metagRoot

F496667

General Info

Members	Datasets	Scaffolds	Average Seq Length
2310	626	2296	136

Family's Representative Sequence

Representative Sequence	3300035089\|Ga0373944_0156404\|Ga0373944_0156404_85_582
Length	165
Sequence	MTRQSIEEEVFRLIDSRVKPAGDRGKSGTTMATFHFDLVSPEKLAFSGEVDQVDVPGVEGDFGVLAGHAPVVAAIRPGILTVTSGGSHQKIIVLGGLAEVSDKGLTVLADVATSMEDLDRARFADKISEMEAKLAEKEGSELDRAVERLDHFKSIQHQLNSTAMH

Samples

	Sample ID	Description	Type	Environment
1	2513237096	Bradyrhizobium pachyrhizi USDA 3259	Isolate	Nodule
2	2513237137	Bradyrhizobium elkanii USDA 94	Isolate	Nodule
3	2513237145	Bradyrhizobium elkanii USDA 3254	Isolate	Nodule
4	2517572143	Bradyrhizobium elkanii USDA 76	Isolate	Nodule
5	2791355197	Bradyrhizobium sp. C9	Isolate	Nodule
6	2935630451	Bradyrhizobium sp. I1.14.4	Isolate	Nodule
7	2941507105	Bradyrhizobium sp. i1.12.3	Isolate	Nodule
8	2941515067	Bradyrhizobium sp. i1.14.1	Isolate	Nodule
9	2941523033	Bradyrhizobium sp. i1.8.4	Isolate	Nodule
10	3300001979	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6	Metagenome	Rhizosphere
11	3300001989	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5	Metagenome	Rhizosphere
12	3300001990	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3	Metagenome	Rhizosphere
13	3300002070	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4	Metagenome	Rhizosphere
14	3300002075	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4	Metagenome	Rhizosphere
15	3300002244	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1	Metagenome	Rhizosphere
16	3300003203	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
17	3300003215	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF	Metagenome	Endosphere
18	3300003354	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS	Metagenome	Endosphere
19	3300003775	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2	Metagenome	Endosphere
20	3300003794	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2	Metagenome	Endosphere
21	3300003911	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
22	3300005262	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3)	Metagenome	Endosphere
23	3300005290	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3)	Metagenome	Rhizosphere
24	3300005293	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2)	Metagenome	Rhizosphere
25	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
26	3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Metagenome	Rhizosphere
27	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
28	3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Metagenome	Rhizosphere
29	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
30	3300005333	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG	Metagenome	Rhizosphere
31	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
32	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
33	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
34	3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Metagenome	Rhizosphere
35	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
36	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
37	3300005343	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG	Metagenome	Rhizosphere
38	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
39	3300005345	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG	Metagenome	Rhizosphere
40	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
41	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
42	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
43	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
44	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
45	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
46	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
47	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
48	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
49	3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Metagenome	Rhizosphere
50	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
51	3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Metagenome	Rhizosphere
52	3300005437	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG	Metagenome	Rhizosphere
53	3300005438	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG	Metagenome	Rhizosphere
54	3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Metagenome	Rhizosphere
55	3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Metagenome	Rhizosphere
56	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
57	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
58	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
59	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
60	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
61	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
62	3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Metagenome	Rhizosphere
63	3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Metagenome	Rhizosphere
64	3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Metagenome	Rhizosphere
65	3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Metagenome	Rhizosphere
66	3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Metagenome	Rhizosphere
67	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
68	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
69	3300005536	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG	Metagenome	Rhizosphere
70	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
71	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
72	3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Metagenome	Rhizosphere
73	3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Metagenome	Rhizosphere
74	3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Metagenome	Rhizosphere
75	3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Metagenome	Rhizosphere
76	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
77	3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Metagenome	Rhizosphere
78	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
79	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
80	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
81	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
82	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
83	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
84	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
85	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
86	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
87	3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Metagenome	Rhizosphere
88	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
89	3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Metagenome	Rhizosphere
90	3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Metagenome	Rhizosphere
91	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
92	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
93	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
94	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
95	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
96	3300005983	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Metagenome	Rhizosphere
97	3300005985	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
98	3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Metagenome	Rhizosphere
99	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
100	3300006042	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3	Metagenome	Endosphere
101	3300006048	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3	Metagenome	Endosphere
102	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
103	3300006163	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG	Metagenome	Rhizosphere
104	3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Metagenome	Rhizosphere
105	3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Metagenome	Rhizosphere
106	3300006177	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2	Metagenome	Endosphere
107	3300006178	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Metagenome	Endosphere
108	3300006186	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4	Metagenome	Endosphere
109	3300006195	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1	Metagenome	Endosphere
110	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
111	3300006353	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5	Metagenome	Endosphere
112	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
113	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
114	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
115	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
116	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
117	3300006914	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Metagenome	Rhizosphere
118	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
119	3300006941	Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW	Metagenome	Nodule
120	3300006942	Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW	Metagenome	Nodule
121	3300006944	Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW	Metagenome	Nodule
122	3300007265	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1	Metagenome	Rhizosphere
123	3300007788	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2	Metagenome	Rhizosphere
124	3300009011	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG	Metagenome	Rhizosphere
125	3300009092	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG	Metagenome	Rhizosphere
126	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
127	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
128	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
129	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
130	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
131	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
132	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
133	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
134	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
135	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
136	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
137	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
138	3300010159	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3	Metagenome	Rhizosphere
139	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
140	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
141	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
142	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
143	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
144	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
145	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
146	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
147	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
148	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
149	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
150	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
151	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
152	3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Metagenome	Rhizosphere
153	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
154	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
155	3300015261	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG	Metagenome	Rhizosphere
156	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
157	3300021320	Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3	Metagenome	Nodule
158	3300021321	Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1	Metagenome	Nodule
159	3300021324	Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4	Metagenome	Nodule
160	3300021327	Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2	Metagenome	Nodule
161	3300021361	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2	Metagenome	Rhizosphere
162	3300021377	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7	Metagenome	Unclassified
163	3300021384	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9	Metagenome	Unclassified
164	3300021388	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8	Metagenome	Unclassified
165	3300024225	Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5	Metagenome	Rhizosphere
166	3300025230	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2)	Metagenome	Endosphere
167	3300025245	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3)	Metagenome	Endosphere
168	3300025253	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
169	3300025254	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2)	Metagenome	Endosphere
170	3300025261	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2)	Metagenome	Endosphere
171	3300025272	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
172	3300025295	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3)	Metagenome	Endosphere
173	3300025297	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2)	Metagenome	Endosphere
174	3300025299	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3)	Metagenome	Endosphere
175	3300025302	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2)	Metagenome	Endosphere
176	3300025303	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
177	3300025304	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
178	3300025315	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2)	Metagenome	Rhizosphere
179	3300025321	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
180	3300025885	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
181	3300025893	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
182	3300025898	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
183	3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
184	3300025900	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
185	3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2)	Metagenome	Rhizosphere
186	3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
187	3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2)	Metagenome	Rhizosphere
188	3300025905	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
189	3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
190	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
191	3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
192	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
193	3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
194	3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
195	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
196	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
197	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
198	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
199	3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
200	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
201	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
202	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
203	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
204	3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
205	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
206	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
207	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
208	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
209	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
210	3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
211	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
212	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
213	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
214	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
215	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
216	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
217	3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
218	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
219	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
220	3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
221	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
222	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
223	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
224	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
225	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
226	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
227	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
228	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
229	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
230	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
231	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
232	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
233	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
234	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
235	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
236	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
237	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
238	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
239	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
240	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
241	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
242	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
243	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
244	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
245	3300027296	Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2)	Metagenome	Nodule
246	3300027357	Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2)	Metagenome	Nodule
247	3300027361	Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2)	Metagenome	Nodule
248	3300027363	Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2)	Metagenome	Nodule
249	3300027512	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2)	Metagenome	Rhizosphere
250	3300027671	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2)	Metagenome	Rhizosphere
251	3300027866	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2)	Metagenome	Endosphere
252	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
253	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
254	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
255	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
256	3300028556	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG	Metagenome	Rhizosphere
257	3300028563	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG	Metagenome	Rhizosphere
258	3300028573	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG	Metagenome	Rhizosphere
259	3300028577	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG	Metagenome	Rhizosphere
260	3300028653	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG	Metagenome	Rhizosphere
261	3300028666	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG	Metagenome	Rhizosphere
262	3300028786	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM	Metagenome	Unclassified
263	3300028794	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM	Metagenome	Unclassified
264	3300028800	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG	Metagenome	Rhizosphere
265	3300029957	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG	Metagenome	Rhizosphere
266	3300030521	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM	Metagenome	Unclassified
267	3300030760	Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
268	3300030879	Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
269	3300031235	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG	Metagenome	Rhizosphere
270	3300031238	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG	Metagenome	Rhizosphere
271	3300031242	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG	Metagenome	Rhizosphere
272	3300031247	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG	Metagenome	Rhizosphere
273	3300031249	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG	Metagenome	Rhizosphere
274	3300031250	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG	Metagenome	Rhizosphere
275	3300031251	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG	Metagenome	Rhizosphere
276	3300031344	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG	Metagenome	Rhizosphere
277	3300031456	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM	Metagenome	Unclassified
278	3300031507	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM	Metagenome	Unclassified
279	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
280	3300031595	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG	Metagenome	Rhizosphere
281	3300031616	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM	Metagenome	Unclassified
282	3300031711	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG	Metagenome	Rhizosphere
283	3300031712	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG	Metagenome	Rhizosphere
284	3300031730	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM	Metagenome	Unclassified
285	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
286	3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Metagenome	Rhizosphere
287	3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Metagenome	Rhizosphere
288	3300031903	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1	Metagenome	Rhizosphere
289	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
290	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
291	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
292	3300032004	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3	Metagenome	Rhizosphere
293	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
294	3300032126	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2	Metagenome	Rhizosphere
295	3300033179	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM	Metagenome	Unclassified
296	3300033180	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM	Metagenome	Unclassified
297	3300033442	Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1	Metagenome	Nodule
298	3300034816	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3	Metagenome	Rhizosphere
299	3300034818	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3	Metagenome	Rhizosphere
300	3300035083	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17	Metagenome	Rhizosphere
301	3300035086	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4	Metagenome	Rhizosphere
302	3300035089	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2	Metagenome	Rhizosphere
303	3300035092	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11	Metagenome	Rhizosphere
304	3300035111	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11	Metagenome	Rhizosphere
305	3300035112	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16	Metagenome	Rhizosphere
306	3300035113	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12	Metagenome	Rhizosphere
307	3300035114	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3	Metagenome	Rhizosphere
308	3300035116	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3	Metagenome	Rhizosphere
309	3300035117	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1	Metagenome	Rhizosphere
310	3300035118	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2	Metagenome	Rhizosphere
311	3300035119	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4	Metagenome	Rhizosphere
312	3300035120	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5	Metagenome	Rhizosphere
313	3300035121	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3	Metagenome	Rhizosphere
314	3300035170	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1	Metagenome	Rhizosphere
315	3300035171	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4	Metagenome	Rhizosphere
316	3300035172	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3	Metagenome	Rhizosphere
317	3300035242	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11	Metagenome	Rhizosphere
318	3300035410	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12	Metagenome	Rhizosphere
319	3300035691	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4	Metagenome	Rhizosphere
320	3300035692	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11	Metagenome	Rhizosphere
321	3300035695	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19	Metagenome	Rhizosphere
322	3300035724	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1	Metagenome	Rhizosphere
323	3300035725	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8	Metagenome	Rhizosphere
324	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
325	3300036458	Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE2 (Metagenome Metatranscriptome)	Metatranscriptome	Unclassified
326	3300036459	Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome)	Metatranscriptome	Unclassified
327	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
328	3300037312	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2	Metagenome	Rhizosphere
329	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
330	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
331	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
332	3300037853	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2	Metagenome	Unclassified
333	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
334	3300039437	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2	Metagenome	Unclassified
335	3300039438	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2	Metagenome	Rhizosphere
336	3300039447	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2	Metagenome	Rhizosphere
337	3300039450	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2	Metagenome	Unclassified
338	3300041410	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596	Metagenome	Rhizosphere
339	3300041413	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839	Metagenome	Rhizosphere
340	3300041441	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG	Metagenome	Rhizoplane
341	3300041452	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG	Metagenome	Rhizoplane
342	3300041458	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG	Metagenome	Rhizoplane
343	3300041459	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG	Metagenome	Rhizoplane
344	3300041460	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG	Metagenome	Rhizoplane
345	3300041461	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT	Metatranscriptome	Rhizoplane
346	3300041463	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG	Metagenome	Rhizoplane
347	3300041486	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG	Metagenome	Rhizoplane
348	3300041492	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG	Metagenome	Unclassified
349	3300041494	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG	Metagenome	Unclassified
350	3300041496	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG	Metagenome	Unclassified
351	3300041498	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG	Metagenome	Unclassified
352	3300041505	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG	Metagenome	Unclassified
353	3300041512	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG	Metagenome	Unclassified
354	3300042005	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216	Metagenome	Rhizosphere
355	3300044656	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R	Metagenome	Rhizosphere
356	3300044658	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R	Metagenome	Rhizosphere
357	3300044684	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R	Metagenome	Rhizosphere
358	3300044693	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R	Metagenome	Rhizosphere
359	3300044694	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R	Metagenome	Rhizosphere
360	3300044706	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R	Metagenome	Rhizosphere
361	3300044735	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R	Metagenome	Rhizosphere
362	3300044765	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R	Metagenome	Rhizosphere
363	3300044842	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R	Metagenome	Rhizosphere
364	3300044901	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R	Metagenome	Rhizosphere
365	3300045049	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R	Metagenome	Rhizosphere
366	3300045836	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R	Metagenome	Rhizosphere
367	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
368	3300046452	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere	Metagenome	Rhizosphere
369	3300046454	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere	Metagenome	Rhizosphere
370	3300046455	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere	Metagenome	Rhizosphere
371	3300046457	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere	Metagenome	Rhizosphere
372	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
373	3300046460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere	Metagenome	Rhizosphere
374	3300046461	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere	Metagenome	Rhizosphere
375	3300046462	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere	Metagenome	Rhizosphere
376	3300046463	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere	Metagenome	Rhizosphere
377	3300046471	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere	Metagenome	Rhizosphere
378	3300046472	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere	Metagenome	Rhizosphere
379	3300046473	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere	Metagenome	Rhizosphere
380	3300046474	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere	Metagenome	Rhizosphere
381	3300046475	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere	Metagenome	Rhizosphere
382	3300046476	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere	Metagenome	Rhizosphere
383	3300046477	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere	Metagenome	Rhizosphere
384	3300046491	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere	Metagenome	Rhizosphere
385	3300046492	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere	Metagenome	Rhizosphere
386	3300046499	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere	Metagenome	Rhizosphere
387	3300046500	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere	Metagenome	Rhizosphere
388	3300046501	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere	Metagenome	Rhizosphere
389	3300046506	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere	Metagenome	Rhizosphere
390	3300046507	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere	Metagenome	Rhizosphere
391	3300046511	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere	Metagenome	Rhizosphere
392	3300046512	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere	Metagenome	Rhizosphere
393	3300046513	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere	Metagenome	Rhizosphere
394	3300046514	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere	Metagenome	Rhizosphere
395	3300046515	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere	Metagenome	Rhizosphere
396	3300046516	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere	Metagenome	Rhizosphere
397	3300046517	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere	Metagenome	Rhizosphere
398	3300046518	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere	Metagenome	Rhizosphere
399	3300046519	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere	Metagenome	Rhizosphere
400	3300046520	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere	Metagenome	Rhizosphere
401	3300046522	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere	Metagenome	Rhizosphere
402	3300046523	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere	Metagenome	Rhizosphere
403	3300046524	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere	Metagenome	Rhizosphere
404	3300046526	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere	Metagenome	Rhizosphere
405	3300046528	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere	Metagenome	Rhizosphere
406	3300046529	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere	Metagenome	Rhizosphere
407	3300046530	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere	Metagenome	Rhizosphere
408	3300046531	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere	Metagenome	Rhizosphere
409	3300046533	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere	Metagenome	Rhizosphere
410	3300046535	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere	Metagenome	Rhizosphere
411	3300046536	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere	Metagenome	Rhizosphere
412	3300046537	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere	Metagenome	Rhizosphere
413	3300046538	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere	Metagenome	Rhizosphere
414	3300046539	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere	Metagenome	Rhizosphere
415	3300046542	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere	Metagenome	Rhizosphere
416	3300046543	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere	Metagenome	Rhizosphere
417	3300046557	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere	Metagenome	Rhizosphere
418	3300046558	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere	Metagenome	Rhizosphere
419	3300046559	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere	Metagenome	Rhizosphere
420	3300046615	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere	Metagenome	Rhizosphere
421	3300046616	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere	Metagenome	Rhizosphere
422	3300046642	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere	Metagenome	Rhizosphere
423	3300046648	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere	Metagenome	Rhizosphere
424	3300046660	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere	Metagenome	Rhizosphere
425	3300046663	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere	Metagenome	Rhizosphere
426	3300046664	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere	Metagenome	Rhizosphere
427	3300046665	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere	Metagenome	Rhizosphere
428	3300046674	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere	Metagenome	Rhizosphere
429	3300046675	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere	Metagenome	Rhizosphere
430	3300046678	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere	Metagenome	Rhizosphere
431	3300046679	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere	Metagenome	Rhizosphere
432	3300046680	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere	Metagenome	Rhizosphere
433	3300046681	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere	Metagenome	Rhizosphere
434	3300046683	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere	Metagenome	Rhizosphere
435	3300046684	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere	Metagenome	Rhizosphere
436	3300046689	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere	Metagenome	Rhizosphere
437	3300046690	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere	Metagenome	Rhizosphere
438	3300046691	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere	Metagenome	Rhizosphere
439	3300046692	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere	Metagenome	Rhizosphere
440	3300046694	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere	Metagenome	Rhizosphere
441	3300046794	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere	Metagenome	Rhizosphere
442	3300046809	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere	Metagenome	Rhizosphere
443	3300046810	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere	Metagenome	Rhizosphere
444	3300047315	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere	Metagenome	Rhizosphere
445	3300047317	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere	Metagenome	Rhizosphere
446	3300047318	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere	Metagenome	Rhizosphere
447	3300047319	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere	Metagenome	Rhizosphere
448	3300047320	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere	Metagenome	Rhizosphere
449	3300047321	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere	Metagenome	Rhizosphere
450	3300047322	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere	Metagenome	Rhizosphere
451	3300047323	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere	Metagenome	Rhizosphere
452	3300047444	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere	Metagenome	Rhizosphere
453	3300047445	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere	Metagenome	Rhizosphere
454	3300047447	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere	Metagenome	Rhizosphere
455	3300047469	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere	Metagenome	Rhizosphere
456	3300047470	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere	Metagenome	Rhizosphere
457	3300047471	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere	Metagenome	Rhizosphere
458	3300047472	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere	Metagenome	Rhizosphere
459	3300047673	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere	Metagenome	Rhizosphere
460	3300048088	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere	Metagenome	Rhizosphere
461	3300048089	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere	Metagenome	Rhizosphere
462	3300048090	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere	Metagenome	Rhizosphere
463	3300048091	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere	Metagenome	Rhizosphere
464	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
465	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
466	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
467	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
468	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
469	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
470	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
471	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
472	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
473	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
474	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
475	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
476	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
477	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
478	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
479	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
480	3300048919	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled	Metagenome	Unclassified
481	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
482	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
483	3300048922	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15	Metagenome	Unclassified
484	3300048923	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15	Metagenome	Unclassified
485	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
486	3300048925	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled	Metagenome	Unclassified
487	3300048926	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled	Metagenome	Unclassified
488	3300048927	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15	Metagenome	Unclassified
489	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
490	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
491	3300049459	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere	Metagenome	Rhizosphere
492	3300049460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere	Metagenome	Rhizosphere
493	3300049568	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01	Metagenome	Rhizosphere
494	3300049569	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02	Metagenome	Rhizosphere
495	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
496	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
497	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
498	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
499	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
500	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
501	3300049576	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01	Metagenome	Rhizosphere
502	3300049577	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02	Metagenome	Rhizosphere
503	3300049578	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03	Metagenome	Rhizosphere
504	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
505	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
506	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
507	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
508	3300049583	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01	Metagenome	Rhizosphere
509	3300049584	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02	Metagenome	Rhizosphere
510	3300049585	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03	Metagenome	Rhizosphere
511	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
512	3300049587	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02	Metagenome	Rhizosphere
513	3300049588	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03	Metagenome	Rhizosphere
514	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
515	3300049590	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02	Metagenome	Rhizosphere
516	3300049592	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01	Metagenome	Rhizosphere
517	3300049593	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02	Metagenome	Rhizosphere
518	3300049741	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01	Metagenome	Rhizosphere
519	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
520	3300049743	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03	Metagenome	Rhizosphere
521	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
522	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
523	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
524	3300049824	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03	Metagenome	Rhizosphere
525	3300050489	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation	Metagenome	Endosphere
526	3300050490	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation	Metagenome	Endosphere
527	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
528	3300050492	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation	Metagenome	Endosphere
529	3300050493	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation	Metagenome	Endosphere
530	3300050494	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation	Metagenome	Endosphere
531	3300050495	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation	Metagenome	Endosphere
532	3300050496	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation	Metagenome	Endosphere
533	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
534	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
535	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
536	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
537	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
538	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
539	3300050514	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation	Metagenome	Rhizosphere
540	3300050515	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation	Metagenome	Rhizosphere
541	3300050516	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation	Metagenome	Endosphere
542	3300053077	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere	Metagenome	Rhizosphere
543	3300053078	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere	Metagenome	Rhizosphere
544	3300053080	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere	Metagenome	Endosphere
545	3300053083	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere	Metagenome	Rhizosphere
546	3300053084	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere	Metagenome	Rhizosphere
547	3300053085	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere	Metagenome	Rhizosphere
548	3300053086	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere	Metagenome	Endosphere
549	3300053087	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere	Metagenome	Endosphere
550	3300053088	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere	Metagenome	Endosphere
551	3300053089	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere	Metagenome	Endosphere
552	3300053092	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere	Metagenome	Endosphere
553	3300053093	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere	Metagenome	Endosphere
554	3300053094	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere	Metagenome	Endosphere
555	3300053096	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere	Metagenome	Endosphere
556	3300053097	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere	Metagenome	Endosphere
557	3300053098	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere	Metagenome	Endosphere
558	3300053102	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere	Metagenome	Endosphere
559	3300053103	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere	Metagenome	Endosphere
560	3300053104	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere	Metagenome	Endosphere
561	3300053105	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere	Metagenome	Endosphere
562	3300053108	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere	Metagenome	Endosphere
563	3300053109	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere	Metagenome	Endosphere
564	3300053111	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere	Metagenome	Endosphere
565	3300053116	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere	Metagenome	Endosphere
566	3300053118	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere	Metagenome	Endosphere
567	3300053119	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere	Metagenome	Endosphere
568	3300053121	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere	Metagenome	Endosphere
569	3300053122	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere	Metagenome	Endosphere
570	3300053123	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere	Metagenome	Endosphere
571	3300053125	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere	Metagenome	Endosphere
572	3300053129	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere	Metagenome	Endosphere
573	3300053130	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere	Metagenome	Endosphere
574	3300053131	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere	Metagenome	Endosphere
575	3300053133	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere	Metagenome	Endosphere
576	3300053134	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere	Metagenome	Endosphere
577	3300053136	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere	Metagenome	Endosphere
578	3300053137	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere	Metagenome	Endosphere
579	3300053138	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere	Metagenome	Endosphere
580	3300053139	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere	Metagenome	Endosphere
581	3300053140	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere	Metagenome	Endosphere
582	3300053142	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere	Metagenome	Endosphere
583	3300053144	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 endosphere	Metagenome	Endosphere
584	3300053145	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere	Metagenome	Endosphere
585	3300053146	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere	Metagenome	Endosphere
586	3300053147	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere	Metagenome	Endosphere
587	3300053148	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere	Metagenome	Endosphere
588	3300053150	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere	Metagenome	Endosphere
589	3300053151	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere	Metagenome	Endosphere
590	3300053153	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere	Metagenome	Endosphere
591	3300053154	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere	Metagenome	Endosphere
592	3300053155	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere	Metagenome	Endosphere
593	3300053156	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere	Metagenome	Endosphere
594	3300053158	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere	Metagenome	Endosphere
595	3300053160	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere	Metagenome	Endosphere
596	3300053161	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere	Metagenome	Endosphere
597	3300053162	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere	Metagenome	Endosphere
598	3300053163	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere	Metagenome	Endosphere
599	3300053177	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere	Metagenome	Endosphere
600	3300053178	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere	Metagenome	Endosphere
601	3300053727	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere	Metagenome	Endosphere
602	3300053729	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere	Metagenome	Endosphere
603	3300053730	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere	Metagenome	Endosphere
604	3300053731	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere	Metagenome	Endosphere
605	3300053733	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere	Metagenome	Endosphere
606	3300053735	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere	Metagenome	Endosphere
607	3300053736	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere	Metagenome	Endosphere
608	3300053739	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere	Metagenome	Endosphere
609	3300054114	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03	Metagenome	Rhizosphere
610	3300059478	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
611	3300059492	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
612	3300059493	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
613	3300059503	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
614	3300059604	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
615	3300059605	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
616	3300059644	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
617	3300059647	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
618	3300059648	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
619	3300060344	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
620	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere
621	3300061719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1	Metagenome	Rhizosphere
622	8006933436	Bradyrhizobium septentrionale 7(2017)	Isolate	Unclassified
623	8006973647	Bradyrhizobium septentrionale 162S2	Isolate	Nodule
624	8006984368	Bradyrhizobium sp. SRL28	Isolate	Unclassified
625	8019555841	Bradyrhizobium sp. JR6.1	Isolate	Nodule
626	8019565922	Bradyrhizobium sp. JR3.5	Isolate	Nodule

Type Distribution

Type	Percentage (%)
Metagenomes	98.7
Metatranscriptomes	0.69
Isolates	0.61

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	12.73
Nodule	1.34
Rhizoplane	6.19
Rhizosphere	72.9
Stem	0
Stem Tuber	0
Unclassified	6.84

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	JGI24740J21852_10000635	3300001979	Bacteria	15165
2	JGI24739J22299_10002357	3300001989	Bacteria	7276
3	JGI24737J22298_10003086	3300001990	Bacteria	5902
4	JGI24750J21931_1018831	3300002070	Bacteria	953
5	JGI24738J21930_10088130	3300002075	Bacteria	654
6	JGI24742J22300_10039833	3300002244	Bacteria	836
7	JGI25406J46586_10000364	3300003203	Bacteria	20635
8	JGI25406J46586_10005263	3300003203	Bacteria	6004
9	JGI25153J46596_10002894	3300003215	Bacteria	9738
10	JGI25153J46596_10011040	3300003215	Bacteria	4026
11	JGI25153J46596_10013892	3300003215	Bacteria	3379
12	JGI25153J46596_10066167	3300003215	Bacteria	957
13	JGI25160J50197_1008881	3300003354	Bacteria	3781
14	JGI25160J50197_1027217	3300003354	Bacteria	1561
15	Ga0055524_1026510	3300003775	Bacteria	1788
16	Ga0055531_10022725	3300003794	Bacteria	2378
17	JGI25405J52794_10063271	3300003911	Bacteria	802
18	Ga0065165_1006458	3300005262	Bacteria	6137
19	Ga0065165_1007708	3300005262	Bacteria	5214
20	Ga0065165_1080366	3300005262	Bacteria	847
21	Ga0065712_10295706	3300005290	Bacteria	857
22	Ga0065715_10300026	3300005293	Bacteria	1043
23	Ga0070658_10009941	3300005327	Bacteria	7643
24	Ga0070658_10619433	3300005327	Bacteria	938
25	Ga0070658_10875581	3300005327	Bacteria	781
26	Ga0070676_10145927	3300005328	Bacteria	1510
27	Ga0070676_10263703	3300005328	Bacteria	1154
28	Ga0070676_10844255	3300005328	Bacteria	679
29	Ga0070676_11155574	3300005328	Bacteria	587
30	Ga0070683_100023174	3300005329	Bacteria	5552
31	Ga0070683_100031788	3300005329	Bacteria	4803
32	Ga0070683_100066945	3300005329	Bacteria	3345
33	Ga0070683_100186761	3300005329	Bacteria	1968
34	Ga0070683_100470076	3300005329	Bacteria	1201
35	Ga0070690_100343432	3300005330	Bacteria	1082
36	Ga0070670_100242428	3300005331	Bacteria	1569
37	Ga0070670_100322905	3300005331	Bacteria	1353
38	Ga0070677_10279320	3300005333	Bacteria	840
39	Ga0068869_100230823	3300005334	Bacteria	1470
40	Ga0068869_100595165	3300005334	Bacteria	933
41	Ga0068869_101186159	3300005334	Bacteria	670
42	Ga0068869_101324851	3300005334	Bacteria	636
43	Ga0070666_10337059	3300005335	Bacteria	1078
44	Ga0070666_10354290	3300005335	Bacteria	1051
45	Ga0070680_100018571	3300005336	Bacteria	5496
46	Ga0070680_100028929	3300005336	Bacteria	4448
47	Ga0070680_100093185	3300005336	Bacteria	2495
48	Ga0070680_100191211	3300005336	Bacteria	1724
49	Ga0070680_100414785	3300005336	Bacteria	1148
50	Ga0070680_100429857	3300005336	Bacteria	1127
51	Ga0070682_100099703	3300005337	Bacteria	1915
52	Ga0070682_100149754	3300005337	Bacteria	1600
53	Ga0070682_100283448	3300005337	Bacteria	1209
54	Ga0070682_100497949	3300005337	Bacteria	943
55	Ga0068868_100128435	3300005338	Bacteria	2072
56	Ga0068868_100130434	3300005338	Bacteria	2056
57	Ga0068868_100254970	3300005338	Bacteria	1477
58	Ga0068868_100301738	3300005338	Bacteria	1360
59	Ga0068868_100343694	3300005338	Bacteria	1276
60	Ga0068868_100761845	3300005338	Bacteria	871
61	Ga0070660_100071616	3300005339	Bacteria	2707
62	Ga0070660_100327218	3300005339	Bacteria	1260
63	Ga0070660_100330413	3300005339	Bacteria	1253
64	Ga0070660_100454549	3300005339	Bacteria	1063
65	Ga0070660_100456425	3300005339	Bacteria	1060
66	Ga0070687_100588447	3300005343	Bacteria	763
67	Ga0070661_100011760	3300005344	Bacteria	6107
68	Ga0070661_100648808	3300005344	Bacteria	857
69	Ga0070692_10267455	3300005345	Bacteria	1030
70	Ga0070668_100165206	3300005347	Bacteria	1798
71	Ga0070668_100219830	3300005347	Bacteria	1566
72	Ga0070668_100224899	3300005347	Bacteria	1549
73	Ga0070668_100265636	3300005347	Bacteria	1428
74	Ga0070668_100397247	3300005347	Bacteria	1176
75	Ga0070668_101044074	3300005347	Bacteria	736
76	Ga0070668_101099235	3300005347	Bacteria	717
77	Ga0070669_100425396	3300005353	Bacteria	1091
78	Ga0070669_100649352	3300005353	Bacteria	887
79	Ga0070669_100730999	3300005353	Bacteria	837
80	Ga0070675_100150577	3300005354	Bacteria	1995
81	Ga0070675_100619140	3300005354	Bacteria	983
82	Ga0070675_101562812	3300005354	Bacteria	608
83	Ga0070671_100084350	3300005355	Bacteria	2657
84	Ga0070671_100100898	3300005355	Bacteria	2421
85	Ga0070671_100152347	3300005355	Bacteria	1953
86	Ga0070671_100324406	3300005355	Bacteria	1312
87	Ga0070671_100419193	3300005355	Bacteria	1146
88	Ga0070671_100742661	3300005355	Bacteria	853
89	Ga0070674_100190697	3300005356	Bacteria	1577
90	Ga0070674_100309997	3300005356	Bacteria	1261
91	Ga0070674_100387401	3300005356	Bacteria	1139
92	Ga0070674_101662749	3300005356	Bacteria	577
93	Ga0070673_100200679	3300005364	Bacteria	1717
94	Ga0070673_100794053	3300005364	Bacteria	874
95	Ga0070688_100220804	3300005365	Bacteria	1335
96	Ga0070688_100537778	3300005365	Bacteria	886
97	Ga0070688_100607495	3300005365	Bacteria	838
98	Ga0070688_101085207	3300005365	Bacteria	639
99	Ga0070659_100036969	3300005366	Bacteria	3806
100	Ga0070659_100158027	3300005366	Bacteria	1852
101	Ga0070659_100228211	3300005366	Bacteria	1538
102	Ga0070659_100243171	3300005366	Bacteria	1490
103	Ga0070659_100889401	3300005366	Bacteria	778
104	Ga0070659_100897171	3300005366	Bacteria	774
105	Ga0070659_100998515	3300005366	Bacteria	735
106	Ga0070667_100285359	3300005367	Bacteria	1483
107	Ga0070667_100387415	3300005367	Bacteria	1270
108	Ga0070667_100533625	3300005367	Bacteria	1077
109	Ga0070667_100671502	3300005367	Bacteria	957
110	Ga0070667_101090309	3300005367	Bacteria	746
111	Ga0070709_10015451	3300005434	Bacteria	4344
112	Ga0070709_10102893	3300005434	Bacteria	1906
113	Ga0070709_10399642	3300005434	Bacteria	1026
114	Ga0070714_100012416	3300005435	Bacteria	6801
115	Ga0070714_100017642	3300005435	Bacteria	5786
116	Ga0070714_100081631	3300005435	Bacteria	2815
117	Ga0070714_100794903	3300005435	Bacteria	916
118	Ga0070713_100016355	3300005436	Bacteria	5578
119	Ga0070713_100027142	3300005436	Bacteria	4504
120	Ga0070713_100030753	3300005436	Bacteria	4268
121	Ga0070713_100056704	3300005436	Bacteria	3259
122	Ga0070713_100058193	3300005436	Bacteria	3222
123	Ga0070713_100392007	3300005436	Bacteria	1296
124	Ga0070713_100463314	3300005436	Bacteria	1192
125	Ga0070713_101119442	3300005436	Bacteria	761
126	Ga0070710_10001137	3300005437	Bacteria	12606
127	Ga0070710_10299155	3300005437	Bacteria	1050
128	Ga0070710_10328705	3300005437	Bacteria	1006
129	Ga0070701_10240005	3300005438	Bacteria	1089
130	Ga0070711_100002213	3300005439	Bacteria	11038
131	Ga0070711_100036606	3300005439	Bacteria	3288
132	Ga0070711_100682519	3300005439	Bacteria	863
133	Ga0070711_100835687	3300005439	Bacteria	783
134	Ga0070705_100873373	3300005440	Bacteria	721
135	Ga0070700_100268056	3300005441	Bacteria	1232
136	Ga0070700_100527142	3300005441	Bacteria	913
137	Ga0070700_100889657	3300005441	Bacteria	724
138	Ga0070663_100039181	3300005455	Bacteria	3310
139	Ga0070663_100060017	3300005455	Bacteria	2734
140	Ga0070663_100069616	3300005455	Bacteria	2557
141	Ga0070663_100074887	3300005455	Bacteria	2473
142	Ga0070663_100090808	3300005455	Bacteria	2262
143	Ga0070663_100364809	3300005455	Bacteria	1172
144	Ga0070663_100493635	3300005455	Bacteria	1015
145	Ga0070663_100556161	3300005455	Bacteria	960
146	Ga0070663_100697602	3300005455	Bacteria	862
147	Ga0070663_101066378	3300005455	Bacteria	705
148	Ga0070678_100011899	3300005456	Bacteria	5385
149	Ga0070678_100072529	3300005456	Bacteria	2581
150	Ga0070678_100111074	3300005456	Bacteria	2145
151	Ga0070678_100161380	3300005456	Bacteria	1816
152	Ga0070678_100326729	3300005456	Bacteria	1311
153	Ga0070678_100394627	3300005456	Bacteria	1200
154	Ga0070678_100724968	3300005456	Bacteria	897
155	Ga0070678_100750303	3300005456	Bacteria	883
156	Ga0070662_100015653	3300005457	Bacteria	5084
157	Ga0070662_100199248	3300005457	Bacteria	1588
158	Ga0070662_100664924	3300005457	Bacteria	879
159	Ga0070662_100875551	3300005457	Bacteria	766
160	Ga0070662_101067109	3300005457	Bacteria	692
161	Ga0070662_101703779	3300005457	Bacteria	544
162	Ga0070681_10017847	3300005458	Bacteria	7092
163	Ga0070681_10030253	3300005458	Bacteria	5432
164	Ga0070681_10062073	3300005458	Bacteria	3711
165	Ga0070681_10180319	3300005458	Bacteria	2033
166	Ga0070681_10612128	3300005458	Bacteria	1004
167	Ga0068867_100088215	3300005459	Bacteria	2350
168	Ga0068867_100931571	3300005459	Bacteria	784
169	Ga0070685_10315653	3300005466	Bacteria	1058
170	Ga0070685_10439343	3300005466	Bacteria	912
171	Ga0070685_10452483	3300005466	Bacteria	900
172	Ga0070706_100758850	3300005467	Bacteria	899
173	Ga0070707_100069435	3300005468	Bacteria	3393
174	Ga0070698_100066713	3300005471	Bacteria	3620
175	Ga0070698_101238649	3300005471	Bacteria	696
176	Ga0070699_100927905	3300005518	Bacteria	798
177	Ga0070699_101079062	3300005518	Bacteria	737
178	Ga0070679_100017988	3300005530	Bacteria	6849
179	Ga0070679_100105888	3300005530	Bacteria	2798
180	Ga0070679_100247205	3300005530	Bacteria	1740
181	Ga0070679_100363079	3300005530	Bacteria	1395
182	Ga0070679_100431704	3300005530	Bacteria	1262
183	Ga0070679_100975205	3300005530	Bacteria	791
184	Ga0070679_101328753	3300005530	Bacteria	665
185	Ga0070684_100000950	3300005535	Bacteria	20658
186	Ga0070684_100122727	3300005535	Bacteria	2338
187	Ga0070684_101582518	3300005535	Bacteria	618
188	Ga0070684_101686529	3300005535	Bacteria	598
189	Ga0070697_100030494	3300005536	Bacteria	4332
190	Ga0070697_100232263	3300005536	Bacteria	1573
191	Ga0070697_101676039	3300005536	Bacteria	569
192	Ga0068853_100007151	3300005539	Bacteria	8929
193	Ga0068853_100039602	3300005539	Bacteria	4020
194	Ga0068853_100046015	3300005539	Bacteria	3740
195	Ga0068853_100058275	3300005539	Bacteria	3334
196	Ga0068853_100086864	3300005539	Bacteria	2743
197	Ga0068853_100094174	3300005539	Bacteria	2638
198	Ga0068853_100278926	3300005539	Bacteria	1540
199	Ga0068853_100470078	3300005539	Bacteria	1184
200	Ga0068853_101296583	3300005539	Bacteria	704
201	Ga0070672_100081791	3300005543	Bacteria	2590
202	Ga0070672_100302616	3300005543	Bacteria	1356
203	Ga0070672_100538926	3300005543	Bacteria	1012
204	Ga0070672_100871449	3300005543	Bacteria	794
205	Ga0070686_100096462	3300005544	Bacteria	1988
206	Ga0070686_100301468	3300005544	Bacteria	1188
207	Ga0070686_100372306	3300005544	Bacteria	1079
208	Ga0070695_100841368	3300005545	Bacteria	738
209	Ga0070696_101315174	3300005546	Bacteria	614
210	Ga0070693_100068771	3300005547	Bacteria	2079
211	Ga0070693_100264003	3300005547	Bacteria	1146
212	Ga0070693_100418100	3300005547	Bacteria	933
213	Ga0070693_101013845	3300005547	Bacteria	629
214	Ga0070693_101383223	3300005547	Bacteria	547
215	Ga0070665_100237422	3300005548	Bacteria	1823
216	Ga0070665_100260258	3300005548	Bacteria	1736
217	Ga0070665_100294808	3300005548	Bacteria	1624
218	Ga0070665_100333097	3300005548	Bacteria	1522
219	Ga0070665_100408262	3300005548	Bacteria	1366
220	Ga0070665_100453159	3300005548	Bacteria	1292
221	Ga0070665_100511350	3300005548	Bacteria	1212
222	Ga0070665_100617062	3300005548	Bacteria	1098
223	Ga0070665_100642939	3300005548	Bacteria	1074
224	Ga0070665_100715361	3300005548	Bacteria	1014
225	Ga0070665_101631170	3300005548	Bacteria	653
226	Ga0070665_101994970	3300005548	Bacteria	585
227	Ga0070704_100345542	3300005549	Bacteria	1254
228	Ga0070704_100637383	3300005549	Bacteria	940
229	Ga0070704_101032747	3300005549	Bacteria	744
230	Ga0068855_100067225	3300005563	Bacteria	4177
231	Ga0068855_100106967	3300005563	Bacteria	3214
232	Ga0068855_100162038	3300005563	Bacteria	2537
233	Ga0068855_100162722	3300005563	Bacteria	2531
234	Ga0068855_100281770	3300005563	Bacteria	1845
235	Ga0068855_100337465	3300005563	Bacteria	1662
236	Ga0068855_100557755	3300005563	Bacteria	1239
237	Ga0068855_100578329	3300005563	Bacteria	1213
238	Ga0068855_100591555	3300005563	Bacteria	1197
239	Ga0068855_100965921	3300005563	Bacteria	897
240	Ga0068855_101127956	3300005563	Bacteria	818
241	Ga0068855_101352093	3300005563	Bacteria	736
242	Ga0068855_101672919	3300005563	Bacteria	650
243	Ga0070664_100028305	3300005564	Bacteria	4661
244	Ga0070664_100443919	3300005564	Bacteria	1190
245	Ga0070664_100487230	3300005564	Bacteria	1135
246	Ga0070664_100715827	3300005564	Bacteria	933
247	Ga0070664_101135089	3300005564	Bacteria	737
248	Ga0070664_101712854	3300005564	Bacteria	596
249	Ga0070664_101820385	3300005564	Bacteria	577
250	Ga0070664_101844436	3300005564	Bacteria	574
251	Ga0068857_100028342	3300005577	Bacteria	4942
252	Ga0068857_100058005	3300005577	Bacteria	3437
253	Ga0068857_100146635	3300005577	Bacteria	2135
254	Ga0068857_100347260	3300005577	Bacteria	1373
255	Ga0068857_100535841	3300005577	Bacteria	1102
256	Ga0068857_100576469	3300005577	Bacteria	1062
257	Ga0068857_100849286	3300005577	Bacteria	874
258	Ga0068857_101253873	3300005577	Bacteria	719
259	Ga0068854_100020662	3300005578	Bacteria	4460
260	Ga0068854_100021808	3300005578	Bacteria	4352
261	Ga0068854_100093481	3300005578	Bacteria	2241
262	Ga0068854_100943613	3300005578	Bacteria	761
263	Ga0068856_100003724	3300005614	Bacteria	15294
264	Ga0068856_100031694	3300005614	Bacteria	5173
265	Ga0068856_100144962	3300005614	Bacteria	2382
266	Ga0068856_100177211	3300005614	Bacteria	2144
267	Ga0068856_100258750	3300005614	Bacteria	1756
268	Ga0068856_100276729	3300005614	Bacteria	1695
269	Ga0068856_100319224	3300005614	Bacteria	1571
270	Ga0068856_100607431	3300005614	Bacteria	1115
271	Ga0070702_100174657	3300005615	Bacteria	1400
272	Ga0070702_100177570	3300005615	Bacteria	1390
273	Ga0070702_100903811	3300005615	Bacteria	691
274	Ga0068852_100014912	3300005616	Bacteria	6005
275	Ga0068852_100066422	3300005616	Bacteria	3149
276	Ga0068852_100084406	3300005616	Bacteria	2826
277	Ga0068852_100178300	3300005616	Bacteria	1996
278	Ga0068852_100183419	3300005616	Bacteria	1969
279	Ga0068852_100512890	3300005616	Bacteria	1195
280	Ga0068852_101679229	3300005616	Bacteria	658
281	Ga0068859_100116438	3300005617	Bacteria	2737
282	Ga0068859_100444967	3300005617	Bacteria	1392
283	Ga0068859_100616861	3300005617	Bacteria	1177
284	Ga0068859_100677584	3300005617	Bacteria	1122
285	Ga0068864_100151982	3300005618	Bacteria	2098
286	Ga0068864_100259009	3300005618	Bacteria	1617
287	Ga0068864_100599660	3300005618	Bacteria	1069
288	Ga0068864_102020853	3300005618	Bacteria	583
289	Ga0068864_102194583	3300005618	Bacteria	559
290	Ga0068866_10104867	3300005718	Bacteria	1566
291	Ga0068866_10140287	3300005718	Bacteria	1386
292	Ga0068861_100080176	3300005719	Bacteria	2553
293	Ga0068861_100275562	3300005719	Bacteria	1446
294	Ga0068861_100372034	3300005719	Bacteria	1260
295	Ga0068861_100483833	3300005719	Bacteria	1116
296	Ga0068861_100903515	3300005719	Bacteria	836
297	Ga0068851_10001194	3300005834	Bacteria	11281
298	Ga0068851_10065253	3300005834	Bacteria	1873
299	Ga0068851_10402454	3300005834	Bacteria	805
300	Ga0068851_10411084	3300005834	Bacteria	797
301	Ga0068870_10249854	3300005840	Bacteria	1099
302	Ga0068863_100234018	3300005841	Bacteria	1772
303	Ga0068863_100334017	3300005841	Bacteria	1473
304	Ga0068863_100343463	3300005841	Bacteria	1452
305	Ga0068863_101737360	3300005841	Bacteria	634
306	Ga0068858_100156051	3300005842	Bacteria	2147
307	Ga0068858_100173067	3300005842	Bacteria	2036
308	Ga0068858_100388062	3300005842	Bacteria	1340
309	Ga0068858_100530505	3300005842	Bacteria	1139
310	Ga0068858_100656201	3300005842	Bacteria	1019
311	Ga0068858_101040733	3300005842	Bacteria	803
312	Ga0068860_100004778	3300005843	Bacteria	13804
313	Ga0068860_100187140	3300005843	Bacteria	2002
314	Ga0068860_100309883	3300005843	Bacteria	1548
315	Ga0068860_100331649	3300005843	Bacteria	1494
316	Ga0068860_100603045	3300005843	Bacteria	1103
317	Ga0068860_100671855	3300005843	Bacteria	1044
318	Ga0068860_101553634	3300005843	Bacteria	683
319	Ga0068862_100041251	3300005844	Bacteria	3926
320	Ga0068862_100111637	3300005844	Bacteria	2400
321	Ga0068862_100392642	3300005844	Bacteria	1296
322	Ga0068862_100476004	3300005844	Bacteria	1181
323	Ga0081455_10022385	3300005937	Bacteria	5908
324	Ga0081455_10022799	3300005937	Bacteria	5841
325	Ga0081455_10025106	3300005937	Bacteria	5506
326	Ga0081455_10675880	3300005937	Bacteria	661
327	Ga0081540_1000191	3300005983	Bacteria	63533
328	Ga0081540_1005444	3300005983	Bacteria	9499
329	Ga0081540_1009659	3300005983	Bacteria	6630
330	Ga0081540_1297740	3300005983	Bacteria	555
331	Ga0081539_10000048	3300005985	Bacteria	272906
332	Ga0081539_10000371	3300005985	Bacteria	98455
333	Ga0081539_10032296	3300005985	Bacteria	3208
334	Ga0070717_10003776	3300006028	Bacteria	10881
335	Ga0070717_10041094	3300006028	Bacteria	3769
336	Ga0070717_10294426	3300006028	Bacteria	1442
337	Ga0070717_10873199	3300006028	Bacteria	819
338	Ga0070717_11221907	3300006028	Bacteria	684
339	Ga0070717_11678701	3300006028	Bacteria	575
340	Ga0075365_10061672	3300006038	Bacteria	2505
341	Ga0075365_10101270	3300006038	Bacteria	1972
342	Ga0075365_10122711	3300006038	Bacteria	1793
343	Ga0075365_10128226	3300006038	Bacteria	1754
344	Ga0075365_10262934	3300006038	Bacteria	1213
345	Ga0075365_10576698	3300006038	Bacteria	796
346	Ga0075365_10631125	3300006038	Bacteria	757
347	Ga0075368_10005957	3300006042	Bacteria	4224
348	Ga0075368_10132721	3300006042	Bacteria	1035
349	Ga0075363_100020861	3300006048	Bacteria	3291
350	Ga0075363_100169620	3300006048	Bacteria	1238
351	Ga0075363_100191548	3300006048	Bacteria	1166
352	Ga0075363_100194198	3300006048	Bacteria	1158
353	Ga0075363_100245762	3300006048	Bacteria	1030
354	Ga0075364_10068069	3300006051	Bacteria	2341
355	Ga0075364_10199739	3300006051	Bacteria	1355
356	Ga0075364_10275043	3300006051	Bacteria	1145
357	Ga0075364_10348194	3300006051	Bacteria	1010
358	Ga0070715_10008592	3300006163	Bacteria	3564
359	Ga0070715_10457150	3300006163	Bacteria	722
360	Ga0070715_10601127	3300006163	Bacteria	645
361	Ga0070716_100002169	3300006173	Bacteria	9020
362	Ga0070716_100170820	3300006173	Bacteria	1418
363	Ga0070716_100308523	3300006173	Bacteria	1104
364	Ga0070716_100326881	3300006173	Bacteria	1077
365	Ga0070716_100390368	3300006173	Bacteria	998
366	Ga0070716_101040249	3300006173	Bacteria	650
367	Ga0070712_100030018	3300006175	Bacteria	3649
368	Ga0070712_100063019	3300006175	Bacteria	2623
369	Ga0070712_100431704	3300006175	Bacteria	1094
370	Ga0070712_100449185	3300006175	Bacteria	1073
371	Ga0070712_101511906	3300006175	Bacteria	587
372	Ga0075362_10053877	3300006177	Bacteria	1807
373	Ga0075362_10093197	3300006177	Bacteria	1400
374	Ga0075362_10254706	3300006177	Bacteria	864
375	Ga0075362_10363609	3300006177	Bacteria	726
376	Ga0075362_10787110	3300006177	Bacteria	500
377	Ga0075367_10026124	3300006178	Bacteria	3308
378	Ga0075367_10201821	3300006178	Bacteria	1242
379	Ga0075367_10278359	3300006178	Bacteria	1051
380	Ga0075367_10335408	3300006178	Bacteria	953
381	Ga0075367_10344383	3300006178	Bacteria	940
382	Ga0075367_10533272	3300006178	Bacteria	745
383	Ga0075367_10578346	3300006178	Bacteria	714
384	Ga0075369_10004251	3300006186	Bacteria	5276
385	Ga0075369_10013998	3300006186	Bacteria	3196
386	Ga0075369_10098464	3300006186	Bacteria	1310
387	Ga0075369_10201927	3300006186	Bacteria	917
388	Ga0075369_10424955	3300006186	Bacteria	628
389	Ga0075366_10010299	3300006195	Bacteria	5246
390	Ga0075366_10021742	3300006195	Bacteria	3730
391	Ga0075366_10212605	3300006195	Bacteria	1177
392	Ga0075366_10475548	3300006195	Bacteria	772
393	Ga0075366_10478073	3300006195	Bacteria	769
394	Ga0097621_100106844	3300006237	Bacteria	2361
395	Ga0097621_101764728	3300006237	Bacteria	590
396	Ga0075370_10027487	3300006353	Bacteria	3156
397	Ga0075370_10037699	3300006353	Bacteria	2718
398	Ga0075370_10184485	3300006353	Bacteria	1228
399	Ga0075370_10191464	3300006353	Bacteria	1205
400	Ga0075370_10210882	3300006353	Bacteria	1147
401	Ga0075370_10233482	3300006353	Bacteria	1088
402	Ga0075370_10460292	3300006353	Bacteria	766
403	Ga0068871_100292569	3300006358	Bacteria	1427
404	Ga0068871_100406822	3300006358	Bacteria	1213
405	Ga0068871_100481332	3300006358	Bacteria	1116
406	Ga0068871_100929917	3300006358	Bacteria	807
407	Ga0068871_101063631	3300006358	Bacteria	755
408	Ga0075428_100309657	3300006844	Bacteria	1697
409	Ga0075428_101001565	3300006844	Bacteria	884
410	Ga0075431_100456352	3300006847	Bacteria	1273
411	Ga0075434_100013577	3300006871	Bacteria	7761
412	Ga0075434_100120995	3300006871	Bacteria	2633
413	Ga0075434_100632559	3300006871	Bacteria	1089
414	Ga0068865_100120528	3300006881	Bacteria	1950
415	Ga0068865_100165563	3300006881	Bacteria	1690
416	Ga0068865_100472510	3300006881	Bacteria	1040
417	Ga0068865_100747630	3300006881	Bacteria	839
418	Ga0075436_100111391	3300006914	Bacteria	1911
419	Ga0097620_100116432	3300006931	Bacteria	2737
420	Ga0097620_100444931	3300006931	Bacteria	1392
421	Ga0097620_100616844	3300006931	Bacteria	1177
422	Ga0097620_100677561	3300006931	Bacteria	1122
423	Ga0099825_1030695	3300006941	Bacteria	2354
424	Ga0099824_1009785	3300006942	Bacteria	11635
425	Ga0099823_1025693	3300006944	Bacteria	5253
426	Ga0099794_10009516	3300007265	Bacteria	4090
427	Ga0099794_10162650	3300007265	Bacteria	1136
428	Ga0099794_10214856	3300007265	Bacteria	987
429	Ga0099795_10062176	3300007788	Bacteria	1389
430	Ga0099795_10271291	3300007788	Bacteria	738
431	Ga0099795_10330381	3300007788	Bacteria	677
432	Ga0099795_10337946	3300007788	Bacteria	671
433	Ga0105251_10209887	3300009011	Bacteria	877
434	Ga0105251_10268321	3300009011	Bacteria	771
435	Ga0105250_10072153	3300009092	Bacteria	1395
436	Ga0105250_10177584	3300009092	Bacteria	893
437	Ga0105240_10006144	3300009093	Bacteria	17713
438	Ga0105240_10036366	3300009093	Bacteria	6336
439	Ga0105240_10039683	3300009093	Bacteria	6027
440	Ga0105240_10096341	3300009093	Bacteria	3606
441	Ga0105240_10119564	3300009093	Bacteria	3173
442	Ga0105240_10207940	3300009093	Bacteria	2289
443	Ga0105240_10219586	3300009093	Bacteria	2215
444	Ga0105240_10295338	3300009093	Bacteria	1856
445	Ga0105240_10436120	3300009093	Bacteria	1469
446	Ga0105240_11289264	3300009093	Bacteria	771
447	Ga0105240_11594688	3300009093	Bacteria	683
448	Ga0105240_12171052	3300009093	Bacteria	576
449	Ga0105240_12527376	3300009093	Bacteria	531
450	Ga0111539_10059723	3300009094	Bacteria	4521
451	Ga0111539_10838477	3300009094	Bacteria	1070
452	Ga0111539_11261345	3300009094	Bacteria	858
453	Ga0105245_10033417	3300009098	Bacteria	4559
454	Ga0105245_10342710	3300009098	Bacteria	1478
455	Ga0105245_10465342	3300009098	Bacteria	1275
456	Ga0105245_10579864	3300009098	Bacteria	1146
457	Ga0105245_10884425	3300009098	Bacteria	934
458	Ga0105245_12335703	3300009098	Bacteria	588
459	Ga0105245_12643131	3300009098	Bacteria	555
460	Ga0105247_10081778	3300009101	Bacteria	2037
461	Ga0105247_10103396	3300009101	Bacteria	1824
462	Ga0105247_10148137	3300009101	Bacteria	1544
463	Ga0105247_10238850	3300009101	Bacteria	1237
464	Ga0105247_10307147	3300009101	Bacteria	1102
465	Ga0105247_10372976	3300009101	Bacteria	1009
466	Ga0105247_10594718	3300009101	Bacteria	820
467	Ga0114129_10117505	3300009147	Bacteria	3664
468	Ga0114129_12926783	3300009147	Bacteria	564
469	Ga0105243_10117285	3300009148	Bacteria	2238
470	Ga0105243_10237088	3300009148	Bacteria	1621
471	Ga0105243_10475404	3300009148	Bacteria	1178
472	Ga0105243_10638139	3300009148	Bacteria	1030
473	Ga0105243_10766412	3300009148	Bacteria	947
474	Ga0105243_10807389	3300009148	Bacteria	925
475	Ga0105243_11298336	3300009148	Bacteria	745
476	Ga0105243_11942193	3300009148	Bacteria	622
477	Ga0105241_10005046	3300009174	Bacteria	9743
478	Ga0105241_10012991	3300009174	Bacteria	6107
479	Ga0105241_10228155	3300009174	Bacteria	1569
480	Ga0105241_10303976	3300009174	Bacteria	1370
481	Ga0105241_10392229	3300009174	Bacteria	1216
482	Ga0105241_10498377	3300009174	Bacteria	1085
483	Ga0105241_10848833	3300009174	Bacteria	845
484	Ga0105241_11337549	3300009174	Bacteria	684
485	Ga0105242_10125235	3300009176	Bacteria	2211
486	Ga0105242_10529746	3300009176	Bacteria	1126
487	Ga0105242_10811960	3300009176	Bacteria	927
488	Ga0105242_10977584	3300009176	Bacteria	852
489	Ga0105242_11949168	3300009176	Bacteria	629
490	Ga0105248_10100624	3300009177	Bacteria	3257
491	Ga0105248_10136394	3300009177	Bacteria	2768
492	Ga0105248_10170027	3300009177	Bacteria	2456
493	Ga0105248_10172325	3300009177	Bacteria	2439
494	Ga0105248_10531690	3300009177	Bacteria	1326
495	Ga0105248_10538798	3300009177	Bacteria	1317
496	Ga0105248_10598528	3300009177	Bacteria	1244
497	Ga0105248_10617389	3300009177	Bacteria	1223
498	Ga0105248_10702774	3300009177	Bacteria	1141
499	Ga0105237_10019216	3300009545	Bacteria	7060
500	Ga0105237_10035450	3300009545	Bacteria	5049
501	Ga0105237_10045790	3300009545	Bacteria	4401
502	Ga0105237_10050229	3300009545	Bacteria	4190
503	Ga0105237_10109815	3300009545	Bacteria	2750
504	Ga0105237_10156853	3300009545	Bacteria	2273
505	Ga0105237_10174649	3300009545	Bacteria	2149
506	Ga0105237_10290921	3300009545	Bacteria	1636
507	Ga0105237_10319836	3300009545	Bacteria	1555
508	Ga0105237_10445331	3300009545	Bacteria	1301
509	Ga0105237_10762577	3300009545	Bacteria	974
510	Ga0105237_10952843	3300009545	Bacteria	865
511	Ga0105237_10957034	3300009545	Bacteria	863
512	Ga0105237_11202466	3300009545	Bacteria	764
513	Ga0105237_12092957	3300009545	Bacteria	575
514	Ga0105238_10012578	3300009551	Bacteria	8543
515	Ga0105238_10015975	3300009551	Bacteria	7595
516	Ga0105238_10020486	3300009551	Bacteria	6733
517	Ga0105238_10044774	3300009551	Bacteria	4472
518	Ga0105238_10106923	3300009551	Bacteria	2779
519	Ga0105238_10335677	3300009551	Bacteria	1499
520	Ga0105238_10358912	3300009551	Bacteria	1446
521	Ga0105238_10442492	3300009551	Bacteria	1296
522	Ga0105238_10497580	3300009551	Bacteria	1219
523	Ga0105238_10595242	3300009551	Bacteria	1113
524	Ga0105238_10713307	3300009551	Bacteria	1015
525	Ga0105238_11141106	3300009551	Bacteria	803
526	Ga0105238_11142011	3300009551	Bacteria	802
527	Ga0105249_10202545	3300009553	Bacteria	1943
528	Ga0105249_10344930	3300009553	Bacteria	1507
529	Ga0105249_10405176	3300009553	Bacteria	1395
530	Ga0105249_10449246	3300009553	Bacteria	1327
531	Ga0105249_10764069	3300009553	Bacteria	1029
532	Ga0105249_10927548	3300009553	Bacteria	938
533	Ga0105249_11073166	3300009553	Bacteria	875
534	Ga0099796_10088397	3300010159	Bacteria	1148
535	Ga0099796_10279536	3300010159	Bacteria	701
536	Ga0099796_10288862	3300010159	Bacteria	692
537	Ga0105239_10010073	3300010375	Bacteria	10596
538	Ga0105239_10018253	3300010375	Bacteria	7756
539	Ga0105239_10036146	3300010375	Bacteria	5424
540	Ga0105239_10052959	3300010375	Bacteria	4452
541	Ga0105239_10066298	3300010375	Bacteria	3966
542	Ga0105239_10069280	3300010375	Bacteria	3876
543	Ga0105239_10128415	3300010375	Bacteria	2818
544	Ga0105239_10187792	3300010375	Bacteria	2313
545	Ga0105239_10249451	3300010375	Bacteria	1994
546	Ga0105239_10442358	3300010375	Bacteria	1474
547	Ga0105239_10643929	3300010375	Bacteria	1210
548	Ga0105239_10693522	3300010375	Bacteria	1164
549	Ga0105239_10858869	3300010375	Bacteria	1041
550	Ga0105239_11746778	3300010375	Bacteria	720
551	Ga0105246_10041256	3300011119	Bacteria	3118
552	Ga0105246_10113971	3300011119	Bacteria	1991
553	Ga0105246_10424855	3300011119	Bacteria	1110
554	Ga0105246_11038293	3300011119	Bacteria	744
555	Ga0105246_11191745	3300011119	Bacteria	700
556	Ga0105246_11198084	3300011119	Bacteria	699
557	Ga0105246_11359153	3300011119	Bacteria	661
558	Ga0105246_11647065	3300011119	Bacteria	608
559	Ga0105246_12326413	3300011119	Bacteria	524
560	Ga0157373_10155596	3300013100	Bacteria	1608
561	Ga0157373_11418321	3300013100	Bacteria	528
562	Ga0157371_10028952	3300013102	Bacteria	4010
563	Ga0157371_10499253	3300013102	Bacteria	898
564	Ga0157370_10368792	3300013104	Bacteria	1323
565	Ga0157370_10391364	3300013104	Bacteria	1280
566	Ga0157370_10710501	3300013104	Bacteria	917
567	Ga0157370_10718894	3300013104	Bacteria	911
568	Ga0157370_10825420	3300013104	Bacteria	843
569	Ga0157369_10010630	3300013105	Bacteria	10476
570	Ga0157369_10044218	3300013105	Bacteria	4849
571	Ga0157369_10054787	3300013105	Bacteria	4305
572	Ga0157369_10333716	3300013105	Bacteria	1575
573	Ga0157369_10683750	3300013105	Bacteria	1057
574	Ga0157369_10830730	3300013105	Bacteria	949
575	Ga0157369_11076882	3300013105	Bacteria	822
576	Ga0157369_11776454	3300013105	Bacteria	626
577	Ga0157374_10041810	3300013296	Bacteria	4226
578	Ga0157374_10249374	3300013296	Bacteria	1747
579	Ga0157374_10260784	3300013296	Bacteria	1707
580	Ga0157374_10455858	3300013296	Bacteria	1280
581	Ga0157374_11198427	3300013296	Bacteria	781
582	Ga0157374_11716801	3300013296	Bacteria	653
583	Ga0157378_10019963	3300013297	Bacteria	5893
584	Ga0157378_10286678	3300013297	Bacteria	1589
585	Ga0157378_10672311	3300013297	Bacteria	1053
586	Ga0157378_11140247	3300013297	Bacteria	818
587	Ga0157378_12125720	3300013297	Bacteria	612
588	Ga0157378_12131405	3300013297	Bacteria	611
589	Ga0163162_10123771	3300013306	Bacteria	2691
590	Ga0163162_10427077	3300013306	Bacteria	1457
591	Ga0163162_10799541	3300013306	Bacteria	1061
592	Ga0163162_10895978	3300013306	Bacteria	1000
593	Ga0163162_10904467	3300013306	Bacteria	996
594	Ga0163162_10987188	3300013306	Bacteria	952
595	Ga0163162_11039447	3300013306	Bacteria	927
596	Ga0163162_11399487	3300013306	Bacteria	796
597	Ga0163162_11538616	3300013306	Bacteria	758
598	Ga0163162_11665156	3300013306	Bacteria	728
599	Ga0157372_10151028	3300013307	Bacteria	2681
600	Ga0157372_10560753	3300013307	Bacteria	1331
601	Ga0157372_11049922	3300013307	Bacteria	943
602	Ga0157372_12438891	3300013307	Bacteria	600
603	Ga0157375_10078997	3300013308	Bacteria	3325
604	Ga0157375_10648218	3300013308	Bacteria	1212
605	Ga0157375_10827279	3300013308	Bacteria	1074
606	Ga0157375_13519136	3300013308	Bacteria	521
607	Ga0163163_10066441	3300014325	Bacteria	3582
608	Ga0163163_10142848	3300014325	Bacteria	2436
609	Ga0163163_10261960	3300014325	Bacteria	1780
610	Ga0163163_10341313	3300014325	Bacteria	1553
611	Ga0163163_10342235	3300014325	Bacteria	1551
612	Ga0163163_10433414	3300014325	Bacteria	1374
613	Ga0163163_10545480	3300014325	Bacteria	1222
614	Ga0163163_10761685	3300014325	Bacteria	1031
615	Ga0163163_11170213	3300014325	Bacteria	832
616	Ga0157380_10125033	3300014326	Bacteria	2184
617	Ga0157380_10190365	3300014326	Bacteria	1811
618	Ga0157380_13044767	3300014326	Bacteria	534
619	Ga0157377_10149389	3300014745	Bacteria	1443
620	Ga0157377_10390598	3300014745	Bacteria	945
621	Ga0157377_10445350	3300014745	Bacteria	893
622	Ga0157379_10402111	3300014968	Bacteria	1259
623	Ga0157379_10983162	3300014968	Bacteria	804
624	Ga0157379_11037771	3300014968	Bacteria	783
625	Ga0157379_11548039	3300014968	Bacteria	646
626	Ga0157379_11754881	3300014968	Bacteria	609
627	Ga0157376_10065394	3300014969	Bacteria	3070
628	Ga0157376_10138803	3300014969	Bacteria	2178
629	Ga0157376_10253811	3300014969	Bacteria	1644
630	Ga0157376_10579414	3300014969	Bacteria	1114
631	Ga0157376_10616255	3300014969	Bacteria	1082
632	Ga0157376_10784142	3300014969	Bacteria	965
633	Ga0157376_10826571	3300014969	Bacteria	940
634	Ga0157376_10964310	3300014969	Bacteria	874
635	Ga0157376_11582180	3300014969	Bacteria	689
636	Ga0182006_1132238	3300015261	Bacteria	858
637	Ga0163161_10170943	3300017792	Bacteria	1662
638	Ga0163161_11018895	3300017792	Bacteria	708
639	Ga0163161_11085158	3300017792	Bacteria	687
640	Ga0163161_11589195	3300017792	Bacteria	576
641	Ga0214544_1000665	3300021320	Bacteria	65630
642	Ga0214542_1000486	3300021321	Bacteria	71884
643	Ga0214542_1033705	3300021321	Bacteria	1708
644	Ga0214545_1000307	3300021324	Bacteria	71884
645	Ga0214545_1034829	3300021324	Bacteria	1708
646	Ga0214543_1003627	3300021327	Bacteria	29806
647	Ga0213872_10383711	3300021361	Bacteria	572
648	Ga0213874_10093830	3300021377	Bacteria	989
649	Ga0213876_10220879	3300021384	Bacteria	1007
650	Ga0213876_10319346	3300021384	Bacteria	826
651	Ga0213875_10185909	3300021388	Bacteria	976
652	Ga0213875_10224281	3300021388	Bacteria	885
653	Ga0213875_10396757	3300021388	Bacteria	658
654	Ga0224572_1099984	3300024225	Bacteria	536
655	Ga0209563_105662	3300025230	Bacteria	2234
656	Ga0209563_113060	3300025230	Bacteria	1109
657	Ga0207425_1024421	3300025245	Bacteria	1255
658	Ga0209677_101407	3300025253	Bacteria	10444
659	Ga0209677_102409	3300025253	Bacteria	7084
660	Ga0209148_1002869	3300025254	Bacteria	5287
661	Ga0209233_1006290	3300025261	Bacteria	3841
662	Ga0209233_1050197	3300025261	Bacteria	853
663	Ga0209455_1016503	3300025272	Bacteria	1584
664	Ga0209455_1016828	3300025272	Bacteria	1555
665	Ga0209455_1030674	3300025272	Bacteria	913
666	Ga0209455_1054013	3300025272	Bacteria	550
667	Ga0209564_1006329	3300025295	Bacteria	6431
668	Ga0209564_1010374	3300025295	Bacteria	4298
669	Ga0209758_1000069	3300025297	Bacteria	286161
670	Ga0209758_1004973	3300025297	Bacteria	10629
671	Ga0209758_1006237	3300025297	Bacteria	8697
672	Ga0209758_1007493	3300025297	Bacteria	7402
673	Ga0209758_1022223	3300025297	Bacteria	2921
674	Ga0209758_1078408	3300025297	Bacteria	1009
675	Ga0209758_1116264	3300025297	Bacteria	730
676	Ga0209256_1013889	3300025299	Bacteria	2952
677	Ga0209256_1019703	3300025299	Bacteria	2136
678	Ga0209256_1042553	3300025299	Bacteria	1146
679	Ga0207426_1004682	3300025302	Bacteria	6567
680	Ga0207426_1009855	3300025302	Bacteria	3745
681	Ga0207426_1040853	3300025302	Bacteria	1442
682	Ga0207426_1051534	3300025302	Bacteria	1222
683	Ga0209051_1088252	3300025303	Bacteria	871
684	Ga0209257_1004258	3300025304	Bacteria	11292
685	Ga0207697_10055509	3300025315	Bacteria	1642
686	Ga0207697_10092804	3300025315	Bacteria	1280
687	Ga0207656_10003104	3300025321	Bacteria	5689
688	Ga0207656_10049672	3300025321	Bacteria	1809
689	Ga0207653_10024181	3300025885	Bacteria	1938
690	Ga0207682_10022717	3300025893	Bacteria	2473
691	Ga0207682_10557460	3300025893	Bacteria	541
692	Ga0207692_10001569	3300025898	Bacteria	8596
693	Ga0207692_10209620	3300025898	Bacteria	1150
694	Ga0207692_10234012	3300025898	Bacteria	1094
695	Ga0207642_10193790	3300025899	Bacteria	1117
696	Ga0207642_10335005	3300025899	Bacteria	888
697	Ga0207710_10043959	3300025900	Bacteria	1989
698	Ga0207710_10092236	3300025900	Bacteria	1419
699	Ga0207710_10179671	3300025900	Bacteria	1038
700	Ga0207710_10190154	3300025900	Bacteria	1010
701	Ga0207688_10100071	3300025901	Bacteria	1673
702	Ga0207688_10123230	3300025901	Bacteria	1514
703	Ga0207688_10123995	3300025901	Bacteria	1509
704	Ga0207688_10540176	3300025901	Bacteria	732
705	Ga0207688_10610020	3300025901	Bacteria	688
706	Ga0207688_10717795	3300025901	Bacteria	632
707	Ga0207680_10226822	3300025903	Bacteria	1283
708	Ga0207680_10271105	3300025903	Bacteria	1177
709	Ga0207647_10008467	3300025904	Bacteria	7372
710	Ga0207647_10022012	3300025904	Bacteria	4241
711	Ga0207647_10193519	3300025904	Bacteria	1178
712	Ga0207647_10252050	3300025904	Bacteria	1012
713	Ga0207647_10282075	3300025904	Bacteria	948
714	Ga0207685_10392924	3300025905	Bacteria	709
715	Ga0207685_10399324	3300025905	Bacteria	704
716	Ga0207699_10000184	3300025906	Bacteria	37990
717	Ga0207699_10028955	3300025906	Bacteria	3084
718	Ga0207699_10240927	3300025906	Bacteria	1242
719	Ga0207699_10425809	3300025906	Bacteria	949
720	Ga0207645_10017314	3300025907	Bacteria	4759
721	Ga0207645_10335201	3300025907	Bacteria	1011
722	Ga0207643_10109464	3300025908	Bacteria	1626
723	Ga0207643_10175148	3300025908	Bacteria	1296
724	Ga0207705_10617310	3300025909	Bacteria	843
725	Ga0207705_10655776	3300025909	Bacteria	816
726	Ga0207684_10241982	3300025910	Bacteria	1557
727	Ga0207684_10379533	3300025910	Bacteria	1216
728	Ga0207654_10000210	3300025911	Bacteria	35799
729	Ga0207654_10012855	3300025911	Bacteria	4295
730	Ga0207654_10205126	3300025911	Bacteria	1300
731	Ga0207654_10232945	3300025911	Bacteria	1227
732	Ga0207654_10297353	3300025911	Bacteria	1097
733	Ga0207707_10001217	3300025912	Bacteria	24173
734	Ga0207707_10001310	3300025912	Bacteria	23197
735	Ga0207707_10004329	3300025912	Bacteria	12571
736	Ga0207707_10025404	3300025912	Bacteria	5182
737	Ga0207707_10497265	3300025912	Bacteria	1040
738	Ga0207707_10804918	3300025912	Bacteria	783
739	Ga0207695_10000148	3300025913	Bacteria	208344
740	Ga0207695_10001435	3300025913	Bacteria	40061
741	Ga0207695_10010844	3300025913	Bacteria	11100
742	Ga0207695_10125406	3300025913	Bacteria	2531
743	Ga0207695_10128886	3300025913	Bacteria	2489
744	Ga0207695_10154050	3300025913	Bacteria	2234
745	Ga0207695_10346381	3300025913	Bacteria	1373
746	Ga0207695_10488423	3300025913	Bacteria	1113
747	Ga0207695_11079262	3300025913	Bacteria	683
748	Ga0207671_10019101	3300025914	Bacteria	5249
749	Ga0207671_10041473	3300025914	Bacteria	3407
750	Ga0207671_10094407	3300025914	Bacteria	2258
751	Ga0207671_10100917	3300025914	Bacteria	2186
752	Ga0207671_10109371	3300025914	Bacteria	2101
753	Ga0207671_10146451	3300025914	Bacteria	1822
754	Ga0207671_10155314	3300025914	Bacteria	1770
755	Ga0207671_10279107	3300025914	Bacteria	1317
756	Ga0207671_10314458	3300025914	Bacteria	1238
757	Ga0207671_10369998	3300025914	Bacteria	1138
758	Ga0207671_10404952	3300025914	Bacteria	1085
759	Ga0207671_10470066	3300025914	Bacteria	1002
760	Ga0207671_10524677	3300025914	Bacteria	944
761	Ga0207671_10568096	3300025914	Bacteria	904
762	Ga0207671_11313488	3300025914	Bacteria	563
763	Ga0207693_10072567	3300025915	Bacteria	2695
764	Ga0207693_10142591	3300025915	Bacteria	1884
765	Ga0207693_10157500	3300025915	Bacteria	1786
766	Ga0207693_10232007	3300025915	Bacteria	1449
767	Ga0207693_10272528	3300025915	Bacteria	1326
768	Ga0207693_10442653	3300025915	Bacteria	1016
769	Ga0207663_10003478	3300025916	Bacteria	7705
770	Ga0207663_10769376	3300025916	Bacteria	766
771	Ga0207663_10944745	3300025916	Bacteria	690
772	Ga0207663_11215968	3300025916	Bacteria	607
773	Ga0207660_10001470	3300025917	Bacteria	15854
774	Ga0207660_10023266	3300025917	Bacteria	4183
775	Ga0207660_10117946	3300025917	Bacteria	2007
776	Ga0207660_10170712	3300025917	Bacteria	1683
777	Ga0207660_10184862	3300025917	Bacteria	1620
778	Ga0207660_10366098	3300025917	Bacteria	1157
779	Ga0207660_10460683	3300025917	Bacteria	1029
780	Ga0207657_10038374	3300025919	Bacteria	4265
781	Ga0207657_10077106	3300025919	Bacteria	2810
782	Ga0207657_10194382	3300025919	Bacteria	1635
783	Ga0207657_10197792	3300025919	Bacteria	1618
784	Ga0207657_10279479	3300025919	Bacteria	1325
785	Ga0207657_10451733	3300025919	Bacteria	1008
786	Ga0207657_10471671	3300025919	Bacteria	984
787	Ga0207649_10085619	3300025920	Bacteria	2051
788	Ga0207649_10091603	3300025920	Bacteria	1991
789	Ga0207649_10928532	3300025920	Bacteria	683
790	Ga0207652_10007361	3300025921	Bacteria	8875
791	Ga0207652_10008150	3300025921	Bacteria	8413
792	Ga0207652_10235163	3300025921	Bacteria	1651
793	Ga0207646_10137427	3300025922	Bacteria	2201
794	Ga0207681_10278865	3300025923	Bacteria	1315
795	Ga0207681_10688523	3300025923	Bacteria	849
796	Ga0207694_10000106	3300025924	Bacteria	88467
797	Ga0207694_10014114	3300025924	Bacteria	6023
798	Ga0207694_10132052	3300025924	Bacteria	2002
799	Ga0207694_10137641	3300025924	Bacteria	1962
800	Ga0207694_10258445	3300025924	Bacteria	1426
801	Ga0207694_10305966	3300025924	Bacteria	1309
802	Ga0207694_10599110	3300025924	Bacteria	927
803	Ga0207650_10217170	3300025925	Bacteria	1538
804	Ga0207650_10699003	3300025925	Bacteria	856
805	Ga0207659_10280576	3300025926	Bacteria	1362
806	Ga0207687_10167498	3300025927	Bacteria	1692
807	Ga0207687_10171455	3300025927	Bacteria	1674
808	Ga0207687_10272674	3300025927	Bacteria	1353
809	Ga0207687_10273290	3300025927	Bacteria	1352
810	Ga0207687_10711265	3300025927	Bacteria	853
811	Ga0207687_11362084	3300025927	Bacteria	610
812	Ga0207700_10011338	3300025928	Bacteria	5678
813	Ga0207700_10025049	3300025928	Bacteria	4137
814	Ga0207700_10155038	3300025928	Bacteria	1897
815	Ga0207700_10204584	3300025928	Bacteria	1665
816	Ga0207700_10587844	3300025928	Bacteria	990
817	Ga0207700_10589279	3300025928	Bacteria	989
818	Ga0207700_11062113	3300025928	Bacteria	724
819	Ga0207700_11062730	3300025928	Bacteria	724
820	Ga0207664_10020055	3300025929	Bacteria	4948
821	Ga0207664_10043902	3300025929	Bacteria	3498
822	Ga0207664_10169916	3300025929	Bacteria	1865
823	Ga0207664_10295265	3300025929	Bacteria	1425
824	Ga0207664_10907579	3300025929	Bacteria	791
825	Ga0207664_11266283	3300025929	Bacteria	656
826	Ga0207664_11386874	3300025929	Bacteria	623
827	Ga0207644_10070282	3300025931	Bacteria	2558
828	Ga0207644_10246060	3300025931	Bacteria	1425
829	Ga0207644_11029778	3300025931	Bacteria	691
830	Ga0207690_10023344	3300025932	Bacteria	3859
831	Ga0207690_10108580	3300025932	Bacteria	1994
832	Ga0207690_10152001	3300025932	Bacteria	1717
833	Ga0207690_10713065	3300025932	Bacteria	825
834	Ga0207690_10809550	3300025932	Bacteria	774
835	Ga0207690_11660783	3300025932	Bacteria	534
836	Ga0207706_10039352	3300025933	Bacteria	4192
837	Ga0207706_10066273	3300025933	Bacteria	3178
838	Ga0207706_10209358	3300025933	Bacteria	1709
839	Ga0207706_10376951	3300025933	Bacteria	1231
840	Ga0207686_10097640	3300025934	Bacteria	1954
841	Ga0207686_10216247	3300025934	Bacteria	1381
842	Ga0207709_10077279	3300025935	Bacteria	2134
843	Ga0207709_10336471	3300025935	Bacteria	1135
844	Ga0207709_10934657	3300025935	Bacteria	706
845	Ga0207670_10615636	3300025936	Bacteria	893
846	Ga0207669_10063465	3300025937	Bacteria	2280
847	Ga0207669_10240959	3300025937	Bacteria	1340
848	Ga0207669_11253198	3300025937	Bacteria	629
849	Ga0207669_11414966	3300025937	Bacteria	592
850	Ga0207669_11535071	3300025937	Bacteria	568
851	Ga0207704_10334428	3300025938	Bacteria	1173
852	Ga0207704_10484619	3300025938	Bacteria	994
853	Ga0207665_10021482	3300025939	Bacteria	4245
854	Ga0207665_10028607	3300025939	Bacteria	3682
855	Ga0207665_10092690	3300025939	Bacteria	2096
856	Ga0207665_10098942	3300025939	Bacteria	2033
857	Ga0207665_10286110	3300025939	Bacteria	1228
858	Ga0207665_10538098	3300025939	Bacteria	906
859	Ga0207691_10297282	3300025940	Bacteria	1387
860	Ga0207691_10880544	3300025940	Bacteria	750
861	Ga0207711_10027126	3300025941	Bacteria	4810
862	Ga0207711_10282457	3300025941	Bacteria	1529
863	Ga0207711_10373114	3300025941	Bacteria	1323
864	Ga0207711_10547297	3300025941	Bacteria	1079
865	Ga0207711_10756752	3300025941	Bacteria	905
866	Ga0207711_10854942	3300025941	Bacteria	846
867	Ga0207711_10889558	3300025941	Bacteria	828
868	Ga0207711_10908664	3300025941	Bacteria	818
869	Ga0207711_11264817	3300025941	Bacteria	680
870	Ga0207711_11328878	3300025941	Bacteria	661
871	Ga0207689_10271414	3300025942	Bacteria	1404
872	Ga0207689_10564362	3300025942	Bacteria	956
873	Ga0207689_10598029	3300025942	Bacteria	928
874	Ga0207689_10601683	3300025942	Bacteria	925
875	Ga0207661_10001291	3300025944	Bacteria	16759
876	Ga0207661_10056903	3300025944	Bacteria	3142
877	Ga0207661_10133258	3300025944	Bacteria	2131
878	Ga0207661_10158270	3300025944	Bacteria	1963
879	Ga0207661_10422282	3300025944	Bacteria	1211
880	Ga0207661_11680513	3300025944	Bacteria	580
881	Ga0207679_10113908	3300025945	Bacteria	2140
882	Ga0207679_10284568	3300025945	Bacteria	1419
883	Ga0207679_10384742	3300025945	Bacteria	1231
884	Ga0207679_10679086	3300025945	Bacteria	933
885	Ga0207679_10898331	3300025945	Bacteria	810
886	Ga0207679_11087816	3300025945	Bacteria	733
887	Ga0207679_11263187	3300025945	Bacteria	678
888	Ga0207667_10001909	3300025949	Bacteria	26170
889	Ga0207667_10010685	3300025949	Bacteria	10714
890	Ga0207667_10031593	3300025949	Bacteria	5714
891	Ga0207667_10254661	3300025949	Bacteria	1796
892	Ga0207667_10283600	3300025949	Bacteria	1692
893	Ga0207667_10300616	3300025949	Bacteria	1640
894	Ga0207667_10316780	3300025949	Bacteria	1593
895	Ga0207667_10322517	3300025949	Bacteria	1577
896	Ga0207667_10500169	3300025949	Bacteria	1233
897	Ga0207667_10522993	3300025949	Bacteria	1202
898	Ga0207667_10689733	3300025949	Bacteria	1024
899	Ga0207667_10818908	3300025949	Bacteria	927
900	Ga0207667_10870337	3300025949	Bacteria	894
901	Ga0207667_10949434	3300025949	Bacteria	849
902	Ga0207667_11361309	3300025949	Bacteria	684
903	Ga0207651_10185417	3300025960	Bacteria	1655
904	Ga0207651_10194527	3300025960	Bacteria	1620
905	Ga0207651_11192982	3300025960	Bacteria	683
906	Ga0207712_10091411	3300025961	Bacteria	2242
907	Ga0207712_10154765	3300025961	Bacteria	1775
908	Ga0207712_10259657	3300025961	Bacteria	1408
909	Ga0207712_10452059	3300025961	Bacteria	1090
910	Ga0207668_10068763	3300025972	Bacteria	2519
911	Ga0207668_10069665	3300025972	Bacteria	2505
912	Ga0207668_10131842	3300025972	Bacteria	1909
913	Ga0207668_10365065	3300025972	Bacteria	1211
914	Ga0207668_10790626	3300025972	Bacteria	839
915	Ga0207668_10975743	3300025972	Bacteria	756
916	Ga0207668_11282022	3300025972	Bacteria	659
917	Ga0207640_10010346	3300025981	Bacteria	5253
918	Ga0207640_10018761	3300025981	Bacteria	4071
919	Ga0207640_10019123	3300025981	Bacteria	4041
920	Ga0207640_10144473	3300025981	Bacteria	1739
921	Ga0207640_10167668	3300025981	Bacteria	1632
922	Ga0207640_10290504	3300025981	Bacteria	1289
923	Ga0207640_10350994	3300025981	Bacteria	1185
924	Ga0207640_10664207	3300025981	Bacteria	890
925	Ga0207640_10681477	3300025981	Bacteria	879
926	Ga0207640_10889592	3300025981	Bacteria	777
927	Ga0207658_10396513	3300025986	Bacteria	1212
928	Ga0207658_10440086	3300025986	Bacteria	1152
929	Ga0207658_10478985	3300025986	Bacteria	1106
930	Ga0207658_10669603	3300025986	Bacteria	936
931	Ga0207658_10732860	3300025986	Bacteria	894
932	Ga0207658_10803576	3300025986	Bacteria	854
933	Ga0207677_10122455	3300026023	Bacteria	1959
934	Ga0207677_10143041	3300026023	Bacteria	1834
935	Ga0207677_10325266	3300026023	Bacteria	1279
936	Ga0207677_10712161	3300026023	Bacteria	892
937	Ga0207703_10145647	3300026035	Bacteria	2060
938	Ga0207703_10421338	3300026035	Bacteria	1242
939	Ga0207703_10436249	3300026035	Bacteria	1221
940	Ga0207703_10572319	3300026035	Bacteria	1067
941	Ga0207703_10642017	3300026035	Bacteria	1006
942	Ga0207703_10747840	3300026035	Bacteria	931
943	Ga0207639_10002676	3300026041	Bacteria	11963
944	Ga0207639_10017628	3300026041	Bacteria	5063
945	Ga0207639_10116550	3300026041	Bacteria	2187
946	Ga0207639_10141440	3300026041	Bacteria	2005
947	Ga0207639_10240085	3300026041	Bacteria	1575
948	Ga0207639_10269968	3300026041	Bacteria	1492
949	Ga0207639_10286472	3300026041	Bacteria	1451
950	Ga0207639_10352694	3300026041	Bacteria	1314
951	Ga0207639_10385400	3300026041	Bacteria	1260
952	Ga0207639_10504047	3300026041	Bacteria	1106
953	Ga0207639_10738165	3300026041	Bacteria	915
954	Ga0207639_11273240	3300026041	Bacteria	690
955	Ga0207678_10041532	3300026067	Bacteria	3988
956	Ga0207678_10093640	3300026067	Bacteria	2567
957	Ga0207678_10105285	3300026067	Bacteria	2407
958	Ga0207678_10139874	3300026067	Bacteria	2066
959	Ga0207678_10179375	3300026067	Bacteria	1808
960	Ga0207678_10297736	3300026067	Bacteria	1386
961	Ga0207678_10540012	3300026067	Bacteria	1019
962	Ga0207678_10547826	3300026067	Bacteria	1011
963	Ga0207678_10660344	3300026067	Bacteria	919
964	Ga0207678_11511272	3300026067	Bacteria	593
965	Ga0207708_10055153	3300026075	Bacteria	3030
966	Ga0207708_10234680	3300026075	Bacteria	1473
967	Ga0207708_10407821	3300026075	Bacteria	1125
968	Ga0207702_10000004	3300026078	Bacteria	422182
969	Ga0207702_10000318	3300026078	Bacteria	55209
970	Ga0207702_10169714	3300026078	Bacteria	1999
971	Ga0207702_10229417	3300026078	Bacteria	1734
972	Ga0207702_10279831	3300026078	Bacteria	1577
973	Ga0207702_10281269	3300026078	Bacteria	1573
974	Ga0207702_10378373	3300026078	Bacteria	1361
975	Ga0207702_10572759	3300026078	Bacteria	1106
976	Ga0207702_10824663	3300026078	Bacteria	917
977	Ga0207702_11225635	3300026078	Bacteria	744
978	Ga0207702_11228218	3300026078	Bacteria	744
979	Ga0207702_11279074	3300026078	Bacteria	728
980	Ga0207641_10457509	3300026088	Bacteria	1234
981	Ga0207641_10613685	3300026088	Bacteria	1066
982	Ga0207648_10181443	3300026089	Bacteria	1863
983	Ga0207648_10369983	3300026089	Bacteria	1294
984	Ga0207676_10066567	3300026095	Bacteria	2874
985	Ga0207676_10271486	3300026095	Bacteria	1536
986	Ga0207676_10401302	3300026095	Bacteria	1281
987	Ga0207676_10507155	3300026095	Bacteria	1146
988	Ga0207676_10898561	3300026095	Bacteria	869
989	Ga0207674_10018238	3300026116	Bacteria	7634
990	Ga0207674_10066904	3300026116	Bacteria	3618
991	Ga0207674_10074915	3300026116	Bacteria	3395
992	Ga0207674_10197797	3300026116	Bacteria	1960
993	Ga0207674_10214062	3300026116	Bacteria	1876
994	Ga0207674_10222230	3300026116	Bacteria	1837
995	Ga0207674_10280932	3300026116	Bacteria	1613
996	Ga0207674_10571526	3300026116	Bacteria	1092
997	Ga0207674_11211860	3300026116	Bacteria	724
998	Ga0207675_100077770	3300026118	Bacteria	3108
999	Ga0207675_100163338	3300026118	Bacteria	2126
1000	Ga0207675_100391698	3300026118	Bacteria	1368
1001	Ga0207675_100570876	3300026118	Bacteria	1132
1002	Ga0207675_100592030	3300026118	Bacteria	1111
1003	Ga0207675_100813435	3300026118	Bacteria	948
1004	Ga0207683_10067115	3300026121	Bacteria	3164
1005	Ga0207683_10127400	3300026121	Bacteria	2289
1006	Ga0207683_10258297	3300026121	Bacteria	1591
1007	Ga0207683_10296531	3300026121	Bacteria	1479
1008	Ga0207683_10297294	3300026121	Bacteria	1477
1009	Ga0207683_10660437	3300026121	Bacteria	969
1010	Ga0207698_10013935	3300026142	Bacteria	5325
1011	Ga0207698_10014635	3300026142	Bacteria	5222
1012	Ga0207698_10069148	3300026142	Bacteria	2791
1013	Ga0207698_10124068	3300026142	Bacteria	2192
1014	Ga0207698_10345875	3300026142	Bacteria	1402
1015	Ga0207698_10429817	3300026142	Bacteria	1269
1016	Ga0207698_10558070	3300026142	Bacteria	1124
1017	Ga0207698_10609631	3300026142	Bacteria	1077
1018	Ga0207698_10804619	3300026142	Bacteria	942
1019	Ga0207698_11084197	3300026142	Bacteria	813
1020	Ga0207698_11303264	3300026142	Bacteria	741
1021	Ga0207698_11751052	3300026142	Bacteria	637
1022	Ga0209389_1000102	3300027296	Bacteria	78475
1023	Ga0209389_1000142	3300027296	Bacteria	62072
1024	Ga0209589_1000035	3300027357	Bacteria	134091
1025	Ga0209589_1000331	3300027357	Bacteria	62072
1026	Ga0209489_100079	3300027361	Bacteria	134091
1027	Ga0209489_100404	3300027361	Bacteria	78473
1028	Ga0209489_100818	3300027361	Bacteria	62070
1029	Ga0209700_100077	3300027363	Bacteria	134091
1030	Ga0209700_100408	3300027363	Bacteria	78496
1031	Ga0209179_1006992	3300027512	Bacteria	1846
1032	Ga0209179_1013766	3300027512	Bacteria	1475
1033	Ga0209588_1002870	3300027671	Bacteria	4731
1034	Ga0209813_10004333	3300027866	Bacteria	3385
1035	Ga0209813_10059173	3300027866	Bacteria	1219
1036	Ga0209813_10123751	3300027866	Bacteria	903
1037	Ga0209813_10181557	3300027866	Bacteria	770
1038	Ga0209813_10257335	3300027866	Bacteria	665
1039	Ga0207428_10311307	3300027907	Bacteria	1164
1040	Ga0268266_10001335	3300028379	Bacteria	29884
1041	Ga0268266_10049648	3300028379	Bacteria	3598
1042	Ga0268266_10068023	3300028379	Bacteria	3083
1043	Ga0268266_10073499	3300028379	Bacteria	2967
1044	Ga0268266_10143204	3300028379	Bacteria	2146
1045	Ga0268266_10279577	3300028379	Bacteria	1551
1046	Ga0268266_10403776	3300028379	Bacteria	1292
1047	Ga0268266_10504487	3300028379	Bacteria	1155
1048	Ga0268266_10760295	3300028379	Bacteria	935
1049	Ga0268266_10884979	3300028379	Bacteria	863
1050	Ga0268266_10907085	3300028379	Bacteria	852
1051	Ga0268265_10084542	3300028380	Bacteria	2515
1052	Ga0268265_10298166	3300028380	Bacteria	1450
1053	Ga0268265_10394590	3300028380	Bacteria	1277
1054	Ga0268265_10545068	3300028380	Bacteria	1100
1055	Ga0268265_10599593	3300028380	Bacteria	1052
1056	Ga0268265_11067191	3300028380	Bacteria	800
1057	Ga0268265_11664922	3300028380	Bacteria	643
1058	Ga0268264_10000062	3300028381	Bacteria	302110
1059	Ga0268264_10481814	3300028381	Bacteria	1207
1060	Ga0268264_10483967	3300028381	Bacteria	1204
1061	Ga0268264_10698722	3300028381	Bacteria	1007
1062	Ga0268264_10949244	3300028381	Bacteria	865
1063	Ga0265337_1015278	3300028556	Bacteria	2518
1064	Ga0265319_1016635	3300028563	Bacteria	2817
1065	Ga0265334_10005996	3300028573	Bacteria	5279
1066	Ga0265334_10007481	3300028573	Bacteria	4685
1067	Ga0265318_10025123	3300028577	Bacteria	2356
1068	Ga0265323_10008358	3300028653	Bacteria	4272
1069	Ga0265336_10005997	3300028666	Bacteria	4428
1070	Ga0307517_10000232	3300028786	Bacteria	94332
1071	Ga0307517_10089056	3300028786	Bacteria	2545
1072	Ga0307517_10192098	3300028786	Bacteria	1294
1073	Ga0307517_10543192	3300028786	Bacteria	582
1074	Ga0307515_10030422	3300028794	Bacteria	9065
1075	Ga0307515_10137546	3300028794	Bacteria	2644
1076	Ga0307515_10501867	3300028794	Bacteria	824
1077	Ga0307515_10889819	3300028794	Bacteria	520
1078	Ga0265338_10000422	3300028800	Bacteria	75820
1079	Ga0265338_11106022	3300028800	Bacteria	534
1080	Ga0265324_10007630	3300029957	Bacteria	4362
1081	Ga0307511_10010108	3300030521	Bacteria	9384
1082	Ga0265762_1118648	3300030760	Bacteria	603
1083	Ga0265765_1063564	3300030879	Bacteria	525
1084	Ga0265330_10024128	3300031235	Bacteria	2759
1085	Ga0265330_10038768	3300031235	Bacteria	2118
1086	Ga0265332_10002500	3300031238	Bacteria	9344
1087	Ga0265332_10016943	3300031238	Bacteria	3215
1088	Ga0265332_10219714	3300031238	Bacteria	788
1089	Ga0265329_10101479	3300031242	Bacteria	916
1090	Ga0265329_10219448	3300031242	Bacteria	629
1091	Ga0265340_10095700	3300031247	Bacteria	1384
1092	Ga0265340_10144253	3300031247	Bacteria	1088
1093	Ga0265339_10000681	3300031249	Bacteria	26201
1094	Ga0265339_10230626	3300031249	Bacteria	902
1095	Ga0265331_10012649	3300031250	Bacteria	4564
1096	Ga0265331_10158200	3300031250	Bacteria	1027
1097	Ga0265327_10518471	3300031251	Bacteria	513
1098	Ga0265316_10141196	3300031344	Bacteria	1809
1099	Ga0265316_10223768	3300031344	Bacteria	1387
1100	Ga0307513_10241441	3300031456	Bacteria	1611
1101	Ga0307513_10969446	3300031456	Bacteria	559
1102	Ga0307509_10053355	3300031507	Bacteria	4311
1103	Ga0307509_10066569	3300031507	Bacteria	3779
1104	Ga0307509_10186905	3300031507	Bacteria	1928
1105	Ga0307509_10583867	3300031507	Bacteria	792
1106	Ga0307408_100959924	3300031548	Bacteria	786
1107	Ga0307408_101216054	3300031548	Bacteria	703
1108	Ga0265313_10129310	3300031595	Bacteria	1095
1109	Ga0307508_10000045	3300031616	Bacteria	142824
1110	Ga0307508_10054492	3300031616	Bacteria	3545
1111	Ga0307508_10212454	3300031616	Bacteria	1535
1112	Ga0307508_10349550	3300031616	Bacteria	1070
1113	Ga0307508_10418711	3300031616	Bacteria	931
1114	Ga0307508_10599284	3300031616	Bacteria	703
1115	Ga0265314_10049337	3300031711	Bacteria	2948
1116	Ga0265314_10198743	3300031711	Bacteria	1187
1117	Ga0265342_10011010	3300031712	Bacteria	6213
1118	Ga0265342_10026156	3300031712	Bacteria	3660
1119	Ga0307516_10070705	3300031730	Bacteria	3353
1120	Ga0307516_10178764	3300031730	Bacteria	1857
1121	Ga0307516_10218899	3300031730	Bacteria	1614
1122	Ga0307516_10219102	3300031730	Bacteria	1613
1123	Ga0307516_10520764	3300031730	Bacteria	843
1124	Ga0307516_10881908	3300031730	Bacteria	560
1125	Ga0307405_10076245	3300031731	Bacteria	2175
1126	Ga0307405_11053796	3300031731	Bacteria	696
1127	Ga0307405_12126576	3300031731	Bacteria	504
1128	Ga0307410_11627945	3300031852	Bacteria	571
1129	Ga0307406_10321034	3300031901	Bacteria	1198
1130	Ga0307406_10855196	3300031901	Bacteria	771
1131	Ga0307406_10900589	3300031901	Bacteria	753
1132	Ga0307407_10164053	3300031903	Bacteria	1457
1133	Ga0307407_11312460	3300031903	Bacteria	568
1134	Ga0307412_10027981	3300031911	Bacteria	3522
1135	Ga0307412_10442072	3300031911	Bacteria	1069
1136	Ga0307412_11028685	3300031911	Bacteria	729
1137	Ga0307409_100386324	3300031995	Bacteria	1332
1138	Ga0307416_100527437	3300032002	Bacteria	1250
1139	Ga0307416_101655169	3300032002	Bacteria	745
1140	Ga0307414_10852092	3300032004	Bacteria	833
1141	Ga0307411_10594866	3300032005	Bacteria	950
1142	Ga0307411_10607182	3300032005	Bacteria	941
1143	Ga0307415_100027065	3300032126	Bacteria	3628
1144	Ga0307415_100420011	3300032126	Bacteria	1147
1145	Ga0307415_100548277	3300032126	Bacteria	1020
1146	Ga0307507_10069533	3300033179	Bacteria	3202
1147	Ga0307507_10228746	3300033179	Bacteria	1237
1148	Ga0307510_10005192	3300033180	Bacteria	15482
1149	Ga0307510_10014100	3300033180	Bacteria	9465
1150	Ga0307510_10125740	3300033180	Bacteria	2254
1151	Ga0307510_10228937	3300033180	Bacteria	1363
1152	Ga0307510_10558945	3300033180	Bacteria	591
1153	Ga0315911_1000008	3300033442	Bacteria	381285
1154	Ga0373930_0019782	3300034816	Bacteria	1306
1155	Ga0373950_0005163	3300034818	Bacteria	1940
1156	Ga0373926_0028127	3300035083	Bacteria	1973
1157	Ga0373926_0073477	3300035083	Bacteria	1258
1158	Ga0373926_0128397	3300035083	Bacteria	959
1159	Ga0373934_0042295	3300035086	Bacteria	1799
1160	Ga0373934_0045208	3300035086	Bacteria	1741
1161	Ga0373934_0138997	3300035086	Bacteria	993
1162	Ga0373934_0183987	3300035086	Bacteria	859
1163	Ga0373944_0156404	3300035089	Bacteria	806
1164	Ga0373952_0027366	3300035092	Bacteria	1245
1165	Ga0373923_0001920	3300035111	Bacteria	6216
1166	Ga0373923_0002272	3300035111	Bacteria	5856
1167	Ga0373923_0004491	3300035111	Bacteria	4633
1168	Ga0373923_0205178	3300035111	Bacteria	912
1169	Ga0373932_0097630	3300035112	Bacteria	952
1170	Ga0373936_0002980	3300035113	Bacteria	6333
1171	Ga0373936_0070327	3300035113	Bacteria	1441
1172	Ga0373936_0564428	3300035113	Bacteria	533
1173	Ga0373939_0166284	3300035114	Bacteria	813
1174	Ga0373945_0065548	3300035116	Bacteria	1364
1175	Ga0373953_0000295	3300035117	Bacteria	13653
1176	Ga0373953_0085795	3300035117	Bacteria	1314
1177	Ga0373953_0315140	3300035117	Bacteria	683
1178	Ga0373954_0004264	3300035118	Bacteria	6145
1179	Ga0373954_0031690	3300035118	Bacteria	2441
1180	Ga0373954_0102561	3300035118	Bacteria	1381
1181	Ga0373954_0113887	3300035118	Bacteria	1309
1182	Ga0373956_0003640	3300035119	Bacteria	6220
1183	Ga0373956_0025571	3300035119	Bacteria	2553
1184	Ga0373956_0046735	3300035119	Bacteria	1935
1185	Ga0373957_0002556	3300035120	Bacteria	5214
1186	Ga0373957_0004293	3300035120	Bacteria	4324
1187	Ga0373957_0166464	3300035120	Bacteria	910
1188	Ga0373960_0178824	3300035121	Bacteria	739
1189	Ga0373943_0004960	3300035170	Bacteria	6009
1190	Ga0373943_0303470	3300035170	Bacteria	907
1191	Ga0373946_0005215	3300035171	Bacteria	4685
1192	Ga0373946_0104228	3300035171	Bacteria	1275
1193	Ga0373946_0281829	3300035171	Bacteria	818
1194	Ga0373955_0025559	3300035172	Bacteria	3034
1195	Ga0373955_0031384	3300035172	Bacteria	2782
1196	Ga0373955_0106646	3300035172	Bacteria	1615
1197	Ga0373955_0236315	3300035172	Bacteria	1094
1198	Ga0373955_0738707	3300035172	Bacteria	604
1199	Ga0373962_0078420	3300035242	Bacteria	999
1200	Ga0373924_0002842	3300035410	Bacteria	5865
1201	Ga0373924_0003454	3300035410	Bacteria	5438
1202	Ga0373924_0080680	3300035410	Bacteria	1383
1203	Ga0373931_0126077	3300035691	Bacteria	1468
1204	Ga0373931_0447451	3300035691	Bacteria	826
1205	Ga0373931_0537061	3300035691	Bacteria	758
1206	Ga0373935_0000595	3300035692	Bacteria	18877
1207	Ga0373935_0046038	3300035692	Bacteria	2754
1208	Ga0373935_0065098	3300035692	Bacteria	2338
1209	Ga0373935_0133625	3300035692	Unclassified	1669
1210	Ga0373927_0001021	3300035695	Bacteria	21303
1211	Ga0373927_0007921	3300035695	Bacteria	7176
1212	Ga0373927_0013479	3300035695	Bacteria	5432
1213	Ga0373927_0023827	3300035695	Bacteria	4005
1214	Ga0373927_0061957	3300035695	Bacteria	2419
1215	Ga0373927_0082245	3300035695	Bacteria	2087
1216	Ga0373933_0000218	3300035724	Bacteria	37928
1217	Ga0373933_0002329	3300035724	Bacteria	10774
1218	Ga0373933_0438620	3300035724	Bacteria	854
1219	Ga0373933_0679396	3300035724	Bacteria	677
1220	Ga0373947_0000970	3300035725	Bacteria	17506
1221	Ga0373947_0010686	3300035725	Bacteria	5270
1222	Ga0373947_0025586	3300035725	Bacteria	3443
1223	Ga0373947_0058005	3300035725	Bacteria	2344
1224	Ga0373947_0061086	3300035725	Bacteria	2289
1225	Ga0373947_0316941	3300035725	Bacteria	1042
1226	Ga0373937_0010824	3300036401	Bacteria	7982
1227	Ga0373937_0015997	3300036401	Bacteria	6653
1228	Ga0373937_0043428	3300036401	Bacteria	4103
1229	Ga0373937_0866734	3300036401	Bacteria	852
1230	Ga0373937_0955148	3300036401	Bacteria	806
1231	Ga0373937_0983548	3300036401	Bacteria	792
1232	Ga0310112_037901	3300036458	Bacteria	656
1233	Ga0372808_013035	3300036459	Bacteria	1183
1234	Ga0373925_0005771	3300037068	Bacteria	9201
1235	Ga0373925_0029490	3300037068	Bacteria	4026
1236	Ga0373925_0059981	3300037068	Bacteria	2855
1237	Ga0373925_0080800	3300037068	Bacteria	2471
1238	Ga0373925_0303147	3300037068	Bacteria	1290
1239	Ga0373925_0326040	3300037068	Bacteria	1243
1240	Ga0373925_0632027	3300037068	Bacteria	882
1241	Ga0373925_0723747	3300037068	Bacteria	820
1242	Ga0373925_0951737	3300037068	Unclassified	707
1243	Ga0395899_0142005	3300037312	Bacteria	1708
1244	Ga0395899_0408250	3300037312	Bacteria	897
1245	Ga0395899_0421422	3300037312	Bacteria	879
1246	Ga0395899_0490521	3300037312	Bacteria	798
1247	Ga0395900_0000423	3300037418	Bacteria	60773
1248	Ga0395900_0006224	3300037418	Bacteria	12462
1249	Ga0395900_0190863	3300037418	Bacteria	2078
1250	Ga0395900_0213755	3300037418	Bacteria	1946
1251	Ga0395900_1484328	3300037418	Bacteria	590
1252	Ga0395900_1552244	3300037418	Bacteria	574
1253	Ga0395898_0099523	3300037466	Bacteria	2792
1254	Ga0395898_0193297	3300037466	Bacteria	1944
1255	Ga0395898_0295295	3300037466	Bacteria	1546
1256	Ga0395898_0325784	3300037466	Bacteria	1465
1257	Ga0395898_0725642	3300037466	Bacteria	935
1258	Ga0395898_0763267	3300037466	Bacteria	908
1259	Ga0395905_0191063	3300037471	Bacteria	1921
1260	Ga0395905_0194802	3300037471	Bacteria	1900
1261	Ga0395905_0327164	3300037471	Bacteria	1423
1262	Ga0436364_0233904	3300037853	Bacteria	1379
1263	Ga0436364_1394342	3300037853	Bacteria	930
1264	Ga0436364_1558783	3300037853	Bacteria	1378
1265	Ga0395901_0016910	3300038443	Bacteria	7434
1266	Ga0395901_0045830	3300038443	Bacteria	4540
1267	Ga0395901_0851036	3300038443	Bacteria	897
1268	Ga0395901_2060726	3300038443	Bacteria	516
1269	Ga0436365_0023991	3300039437	Bacteria	1317
1270	Ga0436365_0062661	3300039437	Bacteria	612
1271	Ga0436365_0417554	3300039437	Bacteria	782
1272	Ga0436365_0422820	3300039437	Bacteria	1628
1273	Ga0436365_0792962	3300039437	Bacteria	1131
1274	Ga0436365_1775583	3300039437	Bacteria	622
1275	Ga0436365_1921765	3300039437	Bacteria	3280
1276	Ga0436360_0054710	3300039438	Bacteria	645
1277	Ga0436360_0243643	3300039438	Bacteria	1563
1278	Ga0436361_0093117	3300039447	Bacteria	848
1279	Ga0436361_0311968	3300039447	Bacteria	517
1280	Ga0436363_0126016	3300039450	Bacteria	1447
1281	Ga0436363_0504225	3300039450	Bacteria	853
1282	Ga0436363_0638968	3300039450	Bacteria	584
1283	Ga0436363_0728136	3300039450	Bacteria	2948
1284	Ga0436363_0774700	3300039450	Bacteria	1540
1285	Ga0436363_1429645	3300039450	Bacteria	5814
1286	Ga0436363_1608181	3300039450	Bacteria	545
1287	Ga0439461_0216379	3300041410	Bacteria	521
1288	Ga0439465_0190925	3300041413	Bacteria	744
1289	Ga0451787_097135	3300041441	Bacteria	585
1290	Ga0451793_0764484	3300041452	Bacteria	562
1291	Ga0451793_1041072	3300041452	Bacteria	754
1292	Ga0451793_1255108	3300041452	Bacteria	644
1293	Ga0451793_1889595	3300041452	Bacteria	815
1294	Ga0451798_0750927	3300041458	Bacteria	981
1295	Ga0451798_0866552	3300041458	Bacteria	595
1296	Ga0451798_1009128	3300041458	Bacteria	637
1297	Ga0451800_1039335	3300041459	Bacteria	1017
1298	Ga0451802_0142566	3300041460	Bacteria	1216
1299	Ga0451805_107655	3300041461	Bacteria	632
1300	Ga0451804_0251643	3300041463	Bacteria	507
1301	Ga0451807_1467455	3300041486	Bacteria	715
1302	Ga0451807_1887621	3300041486	Bacteria	912
1303	Ga0451835_0003308	3300041492	Bacteria	509
1304	Ga0451837_0451455	3300041494	Bacteria	831
1305	Ga0451839_0292002	3300041496	Bacteria	554
1306	Ga0451841_0249111	3300041498	Bacteria	606
1307	Ga0451841_1261231	3300041498	Bacteria	888
1308	Ga0451849_0900183	3300041505	Bacteria	950
1309	Ga0451849_1430746	3300041505	Bacteria	576
1310	Ga0451853_1951080	3300041512	Bacteria	813
1311	Ga0451853_2124155	3300041512	Bacteria	722
1312	Ga0451853_2441409	3300041512	Bacteria	1281
1313	Ga0451853_2659698	3300041512	Bacteria	1374
1314	Ga0439448_0094372	3300042005	Bacteria	1013
1315	Ga0466969_0056131	3300044656	Bacteria	1924
1316	Ga0466972_0030983	3300044658	Bacteria	2632
1317	Ga0466972_0382439	3300044658	Bacteria	659
1318	Ga0466966_0000628	3300044684	Bacteria	22447
1319	Ga0466966_0473070	3300044684	Bacteria	753
1320	Ga0466961_0000770	3300044693	Bacteria	20096
1321	Ga0466963_0044320	3300044694	Bacteria	2928
1322	Ga0466964_0020180	3300044706	Bacteria	2565
1323	Ga0466964_0055738	3300044706	Bacteria	1633
1324	Ga0466968_0054430	3300044735	Bacteria	1715
1325	Ga0466968_0725445	3300044735	Bacteria	509
1326	Ga0466970_0339744	3300044765	Bacteria	851
1327	Ga0466957_0011135	3300044842	Bacteria	5180
1328	Ga0466957_0374888	3300044842	Bacteria	969
1329	Ga0466960_0028866	3300044901	Bacteria	2541
1330	Ga0466959_0003303	3300045049	Bacteria	10524
1331	Ga0466959_0092328	3300045049	Bacteria	2173
1332	Ga0466959_0100289	3300045049	Bacteria	2073
1333	Ga0466959_0127089	3300045049	Bacteria	1809
1334	Ga0466959_0625053	3300045049	Bacteria	724
1335	Ga0466959_0674731	3300045049	Bacteria	693
1336	Ga0466958_0413592	3300045836	Bacteria	871
1337	Ga0466967_0053699	3300045976	Bacteria	3542
1338	Ga0466967_0107803	3300045976	Bacteria	2555
1339	Ga0466967_0676457	3300045976	Bacteria	1021
1340	Ga0466967_1031684	3300045976	Bacteria	819
1341	Ga0495617_151419	3300046452	Bacteria	738
1342	Ga0495617_249254	3300046452	Bacteria	547
1343	Ga0495592_0015730	3300046454	Bacteria	5739
1344	Ga0495592_0086374	3300046454	Bacteria	2259
1345	Ga0495592_0119008	3300046454	Bacteria	1860
1346	Ga0495592_0366977	3300046454	Bacteria	919
1347	Ga0495603_0001390	3300046455	Bacteria	14060
1348	Ga0495603_0008445	3300046455	Bacteria	6221
1349	Ga0495603_0055326	3300046455	Bacteria	2351
1350	Ga0495603_0156311	3300046455	Bacteria	1323
1351	Ga0495603_0304487	3300046455	Bacteria	915
1352	Ga0495603_0341233	3300046455	Bacteria	859
1353	Ga0495603_0366916	3300046455	Bacteria	826
1354	Ga0495603_0375574	3300046455	Bacteria	815
1355	Ga0495590_0057485	3300046457	Bacteria	1360
1356	Ga0495590_0105501	3300046457	Bacteria	1003
1357	Ga0495590_0267407	3300046457	Bacteria	638
1358	Ga0495629_0000915	3300046459	Bacteria	23696
1359	Ga0495629_0010705	3300046459	Bacteria	6669
1360	Ga0495629_0027900	3300046459	Bacteria	4010
1361	Ga0495629_0033234	3300046459	Bacteria	3650
1362	Ga0495629_0049476	3300046459	Bacteria	2946
1363	Ga0495629_0180367	3300046459	Bacteria	1464
1364	Ga0495629_0190627	3300046459	Bacteria	1419
1365	Ga0495629_0262441	3300046459	Bacteria	1187
1366	Ga0495638_0000880	3300046460	Bacteria	30953
1367	Ga0495638_0295016	3300046460	Bacteria	875
1368	Ga0495638_0298118	3300046460	Bacteria	869
1369	Ga0495638_0330376	3300046460	Bacteria	811
1370	Ga0495638_0394414	3300046460	Bacteria	719
1371	Ga0495641_0007969	3300046461	Bacteria	6530
1372	Ga0495641_0008018	3300046461	Bacteria	6506
1373	Ga0495641_0119632	3300046461	Bacteria	1175
1374	Ga0495651_0011194	3300046462	Bacteria	6895
1375	Ga0495651_0024642	3300046462	Bacteria	4680
1376	Ga0495651_0069688	3300046462	Bacteria	2677
1377	Ga0495651_0171684	3300046462	Bacteria	1543
1378	Ga0495653_0009510	3300046463	Bacteria	7952
1379	Ga0495653_0033378	3300046463	Bacteria	4078
1380	Ga0495653_0256513	3300046463	Bacteria	1158
1381	Ga0495650_0292903	3300046471	Bacteria	546
1382	Ga0495580_0009685	3300046472	Bacteria	7560
1383	Ga0495580_0014933	3300046472	Bacteria	5881
1384	Ga0495580_0111796	3300046472	Bacteria	1897
1385	Ga0495582_0000302	3300046473	Bacteria	27218
1386	Ga0495582_0010682	3300046473	Bacteria	5050
1387	Ga0495582_0014650	3300046473	Bacteria	4308
1388	Ga0495582_0900387	3300046473	Bacteria	511
1389	Ga0495605_0068961	3300046474	Bacteria	1675
1390	Ga0495605_0084028	3300046474	Bacteria	1485
1391	Ga0495605_0238278	3300046474	Bacteria	782
1392	Ga0495605_0266139	3300046474	Bacteria	731
1393	Ga0495639_0000072	3300046475	Bacteria	46904
1394	Ga0495639_0003352	3300046475	Bacteria	6946
1395	Ga0495639_0004340	3300046475	Bacteria	6083
1396	Ga0495639_0279355	3300046475	Bacteria	830
1397	Ga0495662_0001985	3300046476	Bacteria	10261
1398	Ga0495662_0334353	3300046476	Bacteria	745
1399	Ga0495662_0362346	3300046476	Bacteria	712
1400	Ga0495664_0003834	3300046477	Bacteria	8207
1401	Ga0495664_0007335	3300046477	Bacteria	6122
1402	Ga0495664_0090181	3300046477	Bacteria	1843
1403	Ga0495664_0109974	3300046477	Bacteria	1663
1404	Ga0495664_0160233	3300046477	Bacteria	1365
1405	Ga0495664_0214643	3300046477	Bacteria	1165
1406	Ga0495664_0397286	3300046477	Bacteria	828
1407	Ga0495664_0564102	3300046477	Bacteria	678
1408	Ga0495584_0106163	3300046491	Bacteria	1420
1409	Ga0495584_0642822	3300046491	Bacteria	541
1410	Ga0495585_0103789	3300046492	Bacteria	1518
1411	Ga0495585_0203993	3300046492	Bacteria	1005
1412	Ga0495585_0293806	3300046492	Bacteria	800
1413	Ga0495585_0485428	3300046492	Bacteria	588
1414	Ga0495594_0000046	3300046499	Bacteria	53822
1415	Ga0495594_0006637	3300046499	Bacteria	5956
1416	Ga0495594_0255020	3300046499	Bacteria	999
1417	Ga0495594_0338961	3300046499	Bacteria	856
1418	Ga0495594_0751288	3300046499	Bacteria	550
1419	Ga0495596_0026200	3300046500	Bacteria	2351
1420	Ga0495596_0075852	3300046500	Bacteria	1306
1421	Ga0495596_0230503	3300046500	Bacteria	719
1422	Ga0495596_0297699	3300046500	Bacteria	627
1423	Ga0495607_0147406	3300046501	Bacteria	1208
1424	Ga0495607_0213753	3300046501	Bacteria	947
1425	Ga0495607_0295672	3300046501	Bacteria	764
1426	Ga0495583_0133592	3300046506	Bacteria	1037
1427	Ga0495583_0178528	3300046506	Bacteria	870
1428	Ga0495606_0016869	3300046507	Bacteria	5546
1429	Ga0495606_0031269	3300046507	Bacteria	3704
1430	Ga0495606_0087573	3300046507	Bacteria	1922
1431	Ga0495606_0148378	3300046507	Bacteria	1378
1432	Ga0495606_0163043	3300046507	Bacteria	1299
1433	Ga0495606_0256848	3300046507	Bacteria	966
1434	Ga0495606_0267501	3300046507	Bacteria	941
1435	Ga0495606_0344110	3300046507	Bacteria	793
1436	Ga0495606_0514424	3300046507	Bacteria	602
1437	Ga0495608_0022303	3300046511	Bacteria	4341
1438	Ga0495608_0216189	3300046511	Bacteria	1204
1439	Ga0495608_0352552	3300046511	Bacteria	905
1440	Ga0495610_0109614	3300046512	Bacteria	1225
1441	Ga0495610_0139619	3300046512	Bacteria	1044
1442	Ga0495616_0238027	3300046513	Bacteria	786
1443	Ga0495616_0417719	3300046513	Bacteria	548
1444	Ga0495618_0025224	3300046514	Bacteria	3688
1445	Ga0495618_0070301	3300046514	Bacteria	2226
1446	Ga0495620_0013237	3300046515	Bacteria	4230
1447	Ga0495620_0149489	3300046515	Bacteria	911
1448	Ga0495620_0152822	3300046515	Bacteria	899
1449	Ga0495628_0017184	3300046516	Bacteria	6026
1450	Ga0495628_0035925	3300046516	Bacteria	3980
1451	Ga0495628_0063483	3300046516	Bacteria	2894
1452	Ga0495628_0186817	3300046516	Bacteria	1566
1453	Ga0495628_0630296	3300046516	Bacteria	763
1454	Ga0495630_0004933	3300046517	Bacteria	9381
1455	Ga0495630_0008348	3300046517	Bacteria	7434
1456	Ga0495631_0097076	3300046518	Bacteria	1268
1457	Ga0495631_0521436	3300046518	Bacteria	506
1458	Ga0495632_0143890	3300046519	Bacteria	1105
1459	Ga0495632_0287300	3300046519	Bacteria	731
1460	Ga0495632_0309456	3300046519	Bacteria	699
1461	Ga0495637_0010962	3300046520	Bacteria	4368
1462	Ga0495637_0312547	3300046520	Bacteria	556
1463	Ga0495643_0018786	3300046522	Bacteria	4007
1464	Ga0495643_0043328	3300046522	Bacteria	2449
1465	Ga0495643_0109949	3300046522	Bacteria	1402
1466	Ga0495643_0181432	3300046522	Bacteria	1023
1467	Ga0495643_0351356	3300046522	Bacteria	660
1468	Ga0495644_0310752	3300046523	Bacteria	617
1469	Ga0495648_0011672	3300046524	Bacteria	6599
1470	Ga0495648_0096910	3300046524	Bacteria	1637
1471	Ga0495648_0111974	3300046524	Bacteria	1483
1472	Ga0495648_0138924	3300046524	Bacteria	1281
1473	Ga0495648_0217584	3300046524	Bacteria	944
1474	Ga0495648_0437605	3300046524	Bacteria	575
1475	Ga0495666_0004514	3300046526	Bacteria	7032
1476	Ga0495666_0008404	3300046526	Bacteria	5176
1477	Ga0495666_0134877	3300046526	Bacteria	1152
1478	Ga0495666_0540916	3300046526	Bacteria	520
1479	Ga0495642_0158825	3300046528	Bacteria	980
1480	Ga0495642_0493035	3300046528	Bacteria	542
1481	Ga0495652_0014455	3300046529	Bacteria	7084
1482	Ga0495652_0030231	3300046529	Bacteria	4752
1483	Ga0495652_0039718	3300046529	Bacteria	4068
1484	Ga0495652_0122589	3300046529	Bacteria	2070
1485	Ga0495652_0160041	3300046529	Bacteria	1749
1486	Ga0495654_0062998	3300046530	Bacteria	1776
1487	Ga0495665_0000335	3300046531	Bacteria	23811
1488	Ga0495665_0136576	3300046531	Bacteria	1282
1489	Ga0495665_0163588	3300046531	Bacteria	1159
1490	Ga0495665_0263061	3300046531	Bacteria	887
1491	Ga0495665_0341238	3300046531	Bacteria	763
1492	Ga0495665_0660963	3300046531	Bacteria	520
1493	Ga0495640_0014548	3300046533	Bacteria	5949
1494	Ga0495640_0038825	3300046533	Bacteria	3346
1495	Ga0495640_0122339	3300046533	Bacteria	1690
1496	Ga0495640_0177650	3300046533	Bacteria	1358
1497	Ga0495640_0218873	3300046533	Bacteria	1201
1498	Ga0495586_0288426	3300046535	Bacteria	940
1499	Ga0495587_0026010	3300046536	Bacteria	3571
1500	Ga0495587_0066559	3300046536	Bacteria	2101
1501	Ga0495587_0275633	3300046536	Bacteria	943
1502	Ga0495598_0079403	3300046537	Bacteria	1050
1503	Ga0495609_0065976	3300046538	Bacteria	1595
1504	Ga0495609_0194288	3300046538	Bacteria	850
1505	Ga0495609_0276806	3300046538	Bacteria	687
1506	Ga0495621_0025758	3300046539	Bacteria	1979
1507	Ga0495621_0257593	3300046539	Bacteria	714
1508	Ga0495597_0027696	3300046542	Bacteria	2597
1509	Ga0495597_0168361	3300046542	Bacteria	891
1510	Ga0495597_0194621	3300046542	Bacteria	814
1511	Ga0495597_0243333	3300046542	Bacteria	709
1512	Ga0495645_0045775	3300046543	Bacteria	3192
1513	Ga0495645_0211526	3300046543	Bacteria	1309
1514	Ga0495645_0562723	3300046543	Bacteria	705
1515	Ga0495622_0001947	3300046557	Bacteria	10142
1516	Ga0495622_0067515	3300046557	Bacteria	1652
1517	Ga0495633_0138360	3300046558	Bacteria	1126
1518	Ga0495633_0378099	3300046558	Bacteria	641
1519	Ga0495633_0409760	3300046558	Bacteria	613
1520	Ga0495633_0476920	3300046558	Bacteria	563
1521	Ga0495667_0009421	3300046559	Bacteria	6615
1522	Ga0495667_0022920	3300046559	Bacteria	4207
1523	Ga0495667_0044099	3300046559	Bacteria	2954
1524	Ga0495656_0071369	3300046615	Bacteria	1543
1525	Ga0495656_0184567	3300046615	Bacteria	1027
1526	Ga0495656_0207189	3300046615	Bacteria	975
1527	Ga0495656_0298433	3300046615	Bacteria	825
1528	Ga0495656_0325405	3300046615	Bacteria	792
1529	Ga0495656_0381927	3300046615	Bacteria	734
1530	Ga0495656_0571696	3300046615	Bacteria	603
1531	Ga0495668_0090439	3300046616	Bacteria	1677
1532	Ga0495668_0161803	3300046616	Bacteria	1226
1533	Ga0495668_0211251	3300046616	Bacteria	1062
1534	Ga0495668_0214384	3300046616	Bacteria	1054
1535	Ga0495668_0217609	3300046616	Bacteria	1046
1536	Ga0495668_0265612	3300046616	Bacteria	940
1537	Ga0495668_0360017	3300046616	Bacteria	799
1538	Ga0495668_0392315	3300046616	Bacteria	762
1539	Ga0495668_0432136	3300046616	Bacteria	724
1540	Ga0495668_0586824	3300046616	Bacteria	615
1541	Ga0495634_0001329	3300046642	Bacteria	22513
1542	Ga0495634_0016816	3300046642	Bacteria	5225
1543	Ga0495634_0051631	3300046642	Bacteria	2758
1544	Ga0495634_0125165	3300046642	Bacteria	1643
1545	Ga0495611_0109706	3300046648	Bacteria	1284
1546	Ga0495611_0118329	3300046648	Bacteria	1235
1547	Ga0495611_0216358	3300046648	Bacteria	892
1548	Ga0495611_0310637	3300046648	Bacteria	726
1549	Ga0495611_0538228	3300046648	Bacteria	529
1550	Ga0495625_0019643	3300046660	Bacteria	5233
1551	Ga0495625_0088271	3300046660	Bacteria	2148
1552	Ga0495625_0124818	3300046660	Bacteria	1748
1553	Ga0495625_0159303	3300046660	Bacteria	1513
1554	Ga0495625_0266011	3300046660	Bacteria	1108
1555	Ga0495625_0398002	3300046660	Bacteria	861
1556	Ga0495625_0420370	3300046660	Bacteria	831
1557	Ga0495625_0476960	3300046660	Bacteria	766
1558	Ga0495635_0000518	3300046663	Bacteria	24462
1559	Ga0495635_0001404	3300046663	Bacteria	16066
1560	Ga0495635_0011167	3300046663	Bacteria	6297
1561	Ga0495635_0138914	3300046663	Bacteria	1655
1562	Ga0495635_0156618	3300046663	Bacteria	1550
1563	Ga0495659_0047807	3300046664	Bacteria	1548
1564	Ga0495659_0061130	3300046664	Bacteria	1391
1565	Ga0495659_0267464	3300046664	Bacteria	716
1566	Ga0495659_0313746	3300046664	Bacteria	665
1567	Ga0495661_0074186	3300046665	Bacteria	1980
1568	Ga0495661_0119244	3300046665	Bacteria	1459
1569	Ga0495661_0128311	3300046665	Bacteria	1393
1570	Ga0495661_0207010	3300046665	Bacteria	1024
1571	Ga0495661_0586806	3300046665	Bacteria	525
1572	Ga0495588_0002250	3300046674	Bacteria	8263
1573	Ga0495588_0065754	3300046674	Bacteria	1881
1574	Ga0495588_0073061	3300046674	Bacteria	1785
1575	Ga0495588_0150776	3300046674	Bacteria	1229
1576	Ga0495588_0224342	3300046674	Bacteria	992
1577	Ga0495588_0226765	3300046674	Bacteria	986
1578	Ga0495588_0392559	3300046674	Bacteria	728
1579	Ga0495657_0017250	3300046675	Bacteria	5244
1580	Ga0495657_0111853	3300046675	Bacteria	1729
1581	Ga0495599_0000864	3300046678	Bacteria	16965
1582	Ga0495599_0084157	3300046678	Bacteria	1986
1583	Ga0495599_0116511	3300046678	Bacteria	1662
1584	Ga0495623_0011322	3300046679	Bacteria	5770
1585	Ga0495623_0132837	3300046679	Bacteria	1488
1586	Ga0495646_0004855	3300046680	Bacteria	8495
1587	Ga0495646_0015726	3300046680	Bacteria	4803
1588	Ga0495646_0025588	3300046680	Bacteria	3712
1589	Ga0495646_0052006	3300046680	Bacteria	2477
1590	Ga0495646_0077916	3300046680	Bacteria	1938
1591	Ga0495647_0000898	3300046681	Bacteria	8925
1592	Ga0495647_0539489	3300046681	Bacteria	545
1593	Ga0495658_0000201	3300046683	Bacteria	34784
1594	Ga0495658_0013538	3300046683	Bacteria	4153
1595	Ga0495658_0115551	3300046683	Bacteria	1618
1596	Ga0495658_0143421	3300046683	Bacteria	1462
1597	Ga0495658_0157342	3300046683	Bacteria	1399
1598	Ga0495658_0212831	3300046683	Bacteria	1208
1599	Ga0495669_0063750	3300046684	Bacteria	1672
1600	Ga0495669_0119511	3300046684	Bacteria	1234
1601	Ga0495669_0140702	3300046684	Bacteria	1139
1602	Ga0495669_0212821	3300046684	Bacteria	925
1603	Ga0495669_0273962	3300046684	Bacteria	811
1604	Ga0495669_0400113	3300046684	Bacteria	665
1605	Ga0495669_0474954	3300046684	Bacteria	607
1606	Ga0495613_0064733	3300046689	Bacteria	2673
1607	Ga0495613_0080387	3300046689	Bacteria	2369
1608	Ga0495613_0096940	3300046689	Bacteria	2132
1609	Ga0495613_0107083	3300046689	Bacteria	2017
1610	Ga0495624_0004061	3300046690	Bacteria	10771
1611	Ga0495624_0008145	3300046690	Bacteria	7334
1612	Ga0495624_0313914	3300046690	Bacteria	945
1613	Ga0495670_0002080	3300046691	Bacteria	9877
1614	Ga0495670_0092856	3300046691	Bacteria	1546
1615	Ga0495670_0250208	3300046691	Bacteria	945
1616	Ga0495671_0032211	3300046692	Bacteria	2676
1617	Ga0495671_0171447	3300046692	Bacteria	1055
1618	Ga0495671_0249158	3300046692	Bacteria	857
1619	Ga0495649_0140129	3300046694	Bacteria	1273
1620	Ga0495649_0157812	3300046694	Bacteria	1190
1621	Ga0495589_0102605	3300046794	Bacteria	1383
1622	Ga0495589_0171157	3300046794	Bacteria	1032
1623	Ga0495589_0251816	3300046794	Bacteria	825
1624	Ga0495600_0007464	3300046809	Bacteria	6692
1625	Ga0495600_0041357	3300046809	Bacteria	3003
1626	Ga0495600_0367707	3300046809	Bacteria	899
1627	Ga0495660_0045293	3300046810	Bacteria	2416
1628	Ga0495581_0000030	3300047315	Bacteria	53487
1629	Ga0495581_0004004	3300047315	Bacteria	8485
1630	Ga0495581_0019116	3300047315	Bacteria	3977
1631	Ga0495581_0137138	3300047315	Bacteria	1426
1632	Ga0495581_0702313	3300047315	Bacteria	583
1633	Ga0495604_0007603	3300047317	Bacteria	8577
1634	Ga0495604_0040542	3300047317	Bacteria	3656
1635	Ga0495604_0070465	3300047317	Bacteria	2647
1636	Ga0495604_0146773	3300047317	Bacteria	1680
1637	Ga0495604_0395829	3300047317	Bacteria	910
1638	Ga0495636_0400137	3300047318	Bacteria	654
1639	Ga0495674_0002494	3300047319	Bacteria	17944
1640	Ga0495674_0032588	3300047319	Bacteria	4726
1641	Ga0495674_0034870	3300047319	Bacteria	4545
1642	Ga0495674_0086794	3300047319	Bacteria	2678
1643	Ga0495674_0431287	3300047319	Bacteria	1061
1644	Ga0495674_0493124	3300047319	Bacteria	981
1645	Ga0495674_0615556	3300047319	Bacteria	859
1646	Ga0495674_0856616	3300047319	Bacteria	704
1647	Ga0495674_0891731	3300047319	Bacteria	687
1648	Ga0495672_0020587	3300047320	Bacteria	4317
1649	Ga0495676_0005339	3300047321	Bacteria	11767
1650	Ga0495676_0264151	3300047321	Bacteria	1170
1651	Ga0495676_0724794	3300047321	Unclassified	642
1652	Ga0495676_0730983	3300047321	Bacteria	639
1653	Ga0495680_0003293	3300047322	Bacteria	16010
1654	Ga0495680_0008680	3300047322	Bacteria	9218
1655	Ga0495680_0099032	3300047322	Bacteria	2174
1656	Ga0495680_0207402	3300047322	Bacteria	1404
1657	Ga0495680_0781699	3300047322	Bacteria	625
1658	Ga0495683_0172077	3300047323	Bacteria	995
1659	Ga0495675_0005139	3300047444	Bacteria	7962
1660	Ga0495675_0069208	3300047444	Bacteria	2229
1661	Ga0495675_0204753	3300047444	Bacteria	1200
1662	Ga0495675_0494352	3300047444	Bacteria	703
1663	Ga0495677_0182092	3300047445	Bacteria	814
1664	Ga0495685_045914	3300047447	Bacteria	1487
1665	Ga0495685_273135	3300047447	Bacteria	534
1666	Ga0495673_0216856	3300047469	Bacteria	710
1667	Ga0495673_0217865	3300047469	Bacteria	708
1668	Ga0495681_0169213	3300047470	Bacteria	905
1669	Ga0495681_0224257	3300047470	Bacteria	752
1670	Ga0495684_0000443	3300047471	Bacteria	33877
1671	Ga0495684_0033847	3300047471	Bacteria	3920
1672	Ga0495684_0082047	3300047471	Bacteria	2447
1673	Ga0495684_0129176	3300047471	Bacteria	1899
1674	Ga0495686_0207801	3300047472	Bacteria	1120
1675	Ga0495686_0302571	3300047472	Bacteria	882
1676	Ga0495686_0719611	3300047472	Bacteria	508
1677	Ga0495593_0000398	3300047673	Bacteria	24218
1678	Ga0495593_0001302	3300047673	Bacteria	14635
1679	Ga0495593_0007661	3300047673	Bacteria	6298
1680	Ga0495593_0289984	3300047673	Bacteria	818
1681	Ga0495593_0368698	3300047673	Bacteria	718
1682	Ga0495602_0063578	3300048088	Bacteria	3197
1683	Ga0495602_0113402	3300048088	Bacteria	2197
1684	Ga0495602_0115512	3300048088	Bacteria	2171
1685	Ga0495602_0186355	3300048088	Bacteria	1595
1686	Ga0495602_0272624	3300048088	Bacteria	1250
1687	Ga0495614_0007180	3300048089	Bacteria	4968
1688	Ga0495614_0142559	3300048089	Bacteria	1065
1689	Ga0495615_0041157	3300048090	Bacteria	1154
1690	Ga0495626_0060081	3300048091	Bacteria	1733
1691	Ga0495626_0189854	3300048091	Bacteria	847
1692	Ga0496100_0003200	3300048903	Bacteria	8504
1693	Ga0496100_0180266	3300048903	Bacteria	1527
1694	Ga0496100_0291799	3300048903	Bacteria	1219
1695	Ga0496100_0350334	3300048903	Bacteria	1115
1696	Ga0496100_0452089	3300048903	Bacteria	985
1697	Ga0496100_0784322	3300048903	Bacteria	746
1698	Ga0496101_0095143	3300048904	Bacteria	2221
1699	Ga0496101_0255340	3300048904	Bacteria	1366
1700	Ga0496101_0614051	3300048904	Bacteria	860
1701	Ga0496101_1018838	3300048904	Bacteria	651
1702	Ga0496101_1329957	3300048904	Bacteria	561
1703	Ga0496101_1461599	3300048904	Bacteria	532
1704	Ga0496101_1552262	3300048904	Bacteria	515
1705	Ga0496102_0024304	3300048905	Bacteria	5385
1706	Ga0496102_0025407	3300048905	Bacteria	5272
1707	Ga0496102_0256926	3300048905	Bacteria	1647
1708	Ga0496102_0383546	3300048905	Bacteria	1322
1709	Ga0496102_0416889	3300048905	Bacteria	1261
1710	Ga0496102_0562768	3300048905	Bacteria	1063
1711	Ga0496102_0879904	3300048905	Bacteria	818
1712	Ga0496102_1101015	3300048905	Bacteria	714
1713	Ga0496102_1221211	3300048905	Bacteria	671
1714	Ga0496103_0005956	3300048906	Bacteria	7291
1715	Ga0496103_0050459	3300048906	Bacteria	2574
1716	Ga0496103_0165748	3300048906	Bacteria	1418
1717	Ga0496103_0318074	3300048906	Bacteria	1001
1718	Ga0496103_0816729	3300048906	Bacteria	587
1719	Ga0496104_0012106	3300048907	Bacteria	7744
1720	Ga0496104_0013995	3300048907	Bacteria	7238
1721	Ga0496104_0036739	3300048907	Bacteria	4580
1722	Ga0496104_0069915	3300048907	Bacteria	3337
1723	Ga0496104_0089449	3300048907	Bacteria	2941
1724	Ga0496104_0169373	3300048907	Bacteria	2094
1725	Ga0496104_0763695	3300048907	Bacteria	873
1726	Ga0496104_0850553	3300048907	Bacteria	818
1727	Ga0496105_0010197	3300048908	Bacteria	7385
1728	Ga0496105_0012045	3300048908	Bacteria	6845
1729	Ga0496105_0083586	3300048908	Bacteria	2636
1730	Ga0496105_0093999	3300048908	Bacteria	2476
1731	Ga0496105_0301826	3300048908	Bacteria	1287
1732	Ga0496105_0431587	3300048908	Bacteria	1042
1733	Ga0496105_0649206	3300048908	Bacteria	814
1734	Ga0496105_0996296	3300048908	Bacteria	627
1735	Ga0496106_0001851	3300048909	Bacteria	15833
1736	Ga0496106_0016837	3300048909	Bacteria	5409
1737	Ga0496106_0025338	3300048909	Bacteria	4413
1738	Ga0496106_0026040	3300048909	Bacteria	4353
1739	Ga0496106_0040309	3300048909	Bacteria	3497
1740	Ga0496106_0176784	3300048909	Bacteria	1693
1741	Ga0496106_0388231	3300048909	Bacteria	1122
1742	Ga0496106_0880850	3300048909	Bacteria	708
1743	Ga0496106_0953236	3300048909	Bacteria	676
1744	Ga0496106_0965337	3300048909	Bacteria	671
1745	Ga0496107_0006358	3300048910	Bacteria	8120
1746	Ga0496107_0060582	3300048910	Bacteria	2739
1747	Ga0496107_0187995	3300048910	Bacteria	1534
1748	Ga0496107_0207448	3300048910	Bacteria	1457
1749	Ga0496107_0208573	3300048910	Bacteria	1453
1750	Ga0496107_0459162	3300048910	Bacteria	946
1751	Ga0496107_0772129	3300048910	Bacteria	704
1752	Ga0496108_0000160	3300048911	Bacteria	64120
1753	Ga0496108_0018787	3300048911	Bacteria	5666
1754	Ga0496108_0019419	3300048911	Bacteria	5581
1755	Ga0496108_0098892	3300048911	Bacteria	2486
1756	Ga0496108_0108645	3300048911	Bacteria	2369
1757	Ga0496108_0376146	3300048911	Bacteria	1240
1758	Ga0496108_0980996	3300048911	Bacteria	722
1759	Ga0496109_0000245	3300048912	Bacteria	52201
1760	Ga0496109_0036133	3300048912	Bacteria	4459
1761	Ga0496109_0078426	3300048912	Bacteria	3041
1762	Ga0496109_0139732	3300048912	Bacteria	2264
1763	Ga0496109_0144865	3300048912	Bacteria	2222
1764	Ga0496109_0393011	3300048912	Bacteria	1310
1765	Ga0496109_0426233	3300048912	Bacteria	1253
1766	Ga0496109_0726517	3300048912	Bacteria	931
1767	Ga0496109_1020482	3300048912	Bacteria	765
1768	Ga0496109_1049748	3300048912	Bacteria	752
1769	Ga0496109_1457658	3300048912	Bacteria	620
1770	Ga0496110_0029630	3300048913	Bacteria	4713
1771	Ga0496110_0030585	3300048913	Bacteria	4642
1772	Ga0496110_0115649	3300048913	Bacteria	2414
1773	Ga0496110_0125327	3300048913	Bacteria	2317
1774	Ga0496110_0164108	3300048913	Bacteria	2014
1775	Ga0496110_0164405	3300048913	Bacteria	2012
1776	Ga0496110_0261535	3300048913	Bacteria	1575
1777	Ga0496110_0262408	3300048913	Bacteria	1572
1778	Ga0496110_0326128	3300048913	Bacteria	1398
1779	Ga0496110_0385985	3300048913	Bacteria	1276
1780	Ga0496111_0056778	3300048914	Bacteria	2833
1781	Ga0496111_0095529	3300048914	Bacteria	2181
1782	Ga0496111_0139329	3300048914	Bacteria	1797
1783	Ga0496111_0203990	3300048914	Bacteria	1469
1784	Ga0496111_0211141	3300048914	Bacteria	1442
1785	Ga0496111_0233752	3300048914	Bacteria	1365
1786	Ga0496111_0589097	3300048914	Bacteria	815
1787	Ga0496112_0000018	3300048915	Bacteria	188820
1788	Ga0496112_0016551	3300048915	Bacteria	6913
1789	Ga0496112_0039552	3300048915	Bacteria	4609
1790	Ga0496112_0061102	3300048915	Bacteria	3714
1791	Ga0496112_0063989	3300048915	Bacteria	3628
1792	Ga0496112_0086140	3300048915	Bacteria	3108
1793	Ga0496112_0168495	3300048915	Bacteria	2156
1794	Ga0496112_0173916	3300048915	Bacteria	2118
1795	Ga0496112_0183644	3300048915	Bacteria	2055
1796	Ga0496112_0297913	3300048915	Bacteria	1558
1797	Ga0496113_0004682	3300048916	Bacteria	8445
1798	Ga0496113_0020664	3300048916	Bacteria	4634
1799	Ga0496113_0043202	3300048916	Bacteria	3334
1800	Ga0496113_0052142	3300048916	Bacteria	3054
1801	Ga0496113_0163322	3300048916	Bacteria	1761
1802	Ga0496114_0037094	3300048917	Bacteria	4031
1803	Ga0496114_0063203	3300048917	Bacteria	3099
1804	Ga0496114_0103092	3300048917	Bacteria	2438
1805	Ga0496114_0127875	3300048917	Bacteria	2192
1806	Ga0496114_0170747	3300048917	Bacteria	1895
1807	Ga0496114_0305941	3300048917	Bacteria	1404
1808	Ga0496114_1413889	3300048917	Bacteria	583
1809	Ga0496114_1431499	3300048917	Bacteria	579
1810	Ga0496114_1569964	3300048917	Bacteria	546
1811	Ga0496115_0000743	3300048918	Bacteria	24064
1812	Ga0496115_0023941	3300048918	Bacteria	4742
1813	Ga0496115_0025011	3300048918	Bacteria	4645
1814	Ga0496115_0060211	3300048918	Bacteria	3059
1815	Ga0496115_0067632	3300048918	Bacteria	2890
1816	Ga0496115_0105644	3300048918	Bacteria	2311
1817	Ga0496115_0131184	3300048918	Bacteria	2066
1818	Ga0496115_0144191	3300048918	Bacteria	1965
1819	Ga0496115_0212612	3300048918	Bacteria	1597
1820	Ga0496115_0465866	3300048918	Bacteria	1019
1821	Ga0496116_0001672	3300048919	Bacteria	24354
1822	Ga0496116_0024410	3300048919	Bacteria	4473
1823	Ga0496116_0134194	3300048919	Bacteria	1405
1824	Ga0496117_0031287	3300048920	Bacteria	4066
1825	Ga0496117_0039954	3300048920	Bacteria	3457
1826	Ga0496117_0040333	3300048920	Bacteria	3434
1827	Ga0496117_0087728	3300048920	Bacteria	2015
1828	Ga0496117_0142560	3300048920	Bacteria	1432
1829	Ga0496117_0150803	3300048920	Bacteria	1376
1830	Ga0496117_0151944	3300048920	Bacteria	1369
1831	Ga0496117_0203429	3300048920	Bacteria	1117
1832	Ga0496118_0033123	3300048921	Bacteria	4246
1833	Ga0496118_0050095	3300048921	Bacteria	3209
1834	Ga0496118_0052897	3300048921	Bacteria	3092
1835	Ga0496118_0058237	3300048921	Bacteria	2889
1836	Ga0496118_0080213	3300048921	Bacteria	2298
1837	Ga0496118_0082163	3300048921	Bacteria	2259
1838	Ga0496118_0176592	3300048921	Bacteria	1297
1839	Ga0496118_0259722	3300048921	Bacteria	981
1840	Ga0496118_0298241	3300048921	Bacteria	886
1841	Ga0496118_0411815	3300048921	Bacteria	698
1842	Ga0496118_0459630	3300048921	Bacteria	644
1843	Ga0496119_0064683	3300048922	Bacteria	2170
1844	Ga0496119_0192849	3300048922	Bacteria	1060
1845	Ga0496119_0359174	3300048922	Bacteria	703
1846	Ga0496119_0470318	3300048922	Bacteria	589
1847	Ga0496120_0122565	3300048923	Bacteria	1342
1848	Ga0496120_0229224	3300048923	Bacteria	883
1849	Ga0496121_0000278	3300048924	Bacteria	106838
1850	Ga0496121_0000811	3300048924	Bacteria	56962
1851	Ga0496121_0000870	3300048924	Bacteria	54546
1852	Ga0496121_0013765	3300048924	Bacteria	8661
1853	Ga0496121_0023451	3300048924	Bacteria	5942
1854	Ga0496121_0025005	3300048924	Bacteria	5686
1855	Ga0496121_0040752	3300048924	Bacteria	4069
1856	Ga0496121_0042369	3300048924	Bacteria	3961
1857	Ga0496121_0042659	3300048924	Bacteria	3941
1858	Ga0496121_0043491	3300048924	Bacteria	3889
1859	Ga0496121_0045861	3300048924	Bacteria	3749
1860	Ga0496121_0046013	3300048924	Bacteria	3740
1861	Ga0496121_0055430	3300048924	Bacteria	3303
1862	Ga0496121_0078142	3300048924	Bacteria	2632
1863	Ga0496121_0155193	3300048924	Bacteria	1680
1864	Ga0496121_0324600	3300048924	Bacteria	1035
1865	Ga0496121_0394661	3300048924	Bacteria	908
1866	Ga0496122_0016548	3300048925	Bacteria	6964
1867	Ga0496122_0038783	3300048925	Bacteria	3809
1868	Ga0496123_0010686	3300048926	Bacteria	8075
1869	Ga0496123_0454382	3300048926	Bacteria	570
1870	Ga0496124_0001369	3300048927	Bacteria	36505
1871	Ga0496124_0030723	3300048927	Bacteria	4763
1872	Ga0496124_0038984	3300048927	Bacteria	4121
1873	Ga0496124_0075956	3300048927	Bacteria	2775
1874	Ga0496124_0085207	3300048927	Bacteria	2590
1875	Ga0496124_0090096	3300048927	Bacteria	2503
1876	Ga0496124_0172139	3300048927	Bacteria	1675
1877	Ga0496124_0261499	3300048927	Bacteria	1273
1878	Ga0496125_0006423	3300048928	Bacteria	12705
1879	Ga0496125_0012675	3300048928	Bacteria	8344
1880	Ga0496125_0013674	3300048928	Bacteria	7963
1881	Ga0496125_0041291	3300048928	Bacteria	3945
1882	Ga0496125_0109451	3300048928	Bacteria	2006
1883	Ga0496125_0168803	3300048928	Bacteria	1474
1884	Ga0496125_0433232	3300048928	Bacteria	758
1885	Ga0496125_0469928	3300048928	Bacteria	715
1886	Ga0496125_0618542	3300048928	Bacteria	588
1887	Ga0496126_0010955	3300048929	Bacteria	9444
1888	Ga0496126_0021504	3300048929	Bacteria	6300
1889	Ga0496126_0026976	3300048929	Bacteria	5497
1890	Ga0496126_0034893	3300048929	Bacteria	4718
1891	Ga0496126_0036595	3300048929	Bacteria	4587
1892	Ga0496126_0051819	3300048929	Bacteria	3734
1893	Ga0496126_0051928	3300048929	Bacteria	3730
1894	Ga0496126_0054828	3300048929	Bacteria	3608
1895	Ga0496126_0075226	3300048929	Bacteria	2998
1896	Ga0496126_0104783	3300048929	Bacteria	2470
1897	Ga0496126_0227420	3300048929	Bacteria	1564
1898	Ga0496126_0261123	3300048929	Bacteria	1440
1899	Ga0496126_0277050	3300048929	Bacteria	1390
1900	Ga0496126_0320809	3300048929	Bacteria	1273
1901	Ga0496126_0322885	3300048929	Bacteria	1268
1902	Ga0496126_0517407	3300048929	Bacteria	951
1903	Ga0496126_0786254	3300048929	Bacteria	731
1904	Ga0496126_0794248	3300048929	Bacteria	727
1905	Ga0496126_0800993	3300048929	Bacteria	723
1906	Ga0496126_0841782	3300048929	Bacteria	700
1907	Ga0495678_077588	3300049459	Bacteria	1201
1908	Ga0495682_0010624	3300049460	Bacteria	3558
1909	Ga0495682_0116364	3300049460	Bacteria	958
1910	Ga0495682_0207679	3300049460	Bacteria	694
1911	Ga0501031_0016862	3300049568	Bacteria	4743
1912	Ga0501031_0087420	3300049568	Bacteria	2032
1913	Ga0501031_0322841	3300049568	Bacteria	1000
1914	Ga0501031_0399651	3300049568	Bacteria	889
1915	Ga0501031_0743731	3300049568	Bacteria	629
1916	Ga0501032_0004480	3300049569	Bacteria	10516
1917	Ga0501032_0026131	3300049569	Bacteria	4021
1918	Ga0501032_0126827	3300049569	Bacteria	1685
1919	Ga0501032_0265530	3300049569	Bacteria	1112
1920	Ga0501032_0292112	3300049569	Bacteria	1054
1921	Ga0501032_1068724	3300049569	Bacteria	506
1922	Ga0501033_0000075	3300049570	Bacteria	94239
1923	Ga0501033_0000221	3300049570	Bacteria	54727
1924	Ga0501033_0044140	3300049570	Bacteria	3318
1925	Ga0501033_0127352	3300049570	Bacteria	1846
1926	Ga0501033_0206329	3300049570	Bacteria	1402
1927	Ga0501033_0445602	3300049570	Bacteria	900
1928	Ga0501033_0476079	3300049570	Bacteria	865
1929	Ga0501033_0762969	3300049570	Bacteria	655
1930	Ga0501033_0812761	3300049570	Bacteria	631
1931	Ga0501033_0986160	3300049570	Bacteria	564
1932	Ga0501034_0000577	3300049571	Bacteria	58019
1933	Ga0501034_0103566	3300049571	Bacteria	2839
1934	Ga0501034_0103619	3300049571	Bacteria	2839
1935	Ga0501034_0368658	3300049571	Bacteria	1362
1936	Ga0501034_1113073	3300049571	Bacteria	670
1937	Ga0501034_1173448	3300049571	Bacteria	647
1938	Ga0501036_0000501	3300049572	Bacteria	28063
1939	Ga0501036_0047402	3300049572	Bacteria	3639
1940	Ga0501036_0060559	3300049572	Bacteria	3207
1941	Ga0501036_0111077	3300049572	Bacteria	2316
1942	Ga0501036_0126277	3300049572	Bacteria	2160
1943	Ga0501036_0211646	3300049572	Bacteria	1629
1944	Ga0501036_0389785	3300049572	Bacteria	1162
1945	Ga0501036_0886921	3300049572	Bacteria	732
1946	Ga0501037_0001671	3300049573	Bacteria	16131
1947	Ga0501037_0002452	3300049573	Bacteria	13412
1948	Ga0501037_0107640	3300049573	Bacteria	2008
1949	Ga0501037_0120323	3300049573	Bacteria	1888
1950	Ga0501037_0738508	3300049573	Bacteria	653
1951	Ga0501038_0005180	3300049574	Bacteria	12128
1952	Ga0501038_0010565	3300049574	Bacteria	8442
1953	Ga0501038_0019649	3300049574	Bacteria	6083
1954	Ga0501038_0229344	3300049574	Bacteria	1478
1955	Ga0501038_0280253	3300049574	Bacteria	1312
1956	Ga0501038_0590072	3300049574	Bacteria	842
1957	Ga0501039_0012996	3300049575	Bacteria	6365
1958	Ga0501039_0014098	3300049575	Bacteria	6119
1959	Ga0501039_0134184	3300049575	Bacteria	1943
1960	Ga0501039_0360995	3300049575	Bacteria	1141
1961	Ga0501039_0426541	3300049575	Bacteria	1041
1962	Ga0501040_0793043	3300049576	Bacteria	685
1963	Ga0501041_0284692	3300049577	Bacteria	1040
1964	Ga0501042_0089213	3300049578	Bacteria	2212
1965	Ga0501042_0749738	3300049578	Bacteria	710
1966	Ga0501043_0000017	3300049579	Bacteria	166630
1967	Ga0501043_0035578	3300049579	Bacteria	3917
1968	Ga0501043_0170995	3300049579	Bacteria	1695
1969	Ga0501043_0631457	3300049579	Bacteria	788
1970	Ga0501043_0649959	3300049579	Bacteria	774
1971	Ga0501043_0790328	3300049579	Bacteria	687
1972	Ga0501046_0001421	3300049580	Bacteria	23028
1973	Ga0501046_0029646	3300049580	Bacteria	4448
1974	Ga0501046_0064208	3300049580	Bacteria	2867
1975	Ga0501046_0289351	3300049580	Bacteria	1198
1976	Ga0501046_0552765	3300049580	Bacteria	820
1977	Ga0501046_0925603	3300049580	Bacteria	607
1978	Ga0501047_0002585	3300049581	Bacteria	17228
1979	Ga0501047_0034064	3300049581	Bacteria	4917
1980	Ga0501047_0148494	3300049581	Bacteria	2220
1981	Ga0501047_0214486	3300049581	Bacteria	1782
1982	Ga0501047_0381190	3300049581	Bacteria	1244
1983	Ga0501047_1018090	3300049581	Bacteria	642
1984	Ga0501047_1101112	3300049581	Bacteria	608
1985	Ga0501048_0022007	3300049582	Bacteria	4666
1986	Ga0501048_0294464	3300049582	Bacteria	1154
1987	Ga0501067_0000120	3300049583	Bacteria	43772
1988	Ga0501067_0067681	3300049583	Bacteria	1977
1989	Ga0501067_0071550	3300049583	Bacteria	1921
1990	Ga0501067_0250947	3300049583	Bacteria	985
1991	Ga0501068_0001605	3300049584	Bacteria	12036
1992	Ga0501069_0001241	3300049585	Bacteria	12480
1993	Ga0501069_0255729	3300049585	Bacteria	1022
1994	Ga0501069_1008257	3300049585	Bacteria	509
1995	Ga0501070_0006393	3300049586	Bacteria	10022
1996	Ga0501070_0046606	3300049586	Bacteria	3604
1997	Ga0501070_0072035	3300049586	Bacteria	2860
1998	Ga0501070_0240160	3300049586	Bacteria	1483
1999	Ga0501070_0268333	3300049586	Bacteria	1394
2000	Ga0501070_0492774	3300049586	Bacteria	985
2001	Ga0501070_0557877	3300049586	Bacteria	916
2002	Ga0501070_1337962	3300049586	Bacteria	546
2003	Ga0501071_0157749	3300049587	Bacteria	1695
2004	Ga0501071_0238933	3300049587	Bacteria	1370
2005	Ga0501072_0005645	3300049588	Bacteria	9525
2006	Ga0501073_0010113	3300049589	Bacteria	6934
2007	Ga0501073_0032902	3300049589	Bacteria	3694
2008	Ga0501073_0192067	3300049589	Bacteria	1413
2009	Ga0501073_0685854	3300049589	Bacteria	707
2010	Ga0501074_0000055	3300049590	Bacteria	55557
2011	Ga0501074_0067103	3300049590	Bacteria	2580
2012	Ga0501074_0136932	3300049590	Bacteria	1751
2013	Ga0501074_0713133	3300049590	Bacteria	708
2014	Ga0501076_0468787	3300049592	Bacteria	1037
2015	Ga0501077_1149522	3300049593	Bacteria	500
2016	Ga0501079_0002378	3300049741	Bacteria	13652
2017	Ga0501079_0382258	3300049741	Bacteria	1104
2018	Ga0501080_0001422	3300049742	Bacteria	20085
2019	Ga0501080_0003985	3300049742	Bacteria	13074
2020	Ga0501080_0058337	3300049742	Bacteria	3593
2021	Ga0501080_0084618	3300049742	Bacteria	2947
2022	Ga0501080_0377448	3300049742	Bacteria	1278
2023	Ga0501080_0537233	3300049742	Bacteria	1042
2024	Ga0501080_0707109	3300049742	Bacteria	888
2025	Ga0501081_1359440	3300049743	Bacteria	539
2026	Ga0501083_0005528	3300049744	Bacteria	8957
2027	Ga0501083_0171400	3300049744	Bacteria	1418
2028	Ga0501083_0691453	3300049744	Bacteria	663
2029	Ga0501035_0000123	3300049822	Bacteria	93734
2030	Ga0501035_0006891	3300049822	Bacteria	10615
2031	Ga0501035_0078828	3300049822	Bacteria	2909
2032	Ga0501035_0140460	3300049822	Bacteria	2100
2033	Ga0501035_0247023	3300049822	Bacteria	1516
2034	Ga0501035_0529239	3300049822	Bacteria	967
2035	Ga0501035_0564999	3300049822	Bacteria	930
2036	Ga0501035_0868849	3300049822	Bacteria	716
2037	Ga0501044_0000329	3300049823	Bacteria	59853
2038	Ga0501044_0015149	3300049823	Bacteria	8309
2039	Ga0501044_0101952	3300049823	Bacteria	2887
2040	Ga0501044_0104087	3300049823	Bacteria	2852
2041	Ga0501044_0326631	3300049823	Bacteria	1457
2042	Ga0501044_0377160	3300049823	Bacteria	1334
2043	Ga0501044_0455447	3300049823	Bacteria	1185
2044	Ga0501044_0755197	3300049823	Bacteria	854
2045	Ga0501044_0954306	3300049823	Bacteria	730
2046	Ga0501044_1486087	3300049823	Bacteria	543
2047	Ga0501045_0011320	3300049824	Bacteria	6263
2048	Ga0501045_0426019	3300049824	Bacteria	987
2049	nmdc:mga03683_147407_c1	3300050489	Bacteria	1060
2050	nmdc:mga03683_241954_c1	3300050489	Bacteria	836
2051	nmdc:mga03683_27468_c1	3300050489	Bacteria	2254
2052	nmdc:mga03683_311530_c1	3300050489	Bacteria	740
2053	nmdc:mga03683_313102_c1	3300050489	Bacteria	738
2054	nmdc:mga03683_372183_c1	3300050489	Bacteria	679
2055	nmdc:mga03683_568417_c1	3300050489	Bacteria	553
2056	nmdc:mga03n38_2197_c1	3300050490	Bacteria	5952
2057	nmdc:mga03n38_342354_c1	3300050490	Bacteria	812
2058	nmdc:mga03n38_559734_c1	3300050490	Bacteria	648
2059	nmdc:mga03n38_83295_c1	3300050490	Bacteria	1508
2060	nmdc:mga00v17_140364_c1	3300050491	Bacteria	1549
2061	nmdc:mga00v17_2666_c1	3300050491	Bacteria	9152
2062	nmdc:mga00v17_387368_c1	3300050491	Bacteria	909
2063	nmdc:mga00v17_418648_c1	3300050491	Bacteria	870
2064	nmdc:mga00v17_565783_c1	3300050491	Bacteria	734
2065	nmdc:mga00v17_761738_c1	3300050491	Bacteria	618
2066	nmdc:mga0yw44_1178673_c1	3300050492	Bacteria	517
2067	nmdc:mga0yw44_159694_c1	3300050492	Bacteria	1475
2068	nmdc:mga0yw44_17928_c1	3300050492	Bacteria	3866
2069	nmdc:mga0yw44_187611_c1	3300050492	Bacteria	1363
2070	nmdc:mga0yw44_386082_c1	3300050492	Bacteria	946
2071	nmdc:mga0yw44_40195_c1	3300050492	Bacteria	2777
2072	nmdc:mga0yw44_406324_c1	3300050492	Bacteria	921
2073	nmdc:mga0yw44_410043_c1	3300050492	Bacteria	917
2074	nmdc:mga0yw44_57766_c1	3300050492	Bacteria	2368
2075	nmdc:mga0yw44_83926_c1	3300050492	Bacteria	2002
2076	nmdc:mga0yw44_939475_c1	3300050492	Bacteria	586
2077	nmdc:mga0k408_132137_c1	3300050493	Bacteria	1129
2078	nmdc:mga0k408_210814_c1	3300050493	Bacteria	1160
2079	nmdc:mga0k408_43474_c1	3300050493	Bacteria	2043
2080	nmdc:mga0k408_518086_c1	3300050493	Bacteria	706
2081	nmdc:mga0k408_528478_c1	3300050493	Bacteria	698
2082	nmdc:mga0k408_88200_c1	3300050493	Bacteria	1822
2083	nmdc:mga06z11_14853_c1	3300050494	Bacteria	3461
2084	nmdc:mga06z11_17595_c1	3300050494	Bacteria	3248
2085	nmdc:mga06z11_209345_c1	3300050494	Bacteria	1136
2086	nmdc:mga06z11_26308_c1	3300050494	Bacteria	2768
2087	nmdc:mga06z11_264833_c1	3300050494	Bacteria	1015
2088	nmdc:mga06z11_500748_c1	3300050494	Bacteria	736
2089	nmdc:mga06z11_5537_c1	3300050494	Bacteria	5076
2090	nmdc:mga06z11_584374_c1	3300050494	Bacteria	679
2091	nmdc:mga06z11_67807_c1	3300050494	Bacteria	1879
2092	nmdc:mga04h51_133435_c1	3300050495	Bacteria	936
2093	nmdc:mga04h51_209469_c1	3300050495	Bacteria	769
2094	nmdc:mga04h51_253933_c1	3300050495	Bacteria	705
2095	nmdc:mga04h51_286574_c1	3300050495	Bacteria	668
2096	nmdc:mga04h51_77421_c1	3300050495	Bacteria	1174
2097	nmdc:mga04h51_82788_c1	3300050495	Bacteria	1142
2098	nmdc:mga07m45_185975_c1	3300050496	Bacteria	1208
2099	nmdc:mga07m45_2890_c1	3300050496	Bacteria	6197
2100	nmdc:mga07m45_29152_c1	3300050496	Bacteria	3050
2101	nmdc:mga07m45_83022_c1	3300050496	Bacteria	1830
2102	nmdc:mga05p37_258220_c1	3300050507	Bacteria	2087
2103	nmdc:mga0qj67_120895_c1	3300050509	Bacteria	2118
2104	nmdc:mga0qj67_340421_c1	3300050509	Bacteria	1213
2105	nmdc:mga06r32_1208846_c1	3300050510	Bacteria	702
2106	nmdc:mga08y16_544697_c1	3300050511	Bacteria	1175
2107	nmdc:mga0n895_37685_c1	3300050512	Bacteria	4679
2108	nmdc:mga0n895_385075_c1	3300050512	Bacteria	1419
2109	nmdc:mga0rr50_588446_c1	3300050513	Bacteria	948
2110	nmdc:mga08x19_1075971_c1	3300050514	Bacteria	571
2111	nmdc:mga08x19_498598_c1	3300050514	Bacteria	859
2112	nmdc:mga0a205_1535077_c1	3300050515	Bacteria	514
2113	nmdc:mga0sz30_103010_c1	3300050516	Bacteria	877
2114	nmdc:mga0sz30_1770_c1	3300050516	Bacteria	7671
2115	nmdc:mga0sz30_21122_c2	3300050516	Bacteria	1910
2116	nmdc:mga0sz30_54534_c1	3300050516	Bacteria	1700
2117	Ga0495601_0081782	3300053077	Bacteria	2073
2118	Ga0495601_0096433	3300053077	Bacteria	1907
2119	Ga0495601_0114771	3300053077	Bacteria	1746
2120	Ga0495601_0153758	3300053077	Bacteria	1502
2121	Ga0495612_0010159	3300053078	Bacteria	3807
2122	Ga0495612_0199362	3300053078	Bacteria	883
2123	Ga0495612_0320263	3300053078	Bacteria	697
2124	Ga0500635_0097836	3300053080	Bacteria	1075
2125	Ga0500635_0114605	3300053080	Bacteria	1004
2126	Ga0495655_0015832	3300053083	Bacteria	1612
2127	Ga0495655_0061057	3300053083	Bacteria	1028
2128	Ga0495655_0191908	3300053083	Bacteria	664
2129	Ga0495595_0001279	3300053084	Bacteria	9806
2130	Ga0495595_0112424	3300053084	Bacteria	1321
2131	Ga0495595_0648627	3300053084	Bacteria	540
2132	Ga0495619_0002526	3300053085	Bacteria	11970
2133	Ga0495619_0008288	3300053085	Bacteria	6573
2134	Ga0495619_0148348	3300053085	Bacteria	1618
2135	Ga0495619_0152200	3300053085	Bacteria	1596
2136	Ga0495619_0393067	3300053085	Bacteria	958
2137	Ga0495619_0741529	3300053085	Bacteria	666
2138	Ga0500578_0191143	3300053086	Bacteria	1257
2139	Ga0500578_0309115	3300053086	Bacteria	935
2140	Ga0500578_0384604	3300053086	Bacteria	813
2141	Ga0500578_0653590	3300053086	Bacteria	571
2142	Ga0500643_000112	3300053087	Bacteria	84793
2143	Ga0500643_039738	3300053087	Bacteria	1388
2144	Ga0500644_0017901	3300053088	Bacteria	2065
2145	Ga0500644_0203343	3300053088	Bacteria	820
2146	Ga0500644_0570959	3300053088	Bacteria	500
2147	Ga0500581_079515	3300053089	Bacteria	1638
2148	Ga0500583_0045494	3300053092	Bacteria	2015
2149	Ga0500583_0272459	3300053092	Bacteria	832
2150	Ga0500651_0052607	3300053093	Bacteria	2554
2151	Ga0500651_0071644	3300053093	Bacteria	2156
2152	Ga0500651_0129906	3300053093	Bacteria	1524
2153	Ga0500651_0131115	3300053093	Bacteria	1516
2154	Ga0500651_0277224	3300053093	Bacteria	968
2155	Ga0500651_0398234	3300053093	Bacteria	774
2156	Ga0500566_0000811	3300053094	Bacteria	17784
2157	Ga0500566_0014400	3300053094	Bacteria	4650
2158	Ga0500566_0108365	3300053094	Bacteria	1513
2159	Ga0500641_0018452	3300053096	Bacteria	2624
2160	Ga0500641_0180144	3300053096	Bacteria	907
2161	Ga0500641_0257371	3300053096	Bacteria	730
2162	Ga0500648_030629	3300053097	Bacteria	3024
2163	Ga0500650_0131380	3300053098	Bacteria	1164
2164	Ga0500650_0134596	3300053098	Bacteria	1148
2165	Ga0500650_0288401	3300053098	Bacteria	728
2166	Ga0500554_010947	3300053102	Bacteria	2230
2167	Ga0500555_003229	3300053103	Bacteria	4644
2168	Ga0500555_031269	3300053103	Bacteria	1509
2169	Ga0500556_0000006	3300053104	Bacteria	453982
2170	Ga0500556_0004003	3300053104	Bacteria	4248
2171	Ga0500557_000021	3300053105	Bacteria	89662
2172	Ga0500562_035701	3300053108	Bacteria	1317
2173	Ga0500562_055931	3300053108	Bacteria	1057
2174	Ga0500562_113722	3300053108	Bacteria	737
2175	Ga0500569_001412	3300053109	Bacteria	4521
2176	Ga0500569_004967	3300053109	Bacteria	2830
2177	Ga0500569_074917	3300053109	Bacteria	1072
2178	Ga0500572_000229	3300053111	Bacteria	19843
2179	Ga0500572_084615	3300053111	Bacteria	997
2180	Ga0500592_000600	3300053116	Bacteria	5910
2181	Ga0500594_0014913	3300053118	Bacteria	1867
2182	Ga0500595_003189	3300053119	Bacteria	7758
2183	Ga0500595_003555	3300053119	Bacteria	7241
2184	Ga0500595_004189	3300053119	Bacteria	6527
2185	Ga0500595_030704	3300053119	Bacteria	1808
2186	Ga0500607_103795	3300053121	Bacteria	1406
2187	Ga0500607_136333	3300053121	Bacteria	1162
2188	Ga0500608_028614	3300053122	Bacteria	2630
2189	Ga0500608_217624	3300053122	Bacteria	774
2190	Ga0500614_055022	3300053123	Bacteria	1055
2191	Ga0500618_018891	3300053125	Bacteria	1701
2192	Ga0500628_050840	3300053129	Bacteria	983
2193	Ga0500642_0000004	3300053130	Bacteria	433122
2194	Ga0500642_0000531	3300053130	Bacteria	11585
2195	Ga0500642_0042861	3300053130	Bacteria	1963
2196	Ga0500642_0177006	3300053130	Bacteria	998
2197	Ga0500642_0381540	3300053130	Bacteria	619
2198	Ga0500642_0397493	3300053130	Bacteria	602
2199	Ga0500652_000160	3300053131	Bacteria	25768
2200	Ga0500655_014316	3300053133	Bacteria	1451
2201	Ga0500658_0105221	3300053134	Bacteria	1236
2202	Ga0500658_0303005	3300053134	Bacteria	735
2203	Ga0500658_0551958	3300053134	Bacteria	518
2204	Ga0500658_0584126	3300053134	Bacteria	500
2205	Ga0500559_0000186	3300053136	Bacteria	49470
2206	Ga0500559_0001431	3300053136	Bacteria	13545
2207	Ga0500559_0025007	3300053136	Bacteria	2541
2208	Ga0500559_0096910	3300053136	Bacteria	1355
2209	Ga0500559_0414711	3300053136	Bacteria	625
2210	Ga0500559_0450118	3300053136	Bacteria	595
2211	Ga0500561_0030521	3300053137	Bacteria	1355
2212	Ga0500564_028441	3300053138	Bacteria	2573
2213	Ga0500568_0005661	3300053139	Bacteria	6418
2214	Ga0500568_0068898	3300053139	Bacteria	1357
2215	Ga0500568_0110882	3300053139	Bacteria	1025
2216	Ga0500568_0134379	3300053139	Bacteria	919
2217	Ga0500573_0107244	3300053140	Bacteria	1566
2218	Ga0500577_0032763	3300053142	Bacteria	1830
2219	Ga0500577_0061392	3300053142	Bacteria	1446
2220	Ga0500577_0193260	3300053142	Bacteria	876
2221	Ga0500585_079631	3300053144	Bacteria	1184
2222	Ga0500586_000112	3300053145	Bacteria	14466
2223	Ga0500588_0065276	3300053146	Bacteria	1178
2224	Ga0500588_0159482	3300053146	Bacteria	820
2225	Ga0500589_038922	3300053147	Bacteria	2220
2226	Ga0500590_115144	3300053148	Bacteria	1269
2227	Ga0500590_132797	3300053148	Bacteria	1150
2228	Ga0500590_140420	3300053148	Bacteria	1104
2229	Ga0500590_140853	3300053148	Bacteria	1102
2230	Ga0500590_289569	3300053148	Bacteria	623
2231	Ga0500603_001369	3300053150	Bacteria	5560
2232	Ga0500603_233869	3300053150	Bacteria	588
2233	Ga0500604_0020811	3300053151	Bacteria	1850
2234	Ga0500604_0122683	3300053151	Bacteria	869
2235	Ga0500616_0000022	3300053153	Bacteria	460463
2236	Ga0500616_0000046	3300053153	Bacteria	333409
2237	Ga0500616_0160432	3300053153	Bacteria	1032
2238	Ga0500619_082020	3300053154	Bacteria	1083
2239	Ga0500619_139220	3300053154	Bacteria	827
2240	Ga0500620_014749	3300053155	Bacteria	2191
2241	Ga0500622_0003300	3300053156	Bacteria	10912
2242	Ga0500622_0003668	3300053156	Bacteria	10088
2243	Ga0500622_0417505	3300053156	Bacteria	541
2244	Ga0500627_0050928	3300053158	Bacteria	1805
2245	Ga0500627_0146736	3300053158	Bacteria	1066
2246	Ga0500627_0230305	3300053158	Bacteria	825
2247	Ga0500627_0458347	3300053158	Bacteria	535
2248	Ga0500633_0041237	3300053160	Bacteria	1553
2249	Ga0500634_0124148	3300053161	Bacteria	1251
2250	Ga0500634_0139903	3300053161	Bacteria	1148
2251	Ga0500634_0163814	3300053161	Bacteria	1023
2252	Ga0500634_0265285	3300053161	Bacteria	703
2253	Ga0500638_037184	3300053162	Bacteria	2362
2254	Ga0500638_137802	3300053162	Bacteria	1099
2255	Ga0500638_187829	3300053162	Bacteria	886
2256	Ga0500639_096942	3300053163	Bacteria	1459
2257	Ga0500636_0001584	3300053177	Bacteria	12378
2258	Ga0500636_0003476	3300053177	Bacteria	8869
2259	Ga0500636_0126065	3300053177	Bacteria	1431
2260	Ga0500636_0300061	3300053177	Bacteria	791
2261	Ga0500636_0405345	3300053177	Bacteria	631
2262	Ga0500637_0003374	3300053178	Bacteria	7365
2263	Ga0500637_0102425	3300053178	Bacteria	1660
2264	Ga0500637_0193882	3300053178	Bacteria	1160
2265	Ga0500637_0316037	3300053178	Bacteria	846
2266	Ga0500637_0383487	3300053178	Bacteria	736
2267	Ga0500611_172309	3300053727	Bacteria	603
2268	Ga0500625_136418	3300053729	Bacteria	953
2269	Ga0500645_021916	3300053730	Bacteria	1969
2270	Ga0500645_026788	3300053730	Bacteria	1752
2271	Ga0500645_033721	3300053730	Bacteria	1531
2272	Ga0500645_126161	3300053730	Bacteria	712
2273	Ga0500609_010631	3300053731	Bacteria	1240
2274	Ga0500552_041743	3300053733	Bacteria	750
2275	Ga0500552_084511	3300053733	Bacteria	586
2276	Ga0500596_008387	3300053735	Bacteria	1650
2277	Ga0500596_017413	3300053735	Bacteria	1077
2278	Ga0500599_002281	3300053736	Bacteria	2285
2279	Ga0500587_089843	3300053739	Bacteria	505
2280	Ga0501084_0033342	3300054114	Bacteria	4308
2281	Ga0501084_1869670	3300054114	Bacteria	501
2282	Ga0587093_101888	3300059478	Bacteria	519
2283	Ga0587073_0116461	3300059492	Bacteria	716
2284	Ga0587073_0166946	3300059492	Bacteria	636
2285	Ga0587077_086922	3300059493	Bacteria	728
2286	Ga0587080_018802	3300059503	Bacteria	1113
2287	Ga0587098_044908	3300059604	Bacteria	654
2288	Ga0587106_110129	3300059605	Bacteria	573
2289	Ga0587075_135853	3300059644	Bacteria	521
2290	Ga0587079_186056	3300059647	Bacteria	559
2291	Ga0587100_042638	3300059648	Bacteria	515
2292	Ga0587071_049651	3300060344	Bacteria	864
2293	Ga0501082_0014942	3300060353	Bacteria	6690
2294	Ga0501082_0048138	3300060353	Bacteria	3674
2295	Ga0466962_0033677	3300061719	Bacteria	2452
2296	Ga0466962_0135827	3300061719	Bacteria	1190

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300032126	Ga0307415_100548277	Ga0307415_1005482772	115
2	3300031616	Ga0307508_10212454	Ga0307508_102124542	118
3	3300041458	Ga0451798_0866552	Ga0451798_0866552_131_562	130
4	3300026041	Ga0207639_10504047	Ga0207639_105040472	134
5	3300001979	JGI24740J21852_10000635	JGI24740J21852_1000063511	135
6	3300001989	JGI24739J22299_10002357	JGI24739J22299_100023576	135
7	3300001990	JGI24737J22298_10003086	JGI24737J22298_100030865	135
8	3300002070	JGI24750J21931_1018831	JGI24750J21931_10188311	135
9	3300002075	JGI24738J21930_10088130	JGI24738J21930_100881301	135
10	3300002244	JGI24742J22300_10039833	JGI24742J22300_100398332	135
11	3300003203	JGI25406J46586_10000364	JGI25406J46586_1000036418	135
12	3300003203	JGI25406J46586_10005263	JGI25406J46586_100052634	135
13	3300003215	JGI25153J46596_10002894	JGI25153J46596_100028943	135
14	3300003215	JGI25153J46596_10011040	JGI25153J46596_100110402	135
15	3300003215	JGI25153J46596_10013892	JGI25153J46596_100138922	135
16	3300003215	JGI25153J46596_10066167	JGI25153J46596_100661671	135
17	3300003354	JGI25160J50197_1008881	JGI25160J50197_10088812	135
18	3300003354	JGI25160J50197_1027217	JGI25160J50197_10272172	135
19	3300003775	Ga0055524_1026510	Ga0055524_10265102	135
20	3300003794	Ga0055531_10022725	Ga0055531_100227252	135
21	3300003911	JGI25405J52794_10063271	JGI25405J52794_100632712	135
22	3300005262	Ga0065165_1006458	Ga0065165_10064586	135
23	3300005262	Ga0065165_1007708	Ga0065165_10077085	135
24	3300005262	Ga0065165_1080366	Ga0065165_10803661	135
25	3300005290	Ga0065712_10295706	Ga0065712_102957062	135
26	3300005293	Ga0065715_10300026	Ga0065715_103000262	135
27	3300005327	Ga0070658_10009941	Ga0070658_100099415	135
28	3300005327	Ga0070658_10619433	Ga0070658_106194332	135
29	3300005327	Ga0070658_10875581	Ga0070658_108755812	135
30	3300005328	Ga0070676_10145927	Ga0070676_101459272	135
31	3300005328	Ga0070676_10263703	Ga0070676_102637032	135
32	3300005328	Ga0070676_10844255	Ga0070676_108442552	135
33	3300005328	Ga0070676_11155574	Ga0070676_111555741	135
34	3300005329	Ga0070683_100023174	Ga0070683_1000231745	135
35	3300005329	Ga0070683_100031788	Ga0070683_1000317884	135
36	3300005329	Ga0070683_100066945	Ga0070683_1000669452	135
37	3300005329	Ga0070683_100186761	Ga0070683_1001867612	135
38	3300005329	Ga0070683_100470076	Ga0070683_1004700761	135
39	3300005330	Ga0070690_100343432	Ga0070690_1003434322	135
40	3300005331	Ga0070670_100242428	Ga0070670_1002424282	135
41	3300005331	Ga0070670_100322905	Ga0070670_1003229051	135
42	3300005333	Ga0070677_10279320	Ga0070677_102793202	135
43	3300005334	Ga0068869_100230823	Ga0068869_1002308232	135
44	3300005334	Ga0068869_100595165	Ga0068869_1005951652	135
45	3300005334	Ga0068869_101186159	Ga0068869_1011861591	135
46	3300005334	Ga0068869_101324851	Ga0068869_1013248511	135
47	3300005335	Ga0070666_10337059	Ga0070666_103370591	135
48	3300005335	Ga0070666_10354290	Ga0070666_103542902	135
49	3300005336	Ga0070680_100018571	Ga0070680_1000185714	135
50	3300005336	Ga0070680_100028929	Ga0070680_1000289295	135
51	3300005336	Ga0070680_100093185	Ga0070680_1000931853	135
52	3300005336	Ga0070680_100191211	Ga0070680_1001912112	135
53	3300005336	Ga0070680_100414785	Ga0070680_1004147852	135
54	3300005336	Ga0070680_100429857	Ga0070680_1004298572	135
55	3300005337	Ga0070682_100099703	Ga0070682_1000997031	135
56	3300005337	Ga0070682_100149754	Ga0070682_1001497541	135
57	3300005337	Ga0070682_100283448	Ga0070682_1002834482	135
58	3300005337	Ga0070682_100497949	Ga0070682_1004979492	135
59	3300005338	Ga0068868_100128435	Ga0068868_1001284352	135
60	3300005338	Ga0068868_100130434	Ga0068868_1001304341	135
61	3300005338	Ga0068868_100254970	Ga0068868_1002549702	135
62	3300005338	Ga0068868_100301738	Ga0068868_1003017382	135
63	3300005338	Ga0068868_100343694	Ga0068868_1003436942	135
64	3300005338	Ga0068868_100761845	Ga0068868_1007618452	135
65	3300005339	Ga0070660_100071616	Ga0070660_1000716162	135
66	3300005339	Ga0070660_100327218	Ga0070660_1003272181	135
67	3300005339	Ga0070660_100330413	Ga0070660_1003304131	135
68	3300005339	Ga0070660_100454549	Ga0070660_1004545491	135
69	3300005339	Ga0070660_100456425	Ga0070660_1004564252	135
70	3300005343	Ga0070687_100588447	Ga0070687_1005884471	135
71	3300005344	Ga0070661_100011760	Ga0070661_1000117602	135
72	3300005344	Ga0070661_100648808	Ga0070661_1006488082	135
73	3300005345	Ga0070692_10267455	Ga0070692_102674552	135
74	3300005347	Ga0070668_100165206	Ga0070668_1001652063	135
75	3300005347	Ga0070668_100219830	Ga0070668_1002198302	135
76	3300005347	Ga0070668_100224899	Ga0070668_1002248992	135
77	3300005347	Ga0070668_100265636	Ga0070668_1002656362	135
78	3300005347	Ga0070668_100397247	Ga0070668_1003972471	135
79	3300005347	Ga0070668_101044074	Ga0070668_1010440741	135
80	3300005347	Ga0070668_101099235	Ga0070668_1010992351	135
81	3300005353	Ga0070669_100425396	Ga0070669_1004253961	135
82	3300005353	Ga0070669_100649352	Ga0070669_1006493521	135
83	3300005353	Ga0070669_100730999	Ga0070669_1007309991	135
84	3300005354	Ga0070675_100150577	Ga0070675_1001505772	135
85	3300005354	Ga0070675_100619140	Ga0070675_1006191402	135
86	3300005354	Ga0070675_101562812	Ga0070675_1015628121	135
87	3300005355	Ga0070671_100084350	Ga0070671_1000843502	135
88	3300005355	Ga0070671_100100898	Ga0070671_1001008981	135
89	3300005355	Ga0070671_100152347	Ga0070671_1001523472	135
90	3300005355	Ga0070671_100324406	Ga0070671_1003244062	135
91	3300005355	Ga0070671_100419193	Ga0070671_1004191931	135
92	3300005355	Ga0070671_100742661	Ga0070671_1007426611	135
93	3300005356	Ga0070674_100190697	Ga0070674_1001906973	135
94	3300005356	Ga0070674_100309997	Ga0070674_1003099971	135
95	3300005356	Ga0070674_100387401	Ga0070674_1003874011	135
96	3300005356	Ga0070674_101662749	Ga0070674_1016627491	135
97	3300005364	Ga0070673_100200679	Ga0070673_1002006792	135
98	3300005364	Ga0070673_100794053	Ga0070673_1007940531	135
99	3300005365	Ga0070688_100220804	Ga0070688_1002208042	135
100	3300005365	Ga0070688_100537778	Ga0070688_1005377781	135
101	3300005365	Ga0070688_100607495	Ga0070688_1006074951	135
102	3300005365	Ga0070688_101085207	Ga0070688_1010852072	135
103	3300005366	Ga0070659_100036969	Ga0070659_1000369695	135
104	3300005366	Ga0070659_100158027	Ga0070659_1001580271	135
105	3300005366	Ga0070659_100228211	Ga0070659_1002282112	135
106	3300005366	Ga0070659_100243171	Ga0070659_1002431711	135
107	3300005366	Ga0070659_100889401	Ga0070659_1008894011	135
108	3300005366	Ga0070659_100897171	Ga0070659_1008971711	135
109	3300005366	Ga0070659_100998515	Ga0070659_1009985151	135
110	3300005367	Ga0070667_100285359	Ga0070667_1002853592	135
111	3300005367	Ga0070667_100387415	Ga0070667_1003874152	135
112	3300005367	Ga0070667_100533625	Ga0070667_1005336251	135
113	3300005367	Ga0070667_100671502	Ga0070667_1006715022	135
114	3300005367	Ga0070667_101090309	Ga0070667_1010903091	135
115	3300005434	Ga0070709_10015451	Ga0070709_100154512	135
116	3300005434	Ga0070709_10102893	Ga0070709_101028932	135
117	3300005434	Ga0070709_10399642	Ga0070709_103996422	135
118	3300005435	Ga0070714_100012416	Ga0070714_1000124164	135
119	3300005435	Ga0070714_100017642	Ga0070714_1000176428	135
120	3300005435	Ga0070714_100081631	Ga0070714_1000816312	135
121	3300005435	Ga0070714_100794903	Ga0070714_1007949031	135
122	3300005436	Ga0070713_100016355	Ga0070713_1000163556	135
123	3300005436	Ga0070713_100027142	Ga0070713_1000271422	135
124	3300005436	Ga0070713_100030753	Ga0070713_1000307534	135
125	3300005436	Ga0070713_100056704	Ga0070713_1000567041	135
126	3300005436	Ga0070713_100058193	Ga0070713_1000581934	135
127	3300005436	Ga0070713_100392007	Ga0070713_1003920072	135
128	3300005436	Ga0070713_100463314	Ga0070713_1004633142	135
129	3300005436	Ga0070713_101119442	Ga0070713_1011194422	135
130	3300005437	Ga0070710_10001137	Ga0070710_100011377	135
131	3300005437	Ga0070710_10299155	Ga0070710_102991552	135
132	3300005437	Ga0070710_10328705	Ga0070710_103287052	135
133	3300005438	Ga0070701_10240005	Ga0070701_102400052	135
134	3300005439	Ga0070711_100002213	Ga0070711_1000022135	135
135	3300005439	Ga0070711_100036606	Ga0070711_1000366063	135
136	3300005439	Ga0070711_100682519	Ga0070711_1006825191	135
137	3300005439	Ga0070711_100835687	Ga0070711_1008356871	135
138	3300005440	Ga0070705_100873373	Ga0070705_1008733732	135
139	3300005441	Ga0070700_100268056	Ga0070700_1002680562	135
140	3300005441	Ga0070700_100527142	Ga0070700_1005271422	135
141	3300005441	Ga0070700_100889657	Ga0070700_1008896571	135
142	3300005455	Ga0070663_100039181	Ga0070663_1000391814	135
143	3300005455	Ga0070663_100060017	Ga0070663_1000600173	135
144	3300005455	Ga0070663_100069616	Ga0070663_1000696163	135
145	3300005455	Ga0070663_100074887	Ga0070663_1000748872	135
146	3300005455	Ga0070663_100090808	Ga0070663_1000908082	135
147	3300005455	Ga0070663_100364809	Ga0070663_1003648092	135
148	3300005455	Ga0070663_100493635	Ga0070663_1004936351	135
149	3300005455	Ga0070663_100556161	Ga0070663_1005561612	135
150	3300005455	Ga0070663_100697602	Ga0070663_1006976022	135
151	3300005455	Ga0070663_101066378	Ga0070663_1010663781	135
152	3300005456	Ga0070678_100011899	Ga0070678_1000118995	135
153	3300005456	Ga0070678_100072529	Ga0070678_1000725293	135
154	3300005456	Ga0070678_100111074	Ga0070678_1001110742	135
155	3300005456	Ga0070678_100161380	Ga0070678_1001613801	135
156	3300005456	Ga0070678_100326729	Ga0070678_1003267292	135
157	3300005456	Ga0070678_100394627	Ga0070678_1003946272	135
158	3300005456	Ga0070678_100724968	Ga0070678_1007249682	135
159	3300005456	Ga0070678_100750303	Ga0070678_1007503032	135
160	3300005457	Ga0070662_100015653	Ga0070662_1000156535	135
161	3300005457	Ga0070662_100199248	Ga0070662_1001992481	135
162	3300005457	Ga0070662_100664924	Ga0070662_1006649242	135
163	3300005457	Ga0070662_100875551	Ga0070662_1008755512	135
164	3300005457	Ga0070662_101067109	Ga0070662_1010671091	135
165	3300005457	Ga0070662_101703779	Ga0070662_1017037791	135
166	3300005458	Ga0070681_10017847	Ga0070681_100178472	135
167	3300005458	Ga0070681_10030253	Ga0070681_100302532	135
168	3300005458	Ga0070681_10062073	Ga0070681_100620732	135
169	3300005458	Ga0070681_10180319	Ga0070681_101803192	135
170	3300005458	Ga0070681_10612128	Ga0070681_106121282	135
171	3300005459	Ga0068867_100088215	Ga0068867_1000882152	135
172	3300005459	Ga0068867_100931571	Ga0068867_1009315712	135
173	3300005466	Ga0070685_10315653	Ga0070685_103156532	135
174	3300005466	Ga0070685_10439343	Ga0070685_104393432	135
175	3300005466	Ga0070685_10452483	Ga0070685_104524832	135
176	3300005467	Ga0070706_100758850	Ga0070706_1007588501	135
177	3300005468	Ga0070707_100069435	Ga0070707_1000694355	135
178	3300005471	Ga0070698_100066713	Ga0070698_1000667133	135
179	3300005471	Ga0070698_101238649	Ga0070698_1012386491	135
180	3300005518	Ga0070699_100927905	Ga0070699_1009279052	135
181	3300005518	Ga0070699_101079062	Ga0070699_1010790621	135
182	3300005530	Ga0070679_100017988	Ga0070679_1000179882	135
183	3300005530	Ga0070679_100105888	Ga0070679_1001058883	135
184	3300005530	Ga0070679_100247205	Ga0070679_1002472052	135
185	3300005530	Ga0070679_100363079	Ga0070679_1003630792	135
186	3300005530	Ga0070679_100431704	Ga0070679_1004317041	135
187	3300005530	Ga0070679_100975205	Ga0070679_1009752052	135
188	3300005530	Ga0070679_101328753	Ga0070679_1013287531	135
189	3300005535	Ga0070684_100000950	Ga0070684_10000095019	135
190	3300005535	Ga0070684_100122727	Ga0070684_1001227272	135
191	3300005535	Ga0070684_101582518	Ga0070684_1015825181	135
192	3300005535	Ga0070684_101686529	Ga0070684_1016865291	135
193	3300005536	Ga0070697_100030494	Ga0070697_1000304943	135
194	3300005536	Ga0070697_100232263	Ga0070697_1002322633	135
195	3300005536	Ga0070697_101676039	Ga0070697_1016760391	135
196	3300005539	Ga0068853_100007151	Ga0068853_1000071518	135
197	3300005539	Ga0068853_100039602	Ga0068853_1000396024	135
198	3300005539	Ga0068853_100046015	Ga0068853_1000460152	135
199	3300005539	Ga0068853_100058275	Ga0068853_1000582751	135
200	3300005539	Ga0068853_100086864	Ga0068853_1000868642	135
201	3300005539	Ga0068853_100094174	Ga0068853_1000941742	135
202	3300005539	Ga0068853_100278926	Ga0068853_1002789262	135
203	3300005539	Ga0068853_100470078	Ga0068853_1004700782	135
204	3300005539	Ga0068853_101296583	Ga0068853_1012965831	135
205	3300005543	Ga0070672_100081791	Ga0070672_1000817912	135
206	3300005543	Ga0070672_100302616	Ga0070672_1003026161	135
207	3300005543	Ga0070672_100538926	Ga0070672_1005389262	135
208	3300005543	Ga0070672_100871449	Ga0070672_1008714492	135
209	3300005544	Ga0070686_100096462	Ga0070686_1000964622	135
210	3300005544	Ga0070686_100301468	Ga0070686_1003014682	135
211	3300005544	Ga0070686_100372306	Ga0070686_1003723062	135
212	3300005545	Ga0070695_100841368	Ga0070695_1008413681	135
213	3300005546	Ga0070696_101315174	Ga0070696_1013151741	135
214	3300005547	Ga0070693_100068771	Ga0070693_1000687712	135
215	3300005547	Ga0070693_100264003	Ga0070693_1002640032	135
216	3300005547	Ga0070693_100418100	Ga0070693_1004181002	135
217	3300005547	Ga0070693_101013845	Ga0070693_1010138451	135
218	3300005547	Ga0070693_101383223	Ga0070693_1013832231	135
219	3300005548	Ga0070665_100237422	Ga0070665_1002374223	135
220	3300005548	Ga0070665_100260258	Ga0070665_1002602582	135
221	3300005548	Ga0070665_100294808	Ga0070665_1002948082	135
222	3300005548	Ga0070665_100333097	Ga0070665_1003330972	135
223	3300005548	Ga0070665_100408262	Ga0070665_1004082622	135
224	3300005548	Ga0070665_100453159	Ga0070665_1004531592	135
225	3300005548	Ga0070665_100511350	Ga0070665_1005113502	135
226	3300005548	Ga0070665_100617062	Ga0070665_1006170622	135
227	3300005548	Ga0070665_100642939	Ga0070665_1006429392	135
228	3300005548	Ga0070665_100715361	Ga0070665_1007153612	135
229	3300005548	Ga0070665_101631170	Ga0070665_1016311702	135
230	3300005548	Ga0070665_101994970	Ga0070665_1019949701	135
231	3300005549	Ga0070704_100345542	Ga0070704_1003455422	135
232	3300005549	Ga0070704_100637383	Ga0070704_1006373832	135
233	3300005549	Ga0070704_101032747	Ga0070704_1010327471	135
234	3300005563	Ga0068855_100067225	Ga0068855_1000672254	135
235	3300005563	Ga0068855_100106967	Ga0068855_1001069672	135
236	3300005563	Ga0068855_100162038	Ga0068855_1001620382	135
237	3300005563	Ga0068855_100162722	Ga0068855_1001627222	135
238	3300005563	Ga0068855_100281770	Ga0068855_1002817702	135
239	3300005563	Ga0068855_100337465	Ga0068855_1003374652	135
240	3300005563	Ga0068855_100557755	Ga0068855_1005577552	135
241	3300005563	Ga0068855_100578329	Ga0068855_1005783292	135
242	3300005563	Ga0068855_100591555	Ga0068855_1005915552	135
243	3300005563	Ga0068855_100965921	Ga0068855_1009659211	135
244	3300005563	Ga0068855_101127956	Ga0068855_1011279563	135
245	3300005563	Ga0068855_101352093	Ga0068855_1013520932	135
246	3300005563	Ga0068855_101672919	Ga0068855_1016729192	135
247	3300005564	Ga0070664_100028305	Ga0070664_1000283052	135
248	3300005564	Ga0070664_100443919	Ga0070664_1004439192	135
249	3300005564	Ga0070664_100487230	Ga0070664_1004872301	135
250	3300005564	Ga0070664_100715827	Ga0070664_1007158272	135
251	3300005564	Ga0070664_101135089	Ga0070664_1011350891	135
252	3300005564	Ga0070664_101712854	Ga0070664_1017128541	135
253	3300005564	Ga0070664_101820385	Ga0070664_1018203851	135
254	3300005564	Ga0070664_101844436	Ga0070664_1018444361	135
255	3300005577	Ga0068857_100028342	Ga0068857_1000283423	135
256	3300005577	Ga0068857_100058005	Ga0068857_1000580052	135
257	3300005577	Ga0068857_100146635	Ga0068857_1001466352	135
258	3300005577	Ga0068857_100347260	Ga0068857_1003472601	135
259	3300005577	Ga0068857_100535841	Ga0068857_1005358412	135
260	3300005577	Ga0068857_100576469	Ga0068857_1005764692	135
261	3300005577	Ga0068857_100849286	Ga0068857_1008492862	135
262	3300005577	Ga0068857_101253873	Ga0068857_1012538731	135
263	3300005578	Ga0068854_100020662	Ga0068854_1000206622	135
264	3300005578	Ga0068854_100021808	Ga0068854_1000218085	135
265	3300005578	Ga0068854_100093481	Ga0068854_1000934812	135
266	3300005578	Ga0068854_100943613	Ga0068854_1009436132	135
267	3300005614	Ga0068856_100003724	Ga0068856_10000372416	135
268	3300005614	Ga0068856_100031694	Ga0068856_1000316942	135
269	3300005614	Ga0068856_100144962	Ga0068856_1001449623	135
270	3300005614	Ga0068856_100177211	Ga0068856_1001772112	135
271	3300005614	Ga0068856_100258750	Ga0068856_1002587502	135
272	3300005614	Ga0068856_100276729	Ga0068856_1002767292	135
273	3300005614	Ga0068856_100319224	Ga0068856_1003192242	135
274	3300005614	Ga0068856_100607431	Ga0068856_1006074312	135
275	3300005615	Ga0070702_100174657	Ga0070702_1001746572	135
276	3300005615	Ga0070702_100177570	Ga0070702_1001775702	135
277	3300005615	Ga0070702_100903811	Ga0070702_1009038111	135
278	3300005616	Ga0068852_100014912	Ga0068852_1000149127	135
279	3300005616	Ga0068852_100066422	Ga0068852_1000664222	135
280	3300005616	Ga0068852_100084406	Ga0068852_1000844063	135
281	3300005616	Ga0068852_100178300	Ga0068852_1001783002	135
282	3300005616	Ga0068852_100183419	Ga0068852_1001834193	135
283	3300005616	Ga0068852_100512890	Ga0068852_1005128902	135
284	3300005616	Ga0068852_101679229	Ga0068852_1016792292	135
285	3300005617	Ga0068859_100116438	Ga0068859_1001164382	135
286	3300005617	Ga0068859_100444967	Ga0068859_1004449672	135
287	3300005617	Ga0068859_100616861	Ga0068859_1006168612	135
288	3300005617	Ga0068859_100677584	Ga0068859_1006775842	135
289	3300005618	Ga0068864_100151982	Ga0068864_1001519822	135
290	3300005618	Ga0068864_100259009	Ga0068864_1002590092	135
291	3300005618	Ga0068864_100599660	Ga0068864_1005996602	135
292	3300005618	Ga0068864_102020853	Ga0068864_1020208531	135
293	3300005618	Ga0068864_102194583	Ga0068864_1021945831	135
294	3300005718	Ga0068866_10104867	Ga0068866_101048672	135
295	3300005718	Ga0068866_10140287	Ga0068866_101402871	135
296	3300005719	Ga0068861_100080176	Ga0068861_1000801762	135
297	3300005719	Ga0068861_100275562	Ga0068861_1002755623	135
298	3300005719	Ga0068861_100372034	Ga0068861_1003720342	135
299	3300005719	Ga0068861_100483833	Ga0068861_1004838332	135
300	3300005719	Ga0068861_100903515	Ga0068861_1009035152	135
301	3300005834	Ga0068851_10001194	Ga0068851_100011944	135
302	3300005834	Ga0068851_10065253	Ga0068851_100652532	135
303	3300005834	Ga0068851_10402454	Ga0068851_104024542	135
304	3300005834	Ga0068851_10411084	Ga0068851_104110841	135
305	3300005840	Ga0068870_10249854	Ga0068870_102498542	135
306	3300005841	Ga0068863_100234018	Ga0068863_1002340182	135
307	3300005841	Ga0068863_100334017	Ga0068863_1003340172	135
308	3300005841	Ga0068863_100343463	Ga0068863_1003434632	135
309	3300005841	Ga0068863_101737360	Ga0068863_1017373601	135
310	3300005842	Ga0068858_100156051	Ga0068858_1001560512	135
311	3300005842	Ga0068858_100173067	Ga0068858_1001730672	135
312	3300005842	Ga0068858_100388062	Ga0068858_1003880622	135
313	3300005842	Ga0068858_100530505	Ga0068858_1005305052	135
314	3300005842	Ga0068858_100656201	Ga0068858_1006562012	135
315	3300005842	Ga0068858_101040733	Ga0068858_1010407331	135
316	3300005843	Ga0068860_100004778	Ga0068860_10000477813	135
317	3300005843	Ga0068860_100187140	Ga0068860_1001871402	135
318	3300005843	Ga0068860_100309883	Ga0068860_1003098831	135
319	3300005843	Ga0068860_100331649	Ga0068860_1003316492	135
320	3300005843	Ga0068860_100603045	Ga0068860_1006030451	135
321	3300005843	Ga0068860_100671855	Ga0068860_1006718552	135
322	3300005843	Ga0068860_101553634	Ga0068860_1015536341	135
323	3300005844	Ga0068862_100041251	Ga0068862_1000412514	135
324	3300005844	Ga0068862_100111637	Ga0068862_1001116372	135
325	3300005844	Ga0068862_100392642	Ga0068862_1003926422	135
326	3300005844	Ga0068862_100476004	Ga0068862_1004760042	135
327	3300005937	Ga0081455_10022385	Ga0081455_100223852	135
328	3300005937	Ga0081455_10022799	Ga0081455_100227991	135
329	3300005937	Ga0081455_10025106	Ga0081455_100251062	135
330	3300005937	Ga0081455_10675880	Ga0081455_106758801	135
331	3300005983	Ga0081540_1000191	Ga0081540_10001916	135
332	3300005983	Ga0081540_1005444	Ga0081540_10054444	135
333	3300005983	Ga0081540_1009659	Ga0081540_10096597	135
334	3300005983	Ga0081540_1297740	Ga0081540_12977401	135
335	3300005985	Ga0081539_10000048	Ga0081539_10000048222	135
336	3300005985	Ga0081539_10000371	Ga0081539_100003713	135
337	3300005985	Ga0081539_10032296	Ga0081539_100322962	135
338	3300006028	Ga0070717_10003776	Ga0070717_100037763	135
339	3300006028	Ga0070717_10041094	Ga0070717_100410943	135
340	3300006028	Ga0070717_10294426	Ga0070717_102944262	135
341	3300006028	Ga0070717_10873199	Ga0070717_108731991	135
342	3300006028	Ga0070717_11221907	Ga0070717_112219072	135
343	3300006028	Ga0070717_11678701	Ga0070717_116787011	135
344	3300006038	Ga0075365_10061672	Ga0075365_100616724	135
345	3300006038	Ga0075365_10101270	Ga0075365_101012702	135
346	3300006038	Ga0075365_10122711	Ga0075365_101227112	135
347	3300006038	Ga0075365_10128226	Ga0075365_101282262	135
348	3300006038	Ga0075365_10262934	Ga0075365_102629342	135
349	3300006038	Ga0075365_10576698	Ga0075365_105766981	135
350	3300006038	Ga0075365_10631125	Ga0075365_106311252	135
351	3300006042	Ga0075368_10005957	Ga0075368_100059572	135
352	3300006042	Ga0075368_10132721	Ga0075368_101327212	135
353	3300006048	Ga0075363_100020861	Ga0075363_1000208612	135
354	3300006048	Ga0075363_100169620	Ga0075363_1001696202	135
355	3300006048	Ga0075363_100191548	Ga0075363_1001915482	135
356	3300006048	Ga0075363_100194198	Ga0075363_1001941982	135
357	3300006048	Ga0075363_100245762	Ga0075363_1002457622	135
358	3300006051	Ga0075364_10068069	Ga0075364_100680692	135
359	3300006051	Ga0075364_10199739	Ga0075364_101997392	135
360	3300006051	Ga0075364_10275043	Ga0075364_102750432	135
361	3300006051	Ga0075364_10348194	Ga0075364_103481942	135
362	3300006163	Ga0070715_10008592	Ga0070715_100085922	135
363	3300006163	Ga0070715_10457150	Ga0070715_104571501	135
364	3300006163	Ga0070715_10601127	Ga0070715_106011271	135
365	3300006173	Ga0070716_100002169	Ga0070716_1000021693	135
366	3300006173	Ga0070716_100170820	Ga0070716_1001708202	135
367	3300006173	Ga0070716_100308523	Ga0070716_1003085232	135
368	3300006173	Ga0070716_100326881	Ga0070716_1003268812	135
369	3300006173	Ga0070716_100390368	Ga0070716_1003903682	135
370	3300006173	Ga0070716_101040249	Ga0070716_1010402492	135
371	3300006175	Ga0070712_100030018	Ga0070712_1000300184	135
372	3300006175	Ga0070712_100063019	Ga0070712_1000630193	135
373	3300006175	Ga0070712_100431704	Ga0070712_1004317042	135
374	3300006175	Ga0070712_100449185	Ga0070712_1004491851	135
375	3300006175	Ga0070712_101511906	Ga0070712_1015119061	135
376	3300006177	Ga0075362_10053877	Ga0075362_100538772	135
377	3300006177	Ga0075362_10093197	Ga0075362_100931972	135
378	3300006177	Ga0075362_10254706	Ga0075362_102547062	135
379	3300006177	Ga0075362_10363609	Ga0075362_103636092	135
380	3300006177	Ga0075362_10787110	Ga0075362_107871101	135
381	3300006178	Ga0075367_10026124	Ga0075367_100261244	135
382	3300006178	Ga0075367_10201821	Ga0075367_102018212	135
383	3300006178	Ga0075367_10278359	Ga0075367_102783592	135
384	3300006178	Ga0075367_10335408	Ga0075367_103354082	135
385	3300006178	Ga0075367_10344383	Ga0075367_103443832	135
386	3300006178	Ga0075367_10533272	Ga0075367_105332722	135
387	3300006178	Ga0075367_10578346	Ga0075367_105783461	135
388	3300006186	Ga0075369_10004251	Ga0075369_100042513	135
389	3300006186	Ga0075369_10013998	Ga0075369_100139983	135
390	3300006186	Ga0075369_10098464	Ga0075369_100984642	135
391	3300006186	Ga0075369_10201927	Ga0075369_102019272	135
392	3300006186	Ga0075369_10424955	Ga0075369_104249551	135
393	3300006195	Ga0075366_10010299	Ga0075366_100102996	135
394	3300006195	Ga0075366_10021742	Ga0075366_100217424	135
395	3300006195	Ga0075366_10212605	Ga0075366_102126052	135
396	3300006195	Ga0075366_10475548	Ga0075366_104755481	135
397	3300006195	Ga0075366_10478073	Ga0075366_104780731	135
398	3300006237	Ga0097621_100106844	Ga0097621_1001068442	135
399	3300006237	Ga0097621_101764728	Ga0097621_1017647281	135
400	3300006353	Ga0075370_10027487	Ga0075370_100274874	135
401	3300006353	Ga0075370_10037699	Ga0075370_100376992	135
402	3300006353	Ga0075370_10184485	Ga0075370_101844852	135
403	3300006353	Ga0075370_10191464	Ga0075370_101914642	135
404	3300006353	Ga0075370_10210882	Ga0075370_102108823	135
405	3300006353	Ga0075370_10233482	Ga0075370_102334821	135
406	3300006353	Ga0075370_10460292	Ga0075370_104602921	135
407	3300006358	Ga0068871_100292569	Ga0068871_1002925691	135
408	3300006358	Ga0068871_100406822	Ga0068871_1004068221	135
409	3300006358	Ga0068871_100481332	Ga0068871_1004813322	135
410	3300006358	Ga0068871_100929917	Ga0068871_1009299171	135
411	3300006358	Ga0068871_101063631	Ga0068871_1010636311	135
412	3300006844	Ga0075428_100309657	Ga0075428_1003096572	135
413	3300006844	Ga0075428_101001565	Ga0075428_1010015652	135
414	3300006847	Ga0075431_100456352	Ga0075431_1004563521	135
415	3300006871	Ga0075434_100013577	Ga0075434_1000135775	135
416	3300006871	Ga0075434_100120995	Ga0075434_1001209952	135
417	3300006871	Ga0075434_100632559	Ga0075434_1006325592	135
418	3300006881	Ga0068865_100120528	Ga0068865_1001205283	135
419	3300006881	Ga0068865_100165563	Ga0068865_1001655632	135
420	3300006881	Ga0068865_100472510	Ga0068865_1004725102	135
421	3300006881	Ga0068865_100747630	Ga0068865_1007476302	135
422	3300006914	Ga0075436_100111391	Ga0075436_1001113912	135
423	3300006931	Ga0097620_100116432	Ga0097620_1001164322	135
424	3300006931	Ga0097620_100444931	Ga0097620_1004449312	135
425	3300006931	Ga0097620_100616844	Ga0097620_1006168442	135
426	3300006931	Ga0097620_100677561	Ga0097620_1006775612	135
427	3300006941	Ga0099825_1030695	Ga0099825_10306952	135
428	3300006942	Ga0099824_1009785	Ga0099824_10097855	135
429	3300006944	Ga0099823_1025693	Ga0099823_10256936	135
430	3300007265	Ga0099794_10009516	Ga0099794_100095165	135
431	3300007265	Ga0099794_10162650	Ga0099794_101626501	135
432	3300007265	Ga0099794_10214856	Ga0099794_102148561	135
433	3300007788	Ga0099795_10062176	Ga0099795_100621762	135
434	3300007788	Ga0099795_10271291	Ga0099795_102712912	135
435	3300007788	Ga0099795_10330381	Ga0099795_103303811	135
436	3300007788	Ga0099795_10337946	Ga0099795_103379462	135
437	3300009011	Ga0105251_10209887	Ga0105251_102098872	135
438	3300009011	Ga0105251_10268321	Ga0105251_102683212	135
439	3300009092	Ga0105250_10072153	Ga0105250_100721532	135
440	3300009092	Ga0105250_10177584	Ga0105250_101775842	135
441	3300009093	Ga0105240_10006144	Ga0105240_100061444	135
442	3300009093	Ga0105240_10036366	Ga0105240_100363666	135
443	3300009093	Ga0105240_10039683	Ga0105240_100396836	135
444	3300009093	Ga0105240_10096341	Ga0105240_100963413	135
445	3300009093	Ga0105240_10119564	Ga0105240_101195643	135
446	3300009093	Ga0105240_10207940	Ga0105240_102079402	135
447	3300009093	Ga0105240_10219586	Ga0105240_102195862	135
448	3300009093	Ga0105240_10295338	Ga0105240_102953382	135
449	3300009093	Ga0105240_10436120	Ga0105240_104361202	135
450	3300009093	Ga0105240_11289264	Ga0105240_112892641	135
451	3300009093	Ga0105240_11594688	Ga0105240_115946882	135
452	3300009093	Ga0105240_12171052	Ga0105240_121710521	135
453	3300009093	Ga0105240_12527376	Ga0105240_125273761	135
454	3300009094	Ga0111539_10059723	Ga0111539_100597232	135
455	3300009094	Ga0111539_10838477	Ga0111539_108384771	135
456	3300009094	Ga0111539_11261345	Ga0111539_112613452	135
457	3300009098	Ga0105245_10033417	Ga0105245_100334172	135
458	3300009098	Ga0105245_10342710	Ga0105245_103427102	135
459	3300009098	Ga0105245_10465342	Ga0105245_104653422	135
460	3300009098	Ga0105245_10579864	Ga0105245_105798642	135
461	3300009098	Ga0105245_10884425	Ga0105245_108844251	135
462	3300009098	Ga0105245_12335703	Ga0105245_123357032	135
463	3300009098	Ga0105245_12643131	Ga0105245_126431311	135
464	3300009101	Ga0105247_10081778	Ga0105247_100817782	135
465	3300009101	Ga0105247_10103396	Ga0105247_101033961	135
466	3300009101	Ga0105247_10148137	Ga0105247_101481372	135
467	3300009101	Ga0105247_10238850	Ga0105247_102388502	135
468	3300009101	Ga0105247_10307147	Ga0105247_103071471	135
469	3300009101	Ga0105247_10372976	Ga0105247_103729762	135
470	3300009101	Ga0105247_10594718	Ga0105247_105947181	135
471	3300009147	Ga0114129_10117505	Ga0114129_101175052	135
472	3300009147	Ga0114129_12926783	Ga0114129_129267831	135
473	3300009148	Ga0105243_10117285	Ga0105243_101172852	135
474	3300009148	Ga0105243_10237088	Ga0105243_102370882	135
475	3300009148	Ga0105243_10475404	Ga0105243_104754042	135
476	3300009148	Ga0105243_10638139	Ga0105243_106381392	135
477	3300009148	Ga0105243_10766412	Ga0105243_107664122	135
478	3300009148	Ga0105243_10807389	Ga0105243_108073891	135
479	3300009148	Ga0105243_11298336	Ga0105243_112983361	135
480	3300009148	Ga0105243_11942193	Ga0105243_119421931	135
481	3300009174	Ga0105241_10005046	Ga0105241_100050466	135
482	3300009174	Ga0105241_10012991	Ga0105241_100129912	135
483	3300009174	Ga0105241_10228155	Ga0105241_102281552	135
484	3300009174	Ga0105241_10303976	Ga0105241_103039762	135
485	3300009174	Ga0105241_10392229	Ga0105241_103922292	135
486	3300009174	Ga0105241_10498377	Ga0105241_104983772	135
487	3300009174	Ga0105241_10848833	Ga0105241_108488331	135
488	3300009174	Ga0105241_11337549	Ga0105241_113375491	135
489	3300009176	Ga0105242_10125235	Ga0105242_101252354	135
490	3300009176	Ga0105242_10529746	Ga0105242_105297462	135
491	3300009176	Ga0105242_10811960	Ga0105242_108119602	135
492	3300009176	Ga0105242_10977584	Ga0105242_109775842	135
493	3300009176	Ga0105242_11949168	Ga0105242_119491682	135
494	3300009177	Ga0105248_10100624	Ga0105248_101006243	135
495	3300009177	Ga0105248_10136394	Ga0105248_101363943	135
496	3300009177	Ga0105248_10170027	Ga0105248_101700274	135
497	3300009177	Ga0105248_10172325	Ga0105248_101723252	135
498	3300009177	Ga0105248_10531690	Ga0105248_105316902	135
499	3300009177	Ga0105248_10538798	Ga0105248_105387981	135
500	3300009177	Ga0105248_10598528	Ga0105248_105985281	135
501	3300009177	Ga0105248_10617389	Ga0105248_106173891	135
502	3300009177	Ga0105248_10702774	Ga0105248_107027742	135
503	3300009545	Ga0105237_10019216	Ga0105237_100192168	135
504	3300009545	Ga0105237_10035450	Ga0105237_100354502	135
505	3300009545	Ga0105237_10045790	Ga0105237_100457905	135
506	3300009545	Ga0105237_10050229	Ga0105237_100502294	135
507	3300009545	Ga0105237_10109815	Ga0105237_101098152	135
508	3300009545	Ga0105237_10156853	Ga0105237_101568531	135
509	3300009545	Ga0105237_10174649	Ga0105237_101746492	135
510	3300009545	Ga0105237_10290921	Ga0105237_102909212	135
511	3300009545	Ga0105237_10319836	Ga0105237_103198362	135
512	3300009545	Ga0105237_10445331	Ga0105237_104453312	135
513	3300009545	Ga0105237_10762577	Ga0105237_107625772	135
514	3300009545	Ga0105237_10952843	Ga0105237_109528431	135
515	3300009545	Ga0105237_10957034	Ga0105237_109570342	135
516	3300009545	Ga0105237_11202466	Ga0105237_112024662	135
517	3300009545	Ga0105237_12092957	Ga0105237_120929571	135
518	3300009551	Ga0105238_10012578	Ga0105238_100125783	135
519	3300009551	Ga0105238_10015975	Ga0105238_100159752	135
520	3300009551	Ga0105238_10020486	Ga0105238_100204865	135
521	3300009551	Ga0105238_10044774	Ga0105238_100447744	135
522	3300009551	Ga0105238_10106923	Ga0105238_101069232	135
523	3300009551	Ga0105238_10335677	Ga0105238_103356772	135
524	3300009551	Ga0105238_10358912	Ga0105238_103589122	135
525	3300009551	Ga0105238_10442492	Ga0105238_104424922	135
526	3300009551	Ga0105238_10497580	Ga0105238_104975802	135
527	3300009551	Ga0105238_10595242	Ga0105238_105952422	135
528	3300009551	Ga0105238_10713307	Ga0105238_107133072	135
529	3300009551	Ga0105238_11141106	Ga0105238_111411061	135
530	3300009551	Ga0105238_11142011	Ga0105238_111420112	135
531	3300009553	Ga0105249_10202545	Ga0105249_102025453	135
532	3300009553	Ga0105249_10344930	Ga0105249_103449302	135
533	3300009553	Ga0105249_10405176	Ga0105249_104051761	135
534	3300009553	Ga0105249_10449246	Ga0105249_104492462	135
535	3300009553	Ga0105249_10764069	Ga0105249_107640692	135
536	3300009553	Ga0105249_10927548	Ga0105249_109275481	135
537	3300009553	Ga0105249_11073166	Ga0105249_110731662	135
538	3300010159	Ga0099796_10088397	Ga0099796_100883972	135
539	3300010159	Ga0099796_10279536	Ga0099796_102795361	135
540	3300010159	Ga0099796_10288862	Ga0099796_102888622	135
541	3300010375	Ga0105239_10010073	Ga0105239_100100736	135
542	3300010375	Ga0105239_10018253	Ga0105239_100182532	135
543	3300010375	Ga0105239_10036146	Ga0105239_100361462	135
544	3300010375	Ga0105239_10052959	Ga0105239_100529594	135
545	3300010375	Ga0105239_10066298	Ga0105239_100662982	135
546	3300010375	Ga0105239_10069280	Ga0105239_100692805	135
547	3300010375	Ga0105239_10128415	Ga0105239_101284155	135
548	3300010375	Ga0105239_10187792	Ga0105239_101877922	135
549	3300010375	Ga0105239_10249451	Ga0105239_102494512	135
550	3300010375	Ga0105239_10442358	Ga0105239_104423582	135
551	3300010375	Ga0105239_10643929	Ga0105239_106439292	135
552	3300010375	Ga0105239_10693522	Ga0105239_106935222	135
553	3300010375	Ga0105239_10858869	Ga0105239_108588692	135
554	3300010375	Ga0105239_11746778	Ga0105239_117467781	135
555	3300011119	Ga0105246_10041256	Ga0105246_100412562	135
556	3300011119	Ga0105246_10113971	Ga0105246_101139712	135
557	3300011119	Ga0105246_10424855	Ga0105246_104248552	135
558	3300011119	Ga0105246_11038293	Ga0105246_110382932	135
559	3300011119	Ga0105246_11191745	Ga0105246_111917452	135
560	3300011119	Ga0105246_11198084	Ga0105246_111980841	135
561	3300011119	Ga0105246_11359153	Ga0105246_113591532	135
562	3300011119	Ga0105246_11647065	Ga0105246_116470651	135
563	3300011119	Ga0105246_12326413	Ga0105246_123264131	135
564	3300013100	Ga0157373_10155596	Ga0157373_101555962	135
565	3300013100	Ga0157373_11418321	Ga0157373_114183211	135
566	3300013102	Ga0157371_10028952	Ga0157371_100289522	135
567	3300013102	Ga0157371_10499253	Ga0157371_104992531	135
568	3300013104	Ga0157370_10368792	Ga0157370_103687922	135
569	3300013104	Ga0157370_10391364	Ga0157370_103913641	135
570	3300013104	Ga0157370_10710501	Ga0157370_107105012	135
571	3300013104	Ga0157370_10718894	Ga0157370_107188941	135
572	3300013104	Ga0157370_10825420	Ga0157370_108254201	135
573	3300013105	Ga0157369_10010630	Ga0157369_100106308	135
574	3300013105	Ga0157369_10044218	Ga0157369_100442182	135
575	3300013105	Ga0157369_10054787	Ga0157369_100547875	135
576	3300013105	Ga0157369_10333716	Ga0157369_103337162	135
577	3300013105	Ga0157369_10683750	Ga0157369_106837502	135
578	3300013105	Ga0157369_10830730	Ga0157369_108307302	135
579	3300013105	Ga0157369_11076882	Ga0157369_110768822	135
580	3300013105	Ga0157369_11776454	Ga0157369_117764541	135
581	3300013296	Ga0157374_10041810	Ga0157374_100418103	135
582	3300013296	Ga0157374_10249374	Ga0157374_102493741	135
583	3300013296	Ga0157374_10260784	Ga0157374_102607842	135
584	3300013296	Ga0157374_10455858	Ga0157374_104558582	135
585	3300013296	Ga0157374_11198427	Ga0157374_111984271	135
586	3300013296	Ga0157374_11716801	Ga0157374_117168011	135
587	3300013297	Ga0157378_10019963	Ga0157378_100199637	135
588	3300013297	Ga0157378_10286678	Ga0157378_102866782	135
589	3300013297	Ga0157378_10672311	Ga0157378_106723112	135
590	3300013297	Ga0157378_11140247	Ga0157378_111402471	135
591	3300013297	Ga0157378_12125720	Ga0157378_121257202	135
592	3300013297	Ga0157378_12131405	Ga0157378_121314051	135
593	3300013306	Ga0163162_10123771	Ga0163162_101237714	135
594	3300013306	Ga0163162_10427077	Ga0163162_104270772	135
595	3300013306	Ga0163162_10799541	Ga0163162_107995411	135
596	3300013306	Ga0163162_10895978	Ga0163162_108959781	135
597	3300013306	Ga0163162_10904467	Ga0163162_109044672	135
598	3300013306	Ga0163162_10987188	Ga0163162_109871882	135
599	3300013306	Ga0163162_11039447	Ga0163162_110394472	135
600	3300013306	Ga0163162_11399487	Ga0163162_113994872	135
601	3300013306	Ga0163162_11538616	Ga0163162_115386162	135
602	3300013306	Ga0163162_11665156	Ga0163162_116651562	135
603	3300013307	Ga0157372_10151028	Ga0157372_101510282	135
604	3300013307	Ga0157372_10560753	Ga0157372_105607532	135
605	3300013307	Ga0157372_11049922	Ga0157372_110499221	135
606	3300013307	Ga0157372_12438891	Ga0157372_124388912	135
607	3300013308	Ga0157375_10078997	Ga0157375_100789973	135
608	3300013308	Ga0157375_10648218	Ga0157375_106482182	135
609	3300013308	Ga0157375_10827279	Ga0157375_108272792	135
610	3300013308	Ga0157375_13519136	Ga0157375_135191361	135
611	3300014325	Ga0163163_10066441	Ga0163163_100664412	135
612	3300014325	Ga0163163_10142848	Ga0163163_101428482	135
613	3300014325	Ga0163163_10261960	Ga0163163_102619602	135
614	3300014325	Ga0163163_10341313	Ga0163163_103413131	135
615	3300014325	Ga0163163_10342235	Ga0163163_103422352	135
616	3300014325	Ga0163163_10433414	Ga0163163_104334141	135
617	3300014325	Ga0163163_10545480	Ga0163163_105454802	135
618	3300014325	Ga0163163_10761685	Ga0163163_107616852	135
619	3300014325	Ga0163163_11170213	Ga0163163_111702131	135
620	3300014326	Ga0157380_10125033	Ga0157380_101250334	135
621	3300014326	Ga0157380_10190365	Ga0157380_101903651	135
622	3300014326	Ga0157380_13044767	Ga0157380_130447671	135
623	3300014745	Ga0157377_10149389	Ga0157377_101493892	135
624	3300014745	Ga0157377_10390598	Ga0157377_103905981	135
625	3300014745	Ga0157377_10445350	Ga0157377_104453502	135
626	3300014968	Ga0157379_10402111	Ga0157379_104021112	135
627	3300014968	Ga0157379_10983162	Ga0157379_109831622	135
628	3300014968	Ga0157379_11037771	Ga0157379_110377712	135
629	3300014968	Ga0157379_11548039	Ga0157379_115480391	135
630	3300014968	Ga0157379_11754881	Ga0157379_117548811	135
631	3300014969	Ga0157376_10065394	Ga0157376_100653942	135
632	3300014969	Ga0157376_10138803	Ga0157376_101388032	135
633	3300014969	Ga0157376_10253811	Ga0157376_102538112	135
634	3300014969	Ga0157376_10579414	Ga0157376_105794142	135
635	3300014969	Ga0157376_10616255	Ga0157376_106162551	135
636	3300014969	Ga0157376_10784142	Ga0157376_107841422	135
637	3300014969	Ga0157376_10826571	Ga0157376_108265712	135
638	3300014969	Ga0157376_10964310	Ga0157376_109643101	135
639	3300014969	Ga0157376_11582180	Ga0157376_115821801	135
640	3300015261	Ga0182006_1132238	Ga0182006_11322382	135
641	3300017792	Ga0163161_10170943	Ga0163161_101709432	135
642	3300017792	Ga0163161_11018895	Ga0163161_110188952	135
643	3300017792	Ga0163161_11085158	Ga0163161_110851581	135
644	3300017792	Ga0163161_11589195	Ga0163161_115891951	135
645	3300021320	Ga0214544_1000665	Ga0214544_100066525	135
646	3300021321	Ga0214542_1000486	Ga0214542_100048625	135
647	3300021321	Ga0214542_1033705	Ga0214542_10337053	135
648	3300021324	Ga0214545_1000307	Ga0214545_100030725	135
649	3300021324	Ga0214545_1034829	Ga0214545_10348292	135
650	3300021327	Ga0214543_1003627	Ga0214543_10036279	135
651	3300021361	Ga0213872_10383711	Ga0213872_103837111	135
652	3300021377	Ga0213874_10093830	Ga0213874_100938302	135
653	3300021384	Ga0213876_10220879	Ga0213876_102208792	135
654	3300021384	Ga0213876_10319346	Ga0213876_103193462	135
655	3300021388	Ga0213875_10185909	Ga0213875_101859092	135
656	3300021388	Ga0213875_10224281	Ga0213875_102242811	135
657	3300021388	Ga0213875_10396757	Ga0213875_103967571	135
658	3300024225	Ga0224572_1099984	Ga0224572_10999841	135
659	3300025230	Ga0209563_105662	Ga0209563_1056622	135
660	3300025230	Ga0209563_113060	Ga0209563_1130602	135
661	3300025245	Ga0207425_1024421	Ga0207425_10244212	135
662	3300025253	Ga0209677_101407	Ga0209677_1014072	135
663	3300025253	Ga0209677_102409	Ga0209677_1024094	135
664	3300025254	Ga0209148_1002869	Ga0209148_10028692	135
665	3300025261	Ga0209233_1006290	Ga0209233_10062901	135
666	3300025261	Ga0209233_1050197	Ga0209233_10501971	135
667	3300025272	Ga0209455_1016503	Ga0209455_10165033	135
668	3300025272	Ga0209455_1016828	Ga0209455_10168282	135
669	3300025272	Ga0209455_1030674	Ga0209455_10306741	135
670	3300025272	Ga0209455_1054013	Ga0209455_10540131	135
671	3300025295	Ga0209564_1006329	Ga0209564_10063295	135
672	3300025295	Ga0209564_1010374	Ga0209564_10103744	135
673	3300025297	Ga0209758_1000069	Ga0209758_1000069259	135
674	3300025297	Ga0209758_1004973	Ga0209758_10049737	135
675	3300025297	Ga0209758_1006237	Ga0209758_10062378	135
676	3300025297	Ga0209758_1007493	Ga0209758_10074933	135
677	3300025297	Ga0209758_1022223	Ga0209758_10222234	135
678	3300025297	Ga0209758_1078408	Ga0209758_10784082	135
679	3300025297	Ga0209758_1116264	Ga0209758_11162642	135
680	3300025299	Ga0209256_1013889	Ga0209256_10138892	135
681	3300025299	Ga0209256_1019703	Ga0209256_10197032	135
682	3300025299	Ga0209256_1042553	Ga0209256_10425532	135
683	3300025302	Ga0207426_1004682	Ga0207426_10046826	135
684	3300025302	Ga0207426_1009855	Ga0207426_10098554	135
685	3300025302	Ga0207426_1040853	Ga0207426_10408532	135
686	3300025302	Ga0207426_1051534	Ga0207426_10515342	135
687	3300025303	Ga0209051_1088252	Ga0209051_10882522	135
688	3300025304	Ga0209257_1004258	Ga0209257_10042588	135
689	3300025315	Ga0207697_10055509	Ga0207697_100555092	135
690	3300025315	Ga0207697_10092804	Ga0207697_100928042	135
691	3300025321	Ga0207656_10003104	Ga0207656_100031044	135
692	3300025321	Ga0207656_10049672	Ga0207656_100496722	135
693	3300025885	Ga0207653_10024181	Ga0207653_100241812	135
694	3300025893	Ga0207682_10022717	Ga0207682_100227172	135
695	3300025893	Ga0207682_10557460	Ga0207682_105574601	135
696	3300025898	Ga0207692_10001569	Ga0207692_100015694	135
697	3300025898	Ga0207692_10209620	Ga0207692_102096202	135
698	3300025898	Ga0207692_10234012	Ga0207692_102340122	135
699	3300025899	Ga0207642_10193790	Ga0207642_101937902	135
700	3300025899	Ga0207642_10335005	Ga0207642_103350051	135
701	3300025900	Ga0207710_10043959	Ga0207710_100439592	135
702	3300025900	Ga0207710_10092236	Ga0207710_100922362	135
703	3300025900	Ga0207710_10179671	Ga0207710_101796712	135
704	3300025900	Ga0207710_10190154	Ga0207710_101901542	135
705	3300025901	Ga0207688_10100071	Ga0207688_101000712	135
706	3300025901	Ga0207688_10123230	Ga0207688_101232302	135
707	3300025901	Ga0207688_10123995	Ga0207688_101239952	135
708	3300025901	Ga0207688_10540176	Ga0207688_105401762	135
709	3300025901	Ga0207688_10610020	Ga0207688_106100201	135
710	3300025901	Ga0207688_10717795	Ga0207688_107177952	135
711	3300025903	Ga0207680_10226822	Ga0207680_102268222	135
712	3300025903	Ga0207680_10271105	Ga0207680_102711051	135
713	3300025904	Ga0207647_10008467	Ga0207647_100084672	135
714	3300025904	Ga0207647_10022012	Ga0207647_100220121	135
715	3300025904	Ga0207647_10193519	Ga0207647_101935192	135
716	3300025904	Ga0207647_10252050	Ga0207647_102520502	135
717	3300025904	Ga0207647_10282075	Ga0207647_102820752	135
718	3300025905	Ga0207685_10392924	Ga0207685_103929241	135
719	3300025905	Ga0207685_10399324	Ga0207685_103993242	135
720	3300025906	Ga0207699_10000184	Ga0207699_1000018435	135
721	3300025906	Ga0207699_10028955	Ga0207699_100289553	135
722	3300025906	Ga0207699_10240927	Ga0207699_102409272	135
723	3300025906	Ga0207699_10425809	Ga0207699_104258092	135
724	3300025907	Ga0207645_10017314	Ga0207645_100173144	135
725	3300025907	Ga0207645_10335201	Ga0207645_103352012	135
726	3300025908	Ga0207643_10109464	Ga0207643_101094642	135
727	3300025908	Ga0207643_10175148	Ga0207643_101751482	135
728	3300025909	Ga0207705_10617310	Ga0207705_106173102	135
729	3300025909	Ga0207705_10655776	Ga0207705_106557762	135
730	3300025910	Ga0207684_10241982	Ga0207684_102419822	135
731	3300025910	Ga0207684_10379533	Ga0207684_103795332	135
732	3300025911	Ga0207654_10000210	Ga0207654_1000021023	135
733	3300025911	Ga0207654_10012855	Ga0207654_100128554	135
734	3300025911	Ga0207654_10205126	Ga0207654_102051262	135
735	3300025911	Ga0207654_10232945	Ga0207654_102329452	135
736	3300025911	Ga0207654_10297353	Ga0207654_102973532	135
737	3300025912	Ga0207707_10001217	Ga0207707_1000121712	135
738	3300025912	Ga0207707_10001310	Ga0207707_1000131014	135
739	3300025912	Ga0207707_10004329	Ga0207707_100043295	135
740	3300025912	Ga0207707_10025404	Ga0207707_100254046	135
741	3300025912	Ga0207707_10497265	Ga0207707_104972652	135
742	3300025912	Ga0207707_10804918	Ga0207707_108049182	135
743	3300025913	Ga0207695_10000148	Ga0207695_1000014870	135
744	3300025913	Ga0207695_10001435	Ga0207695_1000143517	135
745	3300025913	Ga0207695_10010844	Ga0207695_1001084410	135
746	3300025913	Ga0207695_10125406	Ga0207695_101254062	135
747	3300025913	Ga0207695_10128886	Ga0207695_101288862	135
748	3300025913	Ga0207695_10154050	Ga0207695_101540502	135
749	3300025913	Ga0207695_10346381	Ga0207695_103463812	135
750	3300025913	Ga0207695_10488423	Ga0207695_104884231	135
751	3300025913	Ga0207695_11079262	Ga0207695_110792622	135
752	3300025914	Ga0207671_10019101	Ga0207671_100191014	135
753	3300025914	Ga0207671_10041473	Ga0207671_100414734	135
754	3300025914	Ga0207671_10094407	Ga0207671_100944072	135
755	3300025914	Ga0207671_10100917	Ga0207671_101009172	135
756	3300025914	Ga0207671_10109371	Ga0207671_101093711	135
757	3300025914	Ga0207671_10146451	Ga0207671_101464512	135
758	3300025914	Ga0207671_10155314	Ga0207671_101553142	135
759	3300025914	Ga0207671_10279107	Ga0207671_102791072	135
760	3300025914	Ga0207671_10314458	Ga0207671_103144582	135
761	3300025914	Ga0207671_10369998	Ga0207671_103699982	135
762	3300025914	Ga0207671_10404952	Ga0207671_104049522	135
763	3300025914	Ga0207671_10470066	Ga0207671_104700662	135
764	3300025914	Ga0207671_10524677	Ga0207671_105246771	135
765	3300025914	Ga0207671_10568096	Ga0207671_105680962	135
766	3300025914	Ga0207671_11313488	Ga0207671_113134881	135
767	3300025915	Ga0207693_10072567	Ga0207693_100725672	135
768	3300025915	Ga0207693_10142591	Ga0207693_101425912	135
769	3300025915	Ga0207693_10157500	Ga0207693_101575002	135
770	3300025915	Ga0207693_10232007	Ga0207693_102320072	135
771	3300025915	Ga0207693_10272528	Ga0207693_102725282	135
772	3300025915	Ga0207693_10442653	Ga0207693_104426531	135
773	3300025916	Ga0207663_10003478	Ga0207663_100034782	135
774	3300025916	Ga0207663_10769376	Ga0207663_107693762	135
775	3300025916	Ga0207663_10944745	Ga0207663_109447451	135
776	3300025916	Ga0207663_11215968	Ga0207663_112159681	135
777	3300025917	Ga0207660_10001470	Ga0207660_1000147010	135
778	3300025917	Ga0207660_10023266	Ga0207660_100232662	135
779	3300025917	Ga0207660_10117946	Ga0207660_101179462	135
780	3300025917	Ga0207660_10170712	Ga0207660_101707121	135
781	3300025917	Ga0207660_10184862	Ga0207660_101848622	135
782	3300025917	Ga0207660_10366098	Ga0207660_103660981	135
783	3300025917	Ga0207660_10460683	Ga0207660_104606832	135
784	3300025919	Ga0207657_10038374	Ga0207657_100383745	135
785	3300025919	Ga0207657_10077106	Ga0207657_100771062	135
786	3300025919	Ga0207657_10194382	Ga0207657_101943822	135
787	3300025919	Ga0207657_10197792	Ga0207657_101977922	135
788	3300025919	Ga0207657_10279479	Ga0207657_102794792	135
789	3300025919	Ga0207657_10451733	Ga0207657_104517331	135
790	3300025919	Ga0207657_10471671	Ga0207657_104716712	135
791	3300025920	Ga0207649_10085619	Ga0207649_100856192	135
792	3300025920	Ga0207649_10091603	Ga0207649_100916032	135
793	3300025920	Ga0207649_10928532	Ga0207649_109285321	135
794	3300025921	Ga0207652_10007361	Ga0207652_100073614	135
795	3300025921	Ga0207652_10008150	Ga0207652_100081504	135
796	3300025921	Ga0207652_10235163	Ga0207652_102351632	135
797	3300025922	Ga0207646_10137427	Ga0207646_101374272	135
798	3300025923	Ga0207681_10278865	Ga0207681_102788652	135
799	3300025923	Ga0207681_10688523	Ga0207681_106885232	135
800	3300025924	Ga0207694_10000106	Ga0207694_1000010676	135
801	3300025924	Ga0207694_10014114	Ga0207694_100141144	135
802	3300025924	Ga0207694_10132052	Ga0207694_101320522	135
803	3300025924	Ga0207694_10137641	Ga0207694_101376412	135
804	3300025924	Ga0207694_10258445	Ga0207694_102584451	135
805	3300025924	Ga0207694_10305966	Ga0207694_103059662	135
806	3300025924	Ga0207694_10599110	Ga0207694_105991102	135
807	3300025925	Ga0207650_10217170	Ga0207650_102171702	135
808	3300025925	Ga0207650_10699003	Ga0207650_106990031	135
809	3300025926	Ga0207659_10280576	Ga0207659_102805762	135
810	3300025927	Ga0207687_10167498	Ga0207687_101674982	135
811	3300025927	Ga0207687_10171455	Ga0207687_101714552	135
812	3300025927	Ga0207687_10272674	Ga0207687_102726742	135
813	3300025927	Ga0207687_10273290	Ga0207687_102732902	135
814	3300025927	Ga0207687_10711265	Ga0207687_107112652	135
815	3300025927	Ga0207687_11362084	Ga0207687_113620841	135
816	3300025928	Ga0207700_10011338	Ga0207700_100113384	135
817	3300025928	Ga0207700_10025049	Ga0207700_100250492	135
818	3300025928	Ga0207700_10155038	Ga0207700_101550382	135
819	3300025928	Ga0207700_10204584	Ga0207700_102045842	135
820	3300025928	Ga0207700_10587844	Ga0207700_105878442	135
821	3300025928	Ga0207700_10589279	Ga0207700_105892792	135
822	3300025928	Ga0207700_11062113	Ga0207700_110621132	135
823	3300025928	Ga0207700_11062730	Ga0207700_110627301	135
824	3300025929	Ga0207664_10020055	Ga0207664_100200552	135
825	3300025929	Ga0207664_10043902	Ga0207664_100439022	135
826	3300025929	Ga0207664_10169916	Ga0207664_101699162	135
827	3300025929	Ga0207664_10295265	Ga0207664_102952651	135
828	3300025929	Ga0207664_10907579	Ga0207664_109075792	135
829	3300025929	Ga0207664_11266283	Ga0207664_112662832	135
830	3300025929	Ga0207664_11386874	Ga0207664_113868742	135
831	3300025931	Ga0207644_10070282	Ga0207644_100702822	135
832	3300025931	Ga0207644_10246060	Ga0207644_102460602	135
833	3300025931	Ga0207644_11029778	Ga0207644_110297781	135
834	3300025932	Ga0207690_10023344	Ga0207690_100233442	135
835	3300025932	Ga0207690_10108580	Ga0207690_101085802	135
836	3300025932	Ga0207690_10152001	Ga0207690_101520012	135
837	3300025932	Ga0207690_10713065	Ga0207690_107130651	135
838	3300025932	Ga0207690_10809550	Ga0207690_108095502	135
839	3300025932	Ga0207690_11660783	Ga0207690_116607831	135
840	3300025933	Ga0207706_10039352	Ga0207706_100393522	135
841	3300025933	Ga0207706_10066273	Ga0207706_100662732	135
842	3300025933	Ga0207706_10209358	Ga0207706_102093582	135
843	3300025933	Ga0207706_10376951	Ga0207706_103769512	135
844	3300025934	Ga0207686_10097640	Ga0207686_100976402	135
845	3300025934	Ga0207686_10216247	Ga0207686_102162471	135
846	3300025935	Ga0207709_10077279	Ga0207709_100772792	135
847	3300025935	Ga0207709_10336471	Ga0207709_103364712	135
848	3300025935	Ga0207709_10934657	Ga0207709_109346572	135
849	3300025936	Ga0207670_10615636	Ga0207670_106156361	135
850	3300025937	Ga0207669_10063465	Ga0207669_100634652	135
851	3300025937	Ga0207669_10240959	Ga0207669_102409593	135
852	3300025937	Ga0207669_11253198	Ga0207669_112531981	135
853	3300025937	Ga0207669_11414966	Ga0207669_114149661	135
854	3300025937	Ga0207669_11535071	Ga0207669_115350711	135
855	3300025938	Ga0207704_10334428	Ga0207704_103344282	135
856	3300025938	Ga0207704_10484619	Ga0207704_104846192	135
857	3300025939	Ga0207665_10021482	Ga0207665_100214822	135
858	3300025939	Ga0207665_10028607	Ga0207665_100286072	135
859	3300025939	Ga0207665_10092690	Ga0207665_100926903	135
860	3300025939	Ga0207665_10098942	Ga0207665_100989422	135
861	3300025939	Ga0207665_10286110	Ga0207665_102861102	135
862	3300025939	Ga0207665_10538098	Ga0207665_105380982	135
863	3300025940	Ga0207691_10297282	Ga0207691_102972822	135
864	3300025940	Ga0207691_10880544	Ga0207691_108805441	135
865	3300025941	Ga0207711_10027126	Ga0207711_100271263	135
866	3300025941	Ga0207711_10282457	Ga0207711_102824572	135
867	3300025941	Ga0207711_10373114	Ga0207711_103731142	135
868	3300025941	Ga0207711_10547297	Ga0207711_105472972	135
869	3300025941	Ga0207711_10756752	Ga0207711_107567521	135
870	3300025941	Ga0207711_10854942	Ga0207711_108549422	135
871	3300025941	Ga0207711_10889558	Ga0207711_108895582	135
872	3300025941	Ga0207711_10908664	Ga0207711_109086641	135
873	3300025941	Ga0207711_11264817	Ga0207711_112648171	135
874	3300025941	Ga0207711_11328878	Ga0207711_113288781	135
875	3300025942	Ga0207689_10271414	Ga0207689_102714142	135
876	3300025942	Ga0207689_10564362	Ga0207689_105643622	135
877	3300025942	Ga0207689_10598029	Ga0207689_105980292	135
878	3300025942	Ga0207689_10601683	Ga0207689_106016832	135
879	3300025944	Ga0207661_10001291	Ga0207661_1000129113	135
880	3300025944	Ga0207661_10056903	Ga0207661_100569032	135
881	3300025944	Ga0207661_10133258	Ga0207661_101332584	135
882	3300025944	Ga0207661_10158270	Ga0207661_101582702	135
883	3300025944	Ga0207661_10422282	Ga0207661_104222822	135
884	3300025944	Ga0207661_11680513	Ga0207661_116805131	135
885	3300025945	Ga0207679_10113908	Ga0207679_101139082	135
886	3300025945	Ga0207679_10284568	Ga0207679_102845682	135
887	3300025945	Ga0207679_10384742	Ga0207679_103847422	135
888	3300025945	Ga0207679_10679086	Ga0207679_106790862	135
889	3300025945	Ga0207679_10898331	Ga0207679_108983311	135
890	3300025945	Ga0207679_11087816	Ga0207679_110878162	135
891	3300025945	Ga0207679_11263187	Ga0207679_112631872	135
892	3300025949	Ga0207667_10001909	Ga0207667_1000190924	135
893	3300025949	Ga0207667_10010685	Ga0207667_100106859	135
894	3300025949	Ga0207667_10031593	Ga0207667_100315936	135
895	3300025949	Ga0207667_10254661	Ga0207667_102546612	135
896	3300025949	Ga0207667_10283600	Ga0207667_102836002	135
897	3300025949	Ga0207667_10300616	Ga0207667_103006162	135
898	3300025949	Ga0207667_10316780	Ga0207667_103167802	135
899	3300025949	Ga0207667_10322517	Ga0207667_103225172	135
900	3300025949	Ga0207667_10500169	Ga0207667_105001692	135
901	3300025949	Ga0207667_10522993	Ga0207667_105229932	135
902	3300025949	Ga0207667_10689733	Ga0207667_106897332	135
903	3300025949	Ga0207667_10818908	Ga0207667_108189082	135
904	3300025949	Ga0207667_10870337	Ga0207667_108703372	135
905	3300025949	Ga0207667_10949434	Ga0207667_109494341	135
906	3300025949	Ga0207667_11361309	Ga0207667_113613092	135
907	3300025960	Ga0207651_10185417	Ga0207651_101854172	135
908	3300025960	Ga0207651_10194527	Ga0207651_101945272	135
909	3300025960	Ga0207651_11192982	Ga0207651_111929822	135
910	3300025961	Ga0207712_10091411	Ga0207712_100914112	135
911	3300025961	Ga0207712_10154765	Ga0207712_101547652	135
912	3300025961	Ga0207712_10259657	Ga0207712_102596572	135
913	3300025961	Ga0207712_10452059	Ga0207712_104520592	135
914	3300025972	Ga0207668_10068763	Ga0207668_100687633	135
915	3300025972	Ga0207668_10069665	Ga0207668_100696652	135
916	3300025972	Ga0207668_10131842	Ga0207668_101318422	135
917	3300025972	Ga0207668_10365065	Ga0207668_103650651	135
918	3300025972	Ga0207668_10790626	Ga0207668_107906261	135
919	3300025972	Ga0207668_10975743	Ga0207668_109757431	135
920	3300025972	Ga0207668_11282022	Ga0207668_112820221	135
921	3300025981	Ga0207640_10010346	Ga0207640_100103461	135
922	3300025981	Ga0207640_10018761	Ga0207640_100187614	135
923	3300025981	Ga0207640_10019123	Ga0207640_100191234	135
924	3300025981	Ga0207640_10144473	Ga0207640_101444734	135
925	3300025981	Ga0207640_10167668	Ga0207640_101676682	135
926	3300025981	Ga0207640_10290504	Ga0207640_102905041	135
927	3300025981	Ga0207640_10350994	Ga0207640_103509942	135
928	3300025981	Ga0207640_10664207	Ga0207640_106642072	135
929	3300025981	Ga0207640_10681477	Ga0207640_106814772	135
930	3300025981	Ga0207640_10889592	Ga0207640_108895921	135
931	3300025986	Ga0207658_10396513	Ga0207658_103965132	135
932	3300025986	Ga0207658_10440086	Ga0207658_104400862	135
933	3300025986	Ga0207658_10478985	Ga0207658_104789852	135
934	3300025986	Ga0207658_10669603	Ga0207658_106696032	135
935	3300025986	Ga0207658_10732860	Ga0207658_107328601	135
936	3300025986	Ga0207658_10803576	Ga0207658_108035761	135
937	3300026023	Ga0207677_10122455	Ga0207677_101224552	135
938	3300026023	Ga0207677_10143041	Ga0207677_101430412	135
939	3300026023	Ga0207677_10325266	Ga0207677_103252661	135
940	3300026023	Ga0207677_10712161	Ga0207677_107121612	135
941	3300026035	Ga0207703_10145647	Ga0207703_101456472	135
942	3300026035	Ga0207703_10421338	Ga0207703_104213382	135
943	3300026035	Ga0207703_10436249	Ga0207703_104362492	135
944	3300026035	Ga0207703_10572319	Ga0207703_105723192	135
945	3300026035	Ga0207703_10642017	Ga0207703_106420172	135
946	3300026035	Ga0207703_10747840	Ga0207703_107478401	135
947	3300026041	Ga0207639_10002676	Ga0207639_1000267613	135
948	3300026041	Ga0207639_10017628	Ga0207639_100176284	135
949	3300026041	Ga0207639_10116550	Ga0207639_101165502	135
950	3300026041	Ga0207639_10141440	Ga0207639_101414402	135
951	3300026041	Ga0207639_10240085	Ga0207639_102400852	135
952	3300026041	Ga0207639_10269968	Ga0207639_102699682	135
953	3300026041	Ga0207639_10286472	Ga0207639_102864722	135
954	3300026041	Ga0207639_10352694	Ga0207639_103526941	135
955	3300026041	Ga0207639_10385400	Ga0207639_103854002	135
956	3300026041	Ga0207639_10738165	Ga0207639_107381652	135
957	3300026041	Ga0207639_11273240	Ga0207639_112732401	135
958	3300026067	Ga0207678_10041532	Ga0207678_100415325	135
959	3300026067	Ga0207678_10093640	Ga0207678_100936402	135
960	3300026067	Ga0207678_10105285	Ga0207678_101052853	135
961	3300026067	Ga0207678_10139874	Ga0207678_101398742	135
962	3300026067	Ga0207678_10179375	Ga0207678_101793752	135
963	3300026067	Ga0207678_10297736	Ga0207678_102977361	135
964	3300026067	Ga0207678_10540012	Ga0207678_105400122	135
965	3300026067	Ga0207678_10547826	Ga0207678_105478262	135
966	3300026067	Ga0207678_10660344	Ga0207678_106603442	135
967	3300026067	Ga0207678_11511272	Ga0207678_115112721	135
968	3300026075	Ga0207708_10055153	Ga0207708_100551532	135
969	3300026075	Ga0207708_10234680	Ga0207708_102346802	135
970	3300026075	Ga0207708_10407821	Ga0207708_104078212	135
971	3300026078	Ga0207702_10000004	Ga0207702_1000000476	135
972	3300026078	Ga0207702_10000318	Ga0207702_1000031849	135
973	3300026078	Ga0207702_10169714	Ga0207702_101697143	135
974	3300026078	Ga0207702_10229417	Ga0207702_102294172	135
975	3300026078	Ga0207702_10279831	Ga0207702_102798312	135
976	3300026078	Ga0207702_10281269	Ga0207702_102812693	135
977	3300026078	Ga0207702_10378373	Ga0207702_103783731	135
978	3300026078	Ga0207702_10572759	Ga0207702_105727592	135
979	3300026078	Ga0207702_10824663	Ga0207702_108246632	135
980	3300026078	Ga0207702_11225635	Ga0207702_112256351	135
981	3300026078	Ga0207702_11228218	Ga0207702_112282182	135
982	3300026078	Ga0207702_11279074	Ga0207702_112790741	135
983	3300026088	Ga0207641_10457509	Ga0207641_104575092	135
984	3300026088	Ga0207641_10613685	Ga0207641_106136851	135
985	3300026089	Ga0207648_10181443	Ga0207648_101814432	135
986	3300026089	Ga0207648_10369983	Ga0207648_103699832	135
987	3300026095	Ga0207676_10066567	Ga0207676_100665672	135
988	3300026095	Ga0207676_10271486	Ga0207676_102714862	135
989	3300026095	Ga0207676_10401302	Ga0207676_104013022	135
990	3300026095	Ga0207676_10507155	Ga0207676_105071552	135
991	3300026095	Ga0207676_10898561	Ga0207676_108985612	135
992	3300026116	Ga0207674_10018238	Ga0207674_100182385	135
993	3300026116	Ga0207674_10066904	Ga0207674_100669044	135
994	3300026116	Ga0207674_10074915	Ga0207674_100749154	135
995	3300026116	Ga0207674_10197797	Ga0207674_101977972	135
996	3300026116	Ga0207674_10214062	Ga0207674_102140622	135
997	3300026116	Ga0207674_10222230	Ga0207674_102222302	135
998	3300026116	Ga0207674_10280932	Ga0207674_102809322	135
999	3300026116	Ga0207674_10571526	Ga0207674_105715262	135
1000	3300026116	Ga0207674_11211860	Ga0207674_112118601	135
1001	3300026118	Ga0207675_100077770	Ga0207675_1000777704	135
1002	3300026118	Ga0207675_100163338	Ga0207675_1001633384	135
1003	3300026118	Ga0207675_100391698	Ga0207675_1003916982	135
1004	3300026118	Ga0207675_100570876	Ga0207675_1005708762	135
1005	3300026118	Ga0207675_100592030	Ga0207675_1005920302	135
1006	3300026118	Ga0207675_100813435	Ga0207675_1008134352	135
1007	3300026121	Ga0207683_10067115	Ga0207683_100671154	135
1008	3300026121	Ga0207683_10127400	Ga0207683_101274004	135
1009	3300026121	Ga0207683_10258297	Ga0207683_102582972	135
1010	3300026121	Ga0207683_10296531	Ga0207683_102965312	135
1011	3300026121	Ga0207683_10297294	Ga0207683_102972942	135
1012	3300026121	Ga0207683_10660437	Ga0207683_106604372	135
1013	3300026142	Ga0207698_10013935	Ga0207698_100139354	135
1014	3300026142	Ga0207698_10014635	Ga0207698_100146354	135
1015	3300026142	Ga0207698_10069148	Ga0207698_100691482	135
1016	3300026142	Ga0207698_10124068	Ga0207698_101240682	135
1017	3300026142	Ga0207698_10345875	Ga0207698_103458752	135
1018	3300026142	Ga0207698_10429817	Ga0207698_104298172	135
1019	3300026142	Ga0207698_10558070	Ga0207698_105580702	135
1020	3300026142	Ga0207698_10609631	Ga0207698_106096312	135
1021	3300026142	Ga0207698_10804619	Ga0207698_108046192	135
1022	3300026142	Ga0207698_11084197	Ga0207698_110841972	135
1023	3300026142	Ga0207698_11303264	Ga0207698_113032641	135
1024	3300026142	Ga0207698_11751052	Ga0207698_117510521	135
1025	3300027296	Ga0209389_1000102	Ga0209389_100010242	135
1026	3300027296	Ga0209389_1000142	Ga0209389_100014235	135
1027	3300027357	Ga0209589_1000035	Ga0209589_100003543	135
1028	3300027357	Ga0209589_1000331	Ga0209589_100033135	135
1029	3300027361	Ga0209489_100079	Ga0209489_10007943	135
1030	3300027361	Ga0209489_100404	Ga0209489_10040442	135
1031	3300027361	Ga0209489_100818	Ga0209489_10081835	135
1032	3300027363	Ga0209700_100077	Ga0209700_10007743	135
1033	3300027363	Ga0209700_100408	Ga0209700_10040842	135
1034	3300027512	Ga0209179_1006992	Ga0209179_10069922	135
1035	3300027512	Ga0209179_1013766	Ga0209179_10137662	135
1036	3300027671	Ga0209588_1002870	Ga0209588_10028702	135
1037	3300027866	Ga0209813_10004333	Ga0209813_100043332	135
1038	3300027866	Ga0209813_10059173	Ga0209813_100591732	135
1039	3300027866	Ga0209813_10123751	Ga0209813_101237512	135
1040	3300027866	Ga0209813_10181557	Ga0209813_101815572	135
1041	3300027866	Ga0209813_10257335	Ga0209813_102573351	135
1042	3300027907	Ga0207428_10311307	Ga0207428_103113071	135
1043	3300028379	Ga0268266_10001335	Ga0268266_100013352	135
1044	3300028379	Ga0268266_10049648	Ga0268266_100496483	135
1045	3300028379	Ga0268266_10068023	Ga0268266_100680232	135
1046	3300028379	Ga0268266_10073499	Ga0268266_100734992	135
1047	3300028379	Ga0268266_10143204	Ga0268266_101432041	135
1048	3300028379	Ga0268266_10279577	Ga0268266_102795772	135
1049	3300028379	Ga0268266_10403776	Ga0268266_104037762	135
1050	3300028379	Ga0268266_10504487	Ga0268266_105044872	135
1051	3300028379	Ga0268266_10760295	Ga0268266_107602952	135
1052	3300028379	Ga0268266_10884979	Ga0268266_108849792	135
1053	3300028379	Ga0268266_10907085	Ga0268266_109070852	135
1054	3300028380	Ga0268265_10084542	Ga0268265_100845423	135
1055	3300028380	Ga0268265_10298166	Ga0268265_102981662	135
1056	3300028380	Ga0268265_10394590	Ga0268265_103945902	135
1057	3300028380	Ga0268265_10545068	Ga0268265_105450682	135
1058	3300028380	Ga0268265_10599593	Ga0268265_105995932	135
1059	3300028380	Ga0268265_11067191	Ga0268265_110671911	135
1060	3300028380	Ga0268265_11664922	Ga0268265_116649222	135
1061	3300028381	Ga0268264_10000062	Ga0268264_10000062280	135
1062	3300028381	Ga0268264_10481814	Ga0268264_104818142	135
1063	3300028381	Ga0268264_10483967	Ga0268264_104839672	135
1064	3300028381	Ga0268264_10698722	Ga0268264_106987222	135
1065	3300028381	Ga0268264_10949244	Ga0268264_109492442	135
1066	3300028556	Ga0265337_1015278	Ga0265337_10152782	135
1067	3300028563	Ga0265319_1016635	Ga0265319_10166352	135
1068	3300028573	Ga0265334_10005996	Ga0265334_100059962	135
1069	3300028573	Ga0265334_10007481	Ga0265334_100074813	135
1070	3300028577	Ga0265318_10025123	Ga0265318_100251232	135
1071	3300028653	Ga0265323_10008358	Ga0265323_100083584	135
1072	3300028666	Ga0265336_10005997	Ga0265336_100059975	135
1073	3300028786	Ga0307517_10000232	Ga0307517_1000023237	135
1074	3300028786	Ga0307517_10089056	Ga0307517_100890561	135
1075	3300028786	Ga0307517_10192098	Ga0307517_101920982	135
1076	3300028786	Ga0307517_10543192	Ga0307517_105431922	135
1077	3300028794	Ga0307515_10030422	Ga0307515_100304224	135
1078	3300028794	Ga0307515_10137546	Ga0307515_101375463	135
1079	3300028794	Ga0307515_10501867	Ga0307515_105018672	135
1080	3300028794	Ga0307515_10889819	Ga0307515_108898191	135
1081	3300028800	Ga0265338_10000422	Ga0265338_1000042230	135
1082	3300028800	Ga0265338_11106022	Ga0265338_111060221	135
1083	3300029957	Ga0265324_10007630	Ga0265324_100076302	135
1084	3300030521	Ga0307511_10010108	Ga0307511_100101087	135
1085	3300030760	Ga0265762_1118648	Ga0265762_11186481	135
1086	3300030879	Ga0265765_1063564	Ga0265765_10635641	135
1087	3300031235	Ga0265330_10024128	Ga0265330_100241283	135
1088	3300031235	Ga0265330_10038768	Ga0265330_100387682	135
1089	3300031238	Ga0265332_10002500	Ga0265332_100025004	135
1090	3300031238	Ga0265332_10016943	Ga0265332_100169432	135
1091	3300031238	Ga0265332_10219714	Ga0265332_102197141	135
1092	3300031242	Ga0265329_10101479	Ga0265329_101014791	135
1093	3300031242	Ga0265329_10219448	Ga0265329_102194481	135
1094	3300031247	Ga0265340_10095700	Ga0265340_100957002	135
1095	3300031247	Ga0265340_10144253	Ga0265340_101442532	135
1096	3300031249	Ga0265339_10000681	Ga0265339_1000068117	135
1097	3300031249	Ga0265339_10230626	Ga0265339_102306262	135
1098	3300031250	Ga0265331_10012649	Ga0265331_100126493	135
1099	3300031250	Ga0265331_10158200	Ga0265331_101582002	135
1100	3300031251	Ga0265327_10518471	Ga0265327_105184711	135
1101	3300031344	Ga0265316_10141196	Ga0265316_101411962	135
1102	3300031344	Ga0265316_10223768	Ga0265316_102237682	135
1103	3300031456	Ga0307513_10241441	Ga0307513_102414412	135
1104	3300031456	Ga0307513_10969446	Ga0307513_109694461	135
1105	3300031507	Ga0307509_10053355	Ga0307509_100533554	135
1106	3300031507	Ga0307509_10066569	Ga0307509_100665694	135
1107	3300031507	Ga0307509_10186905	Ga0307509_101869052	135
1108	3300031507	Ga0307509_10583867	Ga0307509_105838672	135
1109	3300031548	Ga0307408_100959924	Ga0307408_1009599241	135
1110	3300031548	Ga0307408_101216054	Ga0307408_1012160542	135
1111	3300031595	Ga0265313_10129310	Ga0265313_101293101	135
1112	3300031616	Ga0307508_10000045	Ga0307508_1000004578	135
1113	3300031616	Ga0307508_10054492	Ga0307508_100544924	135
1114	3300031616	Ga0307508_10349550	Ga0307508_103495502	135
1115	3300031616	Ga0307508_10418711	Ga0307508_104187112	135
1116	3300031616	Ga0307508_10599284	Ga0307508_105992841	135
1117	3300031711	Ga0265314_10049337	Ga0265314_100493374	135
1118	3300031711	Ga0265314_10198743	Ga0265314_101987432	135
1119	3300031712	Ga0265342_10011010	Ga0265342_100110103	135
1120	3300031712	Ga0265342_10026156	Ga0265342_100261564	135
1121	3300031730	Ga0307516_10070705	Ga0307516_100707052	135
1122	3300031730	Ga0307516_10178764	Ga0307516_101787642	135
1123	3300031730	Ga0307516_10218899	Ga0307516_102188992	135
1124	3300031730	Ga0307516_10219102	Ga0307516_102191022	135
1125	3300031730	Ga0307516_10520764	Ga0307516_105207642	135
1126	3300031730	Ga0307516_10881908	Ga0307516_108819081	135
1127	3300031731	Ga0307405_10076245	Ga0307405_100762452	135
1128	3300031731	Ga0307405_11053796	Ga0307405_110537961	135
1129	3300031731	Ga0307405_12126576	Ga0307405_121265761	135
1130	3300031852	Ga0307410_11627945	Ga0307410_116279451	135
1131	3300031901	Ga0307406_10321034	Ga0307406_103210342	135
1132	3300031901	Ga0307406_10855196	Ga0307406_108551962	135
1133	3300031901	Ga0307406_10900589	Ga0307406_109005892	135
1134	3300031903	Ga0307407_10164053	Ga0307407_101640532	135
1135	3300031903	Ga0307407_11312460	Ga0307407_113124601	135
1136	3300031911	Ga0307412_10027981	Ga0307412_100279812	135
1137	3300031911	Ga0307412_10442072	Ga0307412_104420722	135
1138	3300031911	Ga0307412_11028685	Ga0307412_110286852	135
1139	3300031995	Ga0307409_100386324	Ga0307409_1003863242	135
1140	3300032002	Ga0307416_100527437	Ga0307416_1005274372	135
1141	3300032002	Ga0307416_101655169	Ga0307416_1016551691	135
1142	3300032004	Ga0307414_10852092	Ga0307414_108520921	135
1143	3300032005	Ga0307411_10594866	Ga0307411_105948662	135
1144	3300032005	Ga0307411_10607182	Ga0307411_106071822	135
1145	3300032126	Ga0307415_100027065	Ga0307415_1000270654	135
1146	3300032126	Ga0307415_100420011	Ga0307415_1004200112	135
1147	3300033179	Ga0307507_10069533	Ga0307507_100695332	135
1148	3300033179	Ga0307507_10228746	Ga0307507_102287461	135
1149	3300033180	Ga0307510_10005192	Ga0307510_100051921	135
1150	3300033180	Ga0307510_10014100	Ga0307510_100141007	135
1151	3300033180	Ga0307510_10125740	Ga0307510_101257402	135
1152	3300033180	Ga0307510_10228937	Ga0307510_102289372	135
1153	3300033180	Ga0307510_10558945	Ga0307510_105589451	135
1154	3300033442	Ga0315911_1000008	Ga0315911_100000883	135
1155	3300034816	Ga0373930_0019782	Ga0373930_0019782_691_1098	135
1156	3300034818	Ga0373950_0005163	Ga0373950_0005163_508_918	135
1157	3300035083	Ga0373926_0028127	Ga0373926_0028127_844_1251	135
1158	3300035083	Ga0373926_0073477	Ga0373926_0073477_28_435	135
1159	3300035083	Ga0373926_0128397	Ga0373926_0128397_361_771	135
1160	3300035086	Ga0373934_0042295	Ga0373934_0042295_348_755	135
1161	3300035086	Ga0373934_0045208	Ga0373934_0045208_880_1287	135
1162	3300035086	Ga0373934_0138997	Ga0373934_0138997_290_700	135
1163	3300035086	Ga0373934_0183987	Ga0373934_0183987_335_742	135
1164	3300035089	Ga0373944_0156404	Ga0373944_0156404_85_582	135
1165	3300035092	Ga0373952_0027366	Ga0373952_0027366_149_556	135
1166	3300035111	Ga0373923_0001920	Ga0373923_0001920_3919_4326	135
1167	3300035111	Ga0373923_0002272	Ga0373923_0002272_5383_5793	135
1168	3300035111	Ga0373923_0004491	Ga0373923_0004491_2976_3383	135
1169	3300035111	Ga0373923_0205178	Ga0373923_0205178_66_473	135
1170	3300035112	Ga0373932_0097630	Ga0373932_0097630_46_453	135
1171	3300035113	Ga0373936_0002980	Ga0373936_0002980_3937_4344	135
1172	3300035113	Ga0373936_0070327	Ga0373936_0070327_50_457	135
1173	3300035113	Ga0373936_0564428	Ga0373936_0564428_25_432	135
1174	3300035114	Ga0373939_0166284	Ga0373939_0166284_302_709	135
1175	3300035116	Ga0373945_0065548	Ga0373945_0065548_502_909	135
1176	3300035117	Ga0373953_0000295	Ga0373953_0000295_9443_9850	135
1177	3300035117	Ga0373953_0085795	Ga0373953_0085795_400_807	135
1178	3300035117	Ga0373953_0315140	Ga0373953_0315140_219_626	135
1179	3300035118	Ga0373954_0004264	Ga0373954_0004264_3780_4187	135
1180	3300035118	Ga0373954_0031690	Ga0373954_0031690_1200_1607	135
1181	3300035118	Ga0373954_0102561	Ga0373954_0102561_698_1108	135
1182	3300035118	Ga0373954_0113887	Ga0373954_0113887_508_915	135
1183	3300035119	Ga0373956_0003640	Ga0373956_0003640_1629_2036	135
1184	3300035119	Ga0373956_0025571	Ga0373956_0025571_1057_1467	135
1185	3300035119	Ga0373956_0046735	Ga0373956_0046735_1197_1604	135
1186	3300035120	Ga0373957_0002556	Ga0373957_0002556_4074_4481	135
1187	3300035120	Ga0373957_0004293	Ga0373957_0004293_589_996	135
1188	3300035120	Ga0373957_0166464	Ga0373957_0166464_48_455	135
1189	3300035121	Ga0373960_0178824	Ga0373960_0178824_225_632	135
1190	3300035170	Ga0373943_0004960	Ga0373943_0004960_3214_3621	135
1191	3300035170	Ga0373943_0303470	Ga0373943_0303470_214_621	135
1192	3300035171	Ga0373946_0005215	Ga0373946_0005215_158_565	135
1193	3300035171	Ga0373946_0104228	Ga0373946_0104228_45_455	135
1194	3300035171	Ga0373946_0281829	Ga0373946_0281829_206_613	135
1195	3300035172	Ga0373955_0025559	Ga0373955_0025559_2379_2786	135
1196	3300035172	Ga0373955_0031384	Ga0373955_0031384_1965_2372	135
1197	3300035172	Ga0373955_0106646	Ga0373955_0106646_213_623	135
1198	3300035172	Ga0373955_0236315	Ga0373955_0236315_525_932	135
1199	3300035172	Ga0373955_0738707	Ga0373955_0738707_12_419	135
1200	3300035242	Ga0373962_0078420	Ga0373962_0078420_193_600	135
1201	3300035410	Ga0373924_0002842	Ga0373924_0002842_5152_5559	135
1202	3300035410	Ga0373924_0003454	Ga0373924_0003454_3945_4355	135
1203	3300035410	Ga0373924_0080680	Ga0373924_0080680_678_1085	135
1204	3300035691	Ga0373931_0126077	Ga0373931_0126077_236_643	135
1205	3300035691	Ga0373931_0447451	Ga0373931_0447451_115_522	135
1206	3300035691	Ga0373931_0537061	Ga0373931_0537061_294_701	135
1207	3300035692	Ga0373935_0000595	Ga0373935_0000595_4117_4524	135
1208	3300035692	Ga0373935_0046038	Ga0373935_0046038_2251_2658	135
1209	3300035692	Ga0373935_0065098	Ga0373935_0065098_1094_1501	135
1210	3300035692	Ga0373935_0133625	Ga0373935_0133625_1168_1578	135
1211	3300035695	Ga0373927_0001021	Ga0373927_0001021_3996_4403	135
1212	3300035695	Ga0373927_0007921	Ga0373927_0007921_6490_6897	135
1213	3300035695	Ga0373927_0013479	Ga0373927_0013479_2574_2981	135
1214	3300035695	Ga0373927_0023827	Ga0373927_0023827_2583_2993	135
1215	3300035695	Ga0373927_0061957	Ga0373927_0061957_987_1394	135
1216	3300035695	Ga0373927_0082245	Ga0373927_0082245_1538_2035	135
1217	3300035724	Ga0373933_0000218	Ga0373933_0000218_32322_32729	135
1218	3300035724	Ga0373933_0002329	Ga0373933_0002329_6339_6746	135
1219	3300035724	Ga0373933_0438620	Ga0373933_0438620_214_621	135
1220	3300035724	Ga0373933_0679396	Ga0373933_0679396_215_622	135
1221	3300035725	Ga0373947_0000970	Ga0373947_0000970_13683_14090	135
1222	3300035725	Ga0373947_0010686	Ga0373947_0010686_4063_4470	135
1223	3300035725	Ga0373947_0025586	Ga0373947_0025586_42_539	135
1224	3300035725	Ga0373947_0058005	Ga0373947_0058005_1724_2131	135
1225	3300035725	Ga0373947_0061086	Ga0373947_0061086_13_423	135
1226	3300035725	Ga0373947_0316941	Ga0373947_0316941_232_639	135
1227	3300036401	Ga0373937_0010824	Ga0373937_0010824_5686_6093	135
1228	3300036401	Ga0373937_0015997	Ga0373937_0015997_2464_2871	135
1229	3300036401	Ga0373937_0043428	Ga0373937_0043428_2935_3345	135
1230	3300036401	Ga0373937_0866734	Ga0373937_0866734_29_436	135
1231	3300036401	Ga0373937_0955148	Ga0373937_0955148_217_624	135
1232	3300036401	Ga0373937_0983548	Ga0373937_0983548_14_421	135
1233	3300036458	Ga0310112_037901	Ga0310112_037901_171_578	135
1234	3300036459	Ga0372808_013035	Ga0372808_013035_593_1000	135
1235	3300037068	Ga0373925_0005771	Ga0373925_0005771_8751_9158	135
1236	3300037068	Ga0373925_0029490	Ga0373925_0029490_2447_2944	135
1237	3300037068	Ga0373925_0059981	Ga0373925_0059981_209_616	135
1238	3300037068	Ga0373925_0080800	Ga0373925_0080800_1302_1709	135
1239	3300037068	Ga0373925_0303147	Ga0373925_0303147_168_575	135
1240	3300037068	Ga0373925_0326040	Ga0373925_0326040_183_590	135
1241	3300037068	Ga0373925_0632027	Ga0373925_0632027_57_515	135
1242	3300037068	Ga0373925_0723747	Ga0373925_0723747_392_799	135
1243	3300037068	Ga0373925_0951737	Ga0373925_0951737_13_423	135
1244	3300037312	Ga0395899_0142005	Ga0395899_0142005_139_546	135
1245	3300037312	Ga0395899_0408250	Ga0395899_0408250_165_572	135
1246	3300037312	Ga0395899_0421422	Ga0395899_0421422_302_712	135
1247	3300037312	Ga0395899_0490521	Ga0395899_0490521_311_724	135
1248	3300037418	Ga0395900_0000423	Ga0395900_0000423_28826_29233	135
1249	3300037418	Ga0395900_0006224	Ga0395900_0006224_4175_4582	135
1250	3300037418	Ga0395900_0190863	Ga0395900_0190863_1051_1458	135
1251	3300037418	Ga0395900_0213755	Ga0395900_0213755_302_712	135
1252	3300037418	Ga0395900_1484328	Ga0395900_1484328_39_446	135
1253	3300037418	Ga0395900_1552244	Ga0395900_1552244_66_473	135
1254	3300037466	Ga0395898_0099523	Ga0395898_0099523_946_1359	135
1255	3300037466	Ga0395898_0193297	Ga0395898_0193297_861_1271	135
1256	3300037466	Ga0395898_0295295	Ga0395898_0295295_762_1169	135
1257	3300037466	Ga0395898_0325784	Ga0395898_0325784_307_714	135
1258	3300037466	Ga0395898_0725642	Ga0395898_0725642_292_699	135
1259	3300037466	Ga0395898_0763267	Ga0395898_0763267_119_526	135
1260	3300037471	Ga0395905_0191063	Ga0395905_0191063_742_1149	135
1261	3300037471	Ga0395905_0194802	Ga0395905_0194802_208_615	135
1262	3300037471	Ga0395905_0327164	Ga0395905_0327164_298_705	135
1263	3300037853	Ga0436364_0233904	Ga0436364_0233904_234_641	135
1264	3300037853	Ga0436364_1394342	Ga0436364_1394342_415_822	135
1265	3300037853	Ga0436364_1558783	Ga0436364_1558783_537_944	135
1266	3300038443	Ga0395901_0016910	Ga0395901_0016910_1164_1577	135
1267	3300038443	Ga0395901_0045830	Ga0395901_0045830_724_1131	135
1268	3300038443	Ga0395901_0851036	Ga0395901_0851036_69_476	135
1269	3300038443	Ga0395901_2060726	Ga0395901_2060726_79_486	135
1270	3300039437	Ga0436365_0023991	Ga0436365_0023991_823_1230	135
1271	3300039437	Ga0436365_0062661	Ga0436365_0062661_42_449	135
1272	3300039437	Ga0436365_0417554	Ga0436365_0417554_207_614	135
1273	3300039437	Ga0436365_0422820	Ga0436365_0422820_206_613	135
1274	3300039437	Ga0436365_0792962	Ga0436365_0792962_433_840	135
1275	3300039437	Ga0436365_1775583	Ga0436365_1775583_55_462	135
1276	3300039437	Ga0436365_1921765	Ga0436365_1921765_2689_3096	135
1277	3300039438	Ga0436360_0054710	Ga0436360_0054710_28_435	135
1278	3300039438	Ga0436360_0243643	Ga0436360_0243643_987_1394	135
1279	3300039447	Ga0436361_0093117	Ga0436361_0093117_220_627	135
1280	3300039447	Ga0436361_0311968	Ga0436361_0311968_62_469	135
1281	3300039450	Ga0436363_0126016	Ga0436363_0126016_253_660	135
1282	3300039450	Ga0436363_0504225	Ga0436363_0504225_340_747	135
1283	3300039450	Ga0436363_0638968	Ga0436363_0638968_131_538	135
1284	3300039450	Ga0436363_0728136	Ga0436363_0728136_693_1100	135
1285	3300039450	Ga0436363_0774700	Ga0436363_0774700_423_830	135
1286	3300039450	Ga0436363_1429645	Ga0436363_1429645_2628_3035	135
1287	3300039450	Ga0436363_1608181	Ga0436363_1608181_97_504	135
1288	3300041410	Ga0439461_0216379	Ga0439461_0216379_95_502	135
1289	3300041413	Ga0439465_0190925	Ga0439465_0190925_103_510	135
1290	3300041441	Ga0451787_097135	Ga0451787_097135_151_558	135
1291	3300041452	Ga0451793_0764484	Ga0451793_0764484_38_445	135
1292	3300041452	Ga0451793_1041072	Ga0451793_1041072_251_658	135
1293	3300041452	Ga0451793_1255108	Ga0451793_1255108_99_506	135
1294	3300041452	Ga0451793_1889595	Ga0451793_1889595_312_719	135
1295	3300041458	Ga0451798_0750927	Ga0451798_0750927_211_618	135
1296	3300041458	Ga0451798_1009128	Ga0451798_1009128_61_468	135
1297	3300041459	Ga0451800_1039335	Ga0451800_1039335_383_790	135
1298	3300041460	Ga0451802_0142566	Ga0451802_0142566_616_1023	135
1299	3300041461	Ga0451805_107655	Ga0451805_107655_120_527	135
1300	3300041463	Ga0451804_0251643	Ga0451804_0251643_45_452	135
1301	3300041486	Ga0451807_1467455	Ga0451807_1467455_204_662	135
1302	3300041486	Ga0451807_1887621	Ga0451807_1887621_195_602	135
1303	3300041492	Ga0451835_0003308	Ga0451835_0003308_14_421	135
1304	3300041494	Ga0451837_0451455	Ga0451837_0451455_240_647	135
1305	3300041496	Ga0451839_0292002	Ga0451839_0292002_99_506	135
1306	3300041498	Ga0451841_0249111	Ga0451841_0249111_64_471	135
1307	3300041498	Ga0451841_1261231	Ga0451841_1261231_398_805	135
1308	3300041505	Ga0451849_0900183	Ga0451849_0900183_19_426	135
1309	3300041505	Ga0451849_1430746	Ga0451849_1430746_79_486	135
1310	3300041512	Ga0451853_1951080	Ga0451853_1951080_136_543	135
1311	3300041512	Ga0451853_2124155	Ga0451853_2124155_182_589	135
1312	3300041512	Ga0451853_2441409	Ga0451853_2441409_48_455	135
1313	3300041512	Ga0451853_2659698	Ga0451853_2659698_809_1216	135
1314	3300042005	Ga0439448_0094372	Ga0439448_0094372_405_812	135
1315	3300044656	Ga0466969_0056131	Ga0466969_0056131_362_769	135
1316	3300044658	Ga0466972_0030983	Ga0466972_0030983_165_572	135
1317	3300044658	Ga0466972_0382439	Ga0466972_0382439_202_609	135
1318	3300044684	Ga0466966_0000628	Ga0466966_0000628_15613_16020	135
1319	3300044684	Ga0466966_0473070	Ga0466966_0473070_269_676	135
1320	3300044693	Ga0466961_0000770	Ga0466961_0000770_18146_18553	135
1321	3300044694	Ga0466963_0044320	Ga0466963_0044320_1551_1958	135
1322	3300044706	Ga0466964_0020180	Ga0466964_0020180_1878_2285	135
1323	3300044706	Ga0466964_0055738	Ga0466964_0055738_673_1080	135
1324	3300044735	Ga0466968_0054430	Ga0466968_0054430_566_973	135
1325	3300044735	Ga0466968_0725445	Ga0466968_0725445_58_465	135
1326	3300044765	Ga0466970_0339744	Ga0466970_0339744_370_777	135
1327	3300044842	Ga0466957_0011135	Ga0466957_0011135_2522_2929	135
1328	3300044842	Ga0466957_0374888	Ga0466957_0374888_443_850	135
1329	3300044901	Ga0466960_0028866	Ga0466960_0028866_128_535	135
1330	3300045049	Ga0466959_0003303	Ga0466959_0003303_594_1001	135
1331	3300045049	Ga0466959_0092328	Ga0466959_0092328_1152_1559	135
1332	3300045049	Ga0466959_0100289	Ga0466959_0100289_1078_1485	135
1333	3300045049	Ga0466959_0127089	Ga0466959_0127089_596_1003	135
1334	3300045049	Ga0466959_0625053	Ga0466959_0625053_48_455	135
1335	3300045049	Ga0466959_0674731	Ga0466959_0674731_210_617	135
1336	3300045836	Ga0466958_0413592	Ga0466958_0413592_393_800	135
1337	3300045976	Ga0466967_0053699	Ga0466967_0053699_610_1017	135
1338	3300045976	Ga0466967_0107803	Ga0466967_0107803_406_813	135
1339	3300045976	Ga0466967_0676457	Ga0466967_0676457_194_601	135
1340	3300045976	Ga0466967_1031684	Ga0466967_1031684_103_510	135
1341	3300046452	Ga0495617_151419	Ga0495617_151419_243_650	135
1342	3300046452	Ga0495617_249254	Ga0495617_249254_123_530	135
1343	3300046454	Ga0495592_0015730	Ga0495592_0015730_1960_2367	135
1344	3300046454	Ga0495592_0086374	Ga0495592_0086374_490_900	135
1345	3300046454	Ga0495592_0119008	Ga0495592_0119008_230_637	135
1346	3300046454	Ga0495592_0366977	Ga0495592_0366977_120_527	135
1347	3300046455	Ga0495603_0001390	Ga0495603_0001390_4149_4556	135
1348	3300046455	Ga0495603_0008445	Ga0495603_0008445_5236_5643	135
1349	3300046455	Ga0495603_0055326	Ga0495603_0055326_1930_2337	135
1350	3300046455	Ga0495603_0156311	Ga0495603_0156311_782_1189	135
1351	3300046455	Ga0495603_0304487	Ga0495603_0304487_282_689	135
1352	3300046455	Ga0495603_0341233	Ga0495603_0341233_32_439	135
1353	3300046455	Ga0495603_0366916	Ga0495603_0366916_324_731	135
1354	3300046455	Ga0495603_0375574	Ga0495603_0375574_394_801	135
1355	3300046457	Ga0495590_0057485	Ga0495590_0057485_211_618	135
1356	3300046457	Ga0495590_0105501	Ga0495590_0105501_11_418	135
1357	3300046457	Ga0495590_0267407	Ga0495590_0267407_156_563	135
1358	3300046459	Ga0495629_0000915	Ga0495629_0000915_19137_19544	135
1359	3300046459	Ga0495629_0010705	Ga0495629_0010705_1966_2373	135
1360	3300046459	Ga0495629_0027900	Ga0495629_0027900_2683_3093	135
1361	3300046459	Ga0495629_0033234	Ga0495629_0033234_1926_2384	135
1362	3300046459	Ga0495629_0049476	Ga0495629_0049476_2422_2829	135
1363	3300046459	Ga0495629_0180367	Ga0495629_0180367_805_1212	135
1364	3300046459	Ga0495629_0190627	Ga0495629_0190627_329_736	135
1365	3300046459	Ga0495629_0262441	Ga0495629_0262441_110_517	135
1366	3300046460	Ga0495638_0000880	Ga0495638_0000880_3482_3889	135
1367	3300046460	Ga0495638_0295016	Ga0495638_0295016_427_834	135
1368	3300046460	Ga0495638_0298118	Ga0495638_0298118_361_768	135
1369	3300046460	Ga0495638_0330376	Ga0495638_0330376_128_535	135
1370	3300046460	Ga0495638_0394414	Ga0495638_0394414_37_444	135
1371	3300046461	Ga0495641_0007969	Ga0495641_0007969_2443_2850	135
1372	3300046461	Ga0495641_0008018	Ga0495641_0008018_5011_5421	135
1373	3300046461	Ga0495641_0119632	Ga0495641_0119632_114_521	135
1374	3300046462	Ga0495651_0011194	Ga0495651_0011194_1874_2281	135
1375	3300046462	Ga0495651_0024642	Ga0495651_0024642_3789_4196	135
1376	3300046462	Ga0495651_0069688	Ga0495651_0069688_101_511	135
1377	3300046462	Ga0495651_0171684	Ga0495651_0171684_1089_1496	135
1378	3300046463	Ga0495653_0009510	Ga0495653_0009510_1988_2395	135
1379	3300046463	Ga0495653_0033378	Ga0495653_0033378_2247_2657	135
1380	3300046463	Ga0495653_0256513	Ga0495653_0256513_394_801	135
1381	3300046471	Ga0495650_0292903	Ga0495650_0292903_36_443	135
1382	3300046472	Ga0495580_0009685	Ga0495580_0009685_6562_6969	135
1383	3300046472	Ga0495580_0014933	Ga0495580_0014933_2084_2491	135
1384	3300046472	Ga0495580_0111796	Ga0495580_0111796_1294_1791	135
1385	3300046473	Ga0495582_0000302	Ga0495582_0000302_17307_17714	135
1386	3300046473	Ga0495582_0010682	Ga0495582_0010682_2455_2865	135
1387	3300046473	Ga0495582_0014650	Ga0495582_0014650_2765_3172	135
1388	3300046473	Ga0495582_0900387	Ga0495582_0900387_67_474	135
1389	3300046474	Ga0495605_0068961	Ga0495605_0068961_319_726	135
1390	3300046474	Ga0495605_0084028	Ga0495605_0084028_636_1043	135
1391	3300046474	Ga0495605_0238278	Ga0495605_0238278_209_616	135
1392	3300046474	Ga0495605_0266139	Ga0495605_0266139_206_613	135
1393	3300046475	Ga0495639_0000072	Ga0495639_0000072_1048_1455	135
1394	3300046475	Ga0495639_0003352	Ga0495639_0003352_5309_5719	135
1395	3300046475	Ga0495639_0004340	Ga0495639_0004340_753_1160	135
1396	3300046475	Ga0495639_0279355	Ga0495639_0279355_302_709	135
1397	3300046476	Ga0495662_0001985	Ga0495662_0001985_5912_6319	135
1398	3300046476	Ga0495662_0334353	Ga0495662_0334353_313_720	135
1399	3300046476	Ga0495662_0362346	Ga0495662_0362346_290_697	135
1400	3300046477	Ga0495664_0003834	Ga0495664_0003834_5851_6261	135
1401	3300046477	Ga0495664_0007335	Ga0495664_0007335_5673_6080	135
1402	3300046477	Ga0495664_0090181	Ga0495664_0090181_480_887	135
1403	3300046477	Ga0495664_0109974	Ga0495664_0109974_81_488	135
1404	3300046477	Ga0495664_0160233	Ga0495664_0160233_445_852	135
1405	3300046477	Ga0495664_0214643	Ga0495664_0214643_413_820	135
1406	3300046477	Ga0495664_0397286	Ga0495664_0397286_267_674	135
1407	3300046477	Ga0495664_0564102	Ga0495664_0564102_189_596	135
1408	3300046491	Ga0495584_0106163	Ga0495584_0106163_455_862	135
1409	3300046491	Ga0495584_0642822	Ga0495584_0642822_70_477	135
1410	3300046492	Ga0495585_0103789	Ga0495585_0103789_836_1243	135
1411	3300046492	Ga0495585_0203993	Ga0495585_0203993_403_810	135
1412	3300046492	Ga0495585_0293806	Ga0495585_0293806_187_594	135
1413	3300046492	Ga0495585_0485428	Ga0495585_0485428_114_521	135
1414	3300046499	Ga0495594_0000046	Ga0495594_0000046_11851_12258	135
1415	3300046499	Ga0495594_0006637	Ga0495594_0006637_680_1087	135
1416	3300046499	Ga0495594_0255020	Ga0495594_0255020_61_558	135
1417	3300046499	Ga0495594_0338961	Ga0495594_0338961_392_799	135
1418	3300046499	Ga0495594_0751288	Ga0495594_0751288_109_516	135
1419	3300046500	Ga0495596_0026200	Ga0495596_0026200_696_1103	135
1420	3300046500	Ga0495596_0075852	Ga0495596_0075852_571_978	135
1421	3300046500	Ga0495596_0230503	Ga0495596_0230503_286_693	135
1422	3300046500	Ga0495596_0297699	Ga0495596_0297699_20_427	135
1423	3300046501	Ga0495607_0147406	Ga0495607_0147406_759_1166	135
1424	3300046501	Ga0495607_0213753	Ga0495607_0213753_238_645	135
1425	3300046501	Ga0495607_0295672	Ga0495607_0295672_278_685	135
1426	3300046506	Ga0495583_0133592	Ga0495583_0133592_598_1005	135
1427	3300046506	Ga0495583_0178528	Ga0495583_0178528_170_577	135
1428	3300046507	Ga0495606_0016869	Ga0495606_0016869_170_577	135
1429	3300046507	Ga0495606_0031269	Ga0495606_0031269_155_562	135
1430	3300046507	Ga0495606_0087573	Ga0495606_0087573_711_1118	135
1431	3300046507	Ga0495606_0148378	Ga0495606_0148378_12_419	135
1432	3300046507	Ga0495606_0163043	Ga0495606_0163043_651_1058	135
1433	3300046507	Ga0495606_0256848	Ga0495606_0256848_391_798	135
1434	3300046507	Ga0495606_0267501	Ga0495606_0267501_367_774	135
1435	3300046507	Ga0495606_0344110	Ga0495606_0344110_170_577	135
1436	3300046507	Ga0495606_0514424	Ga0495606_0514424_182_589	135
1437	3300046511	Ga0495608_0022303	Ga0495608_0022303_2582_2992	135
1438	3300046511	Ga0495608_0216189	Ga0495608_0216189_376_783	135
1439	3300046511	Ga0495608_0352552	Ga0495608_0352552_400_807	135
1440	3300046512	Ga0495610_0109614	Ga0495610_0109614_513_920	135
1441	3300046512	Ga0495610_0139619	Ga0495610_0139619_426_833	135
1442	3300046513	Ga0495616_0238027	Ga0495616_0238027_22_429	135
1443	3300046513	Ga0495616_0417719	Ga0495616_0417719_53_460	135
1444	3300046514	Ga0495618_0025224	Ga0495618_0025224_3234_3644	135
1445	3300046514	Ga0495618_0070301	Ga0495618_0070301_1121_1528	135
1446	3300046515	Ga0495620_0013237	Ga0495620_0013237_947_1354	135
1447	3300046515	Ga0495620_0149489	Ga0495620_0149489_229_636	135
1448	3300046515	Ga0495620_0152822	Ga0495620_0152822_196_603	135
1449	3300046516	Ga0495628_0017184	Ga0495628_0017184_2221_2631	135
1450	3300046516	Ga0495628_0035925	Ga0495628_0035925_1245_1652	135
1451	3300046516	Ga0495628_0063483	Ga0495628_0063483_1918_2325	135
1452	3300046516	Ga0495628_0186817	Ga0495628_0186817_796_1203	135
1453	3300046516	Ga0495628_0630296	Ga0495628_0630296_107_514	135
1454	3300046517	Ga0495630_0004933	Ga0495630_0004933_5784_6191	135
1455	3300046517	Ga0495630_0008348	Ga0495630_0008348_354_764	135
1456	3300046518	Ga0495631_0097076	Ga0495631_0097076_672_1079	135
1457	3300046518	Ga0495631_0521436	Ga0495631_0521436_85_492	135
1458	3300046519	Ga0495632_0143890	Ga0495632_0143890_660_1067	135
1459	3300046519	Ga0495632_0287300	Ga0495632_0287300_296_703	135
1460	3300046519	Ga0495632_0309456	Ga0495632_0309456_239_646	135
1461	3300046520	Ga0495637_0010962	Ga0495637_0010962_476_883	135
1462	3300046520	Ga0495637_0312547	Ga0495637_0312547_124_531	135
1463	3300046522	Ga0495643_0018786	Ga0495643_0018786_3555_3962	135
1464	3300046522	Ga0495643_0043328	Ga0495643_0043328_18_425	135
1465	3300046522	Ga0495643_0109949	Ga0495643_0109949_972_1379	135
1466	3300046522	Ga0495643_0181432	Ga0495643_0181432_508_915	135
1467	3300046522	Ga0495643_0351356	Ga0495643_0351356_206_613	135
1468	3300046523	Ga0495644_0310752	Ga0495644_0310752_123_530	135
1469	3300046524	Ga0495648_0011672	Ga0495648_0011672_2622_3029	135
1470	3300046524	Ga0495648_0096910	Ga0495648_0096910_90_497	135
1471	3300046524	Ga0495648_0111974	Ga0495648_0111974_823_1230	135
1472	3300046524	Ga0495648_0138924	Ga0495648_0138924_289_696	135
1473	3300046524	Ga0495648_0217584	Ga0495648_0217584_24_431	135
1474	3300046524	Ga0495648_0437605	Ga0495648_0437605_110_517	135
1475	3300046526	Ga0495666_0004514	Ga0495666_0004514_5256_5666	135
1476	3300046526	Ga0495666_0008404	Ga0495666_0008404_1555_1962	135
1477	3300046526	Ga0495666_0134877	Ga0495666_0134877_58_465	135
1478	3300046526	Ga0495666_0540916	Ga0495666_0540916_41_448	135
1479	3300046528	Ga0495642_0158825	Ga0495642_0158825_70_477	135
1480	3300046528	Ga0495642_0493035	Ga0495642_0493035_44_451	135
1481	3300046529	Ga0495652_0014455	Ga0495652_0014455_6036_6446	135
1482	3300046529	Ga0495652_0030231	Ga0495652_0030231_3537_3944	135
1483	3300046529	Ga0495652_0039718	Ga0495652_0039718_197_604	135
1484	3300046529	Ga0495652_0122589	Ga0495652_0122589_896_1303	135
1485	3300046529	Ga0495652_0160041	Ga0495652_0160041_866_1273	135
1486	3300046530	Ga0495654_0062998	Ga0495654_0062998_342_749	135
1487	3300046531	Ga0495665_0000335	Ga0495665_0000335_20111_20518	135
1488	3300046531	Ga0495665_0136576	Ga0495665_0136576_145_555	135
1489	3300046531	Ga0495665_0163588	Ga0495665_0163588_727_1134	135
1490	3300046531	Ga0495665_0263061	Ga0495665_0263061_317_814	135
1491	3300046531	Ga0495665_0341238	Ga0495665_0341238_72_479	135
1492	3300046531	Ga0495665_0660963	Ga0495665_0660963_74_481	135
1493	3300046533	Ga0495640_0014548	Ga0495640_0014548_3594_4001	135
1494	3300046533	Ga0495640_0038825	Ga0495640_0038825_2583_2993	135
1495	3300046533	Ga0495640_0122339	Ga0495640_0122339_10_417	135
1496	3300046533	Ga0495640_0177650	Ga0495640_0177650_854_1261	135
1497	3300046533	Ga0495640_0218873	Ga0495640_0218873_621_1028	135
1498	3300046535	Ga0495586_0288426	Ga0495586_0288426_75_482	135
1499	3300046536	Ga0495587_0026010	Ga0495587_0026010_571_978	135
1500	3300046536	Ga0495587_0066559	Ga0495587_0066559_844_1251	135
1501	3300046536	Ga0495587_0275633	Ga0495587_0275633_432_839	135
1502	3300046537	Ga0495598_0079403	Ga0495598_0079403_398_805	135
1503	3300046538	Ga0495609_0065976	Ga0495609_0065976_506_913	135
1504	3300046538	Ga0495609_0194288	Ga0495609_0194288_225_632	135
1505	3300046538	Ga0495609_0276806	Ga0495609_0276806_57_464	135
1506	3300046539	Ga0495621_0025758	Ga0495621_0025758_710_1117	135
1507	3300046539	Ga0495621_0257593	Ga0495621_0257593_27_434	135
1508	3300046542	Ga0495597_0027696	Ga0495597_0027696_425_832	135
1509	3300046542	Ga0495597_0168361	Ga0495597_0168361_456_863	135
1510	3300046542	Ga0495597_0194621	Ga0495597_0194621_254_661	135
1511	3300046542	Ga0495597_0243333	Ga0495597_0243333_46_453	135
1512	3300046543	Ga0495645_0045775	Ga0495645_0045775_821_1228	135
1513	3300046543	Ga0495645_0211526	Ga0495645_0211526_308_715	135
1514	3300046543	Ga0495645_0562723	Ga0495645_0562723_245_652	135
1515	3300046557	Ga0495622_0001947	Ga0495622_0001947_9638_10045	135
1516	3300046557	Ga0495622_0067515	Ga0495622_0067515_834_1241	135
1517	3300046558	Ga0495633_0138360	Ga0495633_0138360_180_587	135
1518	3300046558	Ga0495633_0378099	Ga0495633_0378099_199_606	135
1519	3300046558	Ga0495633_0409760	Ga0495633_0409760_107_514	135
1520	3300046558	Ga0495633_0476920	Ga0495633_0476920_28_435	135
1521	3300046559	Ga0495667_0009421	Ga0495667_0009421_1916_2323	135
1522	3300046559	Ga0495667_0022920	Ga0495667_0022920_2683_3093	135
1523	3300046559	Ga0495667_0044099	Ga0495667_0044099_425_832	135
1524	3300046615	Ga0495656_0071369	Ga0495656_0071369_229_636	135
1525	3300046615	Ga0495656_0184567	Ga0495656_0184567_306_713	135
1526	3300046615	Ga0495656_0207189	Ga0495656_0207189_74_481	135
1527	3300046615	Ga0495656_0298433	Ga0495656_0298433_248_655	135
1528	3300046615	Ga0495656_0325405	Ga0495656_0325405_22_429	135
1529	3300046615	Ga0495656_0381927	Ga0495656_0381927_75_485	135
1530	3300046615	Ga0495656_0571696	Ga0495656_0571696_185_592	135
1531	3300046616	Ga0495668_0090439	Ga0495668_0090439_470_877	135
1532	3300046616	Ga0495668_0161803	Ga0495668_0161803_244_651	135
1533	3300046616	Ga0495668_0211251	Ga0495668_0211251_82_489	135
1534	3300046616	Ga0495668_0214384	Ga0495668_0214384_273_680	135
1535	3300046616	Ga0495668_0217609	Ga0495668_0217609_227_634	135
1536	3300046616	Ga0495668_0265612	Ga0495668_0265612_102_509	135
1537	3300046616	Ga0495668_0360017	Ga0495668_0360017_159_566	135
1538	3300046616	Ga0495668_0392315	Ga0495668_0392315_23_430	135
1539	3300046616	Ga0495668_0432136	Ga0495668_0432136_178_585	135
1540	3300046616	Ga0495668_0586824	Ga0495668_0586824_189_599	135
1541	3300046642	Ga0495634_0001329	Ga0495634_0001329_18360_18767	135
1542	3300046642	Ga0495634_0016816	Ga0495634_0016816_3172_3579	135
1543	3300046642	Ga0495634_0051631	Ga0495634_0051631_1406_1816	135
1544	3300046642	Ga0495634_0125165	Ga0495634_0125165_568_975	135
1545	3300046648	Ga0495611_0109706	Ga0495611_0109706_261_668	135
1546	3300046648	Ga0495611_0118329	Ga0495611_0118329_332_739	135
1547	3300046648	Ga0495611_0216358	Ga0495611_0216358_417_824	135
1548	3300046648	Ga0495611_0310637	Ga0495611_0310637_223_630	135
1549	3300046648	Ga0495611_0538228	Ga0495611_0538228_43_450	135
1550	3300046660	Ga0495625_0019643	Ga0495625_0019643_11_418	135
1551	3300046660	Ga0495625_0088271	Ga0495625_0088271_170_577	135
1552	3300046660	Ga0495625_0124818	Ga0495625_0124818_1000_1407	135
1553	3300046660	Ga0495625_0159303	Ga0495625_0159303_629_1036	135
1554	3300046660	Ga0495625_0266011	Ga0495625_0266011_614_1021	135
1555	3300046660	Ga0495625_0398002	Ga0495625_0398002_367_774	135
1556	3300046660	Ga0495625_0420370	Ga0495625_0420370_95_502	135
1557	3300046660	Ga0495625_0476960	Ga0495625_0476960_220_627	135
1558	3300046663	Ga0495635_0000518	Ga0495635_0000518_20533_20940	135
1559	3300046663	Ga0495635_0001404	Ga0495635_0001404_14612_15022	135
1560	3300046663	Ga0495635_0011167	Ga0495635_0011167_5323_5730	135
1561	3300046663	Ga0495635_0138914	Ga0495635_0138914_216_623	135
1562	3300046663	Ga0495635_0156618	Ga0495635_0156618_865_1272	135
1563	3300046664	Ga0495659_0047807	Ga0495659_0047807_763_1170	135
1564	3300046664	Ga0495659_0061130	Ga0495659_0061130_630_1037	135
1565	3300046664	Ga0495659_0267464	Ga0495659_0267464_280_687	135
1566	3300046664	Ga0495659_0313746	Ga0495659_0313746_185_592	135
1567	3300046665	Ga0495661_0074186	Ga0495661_0074186_254_661	135
1568	3300046665	Ga0495661_0119244	Ga0495661_0119244_869_1276	135
1569	3300046665	Ga0495661_0128311	Ga0495661_0128311_600_1007	135
1570	3300046665	Ga0495661_0207010	Ga0495661_0207010_223_630	135
1571	3300046665	Ga0495661_0586806	Ga0495661_0586806_71_478	135
1572	3300046674	Ga0495588_0002250	Ga0495588_0002250_3663_4070	135
1573	3300046674	Ga0495588_0065754	Ga0495588_0065754_806_1213	135
1574	3300046674	Ga0495588_0073061	Ga0495588_0073061_246_653	135
1575	3300046674	Ga0495588_0150776	Ga0495588_0150776_91_498	135
1576	3300046674	Ga0495588_0224342	Ga0495588_0224342_194_601	135
1577	3300046674	Ga0495588_0226765	Ga0495588_0226765_410_817	135
1578	3300046674	Ga0495588_0392559	Ga0495588_0392559_174_581	135
1579	3300046675	Ga0495657_0017250	Ga0495657_0017250_2850_3257	135
1580	3300046675	Ga0495657_0111853	Ga0495657_0111853_929_1336	135
1581	3300046678	Ga0495599_0000864	Ga0495599_0000864_1965_2372	135
1582	3300046678	Ga0495599_0084157	Ga0495599_0084157_1127_1537	135
1583	3300046678	Ga0495599_0116511	Ga0495599_0116511_895_1302	135
1584	3300046679	Ga0495623_0011322	Ga0495623_0011322_197_604	135
1585	3300046679	Ga0495623_0132837	Ga0495623_0132837_984_1391	135
1586	3300046680	Ga0495646_0004855	Ga0495646_0004855_1897_2304	135
1587	3300046680	Ga0495646_0015726	Ga0495646_0015726_203_610	135
1588	3300046680	Ga0495646_0025588	Ga0495646_0025588_2924_3331	135
1589	3300046680	Ga0495646_0052006	Ga0495646_0052006_546_953	135
1590	3300046680	Ga0495646_0077916	Ga0495646_0077916_1049_1456	135
1591	3300046681	Ga0495647_0000898	Ga0495647_0000898_4415_4822	135
1592	3300046681	Ga0495647_0539489	Ga0495647_0539489_46_453	135
1593	3300046683	Ga0495658_0000201	Ga0495658_0000201_3682_4089	135
1594	3300046683	Ga0495658_0013538	Ga0495658_0013538_2945_3355	135
1595	3300046683	Ga0495658_0115551	Ga0495658_0115551_365_772	135
1596	3300046683	Ga0495658_0143421	Ga0495658_0143421_396_803	135
1597	3300046683	Ga0495658_0157342	Ga0495658_0157342_624_1121	135
1598	3300046683	Ga0495658_0212831	Ga0495658_0212831_695_1102	135
1599	3300046684	Ga0495669_0063750	Ga0495669_0063750_822_1229	135
1600	3300046684	Ga0495669_0119511	Ga0495669_0119511_645_1052	135
1601	3300046684	Ga0495669_0140702	Ga0495669_0140702_85_492	135
1602	3300046684	Ga0495669_0212821	Ga0495669_0212821_246_653	135
1603	3300046684	Ga0495669_0273962	Ga0495669_0273962_11_418	135
1604	3300046684	Ga0495669_0400113	Ga0495669_0400113_169_576	135
1605	3300046684	Ga0495669_0474954	Ga0495669_0474954_159_566	135
1606	3300046689	Ga0495613_0064733	Ga0495613_0064733_342_749	135
1607	3300046689	Ga0495613_0080387	Ga0495613_0080387_705_1112	135
1608	3300046689	Ga0495613_0096940	Ga0495613_0096940_1445_1855	135
1609	3300046689	Ga0495613_0107083	Ga0495613_0107083_454_861	135
1610	3300046690	Ga0495624_0004061	Ga0495624_0004061_4933_5340	135
1611	3300046690	Ga0495624_0008145	Ga0495624_0008145_2035_2445	135
1612	3300046690	Ga0495624_0313914	Ga0495624_0313914_373_870	135
1613	3300046691	Ga0495670_0002080	Ga0495670_0002080_9300_9707	135
1614	3300046691	Ga0495670_0092856	Ga0495670_0092856_845_1252	135
1615	3300046691	Ga0495670_0250208	Ga0495670_0250208_487_894	135
1616	3300046692	Ga0495671_0032211	Ga0495671_0032211_447_854	135
1617	3300046692	Ga0495671_0171447	Ga0495671_0171447_110_517	135
1618	3300046692	Ga0495671_0249158	Ga0495671_0249158_257_664	135
1619	3300046694	Ga0495649_0140129	Ga0495649_0140129_482_889	135
1620	3300046694	Ga0495649_0157812	Ga0495649_0157812_444_851	135
1621	3300046794	Ga0495589_0102605	Ga0495589_0102605_241_648	135
1622	3300046794	Ga0495589_0171157	Ga0495589_0171157_536_943	135
1623	3300046794	Ga0495589_0251816	Ga0495589_0251816_305_712	135
1624	3300046809	Ga0495600_0007464	Ga0495600_0007464_4293_4700	135
1625	3300046809	Ga0495600_0041357	Ga0495600_0041357_490_900	135
1626	3300046809	Ga0495600_0367707	Ga0495600_0367707_362_769	135
1627	3300046810	Ga0495660_0045293	Ga0495660_0045293_351_758	135
1628	3300047315	Ga0495581_0000030	Ga0495581_0000030_3401_3808	135
1629	3300047315	Ga0495581_0004004	Ga0495581_0004004_7077_7487	135
1630	3300047315	Ga0495581_0019116	Ga0495581_0019116_904_1311	135
1631	3300047315	Ga0495581_0137138	Ga0495581_0137138_647_1054	135
1632	3300047315	Ga0495581_0702313	Ga0495581_0702313_60_467	135
1633	3300047317	Ga0495604_0007603	Ga0495604_0007603_4743_5150	135
1634	3300047317	Ga0495604_0040542	Ga0495604_0040542_2174_2581	135
1635	3300047317	Ga0495604_0070465	Ga0495604_0070465_1262_1672	135
1636	3300047317	Ga0495604_0146773	Ga0495604_0146773_726_1133	135
1637	3300047317	Ga0495604_0395829	Ga0495604_0395829_51_458	135
1638	3300047318	Ga0495636_0400137	Ga0495636_0400137_214_621	135
1639	3300047319	Ga0495674_0002494	Ga0495674_0002494_17488_17895	135
1640	3300047319	Ga0495674_0032588	Ga0495674_0032588_1855_2262	135
1641	3300047319	Ga0495674_0034870	Ga0495674_0034870_685_1092	135
1642	3300047319	Ga0495674_0086794	Ga0495674_0086794_151_561	135
1643	3300047319	Ga0495674_0431287	Ga0495674_0431287_196_603	135
1644	3300047319	Ga0495674_0493124	Ga0495674_0493124_324_731	135
1645	3300047319	Ga0495674_0615556	Ga0495674_0615556_181_588	135
1646	3300047319	Ga0495674_0856616	Ga0495674_0856616_287_694	135
1647	3300047319	Ga0495674_0891731	Ga0495674_0891731_267_674	135
1648	3300047320	Ga0495672_0020587	Ga0495672_0020587_2127_2534	135
1649	3300047321	Ga0495676_0005339	Ga0495676_0005339_8287_8694	135
1650	3300047321	Ga0495676_0264151	Ga0495676_0264151_746_1153	135
1651	3300047321	Ga0495676_0724794	Ga0495676_0724794_220_630	135
1652	3300047321	Ga0495676_0730983	Ga0495676_0730983_118_525	135
1653	3300047322	Ga0495680_0003293	Ga0495680_0003293_10005_10415	135
1654	3300047322	Ga0495680_0008680	Ga0495680_0008680_6874_7281	135
1655	3300047322	Ga0495680_0099032	Ga0495680_0099032_706_1113	135
1656	3300047322	Ga0495680_0207402	Ga0495680_0207402_803_1210	135
1657	3300047322	Ga0495680_0781699	Ga0495680_0781699_98_505	135
1658	3300047323	Ga0495683_0172077	Ga0495683_0172077_345_752	135
1659	3300047444	Ga0495675_0005139	Ga0495675_0005139_1998_2405	135
1660	3300047444	Ga0495675_0069208	Ga0495675_0069208_1633_2040	135
1661	3300047444	Ga0495675_0204753	Ga0495675_0204753_649_1059	135
1662	3300047444	Ga0495675_0494352	Ga0495675_0494352_168_575	135
1663	3300047445	Ga0495677_0182092	Ga0495677_0182092_315_722	135
1664	3300047447	Ga0495685_045914	Ga0495685_045914_1052_1459	135
1665	3300047447	Ga0495685_273135	Ga0495685_273135_77_484	135
1666	3300047469	Ga0495673_0216856	Ga0495673_0216856_14_421	135
1667	3300047469	Ga0495673_0217865	Ga0495673_0217865_251_658	135
1668	3300047470	Ga0495681_0169213	Ga0495681_0169213_172_579	135
1669	3300047470	Ga0495681_0224257	Ga0495681_0224257_58_465	135
1670	3300047471	Ga0495684_0000443	Ga0495684_0000443_28099_28509	135
1671	3300047471	Ga0495684_0033847	Ga0495684_0033847_2074_2481	135
1672	3300047471	Ga0495684_0082047	Ga0495684_0082047_1744_2151	135
1673	3300047471	Ga0495684_0129176	Ga0495684_0129176_533_940	135
1674	3300047472	Ga0495686_0207801	Ga0495686_0207801_64_471	135
1675	3300047472	Ga0495686_0302571	Ga0495686_0302571_395_802	135
1676	3300047472	Ga0495686_0719611	Ga0495686_0719611_53_460	135
1677	3300047673	Ga0495593_0000398	Ga0495593_0000398_1175_1582	135
1678	3300047673	Ga0495593_0001302	Ga0495593_0001302_5247_5657	135
1679	3300047673	Ga0495593_0007661	Ga0495593_0007661_1953_2360	135
1680	3300047673	Ga0495593_0289984	Ga0495593_0289984_386_793	135
1681	3300047673	Ga0495593_0368698	Ga0495593_0368698_109_516	135
1682	3300048088	Ga0495602_0063578	Ga0495602_0063578_197_604	135
1683	3300048088	Ga0495602_0113402	Ga0495602_0113402_1528_1935	135
1684	3300048088	Ga0495602_0115512	Ga0495602_0115512_565_972	135
1685	3300048088	Ga0495602_0186355	Ga0495602_0186355_213_623	135
1686	3300048088	Ga0495602_0272624	Ga0495602_0272624_664_1071	135
1687	3300048089	Ga0495614_0007180	Ga0495614_0007180_250_657	135
1688	3300048089	Ga0495614_0142559	Ga0495614_0142559_213_623	135
1689	3300048090	Ga0495615_0041157	Ga0495615_0041157_459_866	135
1690	3300048091	Ga0495626_0060081	Ga0495626_0060081_467_874	135
1691	3300048091	Ga0495626_0189854	Ga0495626_0189854_393_800	135
1692	3300048903	Ga0496100_0003200	Ga0496100_0003200_6019_6426	135
1693	3300048903	Ga0496100_0180266	Ga0496100_0180266_444_851	135
1694	3300048903	Ga0496100_0291799	Ga0496100_0291799_338_745	135
1695	3300048903	Ga0496100_0350334	Ga0496100_0350334_59_466	135
1696	3300048903	Ga0496100_0452089	Ga0496100_0452089_324_731	135
1697	3300048903	Ga0496100_0784322	Ga0496100_0784322_110_517	135
1698	3300048904	Ga0496101_0095143	Ga0496101_0095143_332_739	135
1699	3300048904	Ga0496101_0255340	Ga0496101_0255340_824_1231	135
1700	3300048904	Ga0496101_0614051	Ga0496101_0614051_248_655	135
1701	3300048904	Ga0496101_1018838	Ga0496101_1018838_88_495	135
1702	3300048904	Ga0496101_1329957	Ga0496101_1329957_83_490	135
1703	3300048904	Ga0496101_1461599	Ga0496101_1461599_77_484	135
1704	3300048904	Ga0496101_1552262	Ga0496101_1552262_60_467	135
1705	3300048905	Ga0496102_0024304	Ga0496102_0024304_3304_3711	135
1706	3300048905	Ga0496102_0025407	Ga0496102_0025407_390_797	135
1707	3300048905	Ga0496102_0256926	Ga0496102_0256926_236_643	135
1708	3300048905	Ga0496102_0383546	Ga0496102_0383546_196_603	135
1709	3300048905	Ga0496102_0416889	Ga0496102_0416889_385_792	135
1710	3300048905	Ga0496102_0562768	Ga0496102_0562768_339_746	135
1711	3300048905	Ga0496102_0879904	Ga0496102_0879904_324_731	135
1712	3300048905	Ga0496102_1101015	Ga0496102_1101015_215_622	135
1713	3300048905	Ga0496102_1221211	Ga0496102_1221211_218_625	135
1714	3300048906	Ga0496103_0005956	Ga0496103_0005956_2470_2877	135
1715	3300048906	Ga0496103_0050459	Ga0496103_0050459_247_654	135
1716	3300048906	Ga0496103_0165748	Ga0496103_0165748_948_1355	135
1717	3300048906	Ga0496103_0318074	Ga0496103_0318074_369_776	135
1718	3300048906	Ga0496103_0816729	Ga0496103_0816729_32_439	135
1719	3300048907	Ga0496104_0012106	Ga0496104_0012106_794_1201	135
1720	3300048907	Ga0496104_0013995	Ga0496104_0013995_212_619	135
1721	3300048907	Ga0496104_0036739	Ga0496104_0036739_3919_4326	135
1722	3300048907	Ga0496104_0069915	Ga0496104_0069915_660_1067	135
1723	3300048907	Ga0496104_0089449	Ga0496104_0089449_1212_1619	135
1724	3300048907	Ga0496104_0169373	Ga0496104_0169373_1131_1538	135
1725	3300048907	Ga0496104_0763695	Ga0496104_0763695_173_580	135
1726	3300048907	Ga0496104_0850553	Ga0496104_0850553_103_510	135
1727	3300048908	Ga0496105_0010197	Ga0496105_0010197_6156_6563	135
1728	3300048908	Ga0496105_0012045	Ga0496105_0012045_5273_5680	135
1729	3300048908	Ga0496105_0083586	Ga0496105_0083586_1188_1595	135
1730	3300048908	Ga0496105_0093999	Ga0496105_0093999_359_766	135
1731	3300048908	Ga0496105_0301826	Ga0496105_0301826_380_787	135
1732	3300048908	Ga0496105_0431587	Ga0496105_0431587_89_496	135
1733	3300048908	Ga0496105_0649206	Ga0496105_0649206_92_499	135
1734	3300048908	Ga0496105_0996296	Ga0496105_0996296_91_498	135
1735	3300048909	Ga0496106_0001851	Ga0496106_0001851_11667_12074	135
1736	3300048909	Ga0496106_0016837	Ga0496106_0016837_248_655	135
1737	3300048909	Ga0496106_0025338	Ga0496106_0025338_524_931	135
1738	3300048909	Ga0496106_0026040	Ga0496106_0026040_2671_3078	135
1739	3300048909	Ga0496106_0040309	Ga0496106_0040309_259_666	135
1740	3300048909	Ga0496106_0176784	Ga0496106_0176784_509_916	135
1741	3300048909	Ga0496106_0388231	Ga0496106_0388231_141_548	135
1742	3300048909	Ga0496106_0880850	Ga0496106_0880850_265_672	135
1743	3300048909	Ga0496106_0953236	Ga0496106_0953236_176_634	135
1744	3300048909	Ga0496106_0965337	Ga0496106_0965337_199_606	135
1745	3300048910	Ga0496107_0006358	Ga0496107_0006358_3969_4376	135
1746	3300048910	Ga0496107_0060582	Ga0496107_0060582_1717_2124	135
1747	3300048910	Ga0496107_0187995	Ga0496107_0187995_854_1261	135
1748	3300048910	Ga0496107_0207448	Ga0496107_0207448_444_902	135
1749	3300048910	Ga0496107_0208573	Ga0496107_0208573_366_773	135
1750	3300048910	Ga0496107_0459162	Ga0496107_0459162_91_498	135
1751	3300048910	Ga0496107_0772129	Ga0496107_0772129_42_449	135
1752	3300048911	Ga0496108_0000160	Ga0496108_0000160_30864_31271	135
1753	3300048911	Ga0496108_0018787	Ga0496108_0018787_2593_3000	135
1754	3300048911	Ga0496108_0019419	Ga0496108_0019419_4930_5337	135
1755	3300048911	Ga0496108_0098892	Ga0496108_0098892_583_990	135
1756	3300048911	Ga0496108_0108645	Ga0496108_0108645_905_1312	135
1757	3300048911	Ga0496108_0376146	Ga0496108_0376146_357_764	135
1758	3300048911	Ga0496108_0980996	Ga0496108_0980996_221_628	135
1759	3300048912	Ga0496109_0000245	Ga0496109_0000245_21866_22273	135
1760	3300048912	Ga0496109_0036133	Ga0496109_0036133_3206_3613	135
1761	3300048912	Ga0496109_0078426	Ga0496109_0078426_2337_2744	135
1762	3300048912	Ga0496109_0139732	Ga0496109_0139732_1145_1552	135
1763	3300048912	Ga0496109_0144865	Ga0496109_0144865_1175_1582	135
1764	3300048912	Ga0496109_0393011	Ga0496109_0393011_698_1105	135
1765	3300048912	Ga0496109_0426233	Ga0496109_0426233_506_913	135
1766	3300048912	Ga0496109_0726517	Ga0496109_0726517_477_884	135
1767	3300048912	Ga0496109_1020482	Ga0496109_1020482_14_421	135
1768	3300048912	Ga0496109_1049748	Ga0496109_1049748_287_694	135
1769	3300048912	Ga0496109_1457658	Ga0496109_1457658_100_507	135
1770	3300048913	Ga0496110_0029630	Ga0496110_0029630_636_1043	135
1771	3300048913	Ga0496110_0030585	Ga0496110_0030585_1296_1703	135
1772	3300048913	Ga0496110_0115649	Ga0496110_0115649_711_1118	135
1773	3300048913	Ga0496110_0125327	Ga0496110_0125327_1744_2151	135
1774	3300048913	Ga0496110_0164108	Ga0496110_0164108_37_444	135
1775	3300048913	Ga0496110_0164405	Ga0496110_0164405_514_921	135
1776	3300048913	Ga0496110_0261535	Ga0496110_0261535_249_656	135
1777	3300048913	Ga0496110_0262408	Ga0496110_0262408_667_1074	135
1778	3300048913	Ga0496110_0326128	Ga0496110_0326128_375_782	135
1779	3300048913	Ga0496110_0385985	Ga0496110_0385985_573_980	135
1780	3300048914	Ga0496111_0056778	Ga0496111_0056778_1376_1786	135
1781	3300048914	Ga0496111_0095529	Ga0496111_0095529_406_813	135
1782	3300048914	Ga0496111_0139329	Ga0496111_0139329_851_1258	135
1783	3300048914	Ga0496111_0203990	Ga0496111_0203990_696_1103	135
1784	3300048914	Ga0496111_0211141	Ga0496111_0211141_546_953	135
1785	3300048914	Ga0496111_0233752	Ga0496111_0233752_723_1130	135
1786	3300048914	Ga0496111_0589097	Ga0496111_0589097_17_424	135
1787	3300048915	Ga0496112_0000018	Ga0496112_0000018_126397_126804	135
1788	3300048915	Ga0496112_0016551	Ga0496112_0016551_2904_3311	135
1789	3300048915	Ga0496112_0039552	Ga0496112_0039552_3591_3998	135
1790	3300048915	Ga0496112_0061102	Ga0496112_0061102_977_1384	135
1791	3300048915	Ga0496112_0063989	Ga0496112_0063989_2379_2786	135
1792	3300048915	Ga0496112_0086140	Ga0496112_0086140_690_1097	135
1793	3300048915	Ga0496112_0168495	Ga0496112_0168495_35_442	135
1794	3300048915	Ga0496112_0173916	Ga0496112_0173916_1166_1573	135
1795	3300048915	Ga0496112_0183644	Ga0496112_0183644_1325_1732	135
1796	3300048915	Ga0496112_0297913	Ga0496112_0297913_676_1083	135
1797	3300048916	Ga0496113_0004682	Ga0496113_0004682_7074_7481	135
1798	3300048916	Ga0496113_0020664	Ga0496113_0020664_2574_2981	135
1799	3300048916	Ga0496113_0043202	Ga0496113_0043202_2699_3106	135
1800	3300048916	Ga0496113_0052142	Ga0496113_0052142_2301_2708	135
1801	3300048916	Ga0496113_0163322	Ga0496113_0163322_1069_1476	135
1802	3300048917	Ga0496114_0037094	Ga0496114_0037094_259_666	135
1803	3300048917	Ga0496114_0063203	Ga0496114_0063203_716_1123	135
1804	3300048917	Ga0496114_0103092	Ga0496114_0103092_1498_1905	135
1805	3300048917	Ga0496114_0127875	Ga0496114_0127875_344_751	135
1806	3300048917	Ga0496114_0170747	Ga0496114_0170747_753_1160	135
1807	3300048917	Ga0496114_0305941	Ga0496114_0305941_254_661	135
1808	3300048917	Ga0496114_1413889	Ga0496114_1413889_58_465	135
1809	3300048917	Ga0496114_1431499	Ga0496114_1431499_161_568	135
1810	3300048917	Ga0496114_1569964	Ga0496114_1569964_93_500	135
1811	3300048918	Ga0496115_0000743	Ga0496115_0000743_4338_4745	135
1812	3300048918	Ga0496115_0023941	Ga0496115_0023941_1418_1825	135
1813	3300048918	Ga0496115_0025011	Ga0496115_0025011_3985_4392	135
1814	3300048918	Ga0496115_0060211	Ga0496115_0060211_2289_2696	135
1815	3300048918	Ga0496115_0067632	Ga0496115_0067632_2388_2795	135
1816	3300048918	Ga0496115_0105644	Ga0496115_0105644_1629_2036	135
1817	3300048918	Ga0496115_0131184	Ga0496115_0131184_1012_1419	135
1818	3300048918	Ga0496115_0144191	Ga0496115_0144191_1022_1429	135
1819	3300048918	Ga0496115_0212612	Ga0496115_0212612_560_967	135
1820	3300048918	Ga0496115_0465866	Ga0496115_0465866_352_759	135
1821	3300048919	Ga0496116_0001672	Ga0496116_0001672_13268_13675	135
1822	3300048919	Ga0496116_0024410	Ga0496116_0024410_1861_2268	135
1823	3300048919	Ga0496116_0134194	Ga0496116_0134194_178_585	135
1824	3300048920	Ga0496117_0031287	Ga0496117_0031287_3595_4002	135
1825	3300048920	Ga0496117_0039954	Ga0496117_0039954_152_559	135
1826	3300048920	Ga0496117_0040333	Ga0496117_0040333_2346_2753	135
1827	3300048920	Ga0496117_0087728	Ga0496117_0087728_65_472	135
1828	3300048920	Ga0496117_0142560	Ga0496117_0142560_395_802	135
1829	3300048920	Ga0496117_0150803	Ga0496117_0150803_181_588	135
1830	3300048920	Ga0496117_0151944	Ga0496117_0151944_676_1083	135
1831	3300048920	Ga0496117_0203429	Ga0496117_0203429_103_510	135
1832	3300048921	Ga0496118_0033123	Ga0496118_0033123_127_534	135
1833	3300048921	Ga0496118_0050095	Ga0496118_0050095_665_1072	135
1834	3300048921	Ga0496118_0052897	Ga0496118_0052897_2007_2414	135
1835	3300048921	Ga0496118_0058237	Ga0496118_0058237_662_1069	135
1836	3300048921	Ga0496118_0080213	Ga0496118_0080213_241_648	135
1837	3300048921	Ga0496118_0082163	Ga0496118_0082163_1681_2088	135
1838	3300048921	Ga0496118_0176592	Ga0496118_0176592_850_1257	135
1839	3300048921	Ga0496118_0259722	Ga0496118_0259722_457_864	135
1840	3300048921	Ga0496118_0298241	Ga0496118_0298241_241_648	135
1841	3300048921	Ga0496118_0411815	Ga0496118_0411815_222_629	135
1842	3300048921	Ga0496118_0459630	Ga0496118_0459630_38_445	135
1843	3300048922	Ga0496119_0064683	Ga0496119_0064683_575_982	135
1844	3300048922	Ga0496119_0192849	Ga0496119_0192849_95_502	135
1845	3300048922	Ga0496119_0359174	Ga0496119_0359174_106_513	135
1846	3300048922	Ga0496119_0470318	Ga0496119_0470318_109_516	135
1847	3300048923	Ga0496120_0122565	Ga0496120_0122565_310_717	135
1848	3300048923	Ga0496120_0229224	Ga0496120_0229224_237_644	135
1849	3300048924	Ga0496121_0000278	Ga0496121_0000278_68003_68410	135
1850	3300048924	Ga0496121_0000811	Ga0496121_0000811_29965_30375	135
1851	3300048924	Ga0496121_0000870	Ga0496121_0000870_44537_44944	135
1852	3300048924	Ga0496121_0013765	Ga0496121_0013765_5214_5621	135
1853	3300048924	Ga0496121_0023451	Ga0496121_0023451_1052_1459	135
1854	3300048924	Ga0496121_0025005	Ga0496121_0025005_563_970	135
1855	3300048924	Ga0496121_0040752	Ga0496121_0040752_249_656	135
1856	3300048924	Ga0496121_0042369	Ga0496121_0042369_350_757	135
1857	3300048924	Ga0496121_0042659	Ga0496121_0042659_2250_2657	135
1858	3300048924	Ga0496121_0043491	Ga0496121_0043491_3053_3460	135
1859	3300048924	Ga0496121_0045861	Ga0496121_0045861_821_1228	135
1860	3300048924	Ga0496121_0046013	Ga0496121_0046013_2188_2595	135
1861	3300048924	Ga0496121_0055430	Ga0496121_0055430_407_814	135
1862	3300048924	Ga0496121_0078142	Ga0496121_0078142_228_635	135
1863	3300048924	Ga0496121_0155193	Ga0496121_0155193_218_625	135
1864	3300048924	Ga0496121_0324600	Ga0496121_0324600_38_496	135
1865	3300048924	Ga0496121_0394661	Ga0496121_0394661_133_540	135
1866	3300048925	Ga0496122_0016548	Ga0496122_0016548_2554_2961	135
1867	3300048925	Ga0496122_0038783	Ga0496122_0038783_2580_2987	135
1868	3300048926	Ga0496123_0010686	Ga0496123_0010686_2905_3312	135
1869	3300048926	Ga0496123_0454382	Ga0496123_0454382_34_441	135
1870	3300048927	Ga0496124_0001369	Ga0496124_0001369_12402_12809	135
1871	3300048927	Ga0496124_0030723	Ga0496124_0030723_568_975	135
1872	3300048927	Ga0496124_0038984	Ga0496124_0038984_3026_3433	135
1873	3300048927	Ga0496124_0075956	Ga0496124_0075956_1659_2066	135
1874	3300048927	Ga0496124_0085207	Ga0496124_0085207_764_1171	135
1875	3300048927	Ga0496124_0090096	Ga0496124_0090096_1710_2117	135
1876	3300048927	Ga0496124_0172139	Ga0496124_0172139_605_1012	135
1877	3300048927	Ga0496124_0261499	Ga0496124_0261499_410_817	135
1878	3300048928	Ga0496125_0006423	Ga0496125_0006423_3039_3446	135
1879	3300048928	Ga0496125_0012675	Ga0496125_0012675_1895_2302	135
1880	3300048928	Ga0496125_0013674	Ga0496125_0013674_2270_2677	135
1881	3300048928	Ga0496125_0041291	Ga0496125_0041291_2806_3213	135
1882	3300048928	Ga0496125_0109451	Ga0496125_0109451_825_1232	135
1883	3300048928	Ga0496125_0168803	Ga0496125_0168803_442_849	135
1884	3300048928	Ga0496125_0433232	Ga0496125_0433232_74_481	135
1885	3300048928	Ga0496125_0469928	Ga0496125_0469928_295_702	135
1886	3300048928	Ga0496125_0618542	Ga0496125_0618542_37_444	135
1887	3300048929	Ga0496126_0010955	Ga0496126_0010955_358_816	135
1888	3300048929	Ga0496126_0021504	Ga0496126_0021504_5457_5864	135
1889	3300048929	Ga0496126_0026976	Ga0496126_0026976_3823_4281	135
1890	3300048929	Ga0496126_0034893	Ga0496126_0034893_2025_2432	135
1891	3300048929	Ga0496126_0036595	Ga0496126_0036595_849_1256	135
1892	3300048929	Ga0496126_0051819	Ga0496126_0051819_2609_3067	135
1893	3300048929	Ga0496126_0051928	Ga0496126_0051928_2382_2789	135
1894	3300048929	Ga0496126_0054828	Ga0496126_0054828_974_1381	135
1895	3300048929	Ga0496126_0075226	Ga0496126_0075226_471_878	135
1896	3300048929	Ga0496126_0104783	Ga0496126_0104783_1078_1485	135
1897	3300048929	Ga0496126_0227420	Ga0496126_0227420_501_908	135
1898	3300048929	Ga0496126_0261123	Ga0496126_0261123_325_732	135
1899	3300048929	Ga0496126_0277050	Ga0496126_0277050_565_972	135
1900	3300048929	Ga0496126_0320809	Ga0496126_0320809_431_838	135
1901	3300048929	Ga0496126_0322885	Ga0496126_0322885_22_429	135
1902	3300048929	Ga0496126_0517407	Ga0496126_0517407_417_824	135
1903	3300048929	Ga0496126_0786254	Ga0496126_0786254_300_707	135
1904	3300048929	Ga0496126_0794248	Ga0496126_0794248_95_502	135
1905	3300048929	Ga0496126_0800993	Ga0496126_0800993_289_696	135
1906	3300048929	Ga0496126_0841782	Ga0496126_0841782_134_541	135
1907	3300049459	Ga0495678_077588	Ga0495678_077588_355_762	135
1908	3300049460	Ga0495682_0010624	Ga0495682_0010624_970_1377	135
1909	3300049460	Ga0495682_0116364	Ga0495682_0116364_503_910	135
1910	3300049460	Ga0495682_0207679	Ga0495682_0207679_269_676	135
1911	3300049568	Ga0501031_0016862	Ga0501031_0016862_2183_2590	135
1912	3300049568	Ga0501031_0087420	Ga0501031_0087420_236_643	135
1913	3300049568	Ga0501031_0322841	Ga0501031_0322841_250_657	135
1914	3300049568	Ga0501031_0399651	Ga0501031_0399651_109_519	135
1915	3300049568	Ga0501031_0743731	Ga0501031_0743731_165_578	135
1916	3300049569	Ga0501032_0004480	Ga0501032_0004480_5569_5976	135
1917	3300049569	Ga0501032_0026131	Ga0501032_0026131_3071_3478	135
1918	3300049569	Ga0501032_0126827	Ga0501032_0126827_337_744	135
1919	3300049569	Ga0501032_0265530	Ga0501032_0265530_391_798	135
1920	3300049569	Ga0501032_0292112	Ga0501032_0292112_255_662	135
1921	3300049569	Ga0501032_1068724	Ga0501032_1068724_56_466	135
1922	3300049570	Ga0501033_0000075	Ga0501033_0000075_88792_89199	135
1923	3300049570	Ga0501033_0000221	Ga0501033_0000221_23042_23449	135
1924	3300049570	Ga0501033_0044140	Ga0501033_0044140_853_1266	135
1925	3300049570	Ga0501033_0127352	Ga0501033_0127352_734_1144	135
1926	3300049570	Ga0501033_0206329	Ga0501033_0206329_609_1016	135
1927	3300049570	Ga0501033_0445602	Ga0501033_0445602_264_674	135
1928	3300049570	Ga0501033_0476079	Ga0501033_0476079_307_762	135
1929	3300049570	Ga0501033_0762969	Ga0501033_0762969_198_605	135
1930	3300049570	Ga0501033_0812761	Ga0501033_0812761_11_418	135
1931	3300049570	Ga0501033_0986160	Ga0501033_0986160_44_454	135
1932	3300049571	Ga0501034_0000577	Ga0501034_0000577_52106_52513	135
1933	3300049571	Ga0501034_0103566	Ga0501034_0103566_535_942	135
1934	3300049571	Ga0501034_0103619	Ga0501034_0103619_2308_2763	135
1935	3300049571	Ga0501034_0368658	Ga0501034_0368658_640_1053	135
1936	3300049571	Ga0501034_1113073	Ga0501034_1113073_60_467	135
1937	3300049571	Ga0501034_1173448	Ga0501034_1173448_26_436	135
1938	3300049572	Ga0501036_0000501	Ga0501036_0000501_24147_24554	135
1939	3300049572	Ga0501036_0047402	Ga0501036_0047402_2563_2970	135
1940	3300049572	Ga0501036_0060559	Ga0501036_0060559_1025_1432	135
1941	3300049572	Ga0501036_0111077	Ga0501036_0111077_633_1040	135
1942	3300049572	Ga0501036_0126277	Ga0501036_0126277_334_747	135
1943	3300049572	Ga0501036_0211646	Ga0501036_0211646_318_728	135
1944	3300049572	Ga0501036_0389785	Ga0501036_0389785_158_565	135
1945	3300049572	Ga0501036_0886921	Ga0501036_0886921_256_663	135
1946	3300049573	Ga0501037_0001671	Ga0501037_0001671_9279_9686	135
1947	3300049573	Ga0501037_0002452	Ga0501037_0002452_9008_9415	135
1948	3300049573	Ga0501037_0107640	Ga0501037_0107640_267_674	135
1949	3300049573	Ga0501037_0120323	Ga0501037_0120323_731_1144	135
1950	3300049573	Ga0501037_0738508	Ga0501037_0738508_95_505	135
1951	3300049574	Ga0501038_0005180	Ga0501038_0005180_8664_9071	135
1952	3300049574	Ga0501038_0010565	Ga0501038_0010565_4616_5023	135
1953	3300049574	Ga0501038_0019649	Ga0501038_0019649_966_1373	135
1954	3300049574	Ga0501038_0229344	Ga0501038_0229344_732_1145	135
1955	3300049574	Ga0501038_0280253	Ga0501038_0280253_19_426	135
1956	3300049574	Ga0501038_0590072	Ga0501038_0590072_39_449	135
1957	3300049575	Ga0501039_0012996	Ga0501039_0012996_3420_3827	135
1958	3300049575	Ga0501039_0014098	Ga0501039_0014098_2140_2547	135
1959	3300049575	Ga0501039_0134184	Ga0501039_0134184_161_568	135
1960	3300049575	Ga0501039_0360995	Ga0501039_0360995_329_739	135
1961	3300049575	Ga0501039_0426541	Ga0501039_0426541_289_696	135
1962	3300049576	Ga0501040_0793043	Ga0501040_0793043_255_662	135
1963	3300049577	Ga0501041_0284692	Ga0501041_0284692_321_728	135
1964	3300049578	Ga0501042_0089213	Ga0501042_0089213_1571_1978	135
1965	3300049578	Ga0501042_0749738	Ga0501042_0749738_266_673	135
1966	3300049579	Ga0501043_0000017	Ga0501043_0000017_150795_151202	135
1967	3300049579	Ga0501043_0035578	Ga0501043_0035578_1723_2130	135
1968	3300049579	Ga0501043_0170995	Ga0501043_0170995_415_825	135
1969	3300049579	Ga0501043_0631457	Ga0501043_0631457_79_486	135
1970	3300049579	Ga0501043_0649959	Ga0501043_0649959_134_547	135
1971	3300049579	Ga0501043_0790328	Ga0501043_0790328_52_459	135
1972	3300049580	Ga0501046_0001421	Ga0501046_0001421_20729_21136	135
1973	3300049580	Ga0501046_0029646	Ga0501046_0029646_118_531	135
1974	3300049580	Ga0501046_0064208	Ga0501046_0064208_38_445	135
1975	3300049580	Ga0501046_0289351	Ga0501046_0289351_289_696	135
1976	3300049580	Ga0501046_0552765	Ga0501046_0552765_10_417	135
1977	3300049580	Ga0501046_0925603	Ga0501046_0925603_96_503	135
1978	3300049581	Ga0501047_0002585	Ga0501047_0002585_11471_11878	135
1979	3300049581	Ga0501047_0034064	Ga0501047_0034064_552_959	135
1980	3300049581	Ga0501047_0148494	Ga0501047_0148494_414_827	135
1981	3300049581	Ga0501047_0214486	Ga0501047_0214486_102_509	135
1982	3300049581	Ga0501047_0381190	Ga0501047_0381190_45_452	135
1983	3300049581	Ga0501047_1018090	Ga0501047_1018090_206_613	135
1984	3300049581	Ga0501047_1101112	Ga0501047_1101112_85_495	135
1985	3300049582	Ga0501048_0022007	Ga0501048_0022007_761_1168	135
1986	3300049582	Ga0501048_0294464	Ga0501048_0294464_401_808	135
1987	3300049583	Ga0501067_0000120	Ga0501067_0000120_24560_24967	135
1988	3300049583	Ga0501067_0067681	Ga0501067_0067681_696_1103	135
1989	3300049583	Ga0501067_0071550	Ga0501067_0071550_754_1212	135
1990	3300049583	Ga0501067_0250947	Ga0501067_0250947_232_639	135
1991	3300049584	Ga0501068_0001605	Ga0501068_0001605_10836_11243	135
1992	3300049585	Ga0501069_0001241	Ga0501069_0001241_6059_6466	135
1993	3300049585	Ga0501069_0255729	Ga0501069_0255729_381_788	135
1994	3300049585	Ga0501069_1008257	Ga0501069_1008257_68_475	135
1995	3300049586	Ga0501070_0006393	Ga0501070_0006393_4109_4516	135
1996	3300049586	Ga0501070_0046606	Ga0501070_0046606_289_696	135
1997	3300049586	Ga0501070_0072035	Ga0501070_0072035_1514_1921	135
1998	3300049586	Ga0501070_0240160	Ga0501070_0240160_241_654	135
1999	3300049586	Ga0501070_0268333	Ga0501070_0268333_646_1053	135
2000	3300049586	Ga0501070_0492774	Ga0501070_0492774_226_636	135
2001	3300049586	Ga0501070_0557877	Ga0501070_0557877_11_418	135
2002	3300049586	Ga0501070_1337962	Ga0501070_1337962_95_505	135
2003	3300049587	Ga0501071_0157749	Ga0501071_0157749_841_1248	135
2004	3300049587	Ga0501071_0238933	Ga0501071_0238933_661_1068	135
2005	3300049588	Ga0501072_0005645	Ga0501072_0005645_590_997	135
2006	3300049589	Ga0501073_0010113	Ga0501073_0010113_6171_6578	135
2007	3300049589	Ga0501073_0032902	Ga0501073_0032902_2909_3316	135
2008	3300049589	Ga0501073_0192067	Ga0501073_0192067_619_1026	135
2009	3300049589	Ga0501073_0685854	Ga0501073_0685854_115_528	135
2010	3300049590	Ga0501074_0000055	Ga0501074_0000055_18731_19138	135
2011	3300049590	Ga0501074_0067103	Ga0501074_0067103_1365_1772	135
2012	3300049590	Ga0501074_0136932	Ga0501074_0136932_649_1056	135
2013	3300049590	Ga0501074_0713133	Ga0501074_0713133_244_651	135
2014	3300049592	Ga0501076_0468787	Ga0501076_0468787_61_468	135
2015	3300049593	Ga0501077_1149522	Ga0501077_1149522_25_432	135
2016	3300049741	Ga0501079_0002378	Ga0501079_0002378_801_1208	135
2017	3300049741	Ga0501079_0382258	Ga0501079_0382258_263_670	135
2018	3300049742	Ga0501080_0001422	Ga0501080_0001422_5974_6381	135
2019	3300049742	Ga0501080_0003985	Ga0501080_0003985_9041_9448	135
2020	3300049742	Ga0501080_0058337	Ga0501080_0058337_2491_2898	135
2021	3300049742	Ga0501080_0084618	Ga0501080_0084618_289_696	135
2022	3300049742	Ga0501080_0377448	Ga0501080_0377448_686_1093	135
2023	3300049742	Ga0501080_0537233	Ga0501080_0537233_263_670	135
2024	3300049742	Ga0501080_0707109	Ga0501080_0707109_167_574	135
2025	3300049743	Ga0501081_1359440	Ga0501081_1359440_61_468	135
2026	3300049744	Ga0501083_0005528	Ga0501083_0005528_930_1337	135
2027	3300049744	Ga0501083_0171400	Ga0501083_0171400_633_1040	135
2028	3300049744	Ga0501083_0691453	Ga0501083_0691453_70_483	135
2029	3300049822	Ga0501035_0000123	Ga0501035_0000123_13658_14065	135
2030	3300049822	Ga0501035_0006891	Ga0501035_0006891_2736_3143	135
2031	3300049822	Ga0501035_0078828	Ga0501035_0078828_1926_2396	135
2032	3300049822	Ga0501035_0140460	Ga0501035_0140460_1647_2054	135
2033	3300049822	Ga0501035_0247023	Ga0501035_0247023_221_634	135
2034	3300049822	Ga0501035_0529239	Ga0501035_0529239_213_620	135
2035	3300049822	Ga0501035_0564999	Ga0501035_0564999_246_656	135
2036	3300049822	Ga0501035_0868849	Ga0501035_0868849_218_628	135
2037	3300049823	Ga0501044_0000329	Ga0501044_0000329_29583_29990	135
2038	3300049823	Ga0501044_0015149	Ga0501044_0015149_1203_1610	135
2039	3300049823	Ga0501044_0101952	Ga0501044_0101952_1148_1558	135
2040	3300049823	Ga0501044_0104087	Ga0501044_0104087_675_1088	135
2041	3300049823	Ga0501044_0326631	Ga0501044_0326631_952_1359	135
2042	3300049823	Ga0501044_0377160	Ga0501044_0377160_554_964	135
2043	3300049823	Ga0501044_0455447	Ga0501044_0455447_296_706	135
2044	3300049823	Ga0501044_0755197	Ga0501044_0755197_32_439	135
2045	3300049823	Ga0501044_0954306	Ga0501044_0954306_292_699	135
2046	3300049823	Ga0501044_1486087	Ga0501044_1486087_102_512	135
2047	3300049824	Ga0501045_0011320	Ga0501045_0011320_4971_5378	135
2048	3300049824	Ga0501045_0426019	Ga0501045_0426019_201_608	135
2049	3300050489	nmdc:mga03683_147407_c1	nmdc:mga03683_147407_c1_627_1034	135
2050	3300050489	nmdc:mga03683_241954_c1	nmdc:mga03683_241954_c1_256_663	135
2051	3300050489	nmdc:mga03683_27468_c1	nmdc:mga03683_27468_c1_1809_2216	135
2052	3300050489	nmdc:mga03683_311530_c1	nmdc:mga03683_311530_c1_139_546	135
2053	3300050489	nmdc:mga03683_313102_c1	nmdc:mga03683_313102_c1_126_533	135
2054	3300050489	nmdc:mga03683_372183_c1	nmdc:mga03683_372183_c1_160_567	135
2055	3300050489	nmdc:mga03683_568417_c1	nmdc:mga03683_568417_c1_50_457	135
2056	3300050490	nmdc:mga03n38_2197_c1	nmdc:mga03n38_2197_c1_4981_5388	135
2057	3300050490	nmdc:mga03n38_342354_c1	nmdc:mga03n38_342354_c1_196_603	135
2058	3300050490	nmdc:mga03n38_559734_c1	nmdc:mga03n38_559734_c1_47_454	135
2059	3300050490	nmdc:mga03n38_83295_c1	nmdc:mga03n38_83295_c1_42_449	135
2060	3300050491	nmdc:mga00v17_140364_c1	nmdc:mga00v17_140364_c1_907_1314	135
2061	3300050491	nmdc:mga00v17_2666_c1	nmdc:mga00v17_2666_c1_6509_6916	135
2062	3300050491	nmdc:mga00v17_387368_c1	nmdc:mga00v17_387368_c1_424_831	135
2063	3300050491	nmdc:mga00v17_418648_c1	nmdc:mga00v17_418648_c1_265_672	135
2064	3300050491	nmdc:mga00v17_565783_c1	nmdc:mga00v17_565783_c1_38_496	135
2065	3300050491	nmdc:mga00v17_761738_c1	nmdc:mga00v17_761738_c1_112_519	135
2066	3300050492	nmdc:mga0yw44_1178673_c1	nmdc:mga0yw44_1178673_c1_11_418	135
2067	3300050492	nmdc:mga0yw44_159694_c1	nmdc:mga0yw44_159694_c1_825_1232	135
2068	3300050492	nmdc:mga0yw44_17928_c1	nmdc:mga0yw44_17928_c1_2885_3292	135
2069	3300050492	nmdc:mga0yw44_187611_c1	nmdc:mga0yw44_187611_c1_634_1041	135
2070	3300050492	nmdc:mga0yw44_386082_c1	nmdc:mga0yw44_386082_c1_454_861	135
2071	3300050492	nmdc:mga0yw44_40195_c1	nmdc:mga0yw44_40195_c1_1726_2133	135
2072	3300050492	nmdc:mga0yw44_406324_c1	nmdc:mga0yw44_406324_c1_151_558	135
2073	3300050492	nmdc:mga0yw44_410043_c1	nmdc:mga0yw44_410043_c1_178_585	135
2074	3300050492	nmdc:mga0yw44_57766_c1	nmdc:mga0yw44_57766_c1_604_1011	135
2075	3300050492	nmdc:mga0yw44_83926_c1	nmdc:mga0yw44_83926_c1_1083_1490	135
2076	3300050492	nmdc:mga0yw44_939475_c1	nmdc:mga0yw44_939475_c1_101_559	135
2077	3300050493	nmdc:mga0k408_132137_c1	nmdc:mga0k408_132137_c1_528_935	135
2078	3300050493	nmdc:mga0k408_210814_c1	nmdc:mga0k408_210814_c1_459_866	135
2079	3300050493	nmdc:mga0k408_43474_c1	nmdc:mga0k408_43474_c1_1159_1566	135
2080	3300050493	nmdc:mga0k408_518086_c1	nmdc:mga0k408_518086_c1_163_570	135
2081	3300050493	nmdc:mga0k408_528478_c1	nmdc:mga0k408_528478_c1_211_618	135
2082	3300050493	nmdc:mga0k408_88200_c1	nmdc:mga0k408_88200_c1_742_1149	135
2083	3300050494	nmdc:mga06z11_14853_c1	nmdc:mga06z11_14853_c1_2031_2438	135
2084	3300050494	nmdc:mga06z11_17595_c1	nmdc:mga06z11_17595_c1_77_484	135
2085	3300050494	nmdc:mga06z11_209345_c1	nmdc:mga06z11_209345_c1_80_487	135
2086	3300050494	nmdc:mga06z11_26308_c1	nmdc:mga06z11_26308_c1_2155_2562	135
2087	3300050494	nmdc:mga06z11_264833_c1	nmdc:mga06z11_264833_c1_406_813	135
2088	3300050494	nmdc:mga06z11_500748_c1	nmdc:mga06z11_500748_c1_281_688	135
2089	3300050494	nmdc:mga06z11_5537_c1	nmdc:mga06z11_5537_c1_1607_2014	135
2090	3300050494	nmdc:mga06z11_584374_c1	nmdc:mga06z11_584374_c1_69_476	135
2091	3300050494	nmdc:mga06z11_67807_c1	nmdc:mga06z11_67807_c1_781_1188	135
2092	3300050495	nmdc:mga04h51_133435_c1	nmdc:mga04h51_133435_c1_389_796	135
2093	3300050495	nmdc:mga04h51_209469_c1	nmdc:mga04h51_209469_c1_319_726	135
2094	3300050495	nmdc:mga04h51_253933_c1	nmdc:mga04h51_253933_c1_288_695	135
2095	3300050495	nmdc:mga04h51_286574_c1	nmdc:mga04h51_286574_c1_58_465	135
2096	3300050495	nmdc:mga04h51_77421_c1	nmdc:mga04h51_77421_c1_750_1157	135
2097	3300050495	nmdc:mga04h51_82788_c1	nmdc:mga04h51_82788_c1_564_971	135
2098	3300050496	nmdc:mga07m45_185975_c1	nmdc:mga07m45_185975_c1_154_561	135
2099	3300050496	nmdc:mga07m45_2890_c1	nmdc:mga07m45_2890_c1_3236_3643	135
2100	3300050496	nmdc:mga07m45_29152_c1	nmdc:mga07m45_29152_c1_982_1389	135
2101	3300050496	nmdc:mga07m45_83022_c1	nmdc:mga07m45_83022_c1_697_1104	135
2102	3300050507	nmdc:mga05p37_258220_c1	nmdc:mga05p37_258220_c1_1207_1614	135
2103	3300050509	nmdc:mga0qj67_120895_c1	nmdc:mga0qj67_120895_c1_946_1353	135
2104	3300050509	nmdc:mga0qj67_340421_c1	nmdc:mga0qj67_340421_c1_556_963	135
2105	3300050510	nmdc:mga06r32_1208846_c1	nmdc:mga06r32_1208846_c1_204_611	135
2106	3300050511	nmdc:mga08y16_544697_c1	nmdc:mga08y16_544697_c1_535_942	135
2107	3300050512	nmdc:mga0n895_37685_c1	nmdc:mga0n895_37685_c1_3982_4389	135
2108	3300050512	nmdc:mga0n895_385075_c1	nmdc:mga0n895_385075_c1_322_729	135
2109	3300050513	nmdc:mga0rr50_588446_c1	nmdc:mga0rr50_588446_c1_100_507	135
2110	3300050514	nmdc:mga08x19_1075971_c1	nmdc:mga08x19_1075971_c1_79_486	135
2111	3300050514	nmdc:mga08x19_498598_c1	nmdc:mga08x19_498598_c1_142_549	135
2112	3300050515	nmdc:mga0a205_1535077_c1	nmdc:mga0a205_1535077_c1_72_479	135
2113	3300050516	nmdc:mga0sz30_103010_c1	nmdc:mga0sz30_103010_c1_221_628	135
2114	3300050516	nmdc:mga0sz30_1770_c1	nmdc:mga0sz30_1770_c1_6332_6739	135
2115	3300050516	nmdc:mga0sz30_21122_c2	nmdc:mga0sz30_21122_c2_271_678	135
2116	3300050516	nmdc:mga0sz30_54534_c1	nmdc:mga0sz30_54534_c1_402_809	135
2117	3300053077	Ga0495601_0081782	Ga0495601_0081782_1250_1657	135
2118	3300053077	Ga0495601_0096433	Ga0495601_0096433_513_923	135
2119	3300053077	Ga0495601_0114771	Ga0495601_0114771_848_1306	135
2120	3300053077	Ga0495601_0153758	Ga0495601_0153758_916_1323	135
2121	3300053078	Ga0495612_0010159	Ga0495612_0010159_1252_1662	135
2122	3300053078	Ga0495612_0199362	Ga0495612_0199362_32_439	135
2123	3300053078	Ga0495612_0320263	Ga0495612_0320263_104_511	135
2124	3300053080	Ga0500635_0097836	Ga0500635_0097836_648_1055	135
2125	3300053080	Ga0500635_0114605	Ga0500635_0114605_363_770	135
2126	3300053083	Ga0495655_0015832	Ga0495655_0015832_660_1067	135
2127	3300053083	Ga0495655_0061057	Ga0495655_0061057_424_831	135
2128	3300053083	Ga0495655_0191908	Ga0495655_0191908_50_457	135
2129	3300053084	Ga0495595_0001279	Ga0495595_0001279_7149_7559	135
2130	3300053084	Ga0495595_0112424	Ga0495595_0112424_515_922	135
2131	3300053084	Ga0495595_0648627	Ga0495595_0648627_114_521	135
2132	3300053085	Ga0495619_0002526	Ga0495619_0002526_9571_9978	135
2133	3300053085	Ga0495619_0008288	Ga0495619_0008288_220_630	135
2134	3300053085	Ga0495619_0148348	Ga0495619_0148348_249_656	135
2135	3300053085	Ga0495619_0152200	Ga0495619_0152200_415_822	135
2136	3300053085	Ga0495619_0393067	Ga0495619_0393067_148_555	135
2137	3300053085	Ga0495619_0741529	Ga0495619_0741529_98_505	135
2138	3300053086	Ga0500578_0191143	Ga0500578_0191143_237_644	135
2139	3300053086	Ga0500578_0309115	Ga0500578_0309115_144_551	135
2140	3300053086	Ga0500578_0384604	Ga0500578_0384604_362_769	135
2141	3300053086	Ga0500578_0653590	Ga0500578_0653590_11_418	135
2142	3300053087	Ga0500643_000112	Ga0500643_000112_28263_28670	135
2143	3300053087	Ga0500643_039738	Ga0500643_039738_447_854	135
2144	3300053088	Ga0500644_0017901	Ga0500644_0017901_1398_1805	135
2145	3300053088	Ga0500644_0203343	Ga0500644_0203343_253_660	135
2146	3300053088	Ga0500644_0570959	Ga0500644_0570959_71_478	135
2147	3300053089	Ga0500581_079515	Ga0500581_079515_1182_1589	135
2148	3300053092	Ga0500583_0045494	Ga0500583_0045494_1280_1687	135
2149	3300053092	Ga0500583_0272459	Ga0500583_0272459_349_756	135
2150	3300053093	Ga0500651_0052607	Ga0500651_0052607_227_634	135
2151	3300053093	Ga0500651_0071644	Ga0500651_0071644_149_556	135
2152	3300053093	Ga0500651_0129906	Ga0500651_0129906_763_1170	135
2153	3300053093	Ga0500651_0131115	Ga0500651_0131115_446_853	135
2154	3300053093	Ga0500651_0277224	Ga0500651_0277224_545_952	135
2155	3300053093	Ga0500651_0398234	Ga0500651_0398234_22_429	135
2156	3300053094	Ga0500566_0000811	Ga0500566_0000811_13668_14075	135
2157	3300053094	Ga0500566_0014400	Ga0500566_0014400_4133_4540	135
2158	3300053094	Ga0500566_0108365	Ga0500566_0108365_673_1080	135
2159	3300053096	Ga0500641_0018452	Ga0500641_0018452_2006_2413	135
2160	3300053096	Ga0500641_0180144	Ga0500641_0180144_67_474	135
2161	3300053096	Ga0500641_0257371	Ga0500641_0257371_64_471	135
2162	3300053097	Ga0500648_030629	Ga0500648_030629_716_1123	135
2163	3300053098	Ga0500650_0131380	Ga0500650_0131380_648_1055	135
2164	3300053098	Ga0500650_0134596	Ga0500650_0134596_334_741	135
2165	3300053098	Ga0500650_0288401	Ga0500650_0288401_270_677	135
2166	3300053102	Ga0500554_010947	Ga0500554_010947_470_877	135
2167	3300053103	Ga0500555_003229	Ga0500555_003229_4054_4461	135
2168	3300053103	Ga0500555_031269	Ga0500555_031269_1033_1440	135
2169	3300053104	Ga0500556_0000006	Ga0500556_0000006_257875_258282	135
2170	3300053104	Ga0500556_0004003	Ga0500556_0004003_3027_3434	135
2171	3300053105	Ga0500557_000021	Ga0500557_000021_55220_55627	135
2172	3300053108	Ga0500562_035701	Ga0500562_035701_613_1020	135
2173	3300053108	Ga0500562_055931	Ga0500562_055931_48_455	135
2174	3300053108	Ga0500562_113722	Ga0500562_113722_289_696	135
2175	3300053109	Ga0500569_001412	Ga0500569_001412_3101_3508	135
2176	3300053109	Ga0500569_004967	Ga0500569_004967_1752_2159	135
2177	3300053109	Ga0500569_074917	Ga0500569_074917_201_608	135
2178	3300053111	Ga0500572_000229	Ga0500572_000229_11973_12380	135
2179	3300053111	Ga0500572_084615	Ga0500572_084615_71_478	135
2180	3300053116	Ga0500592_000600	Ga0500592_000600_4107_4514	135
2181	3300053118	Ga0500594_0014913	Ga0500594_0014913_1095_1502	135
2182	3300053119	Ga0500595_003189	Ga0500595_003189_1337_1744	135
2183	3300053119	Ga0500595_003555	Ga0500595_003555_5966_6373	135
2184	3300053119	Ga0500595_004189	Ga0500595_004189_1268_1675	135
2185	3300053119	Ga0500595_030704	Ga0500595_030704_697_1104	135
2186	3300053121	Ga0500607_103795	Ga0500607_103795_316_723	135
2187	3300053121	Ga0500607_136333	Ga0500607_136333_73_480	135
2188	3300053122	Ga0500608_028614	Ga0500608_028614_2159_2566	135
2189	3300053122	Ga0500608_217624	Ga0500608_217624_153_560	135
2190	3300053123	Ga0500614_055022	Ga0500614_055022_296_703	135
2191	3300053125	Ga0500618_018891	Ga0500618_018891_654_1061	135
2192	3300053129	Ga0500628_050840	Ga0500628_050840_44_451	135
2193	3300053130	Ga0500642_0000004	Ga0500642_0000004_224979_225386	135
2194	3300053130	Ga0500642_0000531	Ga0500642_0000531_7993_8400	135
2195	3300053130	Ga0500642_0042861	Ga0500642_0042861_853_1260	135
2196	3300053130	Ga0500642_0177006	Ga0500642_0177006_352_759	135
2197	3300053130	Ga0500642_0381540	Ga0500642_0381540_118_525	135
2198	3300053130	Ga0500642_0397493	Ga0500642_0397493_137_544	135
2199	3300053131	Ga0500652_000160	Ga0500652_000160_9204_9611	135
2200	3300053133	Ga0500655_014316	Ga0500655_014316_836_1243	135
2201	3300053134	Ga0500658_0105221	Ga0500658_0105221_610_1017	135
2202	3300053134	Ga0500658_0303005	Ga0500658_0303005_86_493	135
2203	3300053134	Ga0500658_0551958	Ga0500658_0551958_48_455	135
2204	3300053134	Ga0500658_0584126	Ga0500658_0584126_44_451	135
2205	3300053136	Ga0500559_0000186	Ga0500559_0000186_48189_48596	135
2206	3300053136	Ga0500559_0001431	Ga0500559_0001431_4259_4666	135
2207	3300053136	Ga0500559_0025007	Ga0500559_0025007_1795_2202	135
2208	3300053136	Ga0500559_0096910	Ga0500559_0096910_816_1223	135
2209	3300053136	Ga0500559_0414711	Ga0500559_0414711_52_459	135
2210	3300053136	Ga0500559_0450118	Ga0500559_0450118_71_478	135
2211	3300053137	Ga0500561_0030521	Ga0500561_0030521_673_1080	135
2212	3300053138	Ga0500564_028441	Ga0500564_028441_1197_1604	135
2213	3300053139	Ga0500568_0005661	Ga0500568_0005661_4641_5048	135
2214	3300053139	Ga0500568_0068898	Ga0500568_0068898_697_1104	135
2215	3300053139	Ga0500568_0110882	Ga0500568_0110882_169_576	135
2216	3300053139	Ga0500568_0134379	Ga0500568_0134379_352_759	135
2217	3300053140	Ga0500573_0107244	Ga0500573_0107244_957_1364	135
2218	3300053142	Ga0500577_0032763	Ga0500577_0032763_27_434	135
2219	3300053142	Ga0500577_0061392	Ga0500577_0061392_921_1328	135
2220	3300053142	Ga0500577_0193260	Ga0500577_0193260_64_471	135
2221	3300053144	Ga0500585_079631	Ga0500585_079631_320_727	135
2222	3300053145	Ga0500586_000112	Ga0500586_000112_13710_14117	135
2223	3300053146	Ga0500588_0065276	Ga0500588_0065276_607_1014	135
2224	3300053146	Ga0500588_0159482	Ga0500588_0159482_62_469	135
2225	3300053147	Ga0500589_038922	Ga0500589_038922_1739_2146	135
2226	3300053148	Ga0500590_115144	Ga0500590_115144_150_557	135
2227	3300053148	Ga0500590_132797	Ga0500590_132797_574_981	135
2228	3300053148	Ga0500590_140420	Ga0500590_140420_545_952	135
2229	3300053148	Ga0500590_140853	Ga0500590_140853_435_842	135
2230	3300053148	Ga0500590_289569	Ga0500590_289569_184_591	135
2231	3300053150	Ga0500603_001369	Ga0500603_001369_4482_4889	135
2232	3300053150	Ga0500603_233869	Ga0500603_233869_88_495	135
2233	3300053151	Ga0500604_0020811	Ga0500604_0020811_788_1195	135
2234	3300053151	Ga0500604_0122683	Ga0500604_0122683_276_683	135
2235	3300053153	Ga0500616_0000022	Ga0500616_0000022_256056_256463	135
2236	3300053153	Ga0500616_0000046	Ga0500616_0000046_2830_3240	135
2237	3300053153	Ga0500616_0160432	Ga0500616_0160432_494_901	135
2238	3300053154	Ga0500619_082020	Ga0500619_082020_375_782	135
2239	3300053154	Ga0500619_139220	Ga0500619_139220_321_728	135
2240	3300053155	Ga0500620_014749	Ga0500620_014749_574_981	135
2241	3300053156	Ga0500622_0003300	Ga0500622_0003300_6260_6667	135
2242	3300053156	Ga0500622_0003668	Ga0500622_0003668_7911_8318	135
2243	3300053156	Ga0500622_0417505	Ga0500622_0417505_27_434	135
2244	3300053158	Ga0500627_0050928	Ga0500627_0050928_168_575	135
2245	3300053158	Ga0500627_0146736	Ga0500627_0146736_414_821	135
2246	3300053158	Ga0500627_0230305	Ga0500627_0230305_180_587	135
2247	3300053158	Ga0500627_0458347	Ga0500627_0458347_70_477	135
2248	3300053160	Ga0500633_0041237	Ga0500633_0041237_819_1226	135
2249	3300053161	Ga0500634_0124148	Ga0500634_0124148_40_447	135
2250	3300053161	Ga0500634_0139903	Ga0500634_0139903_67_474	135
2251	3300053161	Ga0500634_0163814	Ga0500634_0163814_566_973	135
2252	3300053161	Ga0500634_0265285	Ga0500634_0265285_246_653	135
2253	3300053162	Ga0500638_037184	Ga0500638_037184_1291_1698	135
2254	3300053162	Ga0500638_137802	Ga0500638_137802_205_612	135
2255	3300053162	Ga0500638_187829	Ga0500638_187829_128_535	135
2256	3300053163	Ga0500639_096942	Ga0500639_096942_859_1266	135
2257	3300053177	Ga0500636_0001584	Ga0500636_0001584_8065_8472	135
2258	3300053177	Ga0500636_0003476	Ga0500636_0003476_8002_8409	135
2259	3300053177	Ga0500636_0126065	Ga0500636_0126065_647_1054	135
2260	3300053177	Ga0500636_0300061	Ga0500636_0300061_100_507	135
2261	3300053177	Ga0500636_0405345	Ga0500636_0405345_62_469	135
2262	3300053178	Ga0500637_0003374	Ga0500637_0003374_4776_5183	135
2263	3300053178	Ga0500637_0102425	Ga0500637_0102425_259_666	135
2264	3300053178	Ga0500637_0193882	Ga0500637_0193882_243_650	135
2265	3300053178	Ga0500637_0316037	Ga0500637_0316037_75_482	135
2266	3300053178	Ga0500637_0383487	Ga0500637_0383487_316_723	135
2267	3300053727	Ga0500611_172309	Ga0500611_172309_34_441	135
2268	3300053729	Ga0500625_136418	Ga0500625_136418_18_425	135
2269	3300053730	Ga0500645_021916	Ga0500645_021916_1181_1588	135
2270	3300053730	Ga0500645_026788	Ga0500645_026788_104_511	135
2271	3300053730	Ga0500645_033721	Ga0500645_033721_1086_1493	135
2272	3300053730	Ga0500645_126161	Ga0500645_126161_111_569	135
2273	3300053731	Ga0500609_010631	Ga0500609_010631_631_1038	135
2274	3300053733	Ga0500552_041743	Ga0500552_041743_101_508	135
2275	3300053733	Ga0500552_084511	Ga0500552_084511_28_435	135
2276	3300053735	Ga0500596_008387	Ga0500596_008387_444_851	135
2277	3300053735	Ga0500596_017413	Ga0500596_017413_444_851	135
2278	3300053736	Ga0500599_002281	Ga0500599_002281_1405_1812	135
2279	3300053739	Ga0500587_089843	Ga0500587_089843_38_445	135
2280	3300054114	Ga0501084_0033342	Ga0501084_0033342_3217_3624	135
2281	3300054114	Ga0501084_1869670	Ga0501084_1869670_64_471	135
2282	3300059478	Ga0587093_101888	Ga0587093_101888_70_477	135
2283	3300059492	Ga0587073_0116461	Ga0587073_0116461_268_675	135
2284	3300059492	Ga0587073_0166946	Ga0587073_0166946_186_593	135
2285	3300059493	Ga0587077_086922	Ga0587077_086922_44_451	135
2286	3300059503	Ga0587080_018802	Ga0587080_018802_666_1073	135
2287	3300059604	Ga0587098_044908	Ga0587098_044908_75_482	135
2288	3300059605	Ga0587106_110129	Ga0587106_110129_42_449	135
2289	3300059644	Ga0587075_135853	Ga0587075_135853_72_479	135
2290	3300059647	Ga0587079_186056	Ga0587079_186056_109_516	135
2291	3300059648	Ga0587100_042638	Ga0587100_042638_44_451	135
2292	3300060344	Ga0587071_049651	Ga0587071_049651_69_476	135
2293	3300060353	Ga0501082_0014942	Ga0501082_0014942_5715_6122	135
2294	3300060353	Ga0501082_0048138	Ga0501082_0048138_3167_3574	135
2295	3300061719	Ga0466962_0033677	Ga0466962_0033677_1245_1652	135
2296	3300061719	Ga0466962_0135827	Ga0466962_0135827_671_1078	135
2297	iso_pu_bacteria	2513237096	2513659524	135
2298	iso_pu_bacteria	2513237137	2513859369	135
2299	iso_pu_bacteria	2513237145	2513921543	135
2300	iso_pu_bacteria	2517572143	2517889065	135
2301	iso_pu_bacteria	2791355197	2793072696	135
2302	iso_pu_bacteria	2935630451	2935636023	135
2303	iso_pu_bacteria	2941507105	2941512673	135
2304	iso_pu_bacteria	2941515067	2941520489	135
2305	iso_pu_bacteria	2941523033	2941528503	135
2306	iso_pu_bacteria	8006933436	8006935988	135
2307	iso_pu_bacteria	8006973647	8006975888	135
2308	iso_pu_bacteria	8006984368	8006991124	135
2309	iso_pu_bacteria	8019555841	8019562670	135
2310	iso_pu_bacteria	8019565922	8019572749	135

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02823

ATP-synt_DE_N

ATP synthase, Delta/Epsilon chain, beta-sandwich domain

34

112

0.98 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
5dn6-assembly1.cif.gz_I	atp synthase from paracoccus denitrificans	0.9431	9	79
1h8e-assembly1.cif.gz_H	(adp.alf4)2(adp.so4) bovine f1-atpase (all three catalytic sites occupied)	0.938	4	88
4asu-assembly1.cif.gz_H	f1-atpase in which all three catalytic sites contain bound nucleotide, with magnesium ion released in the empty site	0.9328	6	84
7nk9-assembly1.cif.gz_H	mycobacterium smegmatis atp synthase fo domain state 1	0.928	20	77
1h8e-assembly1.cif.gz_H	(adp.alf4)2(adp.so4) bovine f1-atpase (all three catalytic sites occupied)	0.8882	4	88

ID	Description	Score	Start	End	Superfamily
1aqtA01	Mainly Beta;Sandwich;ATP Synthase; domain 1;F0F1 ATP synthase delta/epsilon subunit, N-terminal	0.9716	2	88	2.60.15.10
2e5yB01	Mainly Beta;Sandwich;ATP Synthase; domain 1;F0F1 ATP synthase delta/epsilon subunit, N-terminal	0.9638	1	88	2.60.15.10
af_P00835_1_88_2.60.15.10	Mainly Beta;Sandwich;ATP Synthase; domain 1;F0F1 ATP synthase delta/epsilon subunit, N-terminal	0.9623	2	88	2.60.15.10
af_I1JML1_57_153_2.60.15.10	Mainly Beta;Sandwich;ATP Synthase; domain 1;F0F1 ATP synthase delta/epsilon subunit, N-terminal	0.9602	3	88	2.60.15.10
2e5yB01	Mainly Beta;Sandwich;ATP Synthase; domain 1;F0F1 ATP synthase delta/epsilon subunit, N-terminal	0.9533	1	88	2.60.15.10

ID	Description	Score	Start	End	GO Terms
AF-A0A1H0IFA5-F1-model_v4	ATP synthase epsilon chain (ATP synthase F1 sector epsilon subunit) (F-ATPase epsilon subunit)	1.003	1	135	GO:0005524 GO:0005886 GO:0012505 GO:0045261 GO:0046933
AF-A0A533J4A4-F1-model_v4	deleted	1.002	1	66
AF-A0A525J889-F1-model_v4	ATP synthase epsilon chain (ATP synthase F1 sector epsilon subunit) (F-ATPase epsilon subunit)	0.9982	2	84	GO:0005524 GO:0005886 GO:0012505 GO:0045261 GO:0046933
AF-A0A1H0IFA5-F1-model_v4	ATP synthase epsilon chain (ATP synthase F1 sector epsilon subunit) (F-ATPase epsilon subunit)	0.9954	1	135	GO:0005524 GO:0005886 GO:0012505 GO:0045261 GO:0046933
AF-A0A0G1Y592-F1-model_v4	ATP synthase epsilon chain	0.9867	3	71	GO:0012505 GO:0045261 GO:0046933

Feature Viewer

pLDDT	pTM	Quality
93.48	0.83	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F496667

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF02823

ATP-synt_DE_N

ATP synthase, Delta/Epsilon chain, beta-sandwich domain

34

112

0.98

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map