652_10045678	3300025921	Bacteria	3735
951	Ga0207652_10086240	3300025921	Bacteria	2753
952	Ga0207646_10043966	3300025922	Bacteria	4010
953	Ga0207646_10043993	3300025922	Bacteria	4008
954	Ga0207646_10102915	3300025922	Bacteria	2561
955	Ga0207646_10404167	3300025922	Bacteria	1233
956	Ga0207681_10000118	3300025923	Bacteria	66554
957	Ga0207681_10024137	3300025923	Bacteria	3899
958	Ga0207681_10047751	3300025923	Bacteria	2886
959	Ga0207681_10062788	3300025923	Bacteria	2559
960	Ga0207694_10029705	3300025924	Bacteria	4172
961	Ga0207694_10130337	3300025924	Bacteria	2015
962	Ga0207694_10177273	3300025924	Bacteria	1727
963	Ga0207694_10217846	3300025924	Bacteria	1556
964	Ga0207694_10269016	3300025924	Bacteria	1398
965	Ga0207650_10004695	3300025925	Bacteria	9336
966	Ga0207650_10007168	3300025925	Bacteria	7599
967	Ga0207650_10030086	3300025925	Bacteria	3909
968	Ga0207650_10066293	3300025925	Bacteria	2707
969	Ga0207650_10213151	3300025925	Bacteria	1551
970	Ga0207659_10000015	3300025926	Bacteria	168475
971	Ga0207659_10119142	3300025926	Bacteria	2020
972	Ga0207687_10000050	3300025927	Bacteria	93290
973	Ga0207687_10014107	3300025927	Bacteria	5225
974	Ga0207687_10040389	3300025927	Bacteria	3198
975	Ga0207687_10062205	3300025927	Bacteria	2639
976	Ga0207700_10023671	3300025928	Bacteria	4241
977	Ga0207700_10026515	3300025928	Bacteria	4042
978	Ga0207700_10037196	3300025928	Bacteria	3523
979	Ga0207700_10145527	3300025928	Bacteria	1952
980	Ga0207664_10010958	3300025929	Bacteria	6421
981	Ga0207644_10006370	3300025931	Bacteria	7687
982	Ga0207644_10008956	3300025931	Bacteria	6557
983	Ga0207644_10052180	3300025931	Bacteria	2938
984	Ga0207644_10058422	3300025931	Bacteria	2788
985	Ga0207644_10064573	3300025931	Bacteria	2660
986	Ga0207644_10076308	3300025931	Bacteria	2465
987	Ga0207690_10000376	3300025932	Bacteria	29571
988	Ga0207690_10000397	3300025932	Bacteria	28759
989	Ga0207690_10048738	3300025932	Bacteria	2819
990	Ga0207690_10056827	3300025932	Bacteria	2641
991	Ga0207690_10076961	3300025932	Bacteria	2318
992	Ga0207706_10002825	3300025933	Bacteria	16845
993	Ga0207706_10005486	3300025933	Bacteria	11828
994	Ga0207706_10005547	3300025933	Bacteria	11766
995	Ga0207706_10007138	3300025933	Bacteria	10337
996	Ga0207706_10013655	3300025933	Bacteria	7375
997	Ga0207706_10017959	3300025933	Bacteria	6366
998	Ga0207706_10020936	3300025933	Bacteria	5873
999	Ga0207706_10024748	3300025933	Bacteria	5381
1000	Ga0207706_10182609	3300025933	Bacteria	1842
1001	Ga0207686_10000065	3300025934	Bacteria	95366
1002	Ga0207686_10018935	3300025934	Bacteria	3905
1003	Ga0207686_10039996	3300025934	Bacteria	2848
1004	Ga0207686_10071240	3300025934	Bacteria	2236
1005	Ga0207686_10076178	3300025934	Bacteria	2174
1006	Ga0207686_10089277	3300025934	Bacteria	2031
1007	Ga0207709_10000081	3300025935	Bacteria	164427
1008	Ga0207709_10000497	3300025935	Bacteria	35233
1009	Ga0207709_10027340	3300025935	Bacteria	3285
1010	Ga0207709_10060442	3300025935	Bacteria	2363
1011	Ga0207709_10082191	3300025935	Bacteria	2079
1012	Ga0207709_10111379	3300025935	Bacteria	1831
1013	Ga0207670_10000056	3300025936	Bacteria	84496
1014	Ga0207670_10022223	3300025936	Bacteria	3928
1015	Ga0207670_10097879	3300025936	Bacteria	2090
1016	Ga0207669_10000008	3300025937	Bacteria	168213
1017	Ga0207669_10023634	3300025937	Bacteria	3288
1018	Ga0207669_10107339	3300025937	Bacteria	1862
1019	Ga0207669_10237742	3300025937	Bacteria	1348
1020	Ga0207704_10000031	3300025938	Bacteria	111710
1021	Ga0207704_10018292	3300025938	Bacteria	3654
1022	Ga0207704_10020629	3300025938	Bacteria	3491
1023	Ga0207704_10042458	3300025938	Bacteria	2677
1024	Ga0207665_10000754	3300025939	Bacteria	21774
1025	Ga0207665_10061394	3300025939	Bacteria	2547
1026	Ga0207691_10000251	3300025940	Bacteria	53184
1027	Ga0207691_10004694	3300025940	Bacteria	13225
1028	Ga0207691_10009304	3300025940	Bacteria	9430
1029	Ga0207691_10010272	3300025940	Bacteria	8980
1030	Ga0207691_10017248	3300025940	Bacteria	6848
1031	Ga0207691_10040561	3300025940	Bacteria	4300
1032	Ga0207691_10048066	3300025940	Bacteria	3913
1033	Ga0207691_10072710	3300025940	Bacteria	3102
1034	Ga0207691_10076896	3300025940	Bacteria	3008
1035	Ga0207711_10019660	3300025941	Bacteria	5622
1036	Ga0207711_10022586	3300025941	Bacteria	5262
1037	Ga0207711_10029432	3300025941	Bacteria	4633
1038	Ga0207711_10038183	3300025941	Bacteria	4082
1039	Ga0207711_10043634	3300025941	Bacteria	3826
1040	Ga0207711_10055487	3300025941	Bacteria	3402
1041	Ga0207711_10106488	3300025941	Bacteria	2488
1042	Ga0207689_10000772	3300025942	Bacteria	30699
1043	Ga0207689_10001746	3300025942	Bacteria	20515
1044	Ga0207689_10011753	3300025942	Bacteria	7504
1045	Ga0207689_10030864	3300025942	Bacteria	4465
1046	Ga0207689_10049853	3300025942	Bacteria	3454
1047	Ga0207689_10123647	3300025942	Bacteria	2128
1048	Ga0207689_10223828	3300025942	Bacteria	1555
1049	Ga0207661_10000141	3300025944	Bacteria	45776
1050	Ga0207661_10045959	3300025944	Bacteria	3460
1051	Ga0207661_10377071	3300025944	Bacteria	1283
1052	Ga0207679_10000014	3300025945	Bacteria	275841
1053	Ga0207679_10003520	3300025945	Bacteria	9690
1054	Ga0207679_10013102	3300025945	Bacteria	5428
1055	Ga0207679_10019948	3300025945	Bacteria	4515
1056	Ga0207679_10070067	3300025945	Bacteria	2641
1057	Ga0207667_10026871	3300025949	Bacteria	6280
1058	Ga0207667_10067088	3300025949	Bacteria	3738
1059	Ga0207667_10072411	3300025949	Bacteria	3582
1060	Ga0207667_10100006	3300025949	Bacteria	2992
1061	Ga0207667_10126665	3300025949	Bacteria	2630
1062	Ga0207667_10267396	3300025949	Bacteria	1748
1063	Ga0207651_10000050	3300025960	Bacteria	54654
1064	Ga0207651_10016021	3300025960	Bacteria	4376
1065	Ga0207651_10021642	3300025960	Bacteria	3912
1066	Ga0207651_10112315	3300025960	Bacteria	2048
1067	Ga0207651_10180413	3300025960	Bacteria	1674
1068	Ga0207651_10287615	3300025960	Bacteria	1361
1069	Ga0207712_10001039	3300025961	Bacteria	19654
1070	Ga0207712_10020077	3300025961	Bacteria	4372
1071	Ga0207712_10024551	3300025961	Bacteria	3994
1072	Ga0207712_10052313	3300025961	Bacteria	2860
1073	Ga0207712_10145494	3300025961	Bacteria	1824
1074	Ga0207712_10211974	3300025961	Bacteria	1543
1075	Ga0207712_10287575	3300025961	Bacteria	1344
1076	Ga0207668_10000037	3300025972	Bacteria	115995
1077	Ga0207668_10056320	3300025972	Bacteria	2737
1078	Ga0207668_10084151	3300025972	Bacteria	2317
1079	Ga0207640_10142873	3300025981	Bacteria	1747
1080	Ga0207658_10069901	3300025986	Bacteria	2654
1081	Ga0207658_10268431	3300025986	Bacteria	1457
1082	Ga0207677_10004289	3300026023	Bacteria	7633
1083	Ga0207677_10068555	3300026023	Bacteria	2490
1084	Ga0207677_10107791	3300026023	Bacteria	2067
1085	Ga0207677_10171545	3300026023	Bacteria	1696
1086	Ga0207677_10234189	3300026023	Bacteria	1481
1087	Ga0207703_10006017	3300026035	Bacteria	9711
1088	Ga0207703_10020229	3300026035	Bacteria	5204
1089	Ga0207703_10033836	3300026035	Bacteria	4053
1090	Ga0207703_10109178	3300026035	Bacteria	2357
1091	Ga0207639_10002048	3300026041	Bacteria	13594
1092	Ga0207639_10009583	3300026041	Bacteria	6686
1093	Ga0207639_10027207	3300026041	Bacteria	4163
1094	Ga0207639_10067336	3300026041	Bacteria	2786
1095	Ga0207678_10000372	3300026067	Bacteria	40922
1096	Ga0207678_10003222	3300026067	Bacteria	14749
1097	Ga0207678_10013665	3300026067	Bacteria	7130
1098	Ga0207678_10020674	3300026067	Bacteria	5770
1099	Ga0207678_10022238	3300026067	Bacteria	5555
1100	Ga0207678_10022408	3300026067	Bacteria	5531
1101	Ga0207678_10025928	3300026067	Bacteria	5115
1102	Ga0207678_10119540	3300026067	Bacteria	2248
1103	Ga0207708_10001602	3300026075	Bacteria	16856
1104	Ga0207708_10020468	3300026075	Bacteria	4989
1105	Ga0207708_10041992	3300026075	Bacteria	3487
1106	Ga0207708_10057963	3300026075	Bacteria	2955
1107	Ga0207708_10062641	3300026075	Bacteria	2841
1108	Ga0207708_10076429	3300026075	Bacteria	2569
1109	Ga0207708_10243120	3300026075	Bacteria	1448
1110	Ga0207702_10003438	3300026078	Bacteria	14456
1111	Ga0207702_10009328	3300026078	Bacteria	8244
1112	Ga0207702_10120449	3300026078	Bacteria	2348
1113	Ga0207702_10364105	3300026078	Bacteria	1386
1114	Ga0207641_10011951	3300026088	Bacteria	7123
1115	Ga0207641_10028618	3300026088	Bacteria	4605
1116	Ga0207641_10032736	3300026088	Bacteria	4317
1117	Ga0207641_10067225	3300026088	Bacteria	3070
1118	Ga0207641_10115687	3300026088	Bacteria	2385
1119	Ga0207648_10011868	3300026089	Bacteria	8188
1120	Ga0207648_10011919	3300026089	Bacteria	8164
1121	Ga0207648_10012962	3300026089	Bacteria	7783
1122	Ga0207648_10015627	3300026089	Bacteria	6974
1123	Ga0207648_10020579	3300026089	Bacteria	5940
1124	Ga0207648_10029742	3300026089	Bacteria	4844
1125	Ga0207648_10167324	3300026089	Bacteria	1943
1126	Ga0207648_10222131	3300026089	Bacteria	1679
1127	Ga0207648_10239658	3300026089	Bacteria	1615
1128	Ga0207676_10000208	3300026095	Bacteria	50795
1129	Ga0207676_10049781	3300026095	Bacteria	3262
1130	Ga0207676_10059381	3300026095	Bacteria	3020
1131	Ga0207676_10062512	3300026095	Bacteria	2953
1132	Ga0207676_10103998	3300026095	Bacteria	2361
1133	Ga0207676_10211793	3300026095	Bacteria	1720
1134	Ga0207674_10001378	3300026116	Bacteria	31386
1135	Ga0207674_10033605	3300026116	Bacteria	5368
1136	Ga0207674_10040828	3300026116	Bacteria	4803
1137	Ga0207674_10067898	3300026116	Bacteria	3588
1138	Ga0207674_10089266	3300026116	Bacteria	3075
1139	Ga0207674_10099341	3300026116	Bacteria	2893
1140	Ga0207674_10156505	3300026116	Bacteria	2234
1141	Ga0207674_10161172	3300026116	Bacteria	2197
1142	Ga0207674_10185454	3300026116	Bacteria	2031
1143	Ga0207674_10340251	3300026116	Bacteria	1451
1144	Ga0207675_100001259	3300026118	Bacteria	25276
1145	Ga0207675_100002877	3300026118	Bacteria	16921
1146	Ga0207675_100005267	3300026118	Bacteria	12442
1147	Ga0207675_100010274	3300026118	Bacteria	8772
1148	Ga0207675_100044658	3300026118	Bacteria	4141
1149	Ga0207675_100187188	3300026118	Bacteria	1985
1150	Ga0207675_100208834	3300026118	Bacteria	1877
1151	Ga0207675_100243561	3300026118	Bacteria	1738
1152	Ga0207675_100479872	3300026118	Bacteria	1235
1153	Ga0207683_10000002	3300026121	Bacteria	258441
1154	Ga0207683_10001072	3300026121	Bacteria	24962
1155	Ga0207683_10031065	3300026121	Bacteria	4634
1156	Ga0207683_10035533	3300026121	Bacteria	4334
1157	Ga0207683_10057997	3300026121	Bacteria	3399
1158	Ga0207683_10181510	3300026121	Bacteria	1908
1159	Ga0207698_10001276	3300026142	Bacteria	14690
1160	Ga0207698_10013213	3300026142	Bacteria	5438
1161	Ga0207698_10063833	3300026142	Bacteria	2884
1162	Ga0207698_10269635	3300026142	Bacteria	1568
1163	Ga0207698_10296424	3300026142	Bacteria	1503
1164	Ga0207698_10299030	3300026142	Bacteria	1497
1165	Ga0209281_1000106	3300027111	Bacteria	219666
1166	Ga0209281_1001460	3300027111	Bacteria	13816
1167	Ga0209995_1010725	3300027471	Bacteria	1488
1168	Ga0209968_1001655	3300027526	Bacteria	3360
1169	Ga0209999_1003335	3300027543	Bacteria	2865
1170	Ga0209970_1001986	3300027614	Bacteria	3519
1171	Ga0209282_1000079	3300027666	Bacteria	74206
1172	Ga0209282_1000083	3300027666	Bacteria	70247
1173	Ga0209282_1003410	3300027666	Bacteria	9441
1174	Ga0209588_1010497	3300027671	Bacteria	2784
1175	Ga0209966_1000161	3300027695	Bacteria	28311
1176	Ga0209966_1007068	3300027695	Bacteria	1962
1177	Ga0209966_1012547	3300027695	Bacteria	1558
1178	Ga0209813_10000840	3300027866	Bacteria	6942
1179	Ga0209813_10000917	3300027866	Bacteria	6637
1180	Ga0209813_10003325	3300027866	Bacteria	3759
1181	Ga0209813_10004362	3300027866	Bacteria	3376
1182	Ga0209813_10022424	3300027866	Bacteria	1786
1183	Ga0209974_10004251	3300027876	Bacteria	5112
1184	Ga0209974_10013987	3300027876	Bacteria	2674
1185	Ga0209974_10016310	3300027876	Bacteria	2467
1186	Ga0207428_10000011	3300027907	Bacteria	354388
1187	Ga0207428_10000046	3300027907	Bacteria	191032
1188	Ga0207428_10000086	3300027907	Bacteria	131832
1189	Ga0207428_10002304	3300027907	Bacteria	19123
1190	Ga0207428_10019733	3300027907	Bacteria	5743
1191	Ga0207428_10023698	3300027907	Bacteria	5157
1192	Ga0268266_10000680	3300028379	Bacteria	45937
1193	Ga0268266_10010351	3300028379	Bacteria	8158
1194	Ga0268266_10049533	3300028379	Bacteria	3603
1195	Ga0268266_10106237	3300028379	Bacteria	2481
1196	Ga0268266_10144060	3300028379	Bacteria	2140
1197	Ga0268265_10000117	3300028380	Bacteria	99955
1198	Ga0268265_10007379	3300028380	Bacteria	7423
1199	Ga0268265_10020308	3300028380	Bacteria	4635
1200	Ga0268265_10134565	3300028380	Bacteria	2060
1201	Ga0268264_10000487	3300028381	Bacteria	52821
1202	Ga0268264_10066850	3300028381	Bacteria	3033
1203	Ga0268264_10126627	3300028381	Bacteria	2258
1204	Ga0268264_10141710	3300028381	Bacteria	2144
1205	Ga0307517_10032116	3300028786	Bacteria	6082
1206	Ga0307517_10109150	3300028786	Bacteria	2119
1207	Ga0307515_10000037	3300028794	Bacteria	331970
1208	Ga0307515_10000063	3300028794	Bacteria	245504
1209	Ga0307515_10008845	3300028794	Bacteria	19552
1210	Ga0307515_10014764	3300028794	Bacteria	14449
1211	Ga0307515_10126241	3300028794	Bacteria	2856
1212	Ga0307515_10144544	3300028794	Bacteria	2528
1213	Ga0307511_10000948	3300030521	Bacteria	30775
1214	Ga0307512_10038502	3300030522	Bacteria	4021
1215	Ga0316176_1003191	3300030732	Bacteria	4953
1216	Ga0316183_1032406	3300030742	Bacteria	4426
1217	Ga0265325_10000062	3300031241	Bacteria	74697
1218	Ga0265325_10002896	3300031241	Bacteria	11436
1219	Ga0265331_10011168	3300031250	Bacteria	4926
1220	Ga0265327_10056366	3300031251	Bacteria	2025
1221	Ga0307513_10000034	3300031456	Bacteria	185012
1222	Ga0307513_10000057	3300031456	Bacteria	146564
1223	Ga0307513_10015642	3300031456	Bacteria	9184
1224	Ga0307513_10035153	3300031456	Bacteria	5612
1225	Ga0307513_10161609	3300031456	Bacteria	2132
1226	Ga0307513_10167808	3300031456	Bacteria	2077
1227	Ga0307513_10180045	3300031456	Bacteria	1978
1228	Ga0307509_10022123	3300031507	Bacteria	7177
1229	Ga0307408_100000012	3300031548	Bacteria	408153
1230	Ga0307408_100010920	3300031548	Bacteria	5994
1231	Ga0307408_100022312	3300031548	Bacteria	4300
1232	Ga0307408_100029389	3300031548	Bacteria	3808
1233	Ga0307408_100039495	3300031548	Bacteria	3337
1234	Ga0307408_100061305	3300031548	Bacteria	2746
1235	Ga0307408_100195886	3300031548	Bacteria	1631
1236	Ga0307408_100219383	3300031548	Bacteria	1551
1237	Ga0265313_10018744	3300031595	Bacteria	3877
1238	Ga0307508_10034808	3300031616	Bacteria	4538
1239	Ga0307508_10060820	3300031616	Bacteria	3339
1240	Ga0307508_10246864	3300031616	Bacteria	1382
1241	Ga0307514_10085974	3300031649	Bacteria	2309
1242	Ga0265314_10016720	3300031711	Bacteria	5782
1243	Ga0265314_10041382	3300031711	Bacteria	3299
1244	Ga0307516_10000348	3300031730	Bacteria	60054
1245	Ga0307516_10027202	3300031730	Bacteria	5800
1246	Ga0307516_10048432	3300031730	Bacteria	4182
1247	Ga0307405_10026417	3300031731	Bacteria	3348
1248	Ga0307405_10034312	3300031731	Bacteria	3018
1249	Ga0307405_10050617	3300031731	Bacteria	2573
1250	Ga0307405_10060885	3300031731	Bacteria	2384
1251	Ga0307405_10065929	3300031731	Bacteria	2307
1252	Ga0307405_10157952	3300031731	Bacteria	1602
1253	Ga0307405_10163279	3300031731	Bacteria	1580
1254	Ga0307413_10001553	3300031824	Bacteria	8834
1255	Ga0307413_10005510	3300031824	Bacteria	5660
1256	Ga0307413_10067716	3300031824	Bacteria	2234
1257	Ga0307410_10001543	3300031852	Bacteria	10501
1258	Ga0307410_10011679	3300031852	Bacteria	5036
1259	Ga0307410_10014263	3300031852	Bacteria	4670
1260	Ga0307410_10065105	3300031852	Bacteria	2507
1261	Ga0307410_10127835	3300031852	Bacteria	1863
1262	Ga0307410_10160543	3300031852	Bacteria	1684
1263	Ga0307406_10000470	3300031901	Bacteria	23243
1264	Ga0307406_10024497	3300031901	Bacteria	3606
1265	Ga0307406_10086265	3300031901	Bacteria	2101
1266	Ga0307406_10219098	3300031901	Bacteria	1413
1267	Ga0307407_10063127	3300031903	Bacteria	2172
1268	Ga0307407_10070502	3300031903	Bacteria	2078
1269	Ga0307412_10009817	3300031911	Bacteria	5497
1270	Ga0307412_10018472	3300031911	Bacteria	4196
1271	Ga0307412_10033765	3300031911	Bacteria	3255
1272	Ga0307412_10106054	3300031911	Bacteria	1997
1273	Ga0315914_1002550	3300031967	Bacteria	27863
1274	Ga0307409_100042166	3300031995	Bacteria	3415
1275	Ga0307409_100217107	3300031995	Bacteria	1723
1276	Ga0307409_100221319	3300031995	Bacteria	1709
1277	Ga0307409_100232798	3300031995	Bacteria	1671
1278	Ga0307416_100004367	3300032002	Bacteria	8510
1279	Ga0307416_100009068	3300032002	Bacteria	6477
1280	Ga0307416_100026059	3300032002	Bacteria	4301
1281	Ga0307416_100075869	3300032002	Bacteria	2815
1282	Ga0307416_100164586	3300032002	Bacteria	2055
1283	Ga0307414_10014676	3300032004	Bacteria	4706
1284	Ga0307414_10075338	3300032004	Bacteria	2448
1285	Ga0307414_10124759	3300032004	Bacteria	1987
1286	Ga0307411_10000194	3300032005	Bacteria	19559
1287	Ga0307411_10009447	3300032005	Bacteria	5128
1288	Ga0307411_10070935	3300032005	Bacteria	2359
1289	Ga0307411_10089700	3300032005	Bacteria	2142
1290	Ga0307411_10115475	3300032005	Bacteria	1931
1291	Ga0307411_10163573	3300032005	Bacteria	1670
1292	Ga0307411_10254298	3300032005	Bacteria	1383
1293	Ga0307411_10355342	3300032005	Bacteria	1196
1294	Ga0307415_100002695	3300032126	Bacteria	8873
1295	Ga0315913_1001274	3300033430	Bacteria	27225
1296	Ga0315911_1000017	3300033442	Bacteria	161609
1297	Ga0315915_1000010	3300033464	Bacteria	240214
1298	Ga0373948_0003190	3300034817	Bacteria	2499
1299	Ga0373958_0000994	3300034819	Bacteria	3698
1300	Ga0373938_0001117	3300034957	Bacteria	4318
1301	Ga0373938_0017517	3300034957	Bacteria	1411
1302	Ga0373938_0022912	3300034957	Bacteria	1279
1303	Ga0373926_0047805	3300035083	Bacteria	1538
1304	Ga0373928_0006017	3300035084	Bacteria	2325
1305	Ga0373929_0000488	3300035085	Bacteria	7582
1306	Ga0373929_0000817	3300035085	Bacteria	6064
1307	Ga0373934_0001121	3300035086	Bacteria	9730
1308	Ga0373940_0002973	3300035088	Bacteria	3389
1309	Ga0373940_0004661	3300035088	Bacteria	2912
1310	Ga0373949_0003973	3300035090	Bacteria	3432
1311	Ga0373949_0007963	3300035090	Bacteria	2320
1312	Ga0373952_0000990	3300035092	Bacteria	5180
1313	Ga0373952_0002043	3300035092	Bacteria	3635
1314	Ga0373932_0001709	3300035112	Bacteria	5971
1315	Ga0373932_0045162	3300035112	Bacteria	1287
1316	Ga0373936_0007978	3300035113	Bacteria	3978
1317	Ga0373936_0040844	3300035113	Bacteria	1859
1318	Ga0373936_0042383	3300035113	Bacteria	1827
1319	Ga0373939_0000201	3300035114	Bacteria	16551
1320	Ga0373939_0003356	3300035114	Bacteria	3758
1321	Ga0373939_0019497	3300035114	Bacteria	1831
1322	Ga0373941_0000068	3300035115	Bacteria	16268
1323	Ga0373945_0000837	3300035116	Bacteria	9039
1324	Ga0373945_0008523	3300035116	Bacteria	3343
1325	Ga0373953_0002697	3300035117	Bacteria	5381
1326	Ga0373954_0002099	3300035118	Bacteria	8262
1327	Ga0373956_0000103	3300035119	Bacteria	29146
1328	Ga0373956_0102839	3300035119	Bacteria	1326
1329	Ga0373956_0122683	3300035119	Bacteria	1214
1330	Ga0373957_0004484	3300035120	Bacteria	4248
1331	Ga0373960_0002401	3300035121	Bacteria	4206
1332	Ga0373960_0003160	3300035121	Bacteria	3723
1333	Ga0373943_0009484	3300035170	Bacteria	4362
1334	Ga0373943_0010821	3300035170	Bacteria	4095
1335	Ga0373946_0001105	3300035171	Bacteria	9319
1336	Ga0373946_0024472	3300035171	Bacteria	2366
1337	Ga0373946_0083170	3300035171	Bacteria	1405
1338	Ga0373955_0000069	3300035172	Bacteria	41106
1339	Ga0373955_0043909	3300035172	Bacteria	2405
1340	Ga0373955_0087135	3300035172	Bacteria	1774
1341	Ga0373942_0005648	3300035207	Bacteria	2898
1342	Ga0373961_0002126	3300035241	Bacteria	5252
1343	Ga0373961_0025346	3300035241	Bacteria	1612
1344	Ga0373961_0036339	3300035241	Bacteria	1402
1345	Ga0373962_0003388	3300035242	Bacteria	3830
1346	Ga0373962_0003450	3300035242	Bacteria	3796
1347	Ga0373924_0002976	3300035410	Bacteria	5760
1348	Ga0373924_0013146	3300035410	Bacteria	3106
1349	Ga0373924_0080017	3300035410	Bacteria	1389
1350	Ga0373931_0000087	3300035691	Bacteria	42915
1351	Ga0373931_0000420	3300035691	Bacteria	17341
1352	Ga0373931_0005344	3300035691	Bacteria	5928
1353	Ga0373931_0006310	3300035691	Bacteria	5532
1354	Ga0373931_0023566	3300035691	Bacteria	3109
1355	Ga0373931_0024412	3300035691	Bacteria	3062
1356	Ga0373931_0028923	3300035691	Bacteria	2841
1357	Ga0373935_0000207	3300035692	Bacteria	28322
1358	Ga0373935_0004572	3300035692	Bacteria	8137
1359	Ga0373935_0013074	3300035692	Bacteria	5004
1360	Ga0373927_0007170	3300035695	Bacteria	7563
1361	Ga0373927_0010594	3300035695	Bacteria	6144
1362	Ga0373927_0012327	3300035695	Bacteria	5689
1363	Ga0373927_0042423	3300035695	Bacteria	2947
1364	Ga0373927_0138618	3300035695	Bacteria	1590
1365	Ga0373933_0000811	3300035724	Bacteria	19056
1366	Ga0373933_0004263	3300035724	Bacteria	7863
1367	Ga0373933_0024103	3300035724	Bacteria	3483
1368	Ga0373947_0001477	3300035725	Bacteria	14458
1369	Ga0373947_0001528	3300035725	Bacteria	14191
1370	Ga0373947_0037930	3300035725	Bacteria	2860
1371	Ga0373947_0044165	3300035725	Bacteria	2662
1372	Ga0373947_0110374	3300035725	Bacteria	1737
1373	Ga0373947_0162562	3300035725	Bacteria	1445
1374	Ga0373937_0000356	3300036401	Bacteria	42503
1375	Ga0373937_0000769	3300036401	Bacteria	27707
1376	Ga0373937_0000851	3300036401	Bacteria	26158
1377	Ga0373937_0007794	3300036401	Bacteria	9284
1378	Ga0373925_0000462	3300037068	Bacteria	40936
1379	Ga0373925_0003246	3300037068	Bacteria	12682
1380	Ga0373925_0037746	3300037068	Bacteria	3568
1381	Ga0373925_0048439	3300037068	Bacteria	3166
1382	Ga0373925_0056320	3300037068	Bacteria	2945
1383	Ga0373925_0078103	3300037068	Bacteria	2513
1384	Ga0373925_0157582	3300037068	Bacteria	1786
1385	Ga0395899_0007150	3300037312	Bacteria	8637
1386	Ga0395899_0035604	3300037312	Bacteria	3736
1387	Ga0395899_0117247	3300037312	Bacteria	1910
1388	Ga0395900_0037306	3300037418	Bacteria	5012
1389	Ga0395900_0045463	3300037418	Bacteria	4522
1390	Ga0395900_0049257	3300037418	Bacteria	4340
1391	Ga0395900_0069461	3300037418	Bacteria	3621
1392	Ga0395900_0113092	3300037418	Bacteria	2787
1393	Ga0395898_0018064	3300037466	Bacteria	7194
1394	Ga0395898_0455991	3300037466	Bacteria	1217
1395	Ga0395905_0001722	3300037471	Bacteria	25630
1396	Ga0395905_0011762	3300037471	Bacteria	8448
1397	Ga0395905_0014931	3300037471	Bacteria	7408
1398	Ga0395905_0042449	3300037471	Bacteria	4268
1399	Ga0395905_0082330	3300037471	Bacteria	3016
1400	Ga0395905_0144236	3300037471	Bacteria	2240
1401	Ga0395905_0168201	3300037471	Bacteria	2060
1402	Ga0395905_0260658	3300037471	Bacteria	1618
1403	Ga0395901_0001587	3300038443	Bacteria	23512
1404	Ga0395901_0062732	3300038443	Bacteria	3867
1405	Ga0395901_0203120	3300038443	Bacteria	2077
1406	Ga0436365_0343162	3300039437	Bacteria	2359
1407	Ga0436365_0456736	3300039437	Bacteria	4873
1408	Ga0436360_0589228	3300039438	Bacteria	1824
1409	Ga0436361_0322567	3300039447	Bacteria	10111
1410	Ga0439436_0005041	3300041404	Bacteria	4045
1411	Ga0439436_0008663	3300041404	Bacteria	3126
1412	Ga0439439_0018172	3300041406	Bacteria	1735
1413	Ga0439447_029184	3300041407	Bacteria	1398
1414	Ga0439465_0033292	3300041413	Bacteria	1648
1415	Ga0451798_0799171	3300041458	Bacteria	3231
1416	Ga0451807_1188546	3300041486	Bacteria	1330
1417	Ga0439433_0000342	3300041999	Bacteria	8228
1418	Ga0439445_0003125	3300042004	Bacteria	3713
1419	Ga0439448_0041661	3300042005	Bacteria	1487
1420	Ga0439432_002015	3300042006	Bacteria	7691
1421	Ga0439432_010840	3300042006	Bacteria	3149
1422	Ga0439449_0001924	3300042007	Bacteria	8152
1423	Ga0439449_0003191	3300042007	Bacteria	6388
1424	Ga0439449_0011882	3300042007	Bacteria	3273
1425	Ga0439449_0015373	3300042007	Bacteria	2875
1426	Ga0439449_0084175	3300042007	Bacteria	1173
1427	Ga0439462_0015973	3300042015	Bacteria	1937
1428	Ga0450920_004067	3300042122	Bacteria	2559
1429	Ga0450888_000048	3300042126	Bacteria	8559
1430	Ga0439446_0009626	3300042156	Bacteria	2590
1431	Ga0439446_0043399	3300042156	Bacteria	1329
1432	Ga0450908_012384	3300042184	Bacteria	1547
1433	Ga0439434_0008623	3300042435	Bacteria	2993
1434	Ga0439460_0000593	3300042461	Bacteria	7961
1435	Ga0439460_0001834	3300042461	Bacteria	5061
1436	Ga0450918_000497	3300042531	Bacteria	8443
1437	Ga0450918_000967	3300042531	Bacteria	5989
1438	Ga0450893_0008367	3300042532	Bacteria	1682
1439	Ga0451577_0008635	3300042876	Bacteria	9896
1440	Ga0451577_0097156	3300042876	Bacteria	2630
1441	Ga0451577_0097400	3300042876	Bacteria	2627
1442	Ga0453683_0020949	3300044673	Bacteria	4175
1443	Ga0453683_0032126	3300044673	Bacteria	3314
1444	Ga0453683_0228832	3300044673	Bacteria	1183
1445	Ga0466966_0005805	3300044684	Bacteria	8139
1446	Ga0466961_0104447	3300044693	Bacteria	1784
1447	Ga0453684_0000149	3300044712	Bacteria	307732
1448	Ga0453684_0031305	3300044712	Bacteria	7482
1449	Ga0453684_0037551	3300044712	Bacteria	6647
1450	Ga0453684_0040132	3300044712	Bacteria	6365
1451	Ga0453684_0042288	3300044712	Bacteria	6145
1452	Ga0453684_0088742	3300044712	Bacteria	3827
1453	Ga0466957_0048780	3300044842	Bacteria	2573
1454	Ga0466957_0114954	3300044842	Bacteria	1710
1455	Ga0466960_0051464	3300044901	Bacteria	1990
1456	Ga0451576_0005540	3300045051	Bacteria	15773
1457	Ga0451576_0035603	3300045051	Bacteria	5280
1458	Ga0451576_0037268	3300045051	Bacteria	5151
1459	Ga0451576_0046429	3300045051	Bacteria	4572
1460	Ga0451576_0077193	3300045051	Bacteria	3466
1461	Ga0451576_0078061	3300045051	Bacteria	3446
1462	Ga0451576_0083293	3300045051	Bacteria	3327
1463	Ga0451576_0092888	3300045051	Bacteria	3138
1464	Ga0451576_0093696	3300045051	Bacteria	3123
1465	Ga0451576_0276002	3300045051	Bacteria	1757
1466	Ga0451576_0292265	3300045051	Bacteria	1704
1467	Ga0451576_0368824	3300045051	Bacteria	1504
1468	Ga0466967_0117511	3300045976	Bacteria	2452
1469	Ga0495592_0000090	3300046454	Bacteria	80171
1470	Ga0495592_0008229	3300046454	Bacteria	7828
1471	Ga0495592_0012103	3300046454	Bacteria	6545
1472	Ga0495592_0029878	3300046454	Bacteria	4123
1473	Ga0495603_0005690	3300046455	Bacteria	7449
1474	Ga0495603_0043842	3300046455	Bacteria	2670
1475	Ga0495603_0179670	3300046455	Bacteria	1224
1476	Ga0495629_0000647	3300046459	Bacteria	28130
1477	Ga0495629_0023957	3300046459	Bacteria	4347
1478	Ga0495638_0004071	3300046460	Bacteria	11206
1479	Ga0495638_0106996	3300046460	Bacteria	1666
1480	Ga0495638_0186449	3300046460	Bacteria	1180
1481	Ga0495641_0089527	3300046461	Bacteria	1375
1482	Ga0495651_0000396	3300046462	Bacteria	33745
1483	Ga0495651_0006045	3300046462	Bacteria	9240
1484	Ga0495651_0006702	3300046462	Bacteria	8803
1485	Ga0495651_0021038	3300046462	Bacteria	5065
1486	Ga0495651_0161586	3300046462	Bacteria	1604
1487	Ga0495653_0000322	3300046463	Bacteria	38965
1488	Ga0495653_0001963	3300046463	Bacteria	16192
1489	Ga0495653_0014063	3300046463	Bacteria	6526
1490	Ga0495650_0028994	3300046471	Bacteria	2529
1491	Ga0495580_0010265	3300046472	Bacteria	7304
1492	Ga0495582_0004928	3300046473	Bacteria	7482
1493	Ga0495582_0016535	3300046473	Bacteria	4041
1494	Ga0495582_0028848	3300046473	Bacteria	3046
1495	Ga0495605_0000921	3300046474	Bacteria	20179
1496	Ga0495605_0005211	3300046474	Bacteria	7579
1497	Ga0495639_0005801	3300046475	Bacteria	5313
1498	Ga0495639_0097763	3300046475	Bacteria	1383
1499	Ga0495662_0030466	3300046476	Bacteria	2604
1500	Ga0495664_0000078	3300046477	Bacteria	47377
1501	Ga0495664_0001341	3300046477	Bacteria	12964
1502	Ga0495664_0089296	3300046477	Bacteria	1852
1503	Ga0495584_0023604	3300046491	Bacteria	3118
1504	Ga0495584_0095846	3300046491	Bacteria	1498
1505	Ga0495585_0006064	3300046492	Bacteria	7561
1506	Ga0495585_0069677	3300046492	Bacteria	1919
1507	Ga0495594_0189215	3300046499	Bacteria	1172
1508	Ga0495596_0004018	3300046500	Bacteria	7252
1509	Ga0495606_0006516	3300046507	Bacteria	10744
1510	Ga0495608_0000022	3300046511	Bacteria	165111
1511	Ga0495608_0002747	3300046511	Bacteria	12637
1512	Ga0495608_0005187	3300046511	Bacteria	9309
1513	Ga0495608_0009334	3300046511	Bacteria	6860
1514	Ga0495610_0018212	3300046512	Bacteria	3975
1515	Ga0495616_0012162	3300046513	Bacteria	4898
1516	Ga0495618_0000229	3300046514	Bacteria	40948
1517	Ga0495618_0003608	3300046514	Bacteria	9590
1518	Ga0495618_0011226	3300046514	Bacteria	5427
1519	Ga0495618_0094597	3300046514	Bacteria	1910
1520	Ga0495620_0015107	3300046515	Bacteria	3905
1521	Ga0495628_0000035	3300046516	Bacteria	111560
1522	Ga0495628_0001730	3300046516	Bacteria	19868
1523	Ga0495628_0009232	3300046516	Bacteria	8428
1524	Ga0495628_0011197	3300046516	Bacteria	7590
1525	Ga0495630_0000377	3300046517	Bacteria	35153
1526	Ga0495630_0009987	3300046517	Bacteria	6833
1527	Ga0495630_0093935	3300046517	Bacteria	2267
1528	Ga0495631_0001426	3300046518	Bacteria	14521
1529	Ga0495631_0073903	3300046518	Bacteria	1472
1530	Ga0495632_0032363	3300046519	Bacteria	2695
1531	Ga0495632_0070464	3300046519	Bacteria	1681
1532	Ga0495637_0009670	3300046520	Bacteria	4695
1533	Ga0495644_0019727	3300046523	Bacteria	2574
1534	Ga0495648_0032397	3300046524	Bacteria	3430
1535	Ga0495652_0000062	3300046529	Bacteria	111572
1536	Ga0495652_0000531	3300046529	Bacteria	44460
1537	Ga0495652_0042822	3300046529	Bacteria	3903
1538	Ga0495652_0065079	3300046529	Bacteria	3064
1539	Ga0495652_0279099	3300046529	Bacteria	1224
1540	Ga0495640_0000021	3300046533	Bacteria	110511
1541	Ga0495640_0011454	3300046533	Bacteria	6825
1542	Ga0495640_0017619	3300046533	Bacteria	5317
1543	Ga0495640_0135834	3300046533	Bacteria	1588
1544	Ga0495640_0169236	3300046533	Bacteria	1396
1545	Ga0495586_0018062	3300046535	Bacteria	3751
1546	Ga0495586_0044089	3300046535	Bacteria	2402
1547	Ga0495587_0000006	3300046536	Bacteria	310070
1548	Ga0495587_0002101	3300046536	Bacteria	13299
1549	Ga0495587_0018740	3300046536	Bacteria	4292
1550	Ga0495587_0026126	3300046536	Bacteria	3562
1551	Ga0495621_0016257	3300046539	Bacteria	2386
1552	Ga0495645_0000174	3300046543	Bacteria	44827
1553	Ga0495645_0116993	3300046543	Bacteria	1881
1554	Ga0495622_0015375	3300046557	Bacteria	3557
1555	Ga0495633_0022949	3300046558	Bacteria	3095
1556	Ga0495667_0000161	3300046559	Bacteria	45781
1557	Ga0495667_0006127	3300046559	Bacteria	8140
1558	Ga0495667_0032280	3300046559	Bacteria	3511
1559	Ga0495656_0000081	3300046615	Bacteria	42254
1560	Ga0495634_0000350	3300046642	Bacteria	44772
1561	Ga0495634_0044931	3300046642	Bacteria	2988
1562	Ga0495634_0139002	3300046642	Bacteria	1543
1563	Ga0495625_0000360	3300046660	Bacteria	69587
1564	Ga0495625_0013968	3300046660	Bacteria	6431
1565	Ga0495625_0018806	3300046660	Bacteria	5381
1566	Ga0495625_0067601	3300046660	Bacteria	2514
1567	Ga0495625_0168987	3300046660	Bacteria	1461
1568	Ga0495635_0000018	3300046663	Bacteria	193591
1569	Ga0495635_0005870	3300046663	Bacteria	8558
1570	Ga0495635_0077848	3300046663	Bacteria	2271
1571	Ga0495635_0077944	3300046663	Bacteria	2269
1572	Ga0495635_0147384	3300046663	Bacteria	1602
1573	Ga0495635_0160052	3300046663	Bacteria	1532
1574	Ga0495659_0104376	3300046664	Bacteria	1101
1575	Ga0495661_0010743	3300046665	Bacteria	6234
1576	Ga0495588_0043534	3300046674	Bacteria	2298
1577	Ga0495588_0096889	3300046674	Bacteria	1548
1578	Ga0495657_0000245	3300046675	Bacteria	49381
1579	Ga0495657_0002136	3300046675	Bacteria	16794
1580	Ga0495657_0158529	3300046675	Bacteria	1401
1581	Ga0495599_0000032	3300046678	Bacteria	108178
1582	Ga0495623_0000187	3300046679	Bacteria	39206
1583	Ga0495623_0023797	3300046679	Bacteria	3951
1584	Ga0495623_0042023	3300046679	Bacteria	2914
1585	Ga0495646_0000083	3300046680	Bacteria	45193
1586	Ga0495646_0005710	3300046680	Bacteria	7882
1587	Ga0495646_0006023	3300046680	Bacteria	7688
1588	Ga0495647_0001554	3300046681	Bacteria	7081
1589	Ga0495647_0128540	3300046681	Bacteria	1071
1590	Ga0495658_0000662	3300046683	Bacteria	18692
1591	Ga0495613_0001496	3300046689	Bacteria	17776
1592	Ga0495624_0002043	3300046690	Bacteria	15365
1593	Ga0495624_0016187	3300046690	Bacteria	5022
1594	Ga0495624_0064050	3300046690	Bacteria	2298
1595	Ga0495670_0003330	3300046691	Bacteria	7912
1596	Ga0495670_0065368	3300046691	Bacteria	1833
1597	Ga0495671_0028319	3300046692	Bacteria	2888
1598	Ga0495649_0001025	3300046694	Bacteria	21918
1599	Ga0495649_0020198	3300046694	Bacteria	3737
1600	Ga0495589_0000657	3300046794	Bacteria	22640
1601	Ga0495600_0000022	3300046809	Bacteria	94789
1602	Ga0495600_0002951	3300046809	Bacteria	9916
1603	Ga0495600_0039898	3300046809	Bacteria	3057
1604	Ga0495600_0042697	3300046809	Bacteria	2956
1605	Ga0495600_0089550	3300046809	Bacteria	2007
1606	Ga0495660_0026400	3300046810	Bacteria	3293
1607	Ga0495660_0062563	3300046810	Bacteria	1995
1608	Ga0495581_0000379	3300047315	Bacteria	22263
1609	Ga0495581_0024187	3300047315	Bacteria	3520
1610	Ga0495581_0172724	3300047315	Bacteria	1264
1611	Ga0495604_0000011	3300047317	Bacteria	292024
1612	Ga0495604_0004162	3300047317	Bacteria	11475
1613	Ga0495604_0006220	3300047317	Bacteria	9474
1614	Ga0495604_0111341	3300047317	Bacteria	1996
1615	Ga0495636_0126423	3300047318	Bacteria	1134
1616	Ga0495674_0000034	3300047319	Bacteria	110674
1617	Ga0495674_0027370	3300047319	Bacteria	5210
1618	Ga0495674_0093695	3300047319	Bacteria	2562
1619	Ga0495674_0187346	3300047319	Bacteria	1721
1620	Ga0495674_0221290	3300047319	Bacteria	1565
1621	Ga0495676_0067535	3300047321	Bacteria	2766
1622	Ga0495676_0124879	3300047321	Bacteria	1866
1623	Ga0495676_0148382	3300047321	Bacteria	1672
1624	Ga0495676_0201801	3300047321	Bacteria	1381
1625	Ga0495680_0000290	3300047322	Bacteria	56506
1626	Ga0495680_0017671	3300047322	Bacteria	6077
1627	Ga0495680_0018237	3300047322	Bacteria	5966
1628	Ga0495680_0029343	3300047322	Bacteria	4504
1629	Ga0495680_0168113	3300047322	Bacteria	1588
1630	Ga0495687_000606	3300047443	Bacteria	41890
1631	Ga0495675_0001346	3300047444	Bacteria	14899
1632	Ga0495675_0003486	3300047444	Bacteria	9475
1633	Ga0495673_0060413	3300047469	Bacteria	1626
1634	Ga0495684_0000012	3300047471	Bacteria	187118
1635	Ga0495684_0004611	3300047471	Bacteria	10763
1636	Ga0495684_0083924	3300047471	Bacteria	2416
1637	Ga0495684_0196863	3300047471	Bacteria	1487
1638	Ga0495686_0048570	3300047472	Bacteria	2675
1639	Ga0495593_0002038	3300047673	Bacteria	12051
1640	Ga0495602_0000064	3300048088	Bacteria	104858
1641	Ga0495602_0001681	3300048088	Bacteria	22032
1642	Ga0495602_0032952	3300048088	Bacteria	4869
1643	Ga0496100_0000163	3300048903	Bacteria	36774
1644	Ga0496100_0013150	3300048903	Bacteria	4765
1645	Ga0496100_0013742	3300048903	Bacteria	4682
1646	Ga0496100_0038933	3300048903	Bacteria	3016
1647	Ga0496100_0053558	3300048903	Bacteria	2628
1648	Ga0496100_0095112	3300048903	Bacteria	2041
1649	Ga0496101_0000061	3300048904	Bacteria	127480
1650	Ga0496101_0007751	3300048904	Bacteria	6975
1651	Ga0496101_0020557	3300048904	Bacteria	4521
1652	Ga0496101_0022407	3300048904	Bacteria	4348
1653	Ga0496101_0033804	3300048904	Bacteria	3609
1654	Ga0496101_0040699	3300048904	Bacteria	3310
1655	Ga0496101_0056101	3300048904	Bacteria	2848
1656	Ga0496101_0082947	3300048904	Bacteria	2372
1657	Ga0496101_0260756	3300048904	Bacteria	1352
1658	Ga0496102_0001355	3300048905	Bacteria	21922
1659	Ga0496102_0002271	3300048905	Bacteria	16435
1660	Ga0496102_0006207	3300048905	Bacteria	10182
1661	Ga0496102_0063917	3300048905	Bacteria	3370
1662	Ga0496102_0082507	3300048905	Bacteria	2965
1663	Ga0496102_0116050	3300048905	Bacteria	2498
1664	Ga0496102_0250604	3300048905	Bacteria	1669
1665	Ga0496102_0286405	3300048905	Bacteria	1553
1666	Ga0496102_0388257	3300048905	Bacteria	1313
1667	Ga0496103_0009043	3300048906	Bacteria	5900
1668	Ga0496103_0017655	3300048906	Bacteria	4271
1669	Ga0496103_0049621	3300048906	Bacteria	2595
1670	Ga0496104_0000175	3300048907	Bacteria	56916
1671	Ga0496104_0000273	3300048907	Bacteria	45919
1672	Ga0496104_0012436	3300048907	Bacteria	7653
1673	Ga0496104_0015322	3300048907	Bacteria	6942
1674	Ga0496104_0037698	3300048907	Bacteria	4520
1675	Ga0496104_0044519	3300048907	Bacteria	4170
1676	Ga0496104_0399323	3300048907	Bacteria	1287
1677	Ga0496104_0405892	3300048907	Bacteria	1275
1678	Ga0496105_0001208	3300048908	Bacteria	17996
1679	Ga0496105_0003826	3300048908	Bacteria	11229
1680	Ga0496105_0009918	3300048908	Bacteria	7470
1681	Ga0496106_0000011	3300048909	Bacteria	222845
1682	Ga0496106_0001754	3300048909	Bacteria	16195
1683	Ga0496106_0003095	3300048909	Bacteria	12414
1684	Ga0496106_0005133	3300048909	Bacteria	9702
1685	Ga0496106_0013062	3300048909	Bacteria	6129
1686	Ga0496106_0361974	3300048909	Bacteria	1165
1687	Ga0496107_0002571	3300048910	Bacteria	11841
1688	Ga0496107_0014163	3300048910	Bacteria	5583
1689	Ga0496107_0039546	3300048910	Bacteria	3383
1690	Ga0496107_0082869	3300048910	Bacteria	2338
1691	Ga0496107_0119623	3300048910	Bacteria	1940
1692	Ga0496108_0001839	3300048911	Bacteria	16957
1693	Ga0496108_0003952	3300048911	Bacteria	11907
1694	Ga0496108_0012086	3300048911	Bacteria	7021
1695	Ga0496108_0012969	3300048911	Bacteria	6791
1696	Ga0496108_0036879	3300048911	Bacteria	4069
1697	Ga0496108_0141336	3300048911	Bacteria	2074
1698	Ga0496109_0002227	3300048912	Bacteria	16096
1699	Ga0496109_0004749	3300048912	Bacteria	11355
1700	Ga0496109_0007062	3300048912	Bacteria	9475
1701	Ga0496109_0023874	3300048912	Bacteria	5429
1702	Ga0496109_0052272	3300048912	Bacteria	3723
1703	Ga0496109_0071170	3300048912	Bacteria	3192
1704	Ga0496109_0088757	3300048912	Bacteria	2858
1705	Ga0496110_0002188	3300048913	Bacteria	14604
1706	Ga0496110_0007879	3300048913	Bacteria	8532
1707	Ga0496110_0014213	3300048913	Bacteria	6605
1708	Ga0496110_0015136	3300048913	Bacteria	6413
1709	Ga0496110_0019160	3300048913	Bacteria	5753
1710	Ga0496110_0045747	3300048913	Bacteria	3827
1711	Ga0496110_0071473	3300048913	Bacteria	3077
1712	Ga0496110_0096482	3300048913	Bacteria	2649
1713	Ga0496111_0007525	3300048914	Bacteria	7146
1714	Ga0496111_0062432	3300048914	Bacteria	2702
1715	Ga0496112_0003174	3300048915	Bacteria	13504
1716	Ga0496112_0012256	3300048915	Bacteria	7873
1717	Ga0496112_0015999	3300048915	Bacteria	7013
1718	Ga0496112_0019169	3300048915	Bacteria	6451
1719	Ga0496112_0021208	3300048915	Bacteria	6174
1720	Ga0496112_0022900	3300048915	Bacteria	5959
1721	Ga0496112_0031932	3300048915	Bacteria	5110
1722	Ga0496112_0109376	3300048915	Bacteria	2734
1723	Ga0496112_0265490	3300048915	Bacteria	1665
1724	Ga0496112_0280471	3300048915	Bacteria	1613
1725	Ga0496112_0315803	3300048915	Bacteria	1507
1726	Ga0496112_0544047	3300048915	Bacteria	1095
1727	Ga0496113_0000771	3300048916	Bacteria	16510
1728	Ga0496113_0003775	3300048916	Bacteria	9147
1729	Ga0496113_0010705	3300048916	Bacteria	6076
1730	Ga0496113_0014566	3300048916	Bacteria	5369
1731	Ga0496113_0021610	3300048916	Bacteria	4541
1732	Ga0496113_0140900	3300048916	Bacteria	1897
1733	Ga0496113_0222538	3300048916	Bacteria	1504
1734	Ga0496113_0293876	3300048916	Bacteria	1300
1735	Ga0496114_0005677	3300048917	Bacteria	9787
1736	Ga0496114_0033852	3300048917	Bacteria	4212
1737	Ga0496114_0036515	3300048917	Bacteria	4062
1738	Ga0496114_0055790	3300048917	Bacteria	3295
1739	Ga0496114_0062303	3300048917	Bacteria	3121
1740	Ga0496114_0186990	3300048917	Bacteria	1810
1741	Ga0496114_0302427	3300048917	Bacteria	1412
1742	Ga0496115_0011186	3300048918	Bacteria	6721
1743	Ga0496115_0061762	3300048918	Bacteria	3021
1744	Ga0496115_0101247	3300048918	Bacteria	2362
1745	Ga0496115_0198911	3300048918	Bacteria	1655
1746	Ga0496116_0060313	3300048919	Bacteria	2461
1747	Ga0496117_0031161	3300048920	Bacteria	4076
1748	Ga0496118_0011641	3300048921	Bacteria	8556
1749	Ga0496121_0008623	3300048924	Bacteria	11934
1750	Ga0496121_0014332	3300048924	Bacteria	8424
1751	Ga0496121_0027952	3300048924	Bacteria	5266
1752	Ga0496121_0035137	3300048924	Bacteria	4496
1753	Ga0496121_0061603	3300048924	Bacteria	3077
1754	Ga0496122_0000272	3300048925	Bacteria	115666
1755	Ga0496122_0032501	3300048925	Bacteria	4313
1756	Ga0496123_0000221	3300048926	Bacteria	115688
1757	Ga0496123_0030069	3300048926	Bacteria	3983
1758	Ga0496125_0002271	3300048928	Bacteria	25493
1759	Ga0496126_0032152	3300048929	Bacteria	4947
1760	Ga0496126_0092913	3300048929	Bacteria	2650
1761	Ga0496126_0150213	3300048929	Bacteria	1997
1762	Ga0501292_002976	3300049515	Bacteria	2228
1763	Ga0501298_007043	3300049521	Bacteria	1857
1764	Ga0501300_001664	3300049523	Bacteria	3331
1765	Ga0501032_0004572	3300049569	Bacteria	10410
1766	Ga0501032_0236194	3300049569	Bacteria	1188
1767	Ga0501033_0006569	3300049570	Bacteria	9096
1768	Ga0501034_0017969	3300049571	Bacteria	7254
1769	Ga0501034_0026548	3300049571	Bacteria	5897
1770	Ga0501036_0029222	3300049572	Bacteria	4659
1771	Ga0501037_0003090	3300049573	Bacteria	12063
1772	Ga0501037_0078133	3300049573	Bacteria	2401
1773	Ga0501038_0016392	3300049574	Bacteria	6715
1774	Ga0501038_0030962	3300049574	Bacteria	4730
1775	Ga0501039_0047814	3300049575	Bacteria	3307
1776	Ga0501039_0081146	3300049575	Bacteria	2525
1777	Ga0501039_0091199	3300049575	Bacteria	2375
1778	Ga0501040_0022955	3300049576	Bacteria	4180
1779	Ga0501041_0079360	3300049577	Bacteria	2020
1780	Ga0501042_0069221	3300049578	Bacteria	2524
1781	Ga0501042_0174893	3300049578	Bacteria	1549
1782	Ga0501043_0007577	3300049579	Bacteria	8603
1783	Ga0501043_0123840	3300049579	Bacteria	2027
1784	Ga0501046_0000444	3300049580	Bacteria	41627
1785	Ga0501046_0005718	3300049580	Bacteria	11095
1786	Ga0501047_0054266	3300049581	Bacteria	3876
1787	Ga0501047_0077249	3300049581	Bacteria	3204
1788	Ga0501048_0007480	3300049582	Bacteria	8277
1789	Ga0501048_0008016	3300049582	Bacteria	7996
1790	Ga0501048_0140503	3300049582	Bacteria	1708
1791	Ga0501048_0150890	3300049582	Bacteria	1644
1792	Ga0501067_0007083	3300049583	Bacteria	6229
1793	Ga0501068_0068276	3300049584	Bacteria	2166
1794	Ga0501069_0003111	3300049585	Bacteria	8504
1795	Ga0501069_0080199	3300049585	Bacteria	1838
1796	Ga0501069_0113257	3300049585	Bacteria	1546
1797	Ga0501069_0180817	3300049585	Bacteria	1219
1798	Ga0501070_0015490	3300049586	Bacteria	6413
1799	Ga0501070_0254980	3300049586	Bacteria	1434
1800	Ga0501071_0053577	3300049587	Bacteria	2910
1801	Ga0501072_0003591	3300049588	Bacteria	11676
1802	Ga0501072_0020474	3300049588	Bacteria	5127
1803	Ga0501072_0039043	3300049588	Bacteria	3728
1804	Ga0501072_0043413	3300049588	Bacteria	3533
1805	Ga0501073_0016783	3300049589	Bacteria	5305
1806	Ga0501073_0068939	3300049589	Bacteria	2465
1807	Ga0501074_0011091	3300049590	Bacteria	6545
1808	Ga0501074_0082740	3300049590	Bacteria	2302
1809	Ga0501075_0019209	3300049591	Bacteria	4956
1810	Ga0501075_0028995	3300049591	Bacteria	4091
1811	Ga0501075_0187785	3300049591	Bacteria	1576
1812	Ga0501076_0000640	3300049592	Bacteria	22367
1813	Ga0501076_0010629	3300049592	Bacteria	6837
1814	Ga0501076_0080795	3300049592	Unclassified	2610
1815	Ga0501076_0322642	3300049592	Bacteria	1267
1816	Ga0501077_0037476	3300049593	Bacteria	3088
1817	Ga0501077_0115469	3300049593	Bacteria	1702
1818	Ga0501198_000009	3300049649	Bacteria	122302
1819	Ga0501211_000033	3300049658	Bacteria	9638
1820	Ga0501222_000001	3300049662	Bacteria	307689
1821	Ga0501249_007146	3300049679	Bacteria	2303
1822	Ga0501079_0000465	3300049741	Bacteria	26671
1823	Ga0501079_0065191	3300049741	Bacteria	2810
1824	Ga0501079_0103157	3300049741	Bacteria	2212
1825	Ga0501080_0036125	3300049742	Bacteria	4612
1826	Ga0501080_0069002	3300049742	Bacteria	3288
1827	Ga0501080_0084547	3300049742	Bacteria	2948
1828	Ga0501081_0048753	3300049743	Bacteria	2915
1829	Ga0501081_0109962	3300049743	Bacteria	1955
1830	Ga0501083_0013082	3300049744	Bacteria	5797
1831	Ga0501083_0093578	3300049744	Bacteria	1984
1832	Ga0501083_0106548	3300049744	Bacteria	1845
1833	Ga0501083_0277787	3300049744	Bacteria	1090
1834	Ga0501263_002099	3300049760	Bacteria	1991
1835	Ga0501035_0004152	3300049822	Bacteria	13769
1836	Ga0501035_0056783	3300049822	Bacteria	3491
1837	Ga0501035_0152098	3300049822	Bacteria	2008
1838	Ga0501044_0000255	3300049823	Bacteria	67530
1839	Ga0501044_0011542	3300049823	Bacteria	9573
1840	Ga0501044_0062587	3300049823	Bacteria	3803
1841	Ga0501045_0001483	3300049824	Bacteria	15602
1842	Ga0501045_0010568	3300049824	Bacteria	6466
1843	Ga0501045_0033645	3300049824	Bacteria	3717
1844	Ga0501045_0057999	3300049824	Bacteria	2834
1845	nmdc:mga03683_10789_c1	3300050489	Bacteria	3284
1846	nmdc:mga03683_25935_c1	3300050489	Bacteria	2307
1847	nmdc:mga03683_28736_c1	3300050489	Bacteria	2213
1848	nmdc:mga03683_4627_c1	3300050489	Bacteria	4579
1849	nmdc:mga03683_8562_c1	3300050489	Bacteria	3601
1850	nmdc:mga03n38_13550_c1	3300050490	Bacteria	3101
1851	nmdc:mga03n38_14599_c1	3300050490	Bacteria	3015
1852	nmdc:mga03n38_20365_c1	3300050490	Bacteria	2653
1853	nmdc:mga03n38_6805_c1	3300050490	Bacteria	4005
1854	nmdc:mga00v17_15205_c1	3300050491	Bacteria	4315
1855	nmdc:mga00v17_243813_c1	3300050491	Bacteria	1165
1856	nmdc:mga00v17_32970_c1	3300050491	Bacteria	3065
1857	nmdc:mga00v17_51800_c1	3300050491	Bacteria	2496
1858	nmdc:mga00v17_57554_c1	3300050491	Bacteria	2379
1859	nmdc:mga0yw44_1051_c1	3300050492	Bacteria	10615
1860	nmdc:mga0yw44_1412_c1	3300050492	Bacteria	9523
1861	nmdc:mga0yw44_157252_c1	3300050492	Bacteria	1486
1862	nmdc:mga0yw44_18076_c1	3300050492	Bacteria	3854
1863	nmdc:mga0yw44_26584_c1	3300050492	Bacteria	3307
1864	nmdc:mga0yw44_5088_c1	3300050492	Bacteria	6148
1865	nmdc:mga0yw44_5236_c1	3300050492	Bacteria	6082
1866	nmdc:mga0k408_11822_c1	3300050493	Bacteria	4763
1867	nmdc:mga0k408_122533_c1	3300050493	Bacteria	1541
1868	nmdc:mga0k408_13899_c1	3300050493	Bacteria	4424
1869	nmdc:mga0k408_1947_c1	3300050493	Bacteria	11066
1870	nmdc:mga0k408_1980_c1	3300050493	Bacteria	10986
1871	nmdc:mga0k408_30243_c1	3300050493	Bacteria	3087
1872	nmdc:mga0k408_31602_c1	3300050493	Bacteria	3024
1873	nmdc:mga0k408_33337_c1	3300050493	Bacteria	2946
1874	nmdc:mga0k408_3583_c1	3300050493	Bacteria	8212
1875	nmdc:mga0k408_43361_c1	3300050493	Bacteria	2250
1876	nmdc:mga0k408_44410_c1	3300050493	Bacteria	2563
1877	nmdc:mga0k408_4910_c1	3300050493	Bacteria	7088
1878	nmdc:mga0k408_69687_c1	3300050493	Bacteria	2053
1879	nmdc:mga0k408_7242_c1	3300050493	Bacteria	5929
1880	nmdc:mga0k408_73206_c1	3300050493	Bacteria	2001
1881	nmdc:mga06z11_16684_c1	3300050494	Bacteria	3314
1882	nmdc:mga06z11_23962_c1	3300050494	Bacteria	2874
1883	nmdc:mga06z11_37292_c1	3300050494	Bacteria	2407
1884	nmdc:mga06z11_4933_c1	3300050494	Bacteria	5296
1885	nmdc:mga06z11_6926_c1	3300050494	Bacteria	4642
1886	nmdc:mga06z11_6994_c1	3300050494	Bacteria	4626
1887	nmdc:mga06z11_9113_c1	3300050494	Bacteria	4168
1888	nmdc:mga04h51_1465_c1	3300050495	Bacteria	5465
1889	nmdc:mga04h51_14979_c1	3300050495	Bacteria	2227
1890	nmdc:mga04h51_26464_c1	3300050495	Bacteria	1794
1891	nmdc:mga04h51_3661_c1	3300050495	Bacteria	3759
1892	nmdc:mga07m45_11907_c1	3300050496	Bacteria	4583
1893	nmdc:mga07m45_119679_c1	3300050496	Bacteria	1521
1894	nmdc:mga07m45_12303_c1	3300050496	Bacteria	4520
1895	nmdc:mga07m45_12891_c1	3300050496	Bacteria	4423
1896	nmdc:mga07m45_13948_c1	3300050496	Bacteria	3295
1897	nmdc:mga07m45_16968_c1	3300050496	Bacteria	3904
1898	nmdc:mga07m45_17750_c1	3300050496	Bacteria	3829
1899	nmdc:mga07m45_30392_c1	3300050496	Bacteria	2992
1900	nmdc:mga07m45_33000_c1	3300050496	Bacteria	2874
1901	nmdc:mga07m45_351_c1	3300050496	Bacteria	18810
1902	nmdc:mga07m45_36205_c1	3300050496	Bacteria	2321
1903	nmdc:mga07m45_41876_c1	3300050496	Bacteria	2566
1904	nmdc:mga07m45_4454_c2	3300050496	Bacteria	4259
1905	nmdc:mga07m45_65461_c1	3300050496	Bacteria	2064
1906	nmdc:mga07m45_995_c1	3300050496	Bacteria	12514
1907	nmdc:mga05p37_113004_c1	3300050507	Bacteria	3340
1908	nmdc:mga05p37_12404_c1	3300050507	Bacteria	10177
1909	nmdc:mga05p37_1381_c1	3300050507	Bacteria	28239
1910	nmdc:mga05p37_15097_c1	3300050507	Bacteria	9273
1911	nmdc:mga05p37_172_c1	3300050507	Bacteria	63162
1912	nmdc:mga05p37_194512_c1	3300050507	Bacteria	2460
1913	nmdc:mga05p37_2156_c1	3300050507	Bacteria	20944
1914	nmdc:mga05p37_33797_c1	3300050507	Bacteria	6263
1915	nmdc:mga05p37_38769_c1	3300050507	Bacteria	5847
1916	nmdc:mga05p37_38783_c1	3300050507	Bacteria	5845
1917	nmdc:mga05p37_46598_c1	3300050507	Bacteria	5330
1918	nmdc:mga05p37_4947_c1	3300050507	Bacteria	15612
1919	nmdc:mga05p37_67583_c1	3300050507	Bacteria	4397
1920	nmdc:mga09592_12845_c1	3300050508	Bacteria	6829
1921	nmdc:mga09592_15239_c1	3300050508	Bacteria	6281
1922	nmdc:mga09592_191_c1	3300050508	Bacteria	41426
1923	nmdc:mga09592_52391_c1	3300050508	Bacteria	3444
1924	nmdc:mga09592_87401_c1	3300050508	Bacteria	2661
1925	nmdc:mga0qj67_154229_c1	3300050509	Bacteria	1864
1926	nmdc:mga0qj67_202632_c1	3300050509	Bacteria	1612
1927	nmdc:mga0qj67_52_c1	3300050509	Bacteria	84067
1928	nmdc:mga0qj67_98_c1	3300050509	Bacteria	57947
1929	nmdc:mga06r32_11414_c1	3300050510	Bacteria	8003
1930	nmdc:mga06r32_13686_c1	3300050510	Bacteria	5066
1931	nmdc:mga06r32_15127_c1	3300050510	Bacteria	7007
1932	nmdc:mga06r32_22072_c1	3300050510	Bacteria	5882
1933	nmdc:mga06r32_2221_c1	3300050510	Bacteria	17383
1934	nmdc:mga06r32_27161_c1	3300050510	Bacteria	5344
1935	nmdc:mga06r32_296515_c1	3300050510	Bacteria	1603
1936	nmdc:mga06r32_50437_c1	3300050510	Bacteria	3981
1937	nmdc:mga06r32_57440_c1	3300050510	Bacteria	3738
1938	nmdc:mga06r32_8195_c1	3300050510	Bacteria	9404
1939	nmdc:mga06r32_9529_c1	3300050510	Bacteria	8768
1940	nmdc:mga08y16_11150_c1	3300050511	Bacteria	9439
1941	nmdc:mga08y16_188796_c1	3300050511	Bacteria	2138
1942	nmdc:mga08y16_2766_c1	3300050511	Bacteria	17974
1943	nmdc:mga08y16_62568_c1	3300050511	Bacteria	3887
1944	nmdc:mga08y16_64094_c1	3300050511	Bacteria	3838
1945	nmdc:mga08y16_81780_c1	3300050511	Bacteria	3367
1946	nmdc:mga08y16_90511_c1	3300050511	Bacteria	3190
1947	nmdc:mga08y16_98_c1	3300050511	Bacteria	73684
1948	nmdc:mga0n895_10615_c1	3300050512	Bacteria	8154
1949	nmdc:mga0n895_109242_c1	3300050512	Bacteria	2781
1950	nmdc:mga0n895_140484_c1	3300050512	Bacteria	2443
1951	nmdc:mga0n895_157040_c1	3300050512	Bacteria	2305
1952	nmdc:mga0n895_17917_c1	3300050512	Bacteria	6543
1953	nmdc:mga0n895_179203_c1	3300050512	Bacteria	2150
1954	nmdc:mga0n895_187069_c1	3300050512	Bacteria	2102
1955	nmdc:mga0n895_430666_c1	3300050512	Bacteria	1333
1956	nmdc:mga0n895_43172_c1	3300050512	Bacteria	4393
1957	nmdc:mga0n895_47074_c1	3300050512	Bacteria	4216
1958	nmdc:mga0n895_54355_c1	3300050512	Bacteria	3939
1959	nmdc:mga0n895_65473_c1	3300050512	Bacteria	3597
1960	nmdc:mga0n895_725_c1	3300050512	Bacteria	23201
1961	nmdc:mga0n895_7684_c1	3300050512	Bacteria	9275
1962	nmdc:mga0rr50_119551_c1	3300050513	Bacteria	2095
1963	nmdc:mga0rr50_131810_c1	3300050513	Bacteria	1646
1964	nmdc:mga0rr50_62528_c1	3300050513	Bacteria	2809
1965	nmdc:mga0rr50_88890_c1	3300050513	Bacteria	2401
1966	nmdc:mga08x19_15913_c1	3300050514	Bacteria	4582
1967	nmdc:mga08x19_332156_c1	3300050514	Bacteria	1059
1968	nmdc:mga08x19_3776_c1	3300050514	Bacteria	9014
1969	nmdc:mga08x19_60275_c1	3300050514	Bacteria	2458
1970	nmdc:mga0a205_100217_c1	3300050515	Bacteria	2795
1971	nmdc:mga0a205_141225_c1	3300050515	Bacteria	2308
1972	nmdc:mga0a205_165624_c1	3300050515	Bacteria	2106
1973	nmdc:mga0a205_20332_c1	3300050515	Bacteria	6261
1974	nmdc:mga0a205_245906_c1	3300050515	Bacteria	1669
1975	nmdc:mga0a205_284400_c1	3300050515	Bacteria	1529
1976	nmdc:mga0a205_34714_c1	3300050515	Bacteria	4840
1977	nmdc:mga0a205_4714_c1	3300050515	Bacteria	12242
1978	nmdc:mga0a205_4821_c1	3300050515	Bacteria	12128
1979	nmdc:mga0a205_48710_c1	3300050515	Bacteria	4090
1980	nmdc:mga0a205_66093_c1	3300050515	Bacteria	3494
1981	nmdc:mga0a205_91_c1	3300050515	Bacteria	32392
1982	nmdc:mga0sz30_32796_c1	3300050516	Bacteria	2156
1983	nmdc:mga0sz30_45827_c1	3300050516	Bacteria	1845
1984	nmdc:mga0sz30_57808_c1	3300050516	Bacteria	1359
1985	nmdc:mga0sz30_57845_c1	3300050516	Bacteria	1653
1986	nmdc:mga0sz30_9076_c1	3300050516	Bacteria	3770
1987	Ga0495601_0000015	3300053077	Bacteria	213851
1988	Ga0495601_0000081	3300053077	Bacteria	51417
1989	Ga0495601_0000729	3300053077	Bacteria	17679
1990	Ga0495601_0004409	3300053077	Bacteria	8134
1991	Ga0495601_0020653	3300053077	Bacteria	4023
1992	Ga0495601_0022797	3300053077	Bacteria	3846
1993	Ga0495601_0031646	3300053077	Bacteria	3289
1994	Ga0495601_0035618	3300053077	Bacteria	3107
1995	Ga0495601_0097422	3300053077	Bacteria	1897
1996	Ga0495601_0180933	3300053077	Bacteria	1378
1997	Ga0495612_0000096	3300053078	Bacteria	38017
1998	Ga0495612_0008941	3300053078	Bacteria	4059
1999	Ga0495612_0038048	3300053078	Bacteria	1954
2000	Ga0495612_0042591	3300053078	Bacteria	1853
2001	Ga0495612_0070997	3300053078	Bacteria	1452
2002	Ga0500610_0023802	3300053079	Bacteria	3036
2003	Ga0495595_0000035	3300053084	Bacteria	79822
2004	Ga0495595_0000322	3300053084	Bacteria	18712
2005	Ga0495595_0000731	3300053084	Bacteria	12445
2006	Ga0495595_0000755	3300053084	Bacteria	12269
2007	Ga0495595_0017112	3300053084	Bacteria	3115
2008	Ga0495595_0018422	3300053084	Bacteria	3017
2009	Ga0495619_0000044	3300053085	Bacteria	108581
2010	Ga0495619_0000122	3300053085	Bacteria	57583
2011	Ga0495619_0000270	3300053085	Bacteria	37699
2012	Ga0495619_0005395	3300053085	Bacteria	8100
2013	Ga0495619_0007525	3300053085	Bacteria	6898
2014	Ga0495619_0017076	3300053085	Bacteria	4601
2015	Ga0495619_0047759	3300053085	Bacteria	2820
2016	Ga0495619_0069601	3300053085	Bacteria	2352
2017	Ga0495619_0105414	3300053085	Bacteria	1922
2018	Ga0500578_0106339	3300053086	Bacteria	1772
2019	Ga0500643_008610	3300053087	Bacteria	3994
2020	Ga0500651_0000169	3300053093	Bacteria	42653
2021	Ga0500593_000043	3300053117	Bacteria	45165
2022	Ga0500593_041960	3300053117	Bacteria	2043
2023	Ga0500642_0000513	3300053130	Bacteria	11778
2024	Ga0500642_0060796	3300053130	Bacteria	1696
2025	Ga0500642_0115362	3300053130	Bacteria	1255
2026	Ga0500652_008974	3300053131	Bacteria	3361
2027	Ga0500658_0000435	3300053134	Bacteria	17937
2028	Ga0500658_0000437	3300053134	Bacteria	17923
2029	Ga0500658_0003173	3300053134	Bacteria	6270
2030	Ga0500658_0028244	3300053134	Bacteria	2175
2031	Ga0500568_0012336	3300053139	Bacteria	3935
2032	Ga0500589_074059	3300053147	Bacteria	1534
2033	Ga0500604_0002759	3300053151	Bacteria	4772
2034	Ga0500616_0001923	3300053153	Bacteria	18538
2035	Ga0500616_0002887	3300053153	Bacteria	13778
2036	Ga0500616_0047562	3300053153	Bacteria	2277
2037	Ga0500616_0058481	3300053153	Bacteria	2005
2038	Ga0500619_000027	3300053154	Bacteria	48298
2039	Ga0500645_000465	3300053730	Bacteria	27672
2040	Ga0500645_001469	3300053730	Bacteria	11841
2041	Ga0500645_003457	3300053730	Bacteria	6403
2042	Ga0500609_001768	3300053731	Bacteria	3132
2043	Ga0501084_0001725	3300054114	Bacteria	17338
2044	Ga0501084_0011657	3300054114	Bacteria	7278
2045	Ga0501084_0025251	3300054114	Bacteria	4956
2046	Ga0501084_0196678	3300054114	Bacteria	1701
2047	Ga0590071_003743	3300059421	Bacteria	3731
2048	Ga0587080_012573	3300059503	Bacteria	1282
2049	Ga0587082_001655	3300059504	Bacteria	2360
2050	Ga0587083_0001400	3300059505	Bacteria	2695
2051	Ga0501082_0000230	3300060353	Bacteria	48963
2052	Ga0501082_0000982	3300060353	Bacteria	25167
2053	Ga0501082_0005399	3300060353	Bacteria	11090
2054	Ga0501082_0021119	3300060353	Bacteria	5615
2055	Ga0501082_0057896	3300060353	Bacteria	3338
2056	Ga0501082_0076052	3300060353	Bacteria	2893
2057	Ga0466962_0012226	3300061719	Bacteria	4127
2058	Ga0530510_0000219	3300061734	Bacteria	35590
2059	Ga0530510_0001428	3300061734	Bacteria	15993
2060	Ga0530510_0017333	3300061734	Bacteria	5104
2061	Ga0530510_0087763	3300061734	Bacteria	2266
2062	2509110928	2508501122	Bacteria	6292184
2063	2509376320	2509276019	Bacteria	6802256
2064	2510304332	2510065057	Bacteria	6649661
2065	2511184815	2510917028	Bacteria	6185411
2066	2511242612	2511231002	Bacteria	5042903
2067	2511502103	2511231052	Bacteria	6974333
2068	2512533476	2512047086	Bacteria	6850303
2069	2512970861	2512875026	Bacteria	6861065
2070	2513582503	2513237086	Bacteria	7265287
2071	2513606052	2513237089	Bacteria	6553624
2072	2513615611	2513237091	Bacteria	6900273
2073	2513628441	2513237092	Bacteria	8341956
2074	2513857056	2513237137	Bacteria	9558895
2075	2513881403	2513237140	Bacteria	7076289
2076	2513902630	2513237143	Bacteria	6664116
2077	2513911962	2513237144	Bacteria	7530820
2078	2513923721	2513237146	Bacteria	7166346
2079	2513952722	2513237150	Bacteria	6553639
2080	2513987282	2513237156	Bacteria	6402557
2081	2514006536	2513237160	Bacteria	6650282
2082	2514045157	2513237165	Bacteria	6771773
2083	2515608882	2515154107	Bacteria	6795637
2084	2516209864	2516143018	Bacteria	6951533
2085	2516893481	2516653046	Bacteria	6989037
2086	2517570172	2517487022	Bacteria	7227575
2087	2524448688	2524023207	Bacteria	6813453
2088	2551680087	2551306084	Bacteria	8942552
2089	2551684430	2551306085	Bacteria	7347181
2090	2551690223	2551306086	Bacteria	6843938
2091	2551704936	2551306087	Bacteria	7351905
2092	2551713930	2551306089	Bacteria	7162724
2093	2551722620	2551306090	Bacteria	7953713
2094	2551730639	2551306091	Bacteria	7086830
2095	2551734918	2551306092	Bacteria	6992595
2096	2551746529	2551306093	Bacteria	7064773
2097	2558867856	2558860100	Bacteria	8458965
2098	2585203456	2582581294	Bacteria	6626667
2099	2585398477	2582581867	Bacteria	7184437
2100	2585819376	2585427590	Bacteria	6824633
2101	2599415751	2599185170	Bacteria	7295545
2102	2599627088	2599185214	Bacteria	8209958
2103	2599676551	2599185226	Bacteria	8233575
2104	2599684819	2599185227	Bacteria	8246414
2105	2599696745	2599185229	Bacteria	8216126
2106	2600194785	2599185352	Bacteria	7228948
2107	2643744823	2643221544	Bacteria	5886209
2108	2643934233	2643221585	Bacteria	5812563
2109	2644104596	2643221618	Bacteria	7717186
2110	2644160051	2643221628	Bacteria	5745828
2111	2644219551	2643221639	Bacteria	6649903
2112	2644249081	2643221644	Bacteria	6865017
2113	2644255981	2643221646	Bacteria	6433402
2114	2644307984	2643221655	Bacteria	7722067
2115	2644315720	2643221656	Bacteria	5809961
2116	2644326881	2643221658	Bacteria	6064537
2117	2644333711	2643221659	Bacteria	7890716
2118	2644338080	2643221660	Bacteria	4208257
2119	2644401038	2643221672	Bacteria	6322190
2120	2644466365	2643221683	Bacteria	5749203
2121	2644614138	2643221712	Bacteria	7729434
2122	2644675883	2643221723	Bacteria	7095460
2123	2692315686	2690316117	Bacteria	6800650
2124	2738723471	2738541277	Bacteria	7458140
2125	2738882230	2738541307	Bacteria	8606193
2126	2739054436	2738541337	Bacteria	6183410
2127	2739251772	2738543013	Bacteria	5618633
2128	2739284202	2738543019	Bacteria	7459457
2129	2753460344	2751185821	Bacteria	6189929
2130	2765468964	2765235802	Bacteria	5618596
2131	2770195101	2767802442	Bacteria	5747986
2132	2776270842	2775506902	Bacteria	6208009
2133	2776280335	2775506904	Bacteria	5954060
2134	2792620312	2791355091	Bacteria	6135441
2135	2792626270	2791355092	Bacteria	6248105
2136	2792639213	2791355094	Bacteria	7011481
2137	2802719880	2802428858	Bacteria	6636079
2138	2802727186	2802428859	Bacteria	6667919
2139	2802731814	2802428860	Bacteria	6525526
2140	2802739144	2802428861	Bacteria	6534206
2141	2802745878	2802428862	Bacteria	6633353
2142	2802752478	2802428863	Bacteria	6410669
2143	2819598157	2818991446	Bacteria	7757362
2144	2829748338	2829745981	Bacteria	5406054
2145	2831269144	2831265667	Bacteria	7184833
2146	2834643232	2834641062	Bacteria	5559922
2147	2838035869	2838035591	Bacteria	7166484
2148	2838058574	2838054893	Bacteria	7451788
2149	2838077048	2838074704	Bacteria	6785777
2150	2838665097	2838661181	Bacteria	7385261
2151	2839996938	2839993093	Bacteria	5512535
2152	2840765999	2840764183	Bacteria	6358399
2153	2841736515	2841734538	Bacteria	6784580
2154	2841963888	2841957949	Bacteria	8652217
2155	2842682415	2842677519	Bacteria	5615038
2156	2842733725	2842733646	Bacteria	5716726
2157	2844535133	2844533157	Bacteria	7517899
2158	2847419254	2847417321	Bacteria	6913799
2159	2848994280	2848992105	Bacteria	6810864
2160	2850081286	2850079185	Bacteria	6848280
2161	2855826204	2855825444	Bacteria	6785811
2162	2855841549	2855839649	Bacteria	7135830
2163	2855875948	2855872281	Bacteria	6964271
2164	2858802468	2858800743	Bacteria	6603254
2165	2871481315	2871474448	Bacteria	6806570
2166	2881103112	2881101125	Bacteria	4590519
2167	2885196491	2885192300	Bacteria	5882526
2168	2885200035	2885198086	Bacteria	7212419
2169	2885213735	2885211737	Bacteria	7212420
2170	2896385850	2896384573	Bacteria	7700774
2171	2899929579	2899924645	Bacteria	7487985
2172	2904456395	2904449895	Bacteria	6927402
2173	2904462904	2904456579	Bacteria	6819253
2174	2904546564	2904541872	Bacteria	8915136
2175	2909043633	2909042592	Bacteria	6499737
2176	2915984240	2915980308	Bacteria	6624279
2177	2915991569	2915986958	Bacteria	6739310
2178	2915997785	2915993759	Bacteria	7016183
2179	2916003234	2916000859	Bacteria	6865702
2180	2916007885	2916007675	Bacteria	6898660
2181	2916020161	2916014648	Bacteria	6946486
2182	2916027864	2916021584	Bacteria	6854472
2183	2916032934	2916028427	Bacteria	6748433
2184	2916039503	2916035215	Bacteria	6755766
2185	2916043770	2916041962	Bacteria	6820487
2186	2916052423	2916048683	Bacteria	6543552
2187	2916058864	2916055098	Bacteria	6758838
2188	2916066321	2916061851	Bacteria	6737736
2189	2916075241	2916068649	Bacteria	6943657
2190	2916078033	2916076590	Bacteria	6596108
2191	2919465821	2919462493	Bacteria	5817112
2192	2920761783	2920760137	Bacteria	7427611
2193	2920825428	2920822456	Bacteria	6897201
2194	2921207519	2921201388	Bacteria	6926299
2195	2921210394	2921208531	Bacteria	6745326
2196	2921240856	2921237296	Bacteria	6876710
2197	2921249847	2921244191	Bacteria	6568419
2198	2921255572	2921250672	Bacteria	6677771
2199	2921260564	2921257292	Bacteria	6808382
2200	2921267685	2921263974	Bacteria	6864552
2201	2921287897	2921282425	Bacteria	6826397
2202	2921289514	2921289301	Bacteria	7316391
2203	2921304547	2921296804	Bacteria	7176999
2204	2923557268	2923556063	Bacteria	6793593
2205	2924148664	2924144063	Bacteria	6883928
2206	2924151383	2924150972	Bacteria	7169444
2207	2924162045	2924158325	Bacteria	7188855
2208	2924166058	2924165586	Bacteria	7260590
2209	2924176159	2924172951	Bacteria	6749356
2210	2924183133	2924179722	Bacteria	6843264
2211	2924190703	2924186466	Bacteria	6876637
2212	2924199666	2924193448	Bacteria	6955718
2213	2924203576	2924200457	Bacteria	6757188
2214	2924212725	2924207177	Bacteria	6917007
2215	2924217197	2924214083	Bacteria	7080103
2216	2924227024	2924221636	Bacteria	7113495
2217	2924232187	2924228884	Bacteria	6633132
2218	2928039978	2928037797	Bacteria	7273642
2219	2928047273	2928044640	Bacteria	7271509
2220	2928057524	2928051484	Bacteria	7773759
2221	2928068091	2928064002	Bacteria	7419480
2222	2928072676	2928070936	Bacteria	8062541
2223	2928085841	2928084124	Bacteria	7159212
2224	2929166018	2929160207	Bacteria	9075316
2225	2929523758	2929520902	Bacteria	6765052
2226	2933017822	2933016740	Bacteria	6355406
2227	2937000268	2936996657	Bacteria	6298727
2228	2937008379	2937002841	Bacteria	6934057
2229	2937014739	2937009748	Bacteria	6746052
2230	2937018606	2937016420	Bacteria	6782579
2231	2937027064	2937023124	Bacteria	6815156
2232	2937034244	2937029754	Bacteria	6424026
2233	2937042456	2937036028	Bacteria	6846469
2234	2937046192	2937042894	Bacteria	6741576
2235	2937055522	2937049772	Bacteria	6757901
2236	2937062461	2937056579	Bacteria	7107896
2237	2937069159	2937063883	Bacteria	7199456
2238	2937075080	2937071275	Bacteria	6984483
2239	2937082317	2937078374	Bacteria	6610289
2240	2937089365	2937084907	Bacteria	6618516
2241	2937093841	2937091812	Bacteria	6979387
2242	2937100432	2937098957	Bacteria	7249374
2243	2937110668	2937106411	Bacteria	6947143
2244	2937117053	2937113482	Bacteria	6505872
2245	2937124624	2937119839	Bacteria	6597547
2246	2937127693	2937126314	Bacteria	6771275
2247	2945914827	2945909444	Bacteria	7065066
2248	2945951110	2945945610	Bacteria	5951079
2249	2945974232	2945972063	Bacteria	6086495
2250	2945989775	2945984333	Bacteria	7358892
2251	2954769492	2954767861	Bacteria	5535784
2252	2957380273	2957375807	Bacteria	6425588
2253	2957387685	2957382221	Bacteria	6737050
2254	2957392984	2957388812	Bacteria	6778072
2255	2957398908	2957395598	Bacteria	6822399
2256	2957403072	2957402308	Bacteria	6741770
2257	2957410828	2957408893	Bacteria	6558585
2258	2957421845	2957415311	Bacteria	6991633
2259	2957422712	2957422303	Bacteria	7172205
2260	2957436342	2957430029	Bacteria	7022557
2261	2957443392	2957437181	Bacteria	6568994
2262	2957449658	2957443900	Bacteria	6869977
2263	2957456099	2957450854	Bacteria	6765715
2264	2957460845	2957457609	Bacteria	6967680
2265	2957468703	2957464669	Bacteria	6568877
2266	2957475667	2957471148	Bacteria	6797643
2267	2957481552	2957478035	Bacteria	6756658
2268	2957487613	2957484790	Bacteria	6703082
2269	2957492359	2957491536	Bacteria	6695180
2270	2957502368	2957498199	Bacteria	7126688
2271	2957507388	2957505466	Bacteria	7253085
2272	2958075884	2958071322	Bacteria	6815895
2273	2960590169	2960584000	Bacteria	6864594
2274	2960595748	2960591022	Bacteria	6622873
2275	2960602553	2960597568	Bacteria	6550735
2276	2960609127	2960603979	Bacteria	6898737
2277	2960616238	2960610863	Bacteria	6691244
2278	2960621379	2960617483	Bacteria	6727748
2279	2960627924	2960624210	Bacteria	6875384
2280	2960635976	2960631154	Bacteria	6732508
2281	2960640437	2960637947	Bacteria	7296468
2282	2960650175	2960645483	Bacteria	7211087
2283	2960653190	2960652885	Bacteria	7083688
2284	2960664766	2960660292	Bacteria	7041660
2285	2960670042	2960667422	Bacteria	6763020
2286	2960678873	2960674078	Bacteria	6609048
2287	2960683473	2960680706	Bacteria	6624464
2288	2960690567	2960687367	Bacteria	6535474
2289	2960699359	2960693952	Bacteria	6749742
2290	2964609259	2964607997	Bacteria	7101408
2291	2964615709	2964615318	Bacteria	6809089
2292	2964626406	2964621998	Bacteria	6834995
2293	2964633950	2964628898	Bacteria	7083044
2294	2964639808	2964636051	Bacteria	7091832
2295	2964648012	2964643177	Bacteria	6820887
2296	2964653373	2964649959	Bacteria	6675118
2297	2964662714	2964656573	Bacteria	7100150
2298	2964667551	2964663802	Bacteria	7019362
2299	2964673581	2964670856	Bacteria	6851364
2300	2964684522	2964678106	Bacteria	6792020
2301	2964689447	2964685014	Bacteria	6839111
2302	2964697101	2964691889	Bacteria	6802758
2303	2964703684	2964698721	Bacteria	6765331
2304	2964711974	2964705432	Bacteria	7114648
2305	2964718993	2964712639	Bacteria	6695970
2306	2964720605	2964719344	Bacteria	7286602
2307	2967669830	2967664464	Bacteria	6948836
2308	2967676309	2967671571	Bacteria	7021409
2309	2967679851	2967678726	Bacteria	7264382
2310	2967690535	2967686174	Bacteria	6678622
2311	2967696438	2967693043	Bacteria	6804451
2312	2967700542	2967699805	Bacteria	6854538
2313	2967709777	2967706974	Bacteria	7186053
2314	2967719661	2967714385	Bacteria	7000047
2315	2967727261	2967721400	Bacteria	7073753
2316	2967733417	2967728569	Bacteria	6641507
2317	2967739470	2967735183	Bacteria	6827012
2318	2967744303	2967742019	Bacteria	6794534
2319	2967754177	2967748971	Bacteria	6733771
2320	2967759744	2967755722	Bacteria	6814706
2321	2967766994	2967762386	Bacteria	6923502
2322	2967773359	2967769361	Bacteria	6587838
2323	2967778615	2967775926	Bacteria	6738189
2324	2970024025	2970019648	Bacteria	7072033
2325	2970031692	2970026789	Bacteria	6785236
2326	2970039929	2970033650	Bacteria	7118744
2327	2970047318	2970040964	Bacteria	6731123
2328	2970049462	2970047711	Bacteria	7088379
2329	2970056519	2970054988	Bacteria	6611507
2330	2970066512	2970061556	Bacteria	7099761
2331	2970074180	2970068827	Bacteria	7123112
2332	2970080932	2970076120	Bacteria	6697332
2333	2970086928	2970082768	Bacteria	6183754
2334	2970094095	2970088815	Bacteria	6933825
2335	2970101611	2970095765	Bacteria	6936963
2336	2970106775	2970102677	Bacteria	6812532
2337	2970114765	2970109326	Bacteria	6863976
2338	2970121055	2970116247	Bacteria	6501857
2339	2970127440	2970122695	Bacteria	6625855
2340	2970132435	2970129317	Bacteria	6806560
2341	2970143305	2970136068	Bacteria	7207982
2342	2970148732	2970143518	Bacteria	6446480
2343	2970150633	2970149975	Bacteria	6779706
2344	2970158535	2970156795	Bacteria	7168044
2345	2970168817	2970164137	Bacteria	6861252
2346	2970173927	2970170962	Bacteria	6876229
2347	2970179737	2970177841	Bacteria	6768001
2348	2970189678	2970184632	Bacteria	7054431
2349	2970196466	2970191845	Bacteria	7032787
2350	2977522586	2977516862	Bacteria	6940108
2351	2977528679	2977523885	Bacteria	6960446
2352	2977535263	2977530762	Bacteria	6951399
2353	2977542441	2977537788	Bacteria	6929320
2354	2977549738	2977544691	Bacteria	6875412
2355	2977555345	2977551784	Bacteria	7125765
2356	2977561757	2977558990	Bacteria	6863948
2357	2977572127	2977565890	Bacteria	6901543
2358	2977576196	2977572785	Bacteria	6763888
2359	2977584819	2977579622	Bacteria	6772100
2360	2977870272	2977864932	Bacteria	7534097
2361	2996887700	2996887358	Bacteria	5795980
2362	3005413679	3005409236	Bacteria	7188837
2363	3005490363	3005483717	Bacteria	7877331
2364	643826143	643692032	Bacteria	6891900
2365	644750684	644736347	Bacteria	6476522
2366	648740819	648276728	Bacteria	6968865
2367	8003402462	8003400568	Bacteria	5535898
2368	8003994002	8003992118	Bacteria	7266902
2369	8004001630	8003999396	Bacteria	7063185
2370	8004639255	8004633249	Bacteria	6723080
2371	8005322227	8005321885	Bacteria	5795980
2372	8016588393	8016583857	Bacteria	10421953
2373	8019653375	8019648815	Bacteria	10014479
2374	8055619148	8055617313	Bacteria	7548464
2375	Ga0075432_10029480
2376	SwRhRL2b_contig_3104459
2377	ARSoilYngRDRAFT_c00306
2378	ARSoilOldRDRAFT_c000414
2379	JGI24032J14994_100039
2380	JGI24746J21847_1001657
2381	JGI24740J21852_10005549
2382	JGI24739J22299_10000147
2383	JGI24739J22299_10014355
2384	JGI24737J22298_10007823
2385	JGI24750J21931_1000071
2386	JGI24745J21846_1000160
2387	JGI24748J21848_1000327
2388	JGI24738J21930_10000240
2389	JGI24749J21850_1000221
2390	JGI24744J21845_10003236
2391	JGI24035J26624_1000043
2392	JGI24034J26672_10000318
2393	JGI24742J22300_10000076
2394	JGI25155J39150_1000035
2395	JGI25156J39149_1000012
2396	JGI25154J39366_1000029
2397	JGI25158J39367_1001450
2398	JGI25157J39369_1000014
2399	JGI25150J39212_1013502
2400	JGI25159J45721_1000004
2401	JGI25159J45721_1001438
2402	JGI25159J45721_1003813
2403	JGI25159J45721_1004878
2404	JGI25159J45721_1018868
2405	JGI25151J46595_10000246
2406	JGI25151J46595_10000830
2407	JGI25151J46595_10003554
2408	JGI25151J46595_10004765
2409	JGI25151J46595_10004933
2410	JGI25151J46595_10008959
2411	JGI25151J46595_10013212
2412	JGI25153J46596_10001104
2413	JGI25153J46596_10005082
2414	JGI25153J46596_10005285
2415	JGI25153J46596_10005877
2416	JGI25153J46596_10020512
2417	rootH1_10023711
2418	rootL2_10042394
2419	JGI25160J50197_1000021
2420	JGI25160J50197_1000282
2421	JGI25160J50197_1010318
2422	JGI25161J50226_1000094
2423	JGI25161J50226_1000218
2424	JGI25404J52841_10002056
2425	JGI25404J52841_10016867
2426	Ga0055535_1000168
2427	Ga0055542_1000214
2428	Ga0055526_1001422
2429	Ga0055526_1002738
2430	Ga0055526_1004904
2431	Ga0055526_1015053
2432	Ga0055537_1000029
2433	Ga0055537_1000092
2434	Ga0055537_1000333
2435	Ga0055537_1007396
2436	Ga0055524_1000040
2437	Ga0055524_1000488
2438	Ga0055524_1014861
2439	Ga0055536_1000269
2440	Ga0055536_1000891
2441	Ga0055536_1013542
2442	Ga0055534_1000265
2443	Ga0055534_1003597
2444	Ga0055534_1003664
2445	Ga0055534_1007699
2446	Ga0055528_1000471
2447	Ga0055528_1010020
2448	Ga0055528_1032838
2449	Ga0055530_10000605
2450	Ga0055530_10001556
2451	Ga0055530_10002560
2452	Ga0055530_10029763
2453	Ga0055540_1000030
2454	Ga0055540_1000086
2455	Ga0055540_1001142
2456	Ga0055540_1002670
2457	Ga0055531_10000158
2458	Ga0055531_10000586
2459	Ga0055531_10000983
2460	Ga0055531_10007550
2461	Ga0055531_10008595
2462	Ga0055543_1000164
2463	Ga0055543_1000406
2464	Ga0058859_10012384
2465	Ga0058861_12012918
2466	Ga0058860_10003178
2467	Ga0065165_1000033
2468	Ga0065165_1007849
2469	Ga0065165_1008614
2470	Ga0065714_10004758
2471	Ga0065704_10007501
2472	Ga0065704_10081699
2473	Ga0065712_10029757
2474	Ga0065712_10068036
2475	Ga0065712_10112590
2476	Ga0065715_10000722
2477	Ga0065715_10091985
2478	Ga0065715_10124171
2479	Ga0065715_10129898
2480	Ga0065707_10084079
2481	Ga0065707_10107230
2482	Ga0065707_10181634
2483	Ga0070658_10022444
2484	Ga0070658_10188468
2485	Ga0070676_10000008
2486	Ga0070676_10138086
2487	Ga0070683_100190298
2488	Ga0070683_100319813
2489	Ga0070690_100007387
2490	Ga0070690_100023676
2491	Ga0070670_100008967
2492	Ga0070670_100012979
2493	Ga0070670_100077716
2494	Ga0070670_100122467
2495	Ga0070677_10000012
2496	Ga0070677_10034432
2497	Ga0068869_100000008
2498	Ga0068869_100003230
2499	Ga0068869_100003935
2500	Ga0068869_100028060
2501	Ga0068869_100045523
2502	Ga0068869_100090268
2503	Ga0068869_100152887
2504	Ga0070666_10021322
2505	Ga0070666_10027669
2506	Ga0070680_100000998
2507	Ga0070680_100016488
2508	Ga0070680_100050575
2509	Ga0070680_100183292
2510	Ga0070682_100000808
2511	Ga0070682_100110337
2512	Ga0068868_100002921
2513	Ga0068868_100228391
2514	Ga0070660_100002924
2515	Ga0070660_100008802
2516	Ga0070660_100015080
2517	Ga0070660_100060417
2518	Ga0070660_100312558
2519	Ga0070689_100000092
2520	Ga0070689_100106928
2521	Ga0070691_10092521
2522	Ga0070687_100000531
2523	Ga0070687_100193299
2524	Ga0070661_100000107
2525	Ga0070661_100036888
2526	Ga0070661_100041797
2527	Ga0070661_100099125
2528	Ga0070661_100114922
2529	Ga0070692_10052189
2530	Ga0070692_10126209
2531	Ga0070668_100041647
2532	Ga0070668_100054882
2533	Ga0070668_100107345
2534	Ga0070668_100189241
2535	Ga0070669_100000191
2536	Ga0070669_100005986
2537	Ga0070669_100074359
2538	Ga0070669_100124577
2539	Ga0070675_100000032
2540	Ga0070675_100008045
2541	Ga0070675_100012879
2542	Ga0070675_100015248
2543	Ga0070675_100058396
2544	Ga0070675_100084719
2545	Ga0070675_100187970
2546	Ga0070671_100018708
2547	Ga0070671_100022704
2548	Ga0070671_100034996
2549	Ga0070671_100039875
2550	Ga0070671_100072569
2551	Ga0070671_100102092
2552	Ga0070674_100004488
2553	Ga0070674_100022489
2554	Ga0070674_100031614
2555	Ga0070673_100000024
2556	Ga0070673_100015446
2557	Ga0070673_100022682
2558	Ga0070673_100024507
2559	Ga0070673_100158136
2560	Ga0070673_100199521
2561	Ga0070673_100228513
2562	Ga0070688_100007982
2563	Ga0070659_100000238
2564	Ga0070659_100001324
2565	Ga0070659_100017962
2566	Ga0070659_100100680
2567	Ga0070667_100000593
2568	Ga0070667_100016214
2569	Ga0070667_100033667
2570	Ga0070667_100080703
2571	Ga0070667_100083239
2572	Ga0070709_10039492
2573	Ga0070714_100010319
2574	Ga0070714_100060316
2575	Ga0070714_100219172
2576	Ga0070714_100261477
2577	Ga0070713_100040498
2578	Ga0070713_100099641
2579	Ga0070710_10008971
2580	Ga0070710_10014033
2581	Ga0070710_10146543
2582	Ga0070701_10000141
2583	Ga0070711_100029199
2584	Ga0070711_100029816
2585	Ga0070711_100091171
2586	Ga0070711_100178745
2587	Ga0070711_100196905
2588	Ga0070705_100001291
2589	Ga0070705_100013827
2590	Ga0070705_100147494
2591	Ga0070700_100000181
2592	Ga0070700_100012327
2593	Ga0070700_100050267
2594	Ga0070700_100050686
2595	Ga0070700_100059161
2596	Ga0070700_100092636
2597	Ga0070700_100124587
2598	Ga0070700_100238297
2599	Ga0070694_100004013
2600	Ga0070694_100142276
2601	Ga0070708_100056710
2602	Ga0070708_100304899
2603	Ga0070663_100000390
2604	Ga0070663_100010275
2605	Ga0070663_100038999
2606	Ga0070663_100045705
2607	Ga0070663_100126378
2608	Ga0070663_100282776
2609	Ga0070678_100019298
2610	Ga0070678_100030106
2611	Ga0070678_100031702
2612	Ga0070678_100095638
2613	Ga0070662_100006468
2614	Ga0070662_100050875
2615	Ga0070662_100180112
2616	Ga0070681_10000932
2617	Ga0070681_10038897
2618	Ga0070681_10191752
2619	Ga0068867_100000648
2620	Ga0068867_100002038
2621	Ga0068867_100004592
2622	Ga0068867_100009096
2623	Ga0068867_100019300
2624	Ga0068867_100090152
2625	Ga0068867_100184026
2626	Ga0068867_100213241
2627	Ga0070685_10011870
2628	Ga0070685_10013923
2629	Ga0070706_100000751
2630	Ga0070706_100126995
2631	Ga0070706_100209189
2632	Ga0070707_100015647
2633	Ga0070707_100079760
2634	Ga0070698_100001905
2635	Ga0070698_100185255
2636	Ga0070698_100383710
2637	Ga0070698_100500144
2638	Ga0070699_100018612
2639	Ga0070679_100004826
2640	Ga0070679_100033746
2641	Ga0070679_100074328
2642	Ga0070679_100122097
2643	Ga0070679_100130454
2644	Ga0070679_100139488
2645	Ga0070679_100149559
2646	Ga0070684_100000022
2647	Ga0070684_100325225
2648	Ga0070697_100009294
2649	Ga0070697_100107505
2650	Ga0070697_100250019
2651	Ga0068853_100001716
2652	Ga0068853_100012609
2653	Ga0068853_100045630
2654	Ga0068853_100047419
2655	Ga0068853_100063920
2656	Ga0068853_100100621
2657	Ga0068853_100108256
2658	Ga0068853_100184742
2659	Ga0068853_100243848
2660	Ga0070672_100000012
2661	Ga0070672_100009288
2662	Ga0070672_100011650
2663	Ga0070672_100021278
2664	Ga0070672_100023168
2665	Ga0070672_100030868
2666	Ga0070672_100049603
2667	Ga0070686_100000087
2668	Ga0070686_100004664
2669	Ga0070686_100012980
2670	Ga0070695_100000096
2671	Ga0070695_100003939
2672	Ga0070695_100025073
2673	Ga0070696_100001044
2674	Ga0070696_100007458
2675	Ga0070696_100017960
2676	Ga0070696_100019757
2677	Ga0070696_100022494
2678	Ga0070696_100058692
2679	Ga0070693_100000401
2680	Ga0070693_100005132
2681	Ga0070693_100045559
2682	Ga0070665_100002577
2683	Ga0070665_100013258
2684	Ga0070665_100087922
2685	Ga0070665_100182326
2686	Ga0070704_100002908
2687	Ga0070704_100030404
2688	Ga0070704_100035935
2689	Ga0070704_100167320
2690	Ga0068855_100004353
2691	Ga0068855_100022311
2692	Ga0068855_100033600
2693	Ga0068855_100060876
2694	Ga0068855_100102494
2695	Ga0068855_100137398
2696	Ga0068855_100173541
2697	Ga0070664_100002097
2698	Ga0070664_100005611
2699	Ga0070664_100013090
2700	Ga0070664_100043526
2701	Ga0070664_100051539
2702	Ga0070664_100067992
2703	Ga0070664_100068085
2704	Ga0070664_100264688
2705	Ga0070664_100266272
2706	Ga0068857_100000393
2707	Ga0068857_100031299
2708	Ga0068857_100037574
2709	Ga0068857_100055384
2710	Ga0068857_100059867
2711	Ga0068857_100184903
2712	Ga0068857_100191107
2713	Ga0068857_100220904
2714	Ga0068854_100019329
2715	Ga0068854_100021374
2716	Ga0068854_100103573
2717	Ga0068854_100127946
2718	Ga0068854_100162217
2719	Ga0068856_100000214
2720	Ga0068856_100009377
2721	Ga0068856_100044405
2722	Ga0068856_100190987
2723	Ga0070702_100000013
2724	Ga0068852_100000707
2725	Ga0068852_100010699
2726	Ga0068852_100218715
2727	Ga0068859_100005210
2728	Ga0068859_100028755
2729	Ga0068859_100101230
2730	Ga0068859_100156203
2731	Ga0068859_100167454
2732	Ga0068859_100205623
2733	Ga0068864_100023061
2734	Ga0068864_100025475
2735	Ga0068864_100040947
2736	Ga0068864_100045554
2737	Ga0068864_100052265
2738	Ga0068864_100065519
2739	Ga0068864_100068050
2740	Ga0068864_100242925
2741	Ga0068866_10000455
2742	Ga0068866_10006739
2743	Ga0068861_100000425
2744	Ga0068861_100002872
2745	Ga0068861_100008807
2746	Ga0068861_100136005
2747	Ga0068851_10002550
2748	Ga0068851_10137719
2749	Ga0068870_10000001
2750	Ga0068870_10015660
2751	Ga0068870_10034018
2752	Ga0068870_10160993
2753	Ga0068863_100000313
2754	Ga0068863_100029793
2755	Ga0068863_100078080
2756	Ga0068863_100104100
2757	Ga0068858_100002484
2758	Ga0068858_100051886
2759	Ga0068858_100121341
2760	Ga0068858_100397052
2761	Ga0068860_100035393
2762	Ga0068860_100059007
2763	Ga0068860_100103623
2764	Ga0068862_100002566
2765	Ga0068862_100012043
2766	Ga0068862_100020196
2767	Ga0068862_100067143
2768	Ga0068862_100091723
2769	Ga0068862_100124757
2770	Ga0081455_10000141
2771	Ga0081455_10004492
2772	Ga0081455_10010780
2773	Ga0081455_10021897
2774	Ga0081455_10039250
2775	Ga0081455_10048994
2776	Ga0081538_10003961
2777	Ga0081538_10006100
2778	Ga0081538_10007790
2779	Ga0081538_10016308
2780	Ga0081538_10048881
2781	Ga0081538_10067155
2782	Ga0081538_10098059
2783	Ga0081540_1000922
2784	Ga0081540_1001425
2785	Ga0081540_1002287
2786	Ga0081540_1007355
2787	Ga0081540_1012177
2788	Ga0081540_1014419
2789	Ga0081540_1021474
2790	Ga0081540_1030257
2791	Ga0081540_1077224
2792	Ga0081539_10000276
2793	Ga0081539_10014863
2794	Ga0081539_10114872
2795	Ga0070717_10000215
2796	Ga0070717_10239996
2797	Ga0070717_10359196
2798	Ga0075365_10000866
2799	Ga0075365_10004579
2800	Ga0075365_10010896
2801	Ga0075365_10014307
2802	Ga0075365_10017543
2803	Ga0075365_10018634
2804	Ga0075365_10029869
2805	Ga0075365_10048544
2806	Ga0075365_10051332
2807	Ga0075365_10093439
2808	Ga0075365_10110836
2809	Ga0075365_10193278
2810	Ga0075368_10001912
2811	Ga0075368_10008829
2812	Ga0075368_10078095
2813	Ga0075363_100000268
2814	Ga0075363_100009766
2815	Ga0075363_100020013
2816	Ga0075363_100021306
2817	Ga0075363_100047706
2818	Ga0075363_100082710
2819	Ga0075364_10004279
2820	Ga0075364_10011038
2821	Ga0075364_10028707
2822	Ga0075364_10031064
2823	Ga0075364_10040507
2824	Ga0075364_10047476
2825	Ga0075364_10052470
2826	Ga0075364_10064347
2827	Ga0075364_10066321
2828	Ga0075364_10075648
2829	Ga0075432_10007884
2830	Ga0075432_10064744
2831	Ga0070715_10003840
2832	Ga0070716_100010294
2833	Ga0070716_100055164
2834	Ga0070712_100027467
2835	Ga0070712_100078095
2836	Ga0070712_100118881
2837	Ga0070712_100189476
2838	Ga0075362_10003036
2839	Ga0075362_10007757
2840	Ga0075362_10012934
2841	Ga0075362_10016189
2842	Ga0075362_10017512
2843	Ga0075362_10023007
2844	Ga0075362_10023585
2845	Ga0075362_10055026
2846	Ga0075362_10059329
2847	Ga0075362_10062645
2848	Ga0075362_10064944
2849	Ga0075367_10000458
2850	Ga0075367_10001562
2851	Ga0075367_10020611
2852	Ga0075367_10026426
2853	Ga0075367_10029070
2854	Ga0075367_10042474
2855	Ga0075367_10055851
2856	Ga0075369_10000560
2857	Ga0075369_10003922
2858	Ga0075369_10004019
2859	Ga0075369_10011267
2860	Ga0075369_10011413
2861	Ga0075366_10002850
2862	Ga0075366_10006045
2863	Ga0075366_10007752
2864	Ga0075366_10008444
2865	Ga0075366_10017650
2866	Ga0075366_10018680
2867	Ga0075366_10020283
2868	Ga0075366_10020647
2869	Ga0075366_10025598
2870	Ga0075366_10028808
2871	Ga0075366_10040972
2872	Ga0075366_10042823
2873	Ga0075366_10085776
2874	Ga0075366_10091559
2875	Ga0075366_10092283
2876	Ga0075366_10151782
2877	Ga0075366_10196424
2878	Ga0097621_100000233
2879	Ga0097621_100003286
2880	Ga0097621_100055006
2881	Ga0097621_100065032
2882	Ga0075370_10000410
2883	Ga0075370_10001220
2884	Ga0075370_10003598
2885	Ga0075370_10006565
2886	Ga0075370_10008450
2887	Ga0075370_10008825
2888	Ga0075370_10013050
2889	Ga0075370_10013843
2890	Ga0075370_10033034
2891	Ga0075370_10044894
2892	Ga0075370_10049191
2893	Ga0075370_10105152
2894	Ga0068871_100000007
2895	Ga0068871_100010086
2896	Ga0068871_100012201
2897	Ga0068871_100134753
2898	Ga0068871_100215312
2899	Ga0075428_100010917
2900	Ga0075428_100017973
2901	Ga0075428_100045633
2902	Ga0075428_100060357
2903	Ga0075428_100084158
2904	Ga0075428_100157757
2905	Ga0075428_100261600
2906	Ga0075428_100528479
2907	Ga0075430_100000126
2908	Ga0075430_100000281
2909	Ga0075430_100178260
2910	Ga0075431_100000203
2911	Ga0075431_100001584
2912	Ga0075431_100007038
2913	Ga0075431_100010580
2914	Ga0075431_100016863
2915	Ga0075431_100039393
2916	Ga0075431_100084422
2917	Ga0075433_10001874
2918	Ga0075433_10023504
2919	Ga0075433_10069863
2920	Ga0075433_10152537
2921	Ga0075433_10381560
2922	Ga0075434_100001617
2923	Ga0075434_100030612
2924	Ga0075434_100042100
2925	Ga0075434_100055229
2926	Ga0075434_100064860
2927	Ga0075434_100125017
2928	Ga0075434_100278926
2929	Ga0075429_100000246
2930	Ga0075429_100002793
2931	Ga0075429_100106469
2932	Ga0068865_100000091
2933	Ga0068865_100002621
2934	Ga0068865_100053876
2935	Ga0068865_100063199
2936	Ga0068865_100116814
2937	Ga0075436_100006889
2938	Ga0075436_100006942
2939	Ga0075436_100044740
2940	Ga0075436_100051456
2941	Ga0075436_100079638
2942	Ga0097620_100005210
2943	Ga0097620_100028754
2944	Ga0097620_100101227
2945	Ga0097620_100156203
2946	Ga0097620_100167450
2947	Ga0097620_100205615
2948	Ga0079104_1020912
2949	Ga0099826_10000050
2950	Ga0099826_10008505
2951	Ga0075435_100015059
2952	Ga0075435_100034644
2953	Ga0075435_100107262
2954	Ga0075435_100144008
2955	Ga0075435_100169790
2956	Ga0075435_100204857
2957	Ga0075435_100254332
2958	Ga0099794_10022811
2959	Ga0099795_10063856
2960	Ga0105251_10024034
2961	Ga0105244_10030917
2962	Ga0105244_10054984
2963	Ga0105250_10011840
2964	Ga0105250_10020340
2965	Ga0105240_10039796
2966	Ga0105240_10110411
2967	Ga0105240_10190790
2968	Ga0111539_10000241
2969	Ga0111539_10000336
2970	Ga0111539_10001767
2971	Ga0111539_10035683
2972	Ga0111539_10037523
2973	Ga0111539_10064142
2974	Ga0111539_10065941
2975	Ga0111539_10087300
2976	Ga0111539_10126572
2977	Ga0105245_10000187
2978	Ga0105245_10085463
2979	Ga0105245_10102055
2980	Ga0105245_10242021
2981	Ga0105245_10343362
2982	Ga0114129_10004345
2983	Ga0114129_10006933
2984	Ga0114129_10007976
2985	Ga0114129_10010074
2986	Ga0114129_10015802
2987	Ga0114129_10029076
2988	Ga0114129_10040592
2989	Ga0114129_10073185
2990	Ga0114129_10168240
2991	Ga0114129_10425993
2992	Ga0105243_10002088
2993	Ga0105243_10011004
2994	Ga0105243_10013502
2995	Ga0105243_10022158
2996	Ga0105243_10034587
2997	Ga0105243_10089698
2998	Ga0105243_10150493
2999	Ga0105243_10162935
3000	Ga0105243_10304070
3001	Ga0105241_10001147
3002	Ga0105241_10013082
3003	Ga0105241_10023453
3004	Ga0105242_10000633
3005	Ga0105242_10090738
3006	Ga0105242_10125393
3007	Ga0105248_10003122
3008	Ga0105248_10035748
3009	Ga0105248_10038151
3010	Ga0105248_10060021
3011	Ga0105248_10148531
3012	Ga0105248_10159029
3013	Ga0105248_10273812
3014	Ga0105248_10347888
3015	Ga0105248_10459502
3016	Ga0105237_10004886
3017	Ga0105237_10152282
3018	Ga0105237_10173614
3019	Ga0105237_10220466
3020	Ga0105238_10007610
3021	Ga0105238_10020792
3022	Ga0105238_10038849
3023	Ga0105238_10087449
3024	Ga0105238_10260444
3025	Ga0105249_10003785
3026	Ga0105249_10005505
3027	Ga0105249_10045236
3028	Ga0105249_10081151
3029	Ga0105249_10106002
3030	Ga0105249_10201672
3031	Ga0105249_10233879
3032	Ga0105249_10242708
3033	Ga0105249_10271190
3034	Ga0123341_1044012
3035	Ga0123341_1044321
3036	Ga0123342_1003939
3037	Ga0105239_10016888
3038	Ga0105239_10022702
3039	Ga0105239_10049097
3040	Ga0105239_10053557
3041	Ga0105239_10059788
3042	Ga0105239_10090586
3043	Ga0105239_10171775
3044	Ga0105239_10194675
3045	Ga0105239_10353836
3046	Ga0105246_10000018
3047	Ga0105246_10020609
3048	Ga0157373_10006275
3049	Ga0157373_10052769
3050	Ga0157373_10089421
3051	Ga0157371_10031563
3052	Ga0157370_10005248
3053	Ga0157370_10008445
3054	Ga0157370_10080715
3055	Ga0157370_10098507
3056	Ga0157370_10109542
3057	Ga0157369_10002895
3058	Ga0157369_10019292
3059	Ga0157369_10032739
3060	Ga0157374_10001801
3061	Ga0157374_10019084
3062	Ga0157374_10122468
3063	Ga0157374_10177495
3064	Ga0157374_10218496
3065	Ga0157378_10001922
3066	Ga0157378_10037347
3067	Ga0157378_10065285
3068	Ga0157378_10130800
3069	Ga0157378_10219848
3070	Ga0163162_10001106
3071	Ga0163162_10002702
3072	Ga0163162_10015991
3073	Ga0163162_10137899
3074	Ga0163162_10140509
3075	Ga0157372_10018149
3076	Ga0157372_10028757
3077	Ga0157372_10060311
3078	Ga0157372_10066923
3079	Ga0157372_10116308
3080	Ga0157372_10272519
3081	Ga0157375_10000982
3082	Ga0157375_10049850
3083	Ga0157375_10069157
3084	Ga0157375_10086372
3085	Ga0157375_10283168
3086	Ga0163163_10004817
3087	Ga0163163_10039332
3088	Ga0163163_10059805
3089	Ga0157380_10000203
3090	Ga0157380_10010872
3091	Ga0157380_10139732
3092	Ga0182008_10021754
3093	Ga0157377_10000086
3094	Ga0157377_10051052
3095	Ga0157377_10146472
3096	Ga0157379_10015572
3097	Ga0157379_10055959
3098	Ga0157379_10075244
3099	Ga0157379_10128410
3100	Ga0157376_10000104
3101	Ga0157376_10022178
3102	Ga0157376_10044711
3103	Ga0157376_10066769
3104	Ga0157376_10314107
3105	Ga0183362_10005
3106	Ga0163161_10000669
3107	Ga0163161_10000965
3108	Ga0163161_10003970
3109	Ga0163161_10107099
3110	Ga0163161_10142226
3111	Ga0206356_10177300
3112	Ga0206356_10240664
3113	Ga0206356_10244957
3114	Ga0206350_10440167
3115	Ga0206350_10540462
3116	Ga0206354_10822350
3117	Ga0206353_10954712
3118	Ga0214542_1019223
3119	Ga0214543_1002177
3120	Ga0213876_10007987
3121	Ga0224712_10018713
3122	Ga0228711_1002116
3123	Ga0228710_1011349
3124	Ga0209435_100002
3125	Ga0209436_103264
3126	Ga0209436_105687
3127	Ga0209436_109343
3128	Ga0209672_101560
3129	Ga0209147_101849
3130	Ga0209258_100015
3131	Ga0207425_1001050
3132	Ga0207425_1001136
3133	Ga0209646_1000001
3134	Ga0209026_1000040
3135	Ga0209148_1000183
3136	Ga0209759_1000001
3137	Ga0209129_1000049
3138	Ga0209565_1000026
3139	Ga0209565_1000357
3140	Ga0209565_1000381
3141	Ga0209565_1001334
3142	Ga0209565_1002907
3143	Ga0207666_1000008
3144	Ga0209673_1000009
3145	Ga0209673_1000012
3146	Ga0209673_1000849
3147	Ga0209673_1000949
3148	Ga0209673_1001805
3149	Ga0209673_1005062
3150	Ga0209673_1019462
3151	Ga0209673_1047189
3152	Ga0209130_1000017
3153	Ga0209130_1000123
3154	Ga0209130_1000516
3155	Ga0209130_1000591
3156	Ga0209130_1004444
3157	Ga0207673_1001932
3158	Ga0209675_1000352
3159	Ga0209675_1000360
3160	Ga0209675_1001409
3161	Ga0209675_1003382
3162	Ga0209675_1005646
3163	Ga0209676_1000051
3164	Ga0209676_1000137
3165	Ga0209676_1000873
3166	Ga0209676_1000876
3167	Ga0209676_1003390
3168	Ga0209676_1004131
3169	Ga0209025_1000145
3170	Ga0209025_1000161
3171	Ga0209025_1000265
3172	Ga0209025_1000290
3173	Ga0209025_1000594
3174	Ga0209025_1001396
3175	Ga0209025_1004020
3176	Ga0209025_1004882
3177	Ga0209025_1008607
3178	Ga0209025_1009995
3179	Ga0209025_1029096
3180	Ga0209564_1000013
3181	Ga0209564_1000211
3182	Ga0209564_1000228
3183	Ga0209564_1000303
3184	Ga0209564_1000932
3185	Ga0209564_1001504
3186	Ga0209758_1000135
3187	Ga0209758_1000251
3188	Ga0209758_1000628
3189	Ga0209758_1002358
3190	Ga0209758_1006011
3191	Ga0209758_1007019
3192	Ga0209758_1011107
3193	Ga0209758_1012024
3194	Ga0209758_1019126
3195	Ga0209758_1023130
3196	Ga0209758_1024601
3197	Ga0209758_1030742
3198	Ga0209050_1000015
3199	Ga0209050_1000044
3200	Ga0209050_1000759
3201	Ga0209050_1000808
3202	Ga0209050_1002190
3203	Ga0209050_1002533
3204	Ga0209050_1015356
3205	Ga0209050_1029943
3206	Ga0209256_1000003
3207	Ga0209256_1000129
3208	Ga0209256_1000196
3209	Ga0209256_1000224
3210	Ga0209256_1002058
3211	Ga0209256_1003058
3212	Ga0209256_1015037
3213	Ga0209256_1019150
3214	Ga0207426_1000006
3215	Ga0207426_1000062
3216	Ga0207426_1000171
3217	Ga0207426_1000185
3218	Ga0207426_1000287
3219	Ga0207426_1001827
3220	Ga0207426_1028033
3221	Ga0209051_1000010
3222	Ga0209051_1000031
3223	Ga0209051_1000210
3224	Ga0209051_1000315
3225	Ga0209051_1000773
3226	Ga0209051_1000859
3227	Ga0209051_1003896
3228	Ga0209051_1006359
3229	Ga0209051_1014927
3230	Ga0209051_1015137
3231	Ga0209257_1000026
3232	Ga0209257_1000058
3233	Ga0209257_1000061
3234	Ga0209257_1000309
3235	Ga0209257_1000314
3236	Ga0209257_1003778
3237	Ga0209257_1006709
3238	Ga0209257_1007911
3239	Ga0209257_1009716
3240	Ga0207697_10000890
3241	Ga0207697_10055827
3242	Ga0207656_10020045
3243	Ga0207656_10020569
3244	Ga0207655_1024412
3245	Ga0207713_1025539
3246	Ga0207682_10000002
3247	Ga0207682_10024245
3248	Ga0207692_10002009
3249	Ga0207692_10015104
3250	Ga0207692_10029761
3251	Ga0207642_10000045
3252	Ga0207642_10002555
3253	Ga0207642_10028824
3254	Ga0207710_10005065
3255	Ga0207710_10098337
3256	Ga0207710_10104361
3257	Ga0207688_10000111
3258	Ga0207688_10001353
3259	Ga0207688_10104720
3260	Ga0207680_10035071
3261	Ga0207680_10095235
3262	Ga0207647_10011642
3263	Ga0207685_10005783
3264	Ga0207685_10033962
3265	Ga0207699_10175077
3266	Ga0207645_10000026
3267	Ga0207645_10000424
3268	Ga0207645_10057015
3269	Ga0207645_10067046
3270	Ga0207645_10123071
3271	Ga0207645_10171377
3272	Ga0207643_10000090
3273	Ga0207643_10058384
3274	Ga0207643_10072993
3275	Ga0207705_10026021
3276	Ga0207705_10078974
3277	Ga0207684_10007960
3278	Ga0207684_10029535
3279	Ga0207684_10038233
3280	Ga0207684_10124766
3281	Ga0207654_10000296
3282	Ga0207654_10053262
3283	Ga0207707_10000652
3284	Ga0207707_10007118
3285	Ga0207707_10016505
3286	Ga0207707_10201112
3287	Ga0207695_10004829
3288	Ga0207695_10058919
3289	Ga0207695_10205985
3290	Ga0207671_10012628
3291	Ga0207671_10016074
3292	Ga0207671_10019749
3293	Ga0207671_10083807
3294	Ga0207671_10350518
3295	Ga0207693_10005410
3296	Ga0207693_10007613
3297	Ga0207693_10013053
3298	Ga0207693_10031687
3299	Ga0207693_10087937
3300	Ga0207663_10047748
3301	Ga0207663_10113105
3302	Ga0207663_10141902
3303	Ga0207660_10000070
3304	Ga0207660_10016263
3305	Ga0207660_10096372
3306	Ga0207660_10171587
3307	Ga0207662_10000617
3308	Ga0207662_10002827
3309	Ga0207662_10189125
3310	Ga0207662_10238422
3311	Ga0207657_10003460
3312	Ga0207657_10014122
3313	Ga0207657_10020697
3314	Ga0207657_10138724
3315	Ga0207649_10000878
3316	Ga0207649_10019621
3317	Ga0207649_10054369
3318	Ga0207649_10055966
3319	Ga0207649_10062557
3320	Ga0207649_10209718
3321	Ga0207652_10001231
3322	Ga0207652_10016979
3323	Ga0207652_10042076
3324	Ga0207652_10045678
3325	Ga0207652_10086240
3326	Ga0207646_10043966
3327	Ga0207646_10043993
3328	Ga0207646_10102915
3329	Ga0207646_10404167
3330	Ga0207681_10000118
3331	Ga0207681_10024137
3332	Ga0207681_10047751
3333	Ga0207681_10062788
3334	Ga0207694_10029705
3335	Ga0207694_10130337
3336	Ga0207694_10177273
3337	Ga0207694_10217846
3338	Ga0207694_10269016
3339	Ga0207650_10004695
3340	Ga0207650_10007168
3341	Ga0207650_10030086
3342	Ga0207650_10066293
3343	Ga0207650_10213151
3344	Ga0207659_10000015
3345	Ga0207659_10119142
3346	Ga0207687_10000050
3347	Ga0207687_10014107
3348	Ga0207687_10040389
3349	Ga0207687_10062205
3350	Ga0207700_10023671
3351	Ga0207700_10026515
3352	Ga0207700_10037196
3353	Ga0207700_10145527
3354	Ga0207664_10010958
3355	Ga0207644_10006370
3356	Ga0207644_10008956
3357	Ga0207644_10052180
3358	Ga0207644_10058422
3359	Ga0207644_10064573
3360	Ga0207644_10076308
3361	Ga0207690_10000376
3362	Ga0207690_10000397
3363	Ga0207690_10048738
3364	Ga0207690_10056827
3365	Ga0207690_10076961
3366	Ga0207706_10002825
3367	Ga0207706_10005486
3368	Ga0207706_10005547
3369	Ga0207706_10007138
3370	Ga0207706_10013655
3371	Ga0207706_10017959
3372	Ga0207706_10020936
3373	Ga0207706_10024748
3374	Ga0207706_10182609
3375	Ga0207686_10000065
3376	Ga0207686_10018935
3377	Ga0207686_10039996
3378	Ga0207686_10071240
3379	Ga0207686_10076178
3380	Ga0207686_10089277
3381	Ga0207709_10000081
3382	Ga0207709_10000497
3383	Ga0207709_10027340
3384	Ga0207709_10060442
3385	Ga0207709_10082191
3386	Ga0207709_10111379
3387	Ga0207670_10000056
3388	Ga0207670_10022223
3389	Ga0207670_10097879
3390	Ga0207669_10000008
3391	Ga0207669_10023634
3392	Ga0207669_10107339
3393	Ga0207669_10237742
3394	Ga0207704_10000031
3395	Ga0207704_10018292
3396	Ga0207704_10020629
3397	Ga0207704_10042458
3398	Ga0207665_10000754
3399	Ga0207665_10061394
3400	Ga0207691_10000251
3401	Ga0207691_10004694
3402	Ga0207691_10009304
3403	Ga0207691_10010272
3404	Ga0207691_10017248
3405	Ga0207691_10040561
3406	Ga0207691_10048066
3407	Ga0207691_10072710
3408	Ga0207691_10076896
3409	Ga0207711_10019660
3410	Ga0207711_10022586
3411	Ga0207711_10029432
3412	Ga0207711_10038183
3413	Ga0207711_10043634
3414	Ga0207711_10055487
3415	Ga0207711_10106488
3416	Ga0207689_10000772
3417	Ga0207689_10001746
3418	Ga0207689_10011753
3419	Ga0207689_10030864
3420	Ga0207689_10049853
3421	Ga0207689_10123647
3422	Ga0207689_10223828
3423	Ga0207661_10000141
3424	Ga0207661_10045959
3425	Ga0207661_10377071
3426	Ga0207679_10000014
3427	Ga0207679_10003520
3428	Ga0207679_10013102
3429	Ga0207679_10019948
3430	Ga0207679_10070067
3431	Ga0207667_10026871
3432	Ga0207667_10067088
3433	Ga0207667_10072411
3434	Ga0207667_10100006
3435	Ga0207667_10126665
3436	Ga0207667_10267396
3437	Ga0207651_10000050
3438	Ga0207651_10016021
3439	Ga0207651_10021642
3440	Ga0207651_10112315
3441	Ga0207651_10180413
3442	Ga0207651_10287615
3443	Ga0207712_10001039
3444	Ga0207712_10020077
3445	Ga0207712_10024551
3446	Ga0207712_10052313
3447	Ga0207712_10145494
3448	Ga0207712_10211974
3449	Ga0207712_10287575
3450	Ga0207668_10000037
3451	Ga0207668_10056320
3452	Ga0207668_10084151
3453	Ga0207640_10142873
3454	Ga0207658_10069901
3455	Ga0207658_10268431
3456	Ga0207677_10004289
3457	Ga0207677_10068555
3458	Ga0207677_10107791
3459	Ga0207677_10171545
3460	Ga0207677_10234189
3461	Ga0207703_10006017
3462	Ga0207703_10020229
3463	Ga0207703_10033836
3464	Ga0207703_10109178
3465	Ga0207639_10002048
3466	Ga0207639_10009583
3467	Ga0207639_10027207
3468	Ga0207639_10067336
3469	Ga0207678_10000372
3470	Ga0207678_10003222
3471	Ga0207678_10013665
3472	Ga0207678_10020674
3473	Ga0207678_10022238
3474	Ga0207678_10022408
3475	Ga0207678_10025928
3476	Ga0207678_10119540
3477	Ga0207708_10001602
3478	Ga0207708_10020468
3479	Ga0207708_10041992
3480	Ga0207708_10057963
3481	Ga0207708_10062641
3482	Ga0207708_10076429
3483	Ga0207708_10243120
3484	Ga0207702_10003438
3485	Ga0207702_10009328
3486	Ga0207702_10120449
3487	Ga0207702_10364105
3488	Ga0207641_10011951
3489	Ga0207641_10028618
3490	Ga0207641_10032736
3491	Ga0207641_10067225
3492	Ga0207641_10115687
3493	Ga0207648_10011868
3494	Ga0207648_10011919
3495	Ga0207648_10012962
3496	Ga0207648_10015627
3497	Ga0207648_10020579
3498	Ga0207648_10029742
3499	Ga0207648_10167324
3500	Ga0207648_10222131
3501	Ga0207648_10239658
3502	Ga0207676_10000208
3503	Ga0207676_10049781
3504	Ga0207676_10059381
3505	Ga0207676_10062512
3506	Ga0207676_10103998
3507	Ga0207676_10211793
3508	Ga0207674_10001378
3509	Ga0207674_10033605
3510	Ga0207674_10040828
3511	Ga0207674_10067898
3512	Ga0207674_10089266
3513	Ga0207674_10099341
3514	Ga0207674_10156505
3515	Ga0207674_10161172
3516	Ga0207674_10185454
3517	Ga0207674_10340251
3518	Ga0207675_100001259
3519	Ga0207675_100002877
3520	Ga0207675_100005267
3521	Ga0207675_100010274
3522	Ga0207675_100044658
3523	Ga0207675_100187188
3524	Ga0207675_100208834
3525	Ga0207675_100243561
3526	Ga0207675_100479872
3527	Ga0207683_10000002
3528	Ga0207683_10001072
3529	Ga0207683_10031065
3530	Ga0207683_10035533
3531	Ga0207683_10057997
3532	Ga0207683_10181510
3533	Ga0207698_10001276
3534	Ga0207698_10013213
3535	Ga0207698_10063833
3536	Ga0207698_10269635
3537	Ga0207698_10296424
3538	Ga0207698_10299030
3539	Ga0209281_1000106
3540	Ga0209281_1001460
3541	Ga0209995_1010725
3542	Ga0209968_1001655
3543	Ga0209999_1003335
3544	Ga0209970_1001986
3545	Ga0209282_1000079
3546	Ga0209282_1000083
3547	Ga0209282_1003410
3548	Ga0209588_1010497
3549	Ga0209966_1000161
3550	Ga0209966_1007068
3551	Ga0209966_1012547
3552	Ga0209813_10000840
3553	Ga0209813_10000917
3554	Ga0209813_10003325
3555	Ga0209813_10004362
3556	Ga0209813_10022424
3557	Ga0209974_10004251
3558	Ga0209974_10013987
3559	Ga0209974_10016310
3560	Ga0207428_10000011
3561	Ga0207428_10000046
3562	Ga0207428_10000086
3563	Ga0207428_10002304
3564	Ga0207428_10019733
3565	Ga0207428_10023698
3566	Ga0268266_10000680
3567	Ga0268266_10010351
3568	Ga0268266_10049533
3569	Ga0268266_10106237
3570	Ga0268266_10144060
3571	Ga0268265_10000117
3572	Ga0268265_10007379
3573	Ga0268265_10020308
3574	Ga0268265_10134565
3575	Ga0268264_10000487
3576	Ga0268264_10066850
3577	Ga0268264_10126627
3578	Ga0268264_10141710
3579	Ga0307517_10032116
3580	Ga0307517_10109150
3581	Ga0307515_10000037
3582	Ga0307515_10000063
3583	Ga0307515_10008845
3584	Ga0307515_10014764
3585	Ga0307515_10126241
3586	Ga0307515_10144544
3587	Ga0307511_10000948
3588	Ga0307512_10038502
3589	Ga0316176_1003191
3590	Ga0316183_1032406
3591	Ga0265325_10000062
3592	Ga0265325_10002896
3593	Ga0265331_10011168
3594	Ga0265327_10056366
3595	Ga0307513_10000034
3596	Ga0307513_10000057
3597	Ga0307513_10015642
3598	Ga0307513_10035153
3599	Ga0307513_10161609
3600	Ga0307513_10167808
3601	Ga0307513_10180045
3602	Ga0307509_10022123
3603	Ga0307408_100000012
3604	Ga0307408_100010920
3605	Ga0307408_100022312
3606	Ga0307408_100029389
3607	Ga0307408_100039495
3608	Ga0307408_100061305
3609	Ga0307408_100195886
3610	Ga0307408_100219383
3611	Ga0265313_10018744
3612	Ga0307508_10034808
3613	Ga0307508_10060820
3614	Ga0307508_10246864
3615	Ga0307514_10085974
3616	Ga0265314_10016720
3617	Ga0265314_10041382
3618	Ga0307516_10000348
3619	Ga0307516_10027202
3620	Ga0307516_10048432
3621	Ga0307405_10026417
3622	Ga0307405_10034312
3623	Ga0307405_10050617
3624	Ga0307405_10060885
3625	Ga0307405_10065929
3626	Ga0307405_10157952
3627	Ga0307405_10163279
3628	Ga0307413_10001553
3629	Ga0307413_10005510
3630	Ga0307413_10067716
3631	Ga0307410_10001543
3632	Ga0307410_10011679
3633	Ga0307410_10014263
3634	Ga0307410_10065105
3635	Ga0307410_10127835
3636	Ga0307410_10160543
3637	Ga0307406_10000470
3638	Ga0307406_10024497
3639	Ga0307406_10086265
3640	Ga0307406_10219098
3641	Ga0307407_10063127
3642	Ga0307407_10070502
3643	Ga0307412_10009817
3644	Ga0307412_10018472
3645	Ga0307412_10033765
3646	Ga0307412_10106054
3647	Ga0315914_1002550
3648	Ga0307409_100042166
3649	Ga0307409_100217107
3650	Ga0307409_100221319
3651	Ga0307409_100232798
3652	Ga0307416_100004367
3653	Ga0307416_100009068
3654	Ga0307416_100026059
3655	Ga0307416_100075869
3656	Ga0307416_100164586
3657	Ga0307414_10014676
3658	Ga0307414_10075338
3659	Ga0307414_10124759
3660	Ga0307411_10000194
3661	Ga0307411_10009447
3662	Ga0307411_10070935
3663	Ga0307411_10089700
3664	Ga0307411_10115475
3665	Ga0307411_10163573
3666	Ga0307411_10254298
3667	Ga0307411_10355342
3668	Ga0307415_100002695
3669	Ga0315913_1001274
3670	Ga0315911_1000017
3671	Ga0315915_1000010
3672	Ga0373948_0003190
3673	Ga0373958_0000994
3674	Ga0373938_0001117
3675	Ga0373938_0017517
3676	Ga0373938_0022912
3677	Ga0373926_0047805
3678	Ga0373928_0006017
3679	Ga0373929_0000488
3680	Ga0373929_0000817
3681	Ga0373934_0001121
3682	Ga0373940_0002973
3683	Ga0373940_0004661
3684	Ga0373949_0003973
3685	Ga0373949_0007963
3686	Ga0373952_0000990
3687	Ga0373952_0002043
3688	Ga0373932_0001709
3689	Ga0373932_0045162
3690	Ga0373936_0007978
3691	Ga0373936_0040844
3692	Ga0373936_0042383
3693	Ga0373939_0000201
3694	Ga0373939_0003356
3695	Ga0373939_0019497
3696	Ga0373941_0000068
3697	Ga0373945_0000837
3698	Ga0373945_0008523
3699	Ga0373953_0002697
3700	Ga0373954_0002099
3701	Ga0373956_0000103
3702	Ga0373956_0102839
3703	Ga0373956_0122683
3704	Ga0373957_0004484
3705	Ga0373960_0002401
3706	Ga0373960_0003160
3707	Ga0373943_0009484
3708	Ga0373943_0010821
3709	Ga0373946_0001105
3710	Ga0373946_0024472
3711	Ga0373946_0083170
3712	Ga0373955_0000069
3713	Ga0373955_0043909
3714	Ga0373955_0087135
3715	Ga0373942_0005648
3716	Ga0373961_0002126
3717	Ga0373961_0025346
3718	Ga0373961_0036339
3719	Ga0373962_0003388
3720	Ga0373962_0003450
3721	Ga0373924_0002976
3722	Ga0373924_0013146
3723	Ga0373924_0080017
3724	Ga0373931_0000087
3725	Ga0373931_0000420
3726	Ga0373931_0005344
3727	Ga0373931_0006310
3728	Ga0373931_0023566
3729	Ga0373931_0024412
3730	Ga0373931_0028923
3731	Ga0373935_0000207
3732	Ga0373935_0004572
3733	Ga0373935_0013074
3734	Ga0373927_0007170
3735	Ga0373927_0010594
3736	Ga0373927_0012327
3737	Ga0373927_0042423
3738	Ga0373927_0138618
3739	Ga0373933_0000811
3740	Ga0373933_0004263
3741	Ga0373933_0024103
3742	Ga0373947_0001477
3743	Ga0373947_0001528
3744	Ga0373947_0037930
3745	Ga0373947_0044165
3746	Ga0373947_0110374
3747	Ga0373947_0162562
3748	Ga0373937_0000356
3749	Ga0373937_0000769
3750	Ga0373937_0000851
3751	Ga0373937_0007794
3752	Ga0373925_0000462
3753	Ga0373925_0003246
3754	Ga0373925_0037746
3755	Ga0373925_0048439
3756	Ga0373925_0056320
3757	Ga0373925_0078103
3758	Ga0373925_0157582
3759	Ga0395899_0007150
3760	Ga0395899_0035604
3761	Ga0395899_0117247
3762	Ga0395900_0037306
3763	Ga0395900_0045463
3764	Ga0395900_0049257
3765	Ga0395900_0069461
3766	Ga0395900_0113092
3767	Ga0395898_0018064
3768	Ga0395898_0455991
3769	Ga0395905_0001722
3770	Ga0395905_0011762
3771	Ga0395905_0014931
3772	Ga0395905_0042449
3773	Ga0395905_0082330
3774	Ga0395905_0144236
3775	Ga0395905_0168201
3776	Ga0395905_0260658
3777	Ga0395901_0001587
3778	Ga0395901_0062732
3779	Ga0395901_0203120
3780	Ga0436365_0343162
3781	Ga0436365_0456736
3782	Ga0436360_0589228
3783	Ga0436361_0322567
3784	Ga0439436_0005041
3785	Ga0439436_0008663
3786	Ga0439439_0018172
3787	Ga0439447_029184
3788	Ga0439465_0033292
3789	Ga0451798_0799171
3790	Ga0451807_1188546
3791	Ga0439433_0000342
3792	Ga0439445_0003125
3793	Ga0439448_0041661
3794	Ga0439432_002015
3795	Ga0439432_010840
3796	Ga0439449_0001924
3797	Ga0439449_0003191
3798	Ga0439449_0011882
3799	Ga0439449_0015373
3800	Ga0439449_0084175
3801	Ga0439462_0015973
3802	Ga0450920_004067
3803	Ga0450888_000048
3804	Ga0439446_0009626
3805	Ga0439446_0043399
3806	Ga0450908_012384
3807	Ga0439434_0008623
3808	Ga0439460_0000593
3809	Ga0439460_0001834
3810	Ga0450918_000497
3811	Ga0450918_000967
3812	Ga0450893_0008367
3813	Ga0451577_0008635
3814	Ga0451577_0097156
3815	Ga0451577_0097400
3816	Ga0453683_0020949
3817	Ga0453683_0032126
3818	Ga0453683_0228832
3819	Ga0466966_0005805
3820	Ga0466961_0104447
3821	Ga0453684_0000149
3822	Ga0453684_0031305
3823	Ga0453684_0037551
3824	Ga0453684_0040132
3825	Ga0453684_0042288
3826	Ga0453684_0088742
3827	Ga0466957_0048780
3828	Ga0466957_0114954
3829	Ga0466960_0051464
3830	Ga0451576_0005540
3831	Ga0451576_0035603
3832	Ga0451576_0037268
3833	Ga0451576_0046429
3834	Ga0451576_0077193
3835	Ga0451576_0078061
3836	Ga0451576_0083293
3837	Ga0451576_0092888
3838	Ga0451576_0093696
3839	Ga0451576_0276002
3840	Ga0451576_0292265
3841	Ga0451576_0368824
3842	Ga0466967_0117511
3843	Ga0495592_0000090
3844	Ga0495592_0008229
3845	Ga0495592_0012103
3846	Ga0495592_0029878
3847	Ga0495603_0005690
3848	Ga0495603_0043842
3849	Ga0495603_0179670
3850	Ga0495629_0000647
3851	Ga0495629_0023957
3852	Ga0495638_0004071
3853	Ga0495638_0106996
3854	Ga0495638_0186449
3855	Ga0495641_0089527
3856	Ga0495651_0000396
3857	Ga0495651_0006045
3858	Ga0495651_0006702
3859	Ga0495651_0021038
3860	Ga0495651_0161586
3861	Ga0495653_0000322
3862	Ga0495653_0001963
3863	Ga0495653_0014063
3864	Ga0495650_0028994
3865	Ga0495580_0010265
3866	Ga0495582_0004928
3867	Ga0495582_0016535
3868	Ga0495582_0028848
3869	Ga0495605_0000921
3870	Ga0495605_0005211
3871	Ga0495639_0005801
3872	Ga0495639_0097763
3873	Ga0495662_0030466
3874	Ga0495664_0000078
3875	Ga0495664_0001341
3876	Ga0495664_0089296
3877	Ga0495584_0023604
3878	Ga0495584_0095846
3879	Ga0495585_0006064
3880	Ga0495585_0069677
3881	Ga0495594_0189215
3882	Ga0495596_0004018
3883	Ga0495606_0006516
3884	Ga0495608_0000022
3885	Ga0495608_0002747
3886	Ga0495608_0005187
3887	Ga0495608_0009334
3888	Ga0495610_0018212
3889	Ga0495616_0012162
3890	Ga0495618_0000229
3891	Ga0495618_0003608
3892	Ga0495618_0011226
3893	Ga0495618_0094597
3894	Ga0495620_0015107
3895	Ga0495628_0000035
3896	Ga0495628_0001730
3897	Ga0495628_0009232
3898	Ga0495628_0011197
3899	Ga0495630_0000377
3900	Ga0495630_0009987
3901	Ga0495630_0093935
3902	Ga0495631_0001426
3903	Ga0495631_0073903
3904	Ga0495632_0032363
3905	Ga0495632_0070464
3906	Ga0495637_0009670
3907	Ga0495644_0019727
3908	Ga0495648_0032397
3909	Ga0495652_0000062
3910	Ga0495652_0000531
3911	Ga0495652_0042822
3912	Ga0495652_0065079
3913	Ga0495652_0279099
3914	Ga0495640_0000021
3915	Ga0495640_0011454
3916	Ga0495640_0017619
3917	Ga0495640_0135834
3918	Ga0495640_0169236
3919	Ga0495586_0018062
3920	Ga0495586_0044089
3921	Ga0495587_0000006
3922	Ga0495587_0002101
3923	Ga0495587_0018740
3924	Ga0495587_0026126
3925	Ga0495621_0016257
3926	Ga0495645_0000174
3927	Ga0495645_0116993
3928	Ga0495622_0015375
3929	Ga0495633_0022949
3930	Ga0495667_0000161
3931	Ga0495667_0006127
3932	Ga0495667_0032280
3933	Ga0495656_0000081
3934	Ga0495634_0000350
3935	Ga0495634_0044931
3936	Ga0495634_0139002
3937	Ga0495625_0000360
3938	Ga0495625_0013968
3939	Ga0495625_0018806
3940	Ga0495625_0067601
3941	Ga0495625_0168987
3942	Ga0495635_0000018
3943	Ga0495635_0005870
3944	Ga0495635_0077848
3945	Ga0495635_0077944
3946	Ga0495635_0147384
3947	Ga0495635_0160052
3948	Ga0495659_0104376
3949	Ga0495661_0010743
3950	Ga0495588_0043534
3951	Ga0495588_0096889
3952	Ga0495657_0000245
3953	Ga0495657_0002136
3954	Ga0495657_0158529
3955	Ga0495599_0000032
3956	Ga0495623_0000187
3957	Ga0495623_0023797
3958	Ga0495623_0042023
3959	Ga0495646_0000083
3960	Ga0495646_0005710
3961	Ga0495646_0006023
3962	Ga0495647_0001554
3963	Ga0495647_0128540
3964	Ga0495658_0000662
3965	Ga0495613_0001496
3966	Ga0495624_0002043
3967	Ga0495624_0016187
3968	Ga0495624_0064050
3969	Ga0495670_0003330
3970	Ga0495670_0065368
3971	Ga0495671_0028319
3972	Ga0495649_0001025
3973	Ga0495649_0020198
3974	Ga0495589_0000657
3975	Ga0495600_0000022
3976	Ga0495600_0002951
3977	Ga0495600_0039898
3978	Ga0495600_0042697
3979	Ga0495600_0089550
3980	Ga0495660_0026400
3981	Ga0495660_0062563
3982	Ga0495581_0000379
3983	Ga0495581_0024187
3984	Ga0495581_0172724
3985	Ga0495604_0000011
3986	Ga0495604_0004162
3987	Ga0495604_0006220
3988	Ga0495604_0111341
3989	Ga0495636_0126423
3990	Ga0495674_0000034
3991	Ga0495674_0027370
3992	Ga0495674_0093695
3993	Ga0495674_0187346
3994	Ga0495674_0221290
3995	Ga0495676_0067535
3996	Ga0495676_0124879
3997	Ga0495676_0148382
3998	Ga0495676_0201801
3999	Ga0495680_0000290
4000	Ga0495680_0017671
4001	Ga0495680_0018237
4002	Ga0495680_0029343
4003	Ga0495680_0168113
4004	Ga0495687_000606
4005	Ga0495675_0001346
4006	Ga0495675_0003486
4007	Ga0495673_0060413
4008	Ga0495684_0000012
4009	Ga0495684_0004611
4010	Ga0495684_0083924
4011	Ga0495684_0196863
4012	Ga0495686_0048570
4013	Ga0495593_0002038
4014	Ga0495602_0000064
4015	Ga0495602_0001681
4016	Ga0495602_0032952
4017	Ga0496100_0000163
4018	Ga0496100_0013150
4019	Ga0496100_0013742
4020	Ga0496100_0038933
4021	Ga0496100_0053558
4022	Ga0496100_0095112
4023	Ga0496101_0000061
4024	Ga0496101_0007751
4025	Ga0496101_0020557
4026	Ga0496101_0022407
4027	Ga0496101_0033804
4028	Ga0496101_0040699
4029	Ga0496101_0056101
4030	Ga0496101_0082947
4031	Ga0496101_0260756
4032	Ga0496102_0001355
4033	Ga0496102_0002271
4034	Ga0496102_0006207
4035	Ga0496102_0063917
4036	Ga0496102_0082507
4037	Ga0496102_0116050
4038	Ga0496102_0250604
4039	Ga0496102_0286405
4040	Ga0496102_0388257
4041	Ga0496103_0009043
4042	Ga0496103_0017655
4043	Ga0496103_0049621
4044	Ga0496104_0000175
4045	Ga0496104_0000273
4046	Ga0496104_0012436
4047	Ga0496104_0015322
4048	Ga0496104_0037698
4049	Ga0496104_0044519
4050	Ga0496104_0399323
4051	Ga0496104_0405892
4052	Ga0496105_0001208
4053	Ga0496105_0003826
4054	Ga0496105_0009918
4055	Ga0496106_0000011
4056	Ga0496106_0001754
4057	Ga0496106_0003095
4058	Ga0496106_0005133
4059	Ga0496106_0013062
4060	Ga0496106_0361974
4061	Ga0496107_0002571
4062	Ga0496107_0014163
4063	Ga0496107_0039546
4064	Ga0496107_0082869
4065	Ga0496107_0119623
4066	Ga0496108_0001839
4067	Ga0496108_0003952
4068	Ga0496108_0012086
4069	Ga0496108_0012969
4070	Ga0496108_0036879
4071	Ga0496108_0141336
4072	Ga0496109_0002227
4073	Ga0496109_0004749
4074	Ga0496109_0007062
4075	Ga0496109_0023874
4076	Ga0496109_0052272
4077	Ga0496109_0071170
4078	Ga0496109_0088757
4079	Ga0496110_0002188
4080	Ga0496110_0007879
4081	Ga0496110_0014213
4082	Ga0496110_0015136
4083	Ga0496110_0019160
4084	Ga0496110_0045747
4085	Ga0496110_0071473
4086	Ga0496110_0096482
4087	Ga0496111_0007525
4088	Ga0496111_0062432
4089	Ga0496112_0003174
4090	Ga0496112_0012256
4091	Ga0496112_0015999
4092	Ga0496112_0019169
4093	Ga0496112_0021208
4094	Ga0496112_0022900
4095	Ga0496112_0031932
4096	Ga0496112_0109376
4097	Ga0496112_0265490
4098	Ga0496112_0280471
4099	Ga0496112_0315803
4100	Ga0496112_0544047
4101	Ga0496113_0000771
4102	Ga0496113_0003775
4103	Ga0496113_0010705
4104	Ga0496113_0014566
4105	Ga0496113_0021610
4106	Ga0496113_0140900
4107	Ga0496113_0222538
4108	Ga0496113_0293876
4109	Ga0496114_0005677
4110	Ga0496114_0033852
4111	Ga0496114_0036515
4112	Ga0496114_0055790
4113	Ga0496114_0062303
4114	Ga0496114_0186990
4115	Ga0496114_0302427
4116	Ga0496115_0011186
4117	Ga0496115_0061762
4118	Ga0496115_0101247
4119	Ga0496115_0198911
4120	Ga0496116_0060313
4121	Ga0496117_0031161
4122	Ga0496118_0011641
4123	Ga0496121_0008623
4124	Ga0496121_0014332
4125	Ga0496121_0027952
4126	Ga0496121_0035137
4127	Ga0496121_0061603
4128	Ga0496122_0000272
4129	Ga0496122_0032501
4130	Ga0496123_0000221
4131	Ga0496123_0030069
4132	Ga0496125_0002271
4133	Ga0496126_0032152
4134	Ga0496126_0092913
4135	Ga0496126_0150213
4136	Ga0501292_002976
4137	Ga0501298_007043
4138	Ga0501300_001664
4139	Ga0501032_0004572
4140	Ga0501032_0236194
4141	Ga0501033_0006569
4142	Ga0501034_0017969
4143	Ga0501034_0026548
4144	Ga0501036_0029222
4145	Ga0501037_0003090
4146	Ga0501037_0078133
4147	Ga0501038_0016392
4148	Ga0501038_0030962
4149	Ga0501039_0047814
4150	Ga0501039_0081146
4151	Ga0501039_0091199
4152	Ga0501040_0022955
4153	Ga0501041_0079360
4154	Ga0501042_0069221
4155	Ga0501042_0174893
4156	Ga0501043_0007577
4157	Ga0501043_0123840
4158	Ga0501046_0000444
4159	Ga0501046_0005718
4160	Ga0501047_0054266
4161	Ga0501047_0077249
4162	Ga0501048_0007480
4163	Ga0501048_0008016
4164	Ga0501048_0140503
4165	Ga0501048_0150890
4166	Ga0501067_0007083
4167	Ga0501068_0068276
4168	Ga0501069_0003111
4169	Ga0501069_0080199
4170	Ga0501069_0113257
4171	Ga0501069_0180817
4172	Ga0501070_0015490
4173	Ga0501070_0254980
4174	Ga0501071_0053577
4175	Ga0501072_0003591
4176	Ga0501072_0020474
4177	Ga0501072_0039043
4178	Ga0501072_0043413
4179	Ga0501073_0016783
4180	Ga0501073_0068939
4181	Ga0501074_0011091
4182	Ga0501074_0082740
4183	Ga0501075_0019209
4184	Ga0501075_0028995
4185	Ga0501075_0187785
4186	Ga0501076_0000640
4187	Ga0501076_0010629
4188	Ga0501076_0080795
4189	Ga0501076_0322642
4190	Ga0501077_0037476
4191	Ga0501077_0115469
4192	Ga0501198_000009
4193	Ga0501211_000033
4194	Ga0501222_000001
4195	Ga0501249_007146
4196	Ga0501079_0000465
4197	Ga0501079_0065191
4198	Ga0501079_0103157
4199	Ga0501080_0036125
4200	Ga0501080_0069002
4201	Ga0501080_0084547
4202	Ga0501081_0048753
4203	Ga0501081_0109962
4204	Ga0501083_0013082
4205	Ga0501083_0093578
4206	Ga0501083_0106548
4207	Ga0501083_0277787
4208	Ga0501263_002099
4209	Ga0501035_0004152
4210	Ga0501035_0056783
4211	Ga0501035_0152098
4212	Ga0501044_0000255
4213	Ga0501044_0011542
4214	Ga0501044_0062587
4215	Ga0501045_0001483
4216	Ga0501045_0010568
4217	Ga0501045_0033645
4218	Ga0501045_0057999
4219	nmdc:mga03683_10789_c1
4220	nmdc:mga03683_25935_c1
4221	nmdc:mga03683_28736_c1
4222	nmdc:mga03683_4627_c1
4223	nmdc:mga03683_8562_c1
4224	nmdc:mga03n38_13550_c1
4225	nmdc:mga03n38_14599_c1
4226	nmdc:mga03n38_20365_c1
4227	nmdc:mga03n38_6805_c1
4228	nmdc:mga00v17_15205_c1
4229	nmdc:mga00v17_243813_c1
4230	nmdc:mga00v17_32970_c1
4231	nmdc:mga00v17_51800_c1
4232	nmdc:mga00v17_57554_c1
4233	nmdc:mga0yw44_1051_c1
4234	nmdc:mga0yw44_1412_c1
4235	nmdc:mga0yw44_157252_c1
4236	nmdc:mga0yw44_18076_c1
4237	nmdc:mga0yw44_26584_c1
4238	nmdc:mga0yw44_5088_c1
4239	nmdc:mga0yw44_5236_c1
4240	nmdc:mga0k408_11822_c1
4241	nmdc:mga0k408_122533_c1
4242	nmdc:mga0k408_13899_c1
4243	nmdc:mga0k408_1947_c1
4244	nmdc:mga0k408_1980_c1
4245	nmdc:mga0k408_30243_c1
4246	nmdc:mga0k408_31602_c1
4247	nmdc:mga0k408_33337_c1
4248	nmdc:mga0k408_3583_c1
4249	nmdc:mga0k408_43361_c1
4250	nmdc:mga0k408_44410_c1
4251	nmdc:mga0k408_4910_c1
4252	nmdc:mga0k408_69687_c1
4253	nmdc:mga0k408_7242_c1
4254	nmdc:mga0k408_73206_c1
4255	nmdc:mga06z11_16684_c1
4256	nmdc:mga06z11_23962_c1
4257	nmdc:mga06z11_37292_c1
4258	nmdc:mga06z11_4933_c1
4259	nmdc:mga06z11_6926_c1
4260	nmdc:mga06z11_6994_c1
4261	nmdc:mga06z11_9113_c1
4262	nmdc:mga04h51_1465_c1
4263	nmdc:mga04h51_14979_c1
4264	nmdc:mga04h51_26464_c1
4265	nmdc:mga04h51_3661_c1
4266	nmdc:mga07m45_11907_c1
4267	nmdc:mga07m45_119679_c1
4268	nmdc:mga07m45_12303_c1
4269	nmdc:mga07m45_12891_c1
4270	nmdc:mga07m45_13948_c1
4271	nmdc:mga07m45_16968_c1
4272	nmdc:mga07m45_17750_c1
4273	nmdc:mga07m45_30392_c1
4274	nmdc:mga07m45_33000_c1
4275	nmdc:mga07m45_351_c1
4276	nmdc:mga07m45_36205_c1
4277	nmdc:mga07m45_41876_c1
4278	nmdc:mga07m45_4454_c2
4279	nmdc:mga07m45_65461_c1
4280	nmdc:mga07m45_995_c1
4281	nmdc:mga05p37_113004_c1
4282	nmdc:mga05p37_12404_c1
4283	nmdc:mga05p37_1381_c1
4284	nmdc:mga05p37_15097_c1
4285	nmdc:mga05p37_172_c1
4286	nmdc:mga05p37_194512_c1
4287	nmdc:mga05p37_2156_c1
4288	nmdc:mga05p37_33797_c1
4289	nmdc:mga05p37_38769_c1
4290	nmdc:mga05p37_38783_c1
4291	nmdc:mga05p37_46598_c1
4292	nmdc:mga05p37_4947_c1
4293	nmdc:mga05p37_67583_c1
4294	nmdc:mga09592_12845_c1
4295	nmdc:mga09592_15239_c1
4296	nmdc:mga09592_191_c1
4297	nmdc:mga09592_52391_c1
4298	nmdc:mga09592_87401_c1
4299	nmdc:mga0qj67_154229_c1
4300	nmdc:mga0qj67_202632_c1
4301	nmdc:mga0qj67_52_c1
4302	nmdc:mga0qj67_98_c1
4303	nmdc:mga06r32_11414_c1
4304	nmdc:mga06r32_13686_c1
4305	nmdc:mga06r32_15127_c1
4306	nmdc:mga06r32_22072_c1
4307	nmdc:mga06r32_2221_c1
4308	nmdc:mga06r32_27161_c1
4309	nmdc:mga06r32_296515_c1
4310	nmdc:mga06r32_50437_c1
4311	nmdc:mga06r32_57440_c1
4312	nmdc:mga06r32_8195_c1
4313	nmdc:mga06r32_9529_c1
4314	nmdc:mga08y16_11150_c1
4315	nmdc:mga08y16_188796_c1
4316	nmdc:mga08y16_2766_c1
4317	nmdc:mga08y16_62568_c1
4318	nmdc:mga08y16_64094_c1
4319	nmdc:mga08y16_81780_c1
4320	nmdc:mga08y16_90511_c1
4321	nmdc:mga08y16_98_c1
4322	nmdc:mga0n895_10615_c1
4323	nmdc:mga0n895_109242_c1
4324	nmdc:mga0n895_140484_c1
4325	nmdc:mga0n895_157040_c1
4326	nmdc:mga0n895_17917_c1
4327	nmdc:mga0n895_179203_c1
4328	nmdc:mga0n895_187069_c1
4329	nmdc:mga0n895_430666_c1
4330	nmdc:mga0n895_43172_c1
4331	nmdc:mga0n895_47074_c1
4332	nmdc:mga0n895_54355_c1
4333	nmdc:mga0n895_65473_c1
4334	nmdc:mga0n895_725_c1
4335	nmdc:mga0n895_7684_c1
4336	nmdc:mga0rr50_119551_c1
4337	nmdc:mga0rr50_131810_c1
4338	nmdc:mga0rr50_62528_c1
4339	nmdc:mga0rr50_88890_c1
4340	nmdc:mga08x19_15913_c1
4341	nmdc:mga08x19_332156_c1
4342	nmdc:mga08x19_3776_c1
4343	nmdc:mga08x19_60275_c1
4344	nmdc:mga0a205_100217_c1
4345	nmdc:mga0a205_141225_c1
4346	nmdc:mga0a205_165624_c1
4347	nmdc:mga0a205_20332_c1
4348	nmdc:mga0a205_245906_c1
4349	nmdc:mga0a205_284400_c1
4350	nmdc:mga0a205_34714_c1
4351	nmdc:mga0a205_4714_c1
4352	nmdc:mga0a205_4821_c1
4353	nmdc:mga0a205_48710_c1
4354	nmdc:mga0a205_66093_c1
4355	nmdc:mga0a205_91_c1
4356	nmdc:mga0sz30_32796_c1
4357	nmdc:mga0sz30_45827_c1
4358	nmdc:mga0sz30_57808_c1
4359	nmdc:mga0sz30_57845_c1
4360	nmdc:mga0sz30_9076_c1
4361	Ga0495601_0000015
4362	Ga0495601_0000081
4363	Ga0495601_0000729
4364	Ga0495601_0004409
4365	Ga0495601_0020653
4366	Ga0495601_0022797
4367	Ga0495601_0031646
4368	Ga0495601_0035618
4369	Ga0495601_0097422
4370	Ga0495601_0180933
4371	Ga0495612_0000096
4372	Ga0495612_0008941
4373	Ga0495612_0038048
4374	Ga0495612_0042591
4375	Ga0495612_0070997
4376	Ga0500610_0023802
4377	Ga0495595_0000035
4378	Ga0495595_0000322
4379	Ga0495595_0000731
4380	Ga0495595_0000755
4381	Ga0495595_0017112
4382	Ga0495595_0018422
4383	Ga0495619_0000044
4384	Ga0495619_0000122
4385	Ga0495619_0000270
4386	Ga0495619_0005395
4387	Ga0495619_0007525
4388	Ga0495619_0017076
4389	Ga0495619_0047759
4390	Ga0495619_0069601
4391	Ga0495619_0105414
4392	Ga0500578_0106339
4393	Ga0500643_008610
4394	Ga0500651_0000169
4395	Ga0500593_000043
4396	Ga0500593_041960
4397	Ga0500642_0000513
4398	Ga0500642_0060796
4399	Ga0500642_0115362
4400	Ga0500652_008974
4401	Ga0500658_0000435
4402	Ga0500658_0000437
4403	Ga0500658_0003173
4404	Ga0500658_0028244
4405	Ga0500568_0012336
4406	Ga0500589_074059
4407	Ga0500604_0002759
4408	Ga0500616_0001923
4409	Ga0500616_0002887
4410	Ga0500616_0047562
4411	Ga0500616_0058481
4412	Ga0500619_000027
4413	Ga0500645_000465
4414	Ga0500645_001469
4415	Ga0500645_003457
4416	Ga0500609_001768
4417	Ga0501084_0001725
4418	Ga0501084_0011657
4419	Ga0501084_0025251
4420	Ga0501084_0196678
4421	Ga0590071_003743
4422	Ga0587080_012573
4423	Ga0587082_001655
4424	Ga0587083_0001400
4425	Ga0501082_0000230
4426	Ga0501082_0000982
4427	Ga0501082_0005399
4428	Ga0501082_0021119
4429	Ga0501082_0057896
4430	Ga0501082_0076052
4431	Ga0466962_0012226
4432	Ga0530510_0000219
4433	Ga0530510_0001428
4434	Ga0530510_0017333
4435	Ga0530510_0087763
4436	2509110928
4437	2509376320
4438	2510304332
4439	2511184815
4440	2511242612
4441	2511502103
4442	2512533476
4443	2512970861
4444	2513582503
4445	2513606052
4446	2513615611
4447	2513628441
4448	2513857056
4449	2513881403
4450	2513902630
4451	2513911962
4452	2513923721
4453	2513952722
4454	2513987282
4455	2514006536
4456	2514045157
4457	2515608882
4458	2516209864
4459	2516893481
4460	2517570172
4461	2524448688
4462	2551680087
4463	2551684430
4464	2551690223
4465	2551704936
4466	2551713930
4467	2551722620
4468	2551730639
4469	2551734918
4470	2551746529
4471	2558867856
4472	2585203456
4473	2585398477
4474	2585819376
4475	2599415751
4476	2599627088
4477	2599676551
4478	2599684819
4479	2599696745
4480	2600194785
4481	2643744823
4482	2643934233
4483	2644104596
4484	2644160051
4485	2644219551
4486	2644249081
4487	2644255981
4488	2644307984
4489	2644315720
4490	2644326881
4491	2644333711
4492	2644338080
4493	2644401038
4494	2644466365
4495	2644614138
4496	2644675883
4497	2692315686
4498	2738723471
4499	2738882230
4500	2739054436
4501	2739251772
4502	2739284202
4503	2753460344
4504	2765468964
4505	2770195101
4506	2776270842
4507	2776280335
4508	2792620312
4509	2792626270
4510	2792639213
4511	2802719880
4512	2802727186
4513	2802731814
4514	2802739144
4515	2802745878
4516	2802752478
4517	2819598157
4518	2829748338
4519	2831269144
4520	2834643232
4521	2838035869
4522	2838058574
4523	2838077048
4524	2838665097
4525	2839996938
4526	2840765999
4527	2841736515
4528	2841963888
4529	2842682415
4530	2842733725
4531	2844535133
4532	2847419254
4533	2848994280
4534	2850081286
4535	2855826204
4536	2855841549
4537	2855875948
4538	2858802468
4539	2871481315
4540	2881103112
4541	2885196491
4542	2885200035
4543	2885213735
4544	2896385850
4545	2899929579
4546	2904456395
4547	2904462904
4548	2904546564
4549	2909043633
4550	2915984240
4551	2915991569
4552	2915997785
4553	2916003234
4554	2916007885
4555	2916020161
4556	2916027864
4557	2916032934
4558	2916039503
4559	2916043770
4560	2916052423
4561	2916058864
4562	2916066321
4563	2916075241
4564	2916078033
4565	2919465821
4566	2920761783
4567	2920825428
4568	2921207519
4569	2921210394
4570	2921240856
4571	2921249847
4572	2921255572
4573	2921260564
4574	2921267685
4575	2921287897
4576	2921289514
4577	2921304547
4578	2923557268
4579	2924148664
4580	2924151383
4581	2924162045
4582	2924166058
4583	2924176159
4584	2924183133
4585	2924190703
4586	2924199666
4587	2924203576
4588	2924212725
4589	2924217197
4590	2924227024
4591	2924232187
4592	2928039978
4593	2928047273
4594	2928057524
4595	2928068091
4596	2928072676
4597	2928085841
4598	2929166018
4599	2929523758
4600	2933017822
4601	2937000268
4602	2937008379
4603	2937014739
4604	2937018606
4605	2937027064
4606	2937034244
4607	2937042456
4608	2937046192
4609	2937055522
4610	2937062461
4611	2937069159
4612	2937075080
4613	2937082317
4614	2937089365
4615	2937093841
4616	2937100432
4617	2937110668
4618	2937117053
4619	2937124624
4620	2937127693
4621	2945914827
4622	2945951110
4623	2945974232
4624	2945989775
4625	2954769492
4626	2957380273
4627	2957387685
4628	2957392984
4629	2957398908
4630	2957403072
4631	2957410828
4632	2957421845
4633	2957422712
4634	2957436342
4635	2957443392
4636	2957449658
4637	2957456099
4638	2957460845
4639	2957468703
4640	2957475667
4641	2957481552
4642	2957487613
4643	2957492359
4644	2957502368
4645	2957507388
4646	2958075884
4647	2960590169
4648	2960595748
4649	2960602553
4650	2960609127
4651	2960616238
4652	2960621379
4653	2960627924
4654	2960635976
4655	2960640437
4656	2960650175
4657	2960653190
4658	2960664766
4659	2960670042
4660	2960678873
4661	2960683473
4662	2960690567
4663	2960699359
4664	2964609259
4665	2964615709
4666	2964626406
4667	2964633950
4668	2964639808
4669	2964648012
4670	2964653373
4671	2964662714
4672	2964667551
4673	2964673581
4674	2964684522
4675	2964689447
4676	2964697101
4677	2964703684
4678	2964711974
4679	2964718993
4680	2964720605
4681	2967669830
4682	2967676309
4683	2967679851
4684	2967690535
4685	2967696438
4686	2967700542
4687	2967709777
4688	2967719661
4689	2967727261
4690	2967733417
4691	2967739470
4692	2967744303
4693	2967754177
4694	2967759744
4695	2967766994
4696	2967773359
4697	2967778615
4698	2970024025
4699	2970031692
4700	2970039929
4701	2970047318
4702	2970049462
4703	2970056519
4704	2970066512
4705	2970074180
4706	2970080932
4707	2970086928
4708	2970094095
4709	2970101611
4710	2970106775
4711	2970114765
4712	2970121055
4713	2970127440
4714	2970132435
4715	2970143305
4716	2970148732
4717	2970150633
4718	2970158535
4719	2970168817
4720	2970173927
4721	2970179737
4722	2970189678
4723	2970196466
4724	2977522586
4725	2977528679
4726	2977535263
4727	2977542441
4728	2977549738
4729	2977555345
4730	2977561757
4731	2977572127
4732	2977576196
4733	2977584819
4734	2977870272
4735	2996887700
4736	3005413679
4737	3005490363
4738	643826143
4739	644750684
4740	648740819
4741	8003402462
4742	8003994002
4743	8004001630
4744	8004639255
4745	8005322227
4746	8016588393
4747	8019653375
4748	8055619148

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03480

DctP

Bacterial extracellular solute-binding protein, family 7

99

389

0.89 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
7ug8-assembly1.cif.gz_A	crystal structure of a solute receptor from synechococcus cc9311 in complex with alpha-ketovaleric and calcium	0.941	43	372
4yzz-assembly1.cif.gz_A	crystal structure of a trap transporter solute binding protein (ipr025997) from bordetella bronchiseptica rb50 (bb0280, target efi-500035) mixed occupancy dimer, copurified calcium and picolinate bound active site versus apo site	0.937	43	380
7ug8-assembly1.cif.gz_A	crystal structure of a solute receptor from synechococcus cc9311 in complex with alpha-ketovaleric and calcium	0.93	43	372
4yzz-assembly1.cif.gz_A	crystal structure of a trap transporter solute binding protein (ipr025997) from bordetella bronchiseptica rb50 (bb0280, target efi-500035) mixed occupancy dimer, copurified calcium and picolinate bound active site versus apo site	0.9236	43	380
4pet-assembly1.cif.gz_B	crystal structure of a trap periplasmic solute binding protein from colwellia psychrerythraea (cps_0129, target efi-510097) with bound calcium and pyruvate	0.9221	44	375

ID	Description	Score	Start	End	Superfamily
2pfyD00	Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bacterial extracellular solute-binding protein, family 7	0.8865	45	351	3.40.190.170
af_P37676_23_328_3.40.190.170	Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bacterial extracellular solute-binding protein, family 7	0.8847	44	351	3.40.190.170
2zzxA00	Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bacterial extracellular solute-binding protein, family 7	0.8797	44	357	3.40.190.170
2pfyD00	Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bacterial extracellular solute-binding protein, family 7	0.8782	45	351	3.40.190.170
4xeqD00	Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bacterial extracellular solute-binding protein, family 7	0.878	46	353	3.40.190.170

ID	Description	Score	Start	End	GO Terms
AF-A0A382YBQ4-F1-model_v4	SsuA/THI5-like domain-containing protein	0.9847	189	376	GO:0055085
AF-A0A4Q3M5Y7-F1-model_v4	C4-dicarboxylate ABC transporter	0.9803	132	382	GO:0055085
AF-A0A519IU28-F1-model_v4	deleted	0.9784	211	376
AF-A0A4Q3NWW7-F1-model_v4	deleted	0.9779	153	376
AF-A0A7W6D2C2-F1-model_v4	TRAP-type mannitol/chloroaromatic compound transport system substrate-binding protein	0.977	33	378	GO:0031317 GO:0046872 GO:0055085

F496751

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF03480

DctP

Bacterial extracellular solute-binding protein, family 7

99

389

0.89

Structural Annotation

Top 5 Hits

Map