metagRoot

F496651

General Info

Members	Datasets	Scaffolds	Average Seq Length
2297	611	2297	125

Family's Representative Sequence

Representative Sequence	3300000549\|LJQas_1009814\|LJQas_10098142
Length	154
Sequence	MYASSASGISPAATYEQSHLVPLAKDGVSMPRVLIADDEDSMRVLVARAIAMDGHDTITAEDGAEALEILMREQGAFDLLLTDIQMPVMDGIALALAAARDFPDLTILLMTGFADQRERAHGLNAIAHDVITKPFSVADIRAAVAGALAARKAG

Samples

	Sample ID	Description	Type	Environment
1	2010549000	Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes	Metagenome	Endosphere
2	3300000549	Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled	Metagenome	Rhizosphere
3	3300001979	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6	Metagenome	Rhizosphere
4	3300001989	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5	Metagenome	Rhizosphere
5	3300001990	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3	Metagenome	Rhizosphere
6	3300001991	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2	Metagenome	Rhizosphere
7	3300002067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1	Metagenome	Rhizosphere
8	3300002075	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4	Metagenome	Rhizosphere
9	3300003203	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
10	3300003214	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL	Metagenome	Endosphere
11	3300003215	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF	Metagenome	Endosphere
12	3300003323	Sugarcane root Sample H1	Metagenome	Unclassified
13	3300003354	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS	Metagenome	Endosphere
14	3300003374	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF	Metagenome	Endosphere
15	3300003659	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Metagenome	Rhizosphere
16	3300003759	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2	Metagenome	Endosphere
17	3300003762	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2	Metagenome	Endosphere
18	3300003771	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2	Metagenome	Endosphere
19	3300003775	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2	Metagenome	Endosphere
20	3300003794	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2	Metagenome	Endosphere
21	3300003911	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
22	3300004625	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2	Metagenome	Endosphere
23	3300005262	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3)	Metagenome	Endosphere
24	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
25	3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Metagenome	Rhizosphere
26	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
27	3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Metagenome	Rhizosphere
28	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
29	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
30	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
31	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
32	3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Metagenome	Rhizosphere
33	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
34	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
35	3300005341	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG	Metagenome	Rhizosphere
36	3300005343	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG	Metagenome	Rhizosphere
37	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
38	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
39	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
40	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
41	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
42	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
43	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
44	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
45	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
46	3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Metagenome	Rhizosphere
47	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
48	3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Metagenome	Rhizosphere
49	3300005437	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG	Metagenome	Rhizosphere
50	3300005438	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG	Metagenome	Rhizosphere
51	3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Metagenome	Rhizosphere
52	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
53	3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Metagenome	Rhizosphere
54	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
55	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
56	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
57	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
58	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
59	3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Metagenome	Rhizosphere
60	3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Metagenome	Rhizosphere
61	3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Metagenome	Rhizosphere
62	3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Metagenome	Rhizosphere
63	3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Metagenome	Rhizosphere
64	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
65	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
66	3300005536	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG	Metagenome	Rhizosphere
67	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
68	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
69	3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Metagenome	Rhizosphere
70	3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Metagenome	Rhizosphere
71	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
72	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
73	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
74	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
75	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
76	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
77	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
78	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
79	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
80	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
81	3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Metagenome	Rhizosphere
82	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
83	3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Metagenome	Rhizosphere
84	3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Metagenome	Rhizosphere
85	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
86	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
87	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
88	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
89	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
90	3300005981	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1	Metagenome	Rhizosphere
91	3300005983	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Metagenome	Rhizosphere
92	3300005985	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
93	3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Metagenome	Rhizosphere
94	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
95	3300006042	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3	Metagenome	Endosphere
96	3300006048	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3	Metagenome	Endosphere
97	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
98	3300006058	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1	Metagenome	Rhizosphere
99	3300006163	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG	Metagenome	Rhizosphere
100	3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Metagenome	Rhizosphere
101	3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Metagenome	Rhizosphere
102	3300006177	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2	Metagenome	Endosphere
103	3300006178	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Metagenome	Endosphere
104	3300006186	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4	Metagenome	Endosphere
105	3300006195	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1	Metagenome	Endosphere
106	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
107	3300006353	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5	Metagenome	Endosphere
108	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
109	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
110	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
111	3300006852	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Metagenome	Rhizosphere
112	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
113	3300006880	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Metagenome	Rhizosphere
114	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
115	3300006914	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Metagenome	Rhizosphere
116	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
117	3300006942	Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW	Metagenome	Nodule
118	3300006943	Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW	Metagenome	Nodule
119	3300006944	Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW	Metagenome	Nodule
120	3300007076	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Metagenome	Rhizosphere
121	3300007265	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1	Metagenome	Rhizosphere
122	3300007788	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2	Metagenome	Rhizosphere
123	3300009011	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG	Metagenome	Rhizosphere
124	3300009036	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG	Metagenome	Rhizosphere
125	3300009092	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG	Metagenome	Rhizosphere
126	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
127	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
128	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
129	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
130	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
131	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
132	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
133	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
134	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
135	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
136	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
137	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
138	3300010159	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3	Metagenome	Rhizosphere
139	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
140	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
141	3300012500	Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610	Metagenome	Rhizosphere
142	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
143	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
144	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
145	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
146	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
147	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
148	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
149	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
150	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
151	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
152	3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Metagenome	Rhizosphere
153	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
154	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
155	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
156	3300020070	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
157	3300020082	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
158	3300021320	Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3	Metagenome	Nodule
159	3300021321	Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1	Metagenome	Nodule
160	3300021324	Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4	Metagenome	Nodule
161	3300021327	Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2	Metagenome	Nodule
162	3300021361	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2	Metagenome	Rhizosphere
163	3300021377	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7	Metagenome	Unclassified
164	3300021384	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9	Metagenome	Unclassified
165	3300022467	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
166	3300024227	Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4	Metagenome	Rhizosphere
167	3300025230	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2)	Metagenome	Endosphere
168	3300025254	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2)	Metagenome	Endosphere
169	3300025261	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2)	Metagenome	Endosphere
170	3300025272	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
171	3300025295	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3)	Metagenome	Endosphere
172	3300025297	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2)	Metagenome	Endosphere
173	3300025299	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3)	Metagenome	Endosphere
174	3300025302	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2)	Metagenome	Endosphere
175	3300025304	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
176	3300025315	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2)	Metagenome	Rhizosphere
177	3300025321	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
178	3300025893	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
179	3300025898	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
180	3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
181	3300025900	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
182	3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2)	Metagenome	Rhizosphere
183	3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2)	Metagenome	Rhizosphere
184	3300025905	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
185	3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
186	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
187	3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
188	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
189	3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
190	3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
191	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
192	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
193	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
194	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
195	3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
196	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
197	3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
198	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
199	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
200	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
201	3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
202	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
203	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
204	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
205	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
206	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
207	3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
208	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
209	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
210	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
211	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
212	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
213	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
214	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
215	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
216	3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
217	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
218	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
219	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
220	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
221	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
222	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
223	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
224	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
225	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
226	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
227	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
228	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
229	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
230	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
231	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
232	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
233	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
234	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
235	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
236	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
237	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
238	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
239	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
240	3300027296	Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2)	Metagenome	Nodule
241	3300027357	Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2)	Metagenome	Nodule
242	3300027361	Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2)	Metagenome	Nodule
243	3300027363	Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2)	Metagenome	Nodule
244	3300027512	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2)	Metagenome	Rhizosphere
245	3300027671	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2)	Metagenome	Rhizosphere
246	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
247	3300028017	Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4	Metagenome	Rhizosphere
248	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
249	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
250	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
251	3300028556	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG	Metagenome	Rhizosphere
252	3300028558	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG	Metagenome	Rhizosphere
253	3300028563	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG	Metagenome	Rhizosphere
254	3300028573	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG	Metagenome	Rhizosphere
255	3300028577	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG	Metagenome	Rhizosphere
256	3300028653	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG	Metagenome	Rhizosphere
257	3300028654	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG	Metagenome	Rhizosphere
258	3300028666	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG	Metagenome	Rhizosphere
259	3300028786	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM	Metagenome	Unclassified
260	3300028794	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM	Metagenome	Unclassified
261	3300028800	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG	Metagenome	Rhizosphere
262	3300029957	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG	Metagenome	Rhizosphere
263	3300030521	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM	Metagenome	Unclassified
264	3300030763	Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
265	3300031235	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG	Metagenome	Rhizosphere
266	3300031239	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG	Metagenome	Rhizosphere
267	3300031241	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG	Metagenome	Rhizosphere
268	3300031242	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG	Metagenome	Rhizosphere
269	3300031247	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG	Metagenome	Rhizosphere
270	3300031249	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG	Metagenome	Rhizosphere
271	3300031250	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG	Metagenome	Rhizosphere
272	3300031344	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG	Metagenome	Rhizosphere
273	3300031456	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM	Metagenome	Unclassified
274	3300031507	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM	Metagenome	Unclassified
275	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
276	3300031595	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG	Metagenome	Rhizosphere
277	3300031616	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM	Metagenome	Unclassified
278	3300031711	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG	Metagenome	Rhizosphere
279	3300031712	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG	Metagenome	Rhizosphere
280	3300031730	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM	Metagenome	Unclassified
281	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
282	3300031824	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2	Metagenome	Rhizosphere
283	3300031838	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM	Metagenome	Unclassified
284	3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Metagenome	Rhizosphere
285	3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Metagenome	Rhizosphere
286	3300031903	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1	Metagenome	Rhizosphere
287	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
288	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
289	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
290	3300032004	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3	Metagenome	Rhizosphere
291	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
292	3300032126	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2	Metagenome	Rhizosphere
293	3300033179	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM	Metagenome	Unclassified
294	3300033180	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM	Metagenome	Unclassified
295	3300034816	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3	Metagenome	Rhizosphere
296	3300034820	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2	Metagenome	Rhizosphere
297	3300035083	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17	Metagenome	Rhizosphere
298	3300035086	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4	Metagenome	Rhizosphere
299	3300035088	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4	Metagenome	Rhizosphere
300	3300035089	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2	Metagenome	Rhizosphere
301	3300035091	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4	Metagenome	Rhizosphere
302	3300035092	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11	Metagenome	Rhizosphere
303	3300035111	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11	Metagenome	Rhizosphere
304	3300035112	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16	Metagenome	Rhizosphere
305	3300035113	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12	Metagenome	Rhizosphere
306	3300035115	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11	Metagenome	Rhizosphere
307	3300035116	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3	Metagenome	Rhizosphere
308	3300035117	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1	Metagenome	Rhizosphere
309	3300035118	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2	Metagenome	Rhizosphere
310	3300035119	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4	Metagenome	Rhizosphere
311	3300035120	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5	Metagenome	Rhizosphere
312	3300035121	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3	Metagenome	Rhizosphere
313	3300035170	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1	Metagenome	Rhizosphere
314	3300035171	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4	Metagenome	Rhizosphere
315	3300035172	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3	Metagenome	Rhizosphere
316	3300035241	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4	Metagenome	Rhizosphere
317	3300035242	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11	Metagenome	Rhizosphere
318	3300035410	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12	Metagenome	Rhizosphere
319	3300035691	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4	Metagenome	Rhizosphere
320	3300035692	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11	Metagenome	Rhizosphere
321	3300035695	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19	Metagenome	Rhizosphere
322	3300035724	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1	Metagenome	Rhizosphere
323	3300035725	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8	Metagenome	Rhizosphere
324	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
325	3300036459	Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome)	Metatranscriptome	Unclassified
326	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
327	3300037312	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2	Metagenome	Rhizosphere
328	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
329	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
330	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
331	3300037853	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2	Metagenome	Unclassified
332	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
333	3300039437	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2	Metagenome	Unclassified
334	3300039438	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2	Metagenome	Rhizosphere
335	3300039447	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2	Metagenome	Rhizosphere
336	3300039450	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2	Metagenome	Unclassified
337	3300039453	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2	Metagenome	Rhizosphere
338	3300041413	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839	Metagenome	Rhizosphere
339	3300041441	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG	Metagenome	Rhizoplane
340	3300041451	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG	Metagenome	Rhizoplane
341	3300041452	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG	Metagenome	Rhizoplane
342	3300041456	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG	Metagenome	Rhizoplane
343	3300041459	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG	Metagenome	Rhizoplane
344	3300041460	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG	Metagenome	Rhizoplane
345	3300041463	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG	Metagenome	Rhizoplane
346	3300041491	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG	Metagenome	Unclassified
347	3300041498	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG	Metagenome	Unclassified
348	3300041507	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG	Metagenome	Unclassified
349	3300041509	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG	Metagenome	Unclassified
350	3300041512	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG	Metagenome	Unclassified
351	3300041997	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607	Metagenome	Rhizosphere
352	3300042005	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216	Metagenome	Rhizosphere
353	3300042006	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437	Metagenome	Rhizosphere
354	3300042012	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213	Metagenome	Rhizosphere
355	3300042157	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210	Metagenome	Rhizosphere
356	3300042438	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533	Metagenome	Rhizosphere
357	3300042461	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366	Metagenome	Rhizosphere
358	3300044656	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R	Metagenome	Rhizosphere
359	3300044658	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R	Metagenome	Rhizosphere
360	3300044683	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R	Metagenome	Rhizosphere
361	3300044684	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R	Metagenome	Rhizosphere
362	3300044693	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R	Metagenome	Rhizosphere
363	3300044694	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R	Metagenome	Rhizosphere
364	3300044706	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R	Metagenome	Rhizosphere
365	3300044719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R	Metagenome	Rhizosphere
366	3300044735	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R	Metagenome	Rhizosphere
367	3300044765	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R	Metagenome	Rhizosphere
368	3300044842	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R	Metagenome	Rhizosphere
369	3300044901	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R	Metagenome	Rhizosphere
370	3300045049	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R	Metagenome	Rhizosphere
371	3300045051	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED	Metagenome	Rhizosphere
372	3300045836	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R	Metagenome	Rhizosphere
373	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
374	3300046452	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere	Metagenome	Rhizosphere
375	3300046453	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere	Metagenome	Rhizosphere
376	3300046454	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere	Metagenome	Rhizosphere
377	3300046455	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere	Metagenome	Rhizosphere
378	3300046457	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere	Metagenome	Rhizosphere
379	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
380	3300046460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere	Metagenome	Rhizosphere
381	3300046461	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere	Metagenome	Rhizosphere
382	3300046462	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere	Metagenome	Rhizosphere
383	3300046463	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere	Metagenome	Rhizosphere
384	3300046471	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere	Metagenome	Rhizosphere
385	3300046472	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere	Metagenome	Rhizosphere
386	3300046473	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere	Metagenome	Rhizosphere
387	3300046474	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere	Metagenome	Rhizosphere
388	3300046475	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere	Metagenome	Rhizosphere
389	3300046476	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere	Metagenome	Rhizosphere
390	3300046477	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere	Metagenome	Rhizosphere
391	3300046491	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere	Metagenome	Rhizosphere
392	3300046492	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere	Metagenome	Rhizosphere
393	3300046499	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere	Metagenome	Rhizosphere
394	3300046500	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere	Metagenome	Rhizosphere
395	3300046507	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere	Metagenome	Rhizosphere
396	3300046511	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere	Metagenome	Rhizosphere
397	3300046512	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere	Metagenome	Rhizosphere
398	3300046513	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere	Metagenome	Rhizosphere
399	3300046514	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere	Metagenome	Rhizosphere
400	3300046515	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere	Metagenome	Rhizosphere
401	3300046516	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere	Metagenome	Rhizosphere
402	3300046517	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere	Metagenome	Rhizosphere
403	3300046518	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere	Metagenome	Rhizosphere
404	3300046519	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere	Metagenome	Rhizosphere
405	3300046522	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere	Metagenome	Rhizosphere
406	3300046524	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere	Metagenome	Rhizosphere
407	3300046525	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere	Metagenome	Rhizosphere
408	3300046526	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere	Metagenome	Rhizosphere
409	3300046529	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere	Metagenome	Rhizosphere
410	3300046531	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere	Metagenome	Rhizosphere
411	3300046533	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere	Metagenome	Rhizosphere
412	3300046535	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere	Metagenome	Rhizosphere
413	3300046536	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere	Metagenome	Rhizosphere
414	3300046537	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere	Metagenome	Rhizosphere
415	3300046538	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere	Metagenome	Rhizosphere
416	3300046539	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere	Metagenome	Rhizosphere
417	3300046542	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere	Metagenome	Rhizosphere
418	3300046543	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere	Metagenome	Rhizosphere
419	3300046557	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere	Metagenome	Rhizosphere
420	3300046559	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere	Metagenome	Rhizosphere
421	3300046615	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere	Metagenome	Rhizosphere
422	3300046616	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere	Metagenome	Rhizosphere
423	3300046642	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere	Metagenome	Rhizosphere
424	3300046648	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere	Metagenome	Rhizosphere
425	3300046660	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere	Metagenome	Rhizosphere
426	3300046663	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere	Metagenome	Rhizosphere
427	3300046664	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere	Metagenome	Rhizosphere
428	3300046665	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere	Metagenome	Rhizosphere
429	3300046674	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere	Metagenome	Rhizosphere
430	3300046675	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere	Metagenome	Rhizosphere
431	3300046678	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere	Metagenome	Rhizosphere
432	3300046679	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere	Metagenome	Rhizosphere
433	3300046680	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere	Metagenome	Rhizosphere
434	3300046681	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere	Metagenome	Rhizosphere
435	3300046683	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere	Metagenome	Rhizosphere
436	3300046684	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere	Metagenome	Rhizosphere
437	3300046689	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere	Metagenome	Rhizosphere
438	3300046690	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere	Metagenome	Rhizosphere
439	3300046691	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere	Metagenome	Rhizosphere
440	3300046692	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere	Metagenome	Rhizosphere
441	3300046694	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere	Metagenome	Rhizosphere
442	3300046794	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere	Metagenome	Rhizosphere
443	3300046809	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere	Metagenome	Rhizosphere
444	3300046810	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere	Metagenome	Rhizosphere
445	3300047315	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere	Metagenome	Rhizosphere
446	3300047317	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere	Metagenome	Rhizosphere
447	3300047318	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere	Metagenome	Rhizosphere
448	3300047319	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere	Metagenome	Rhizosphere
449	3300047320	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere	Metagenome	Rhizosphere
450	3300047321	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere	Metagenome	Rhizosphere
451	3300047322	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere	Metagenome	Rhizosphere
452	3300047323	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere	Metagenome	Rhizosphere
453	3300047443	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere	Metagenome	Rhizosphere
454	3300047444	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere	Metagenome	Rhizosphere
455	3300047469	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere	Metagenome	Rhizosphere
456	3300047470	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere	Metagenome	Rhizosphere
457	3300047471	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere	Metagenome	Rhizosphere
458	3300047472	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere	Metagenome	Rhizosphere
459	3300047673	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere	Metagenome	Rhizosphere
460	3300048088	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere	Metagenome	Rhizosphere
461	3300048089	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere	Metagenome	Rhizosphere
462	3300048091	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere	Metagenome	Rhizosphere
463	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
464	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
465	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
466	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
467	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
468	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
469	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
470	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
471	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
472	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
473	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
474	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
475	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
476	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
477	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
478	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
479	3300048919	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled	Metagenome	Unclassified
480	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
481	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
482	3300048922	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15	Metagenome	Unclassified
483	3300048923	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15	Metagenome	Unclassified
484	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
485	3300048925	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled	Metagenome	Unclassified
486	3300048926	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled	Metagenome	Unclassified
487	3300048927	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15	Metagenome	Unclassified
488	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
489	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
490	3300049459	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere	Metagenome	Rhizosphere
491	3300049460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere	Metagenome	Rhizosphere
492	3300049569	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02	Metagenome	Rhizosphere
493	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
494	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
495	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
496	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
497	3300049576	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01	Metagenome	Rhizosphere
498	3300049577	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02	Metagenome	Rhizosphere
499	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
500	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
501	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
502	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
503	3300049583	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01	Metagenome	Rhizosphere
504	3300049584	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02	Metagenome	Rhizosphere
505	3300049585	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03	Metagenome	Rhizosphere
506	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
507	3300049587	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02	Metagenome	Rhizosphere
508	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
509	3300049590	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02	Metagenome	Rhizosphere
510	3300049741	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01	Metagenome	Rhizosphere
511	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
512	3300049743	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03	Metagenome	Rhizosphere
513	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
514	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
515	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
516	3300049824	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03	Metagenome	Rhizosphere
517	3300050489	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation	Metagenome	Endosphere
518	3300050490	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation	Metagenome	Endosphere
519	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
520	3300050492	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation	Metagenome	Endosphere
521	3300050493	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation	Metagenome	Endosphere
522	3300050494	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation	Metagenome	Endosphere
523	3300050495	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation	Metagenome	Endosphere
524	3300050496	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation	Metagenome	Endosphere
525	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
526	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
527	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
528	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
529	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
530	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
531	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
532	3300050514	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation	Metagenome	Rhizosphere
533	3300050516	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation	Metagenome	Endosphere
534	3300053077	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere	Metagenome	Rhizosphere
535	3300053078	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere	Metagenome	Rhizosphere
536	3300053080	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere	Metagenome	Endosphere
537	3300053083	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere	Metagenome	Rhizosphere
538	3300053084	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere	Metagenome	Rhizosphere
539	3300053085	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere	Metagenome	Rhizosphere
540	3300053086	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere	Metagenome	Endosphere
541	3300053087	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere	Metagenome	Endosphere
542	3300053088	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere	Metagenome	Endosphere
543	3300053091	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere	Metagenome	Endosphere
544	3300053092	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere	Metagenome	Endosphere
545	3300053093	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere	Metagenome	Endosphere
546	3300053094	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere	Metagenome	Endosphere
547	3300053095	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere	Metagenome	Endosphere
548	3300053096	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere	Metagenome	Endosphere
549	3300053097	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere	Metagenome	Endosphere
550	3300053098	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere	Metagenome	Endosphere
551	3300053102	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere	Metagenome	Endosphere
552	3300053103	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere	Metagenome	Endosphere
553	3300053104	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere	Metagenome	Endosphere
554	3300053105	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere	Metagenome	Endosphere
555	3300053106	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 endosphere	Metagenome	Endosphere
556	3300053108	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere	Metagenome	Endosphere
557	3300053109	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere	Metagenome	Endosphere
558	3300053111	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere	Metagenome	Endosphere
559	3300053112	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 endosphere	Metagenome	Endosphere
560	3300053114	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 endosphere	Metagenome	Endosphere
561	3300053115	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere	Metagenome	Endosphere
562	3300053116	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere	Metagenome	Endosphere
563	3300053118	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere	Metagenome	Endosphere
564	3300053119	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere	Metagenome	Endosphere
565	3300053120	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere	Metagenome	Endosphere
566	3300053121	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere	Metagenome	Endosphere
567	3300053122	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere	Metagenome	Endosphere
568	3300053123	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere	Metagenome	Endosphere
569	3300053125	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere	Metagenome	Endosphere
570	3300053126	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere	Metagenome	Endosphere
571	3300053130	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere	Metagenome	Endosphere
572	3300053133	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere	Metagenome	Endosphere
573	3300053134	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere	Metagenome	Endosphere
574	3300053136	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere	Metagenome	Endosphere
575	3300053138	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere	Metagenome	Endosphere
576	3300053139	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere	Metagenome	Endosphere
577	3300053142	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere	Metagenome	Endosphere
578	3300053146	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere	Metagenome	Endosphere
579	3300053147	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere	Metagenome	Endosphere
580	3300053148	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere	Metagenome	Endosphere
581	3300053150	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere	Metagenome	Endosphere
582	3300053151	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere	Metagenome	Endosphere
583	3300053153	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere	Metagenome	Endosphere
584	3300053154	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere	Metagenome	Endosphere
585	3300053155	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere	Metagenome	Endosphere
586	3300053156	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere	Metagenome	Endosphere
587	3300053158	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere	Metagenome	Endosphere
588	3300053159	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere	Metagenome	Endosphere
589	3300053160	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere	Metagenome	Endosphere
590	3300053161	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere	Metagenome	Endosphere
591	3300053162	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere	Metagenome	Endosphere
592	3300053163	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere	Metagenome	Endosphere
593	3300053177	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere	Metagenome	Endosphere
594	3300053178	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere	Metagenome	Endosphere
595	3300053722	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere	Metagenome	Endosphere
596	3300053725	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere	Metagenome	Endosphere
597	3300053727	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere	Metagenome	Endosphere
598	3300053728	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 endosphere	Metagenome	Endosphere
599	3300053729	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere	Metagenome	Endosphere
600	3300053730	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere	Metagenome	Endosphere
601	3300053731	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere	Metagenome	Endosphere
602	3300053733	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere	Metagenome	Endosphere
603	3300053735	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere	Metagenome	Endosphere
604	3300053736	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere	Metagenome	Endosphere
605	3300053737	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere	Metagenome	Endosphere
606	3300053739	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere	Metagenome	Endosphere
607	3300055283	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere	Metagenome	Endosphere
608	3300059424	Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810	Metagenome	Rhizosphere
609	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere
610	3300061719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1	Metagenome	Rhizosphere
611	3300061734	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2)	Metagenome	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	99.65
Metatranscriptomes	0.35
Isolates	0

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	11.45
Nodule	0.83
Rhizoplane	6.79
Rhizosphere	74.62
Stem	0
Stem Tuber	0
Unclassified	6.31

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	RicEn_C4668	2010549000	Bacteria	1407
2	LJQas_1009814	3300000549	Bacteria	1150
3	JGI24740J21852_10014220	3300001979	Bacteria	2943
4	JGI24739J22299_10023325	3300001989	Bacteria	2189
5	JGI24737J22298_10003163	3300001990	Bacteria	5846
6	JGI24743J22301_10087977	3300001991	Bacteria	660
7	JGI24735J21928_10017746	3300002067	Bacteria	2199
8	JGI24738J21930_10112739	3300002075	Bacteria	587
9	JGI24738J21930_10150900	3300002075	Bacteria	516
10	JGI25406J46586_10032061	3300003203	Bacteria	1957
11	JGI25406J46586_10061139	3300003203	Bacteria	1216
12	JGI25165J46597_1009495	3300003214	Bacteria	1461
13	JGI25153J46596_10001036	3300003215	Bacteria	16945
14	JGI25153J46596_10001434	3300003215	Bacteria	14270
15	JGI25153J46596_10014875	3300003215	Bacteria	3207
16	rootH1_10275241	3300003323	Bacteria	1622
17	JGI25160J50197_1005929	3300003354	Bacteria	5019
18	JGI25160J50197_1032056	3300003354	Bacteria	1341
19	JGI25161J50226_1023803	3300003374	Bacteria	604
20	JGI25404J52841_10007694	3300003659	Bacteria	2283
21	JGI25404J52841_10017399	3300003659	Bacteria	1559
22	JGI25404J52841_10050009	3300003659	Bacteria	879
23	JGI25404J52841_10054189	3300003659	Bacteria	842
24	JGI25404J52841_10127690	3300003659	Bacteria	537
25	Ga0055525_1013753	3300003759	Bacteria	685
26	Ga0055542_1003359	3300003762	Bacteria	4399
27	Ga0055526_1081179	3300003771	Bacteria	632
28	Ga0055524_1037374	3300003775	Bacteria	1289
29	Ga0055531_10009226	3300003794	Bacteria	5074
30	JGI25405J52794_10041171	3300003911	Bacteria	977
31	Ga0055543_1005963	3300004625	Bacteria	3026
32	Ga0065165_1000370	3300005262	Bacteria	73604
33	Ga0065165_1001957	3300005262	Bacteria	19507
34	Ga0065165_1012954	3300005262	Bacteria	3350
35	Ga0065165_1036364	3300005262	Bacteria	1502
36	Ga0070658_10052967	3300005327	Bacteria	3292
37	Ga0070658_10182731	3300005327	Bacteria	1765
38	Ga0070658_10344093	3300005327	Bacteria	1276
39	Ga0070658_11669040	3300005327	Bacteria	552
40	Ga0070676_10072058	3300005328	Bacteria	2076
41	Ga0070676_10153492	3300005328	Bacteria	1476
42	Ga0070676_11208732	3300005328	Bacteria	575
43	Ga0070683_100007348	3300005329	Bacteria	9308
44	Ga0070683_100014102	3300005329	Bacteria	6980
45	Ga0070683_100019323	3300005329	Bacteria	6051
46	Ga0070683_100560193	3300005329	Bacteria	1093
47	Ga0070683_100713510	3300005329	Bacteria	960
48	Ga0070683_101046195	3300005329	Bacteria	784
49	Ga0070690_100649243	3300005330	Bacteria	806
50	Ga0070670_100432329	3300005331	Bacteria	1165
51	Ga0070670_100959526	3300005331	Bacteria	777
52	Ga0070670_101734830	3300005331	Bacteria	575
53	Ga0068869_100123175	3300005334	Bacteria	1985
54	Ga0068869_100333594	3300005334	Bacteria	1233
55	Ga0068869_100714947	3300005334	Bacteria	855
56	Ga0070666_10165378	3300005335	Bacteria	1547
57	Ga0070666_10431689	3300005335	Bacteria	950
58	Ga0070666_10764375	3300005335	Bacteria	711
59	Ga0070666_10846708	3300005335	Bacteria	675
60	Ga0070680_100014896	3300005336	Bacteria	6083
61	Ga0070680_100182700	3300005336	Bacteria	1767
62	Ga0070680_100210876	3300005336	Bacteria	1639
63	Ga0070680_100256045	3300005336	Bacteria	1480
64	Ga0070680_100349370	3300005336	Bacteria	1257
65	Ga0070680_100569126	3300005336	Bacteria	972
66	Ga0070682_100435079	3300005337	Bacteria	1001
67	Ga0070682_100463102	3300005337	Bacteria	974
68	Ga0070682_100504965	3300005337	Bacteria	938
69	Ga0070682_100513760	3300005337	Bacteria	930
70	Ga0068868_100010097	3300005338	Bacteria	6821
71	Ga0068868_100140749	3300005338	Bacteria	1980
72	Ga0068868_100354237	3300005338	Bacteria	1258
73	Ga0068868_100711114	3300005338	Bacteria	899
74	Ga0070660_100048440	3300005339	Bacteria	3264
75	Ga0070660_100096889	3300005339	Bacteria	2333
76	Ga0070660_100156286	3300005339	Bacteria	1836
77	Ga0070660_100287309	3300005339	Bacteria	1346
78	Ga0070660_100687503	3300005339	Bacteria	857
79	Ga0070660_101570552	3300005339	Bacteria	560
80	Ga0070691_10132112	3300005341	Bacteria	1266
81	Ga0070687_100354749	3300005343	Bacteria	948
82	Ga0070661_100084872	3300005344	Bacteria	2339
83	Ga0070661_100108901	3300005344	Bacteria	2067
84	Ga0070661_100163847	3300005344	Bacteria	1685
85	Ga0070661_100458814	3300005344	Bacteria	1015
86	Ga0070668_100060350	3300005347	Bacteria	2936
87	Ga0070668_100076663	3300005347	Bacteria	2612
88	Ga0070668_100109241	3300005347	Bacteria	2201
89	Ga0070668_100377604	3300005347	Bacteria	1205
90	Ga0070668_100496898	3300005347	Bacteria	1055
91	Ga0070668_100761206	3300005347	Bacteria	858
92	Ga0070668_101459951	3300005347	Bacteria	624
93	Ga0070669_100132844	3300005353	Bacteria	1912
94	Ga0070669_100169476	3300005353	Bacteria	1701
95	Ga0070669_100226036	3300005353	Bacteria	1481
96	Ga0070669_100378653	3300005353	Bacteria	1154
97	Ga0070675_100968149	3300005354	Bacteria	781
98	Ga0070671_100223510	3300005355	Bacteria	1597
99	Ga0070671_100907339	3300005355	Bacteria	770
100	Ga0070671_100919334	3300005355	Bacteria	765
101	Ga0070671_101041645	3300005355	Bacteria	718
102	Ga0070674_100056209	3300005356	Bacteria	2728
103	Ga0070674_100766298	3300005356	Bacteria	830
104	Ga0070673_100062374	3300005364	Bacteria	2961
105	Ga0070673_100306532	3300005364	Bacteria	1399
106	Ga0070673_100310488	3300005364	Bacteria	1391
107	Ga0070673_101324270	3300005364	Bacteria	677
108	Ga0070659_100060577	3300005366	Bacteria	2989
109	Ga0070659_100168002	3300005366	Bacteria	1796
110	Ga0070659_100265067	3300005366	Bacteria	1426
111	Ga0070659_101797704	3300005366	Bacteria	549
112	Ga0070667_100069250	3300005367	Bacteria	3002
113	Ga0070667_100385893	3300005367	Bacteria	1273
114	Ga0070667_100464948	3300005367	Bacteria	1157
115	Ga0070667_101016640	3300005367	Bacteria	774
116	Ga0070667_101243977	3300005367	Bacteria	697
117	Ga0070709_10000683	3300005434	Bacteria	19271
118	Ga0070709_10004671	3300005434	Bacteria	7398
119	Ga0070709_10120413	3300005434	Bacteria	1778
120	Ga0070709_10186461	3300005434	Bacteria	1460
121	Ga0070709_10218560	3300005434	Bacteria	1358
122	Ga0070709_10292584	3300005434	Bacteria	1187
123	Ga0070709_10809591	3300005434	Bacteria	736
124	Ga0070709_11154328	3300005434	Bacteria	621
125	Ga0070714_100019867	3300005435	Bacteria	5480
126	Ga0070714_100113094	3300005435	Bacteria	2406
127	Ga0070714_100145442	3300005435	Bacteria	2132
128	Ga0070714_100237304	3300005435	Bacteria	1682
129	Ga0070714_101028335	3300005435	Bacteria	802
130	Ga0070714_101076938	3300005435	Bacteria	783
131	Ga0070714_101817227	3300005435	Bacteria	595
132	Ga0070713_100009227	3300005436	Bacteria	7044
133	Ga0070713_100045222	3300005436	Bacteria	3606
134	Ga0070713_100235133	3300005436	Bacteria	1667
135	Ga0070713_100568151	3300005436	Bacteria	1075
136	Ga0070710_10001685	3300005437	Bacteria	10418
137	Ga0070710_10006030	3300005437	Bacteria	5791
138	Ga0070710_10059987	3300005437	Bacteria	2162
139	Ga0070710_10069934	3300005437	Bacteria	2021
140	Ga0070710_10741593	3300005437	Bacteria	697
141	Ga0070701_10055320	3300005438	Bacteria	2072
142	Ga0070711_100004348	3300005439	Bacteria	8345
143	Ga0070711_100005547	3300005439	Bacteria	7556
144	Ga0070711_100012443	3300005439	Bacteria	5317
145	Ga0070711_100196211	3300005439	Bacteria	1555
146	Ga0070711_100203341	3300005439	Bacteria	1530
147	Ga0070711_100226323	3300005439	Bacteria	1456
148	Ga0070711_100651518	3300005439	Bacteria	883
149	Ga0070700_100176685	3300005441	Bacteria	1483
150	Ga0070708_100486836	3300005445	Bacteria	1164
151	Ga0070663_100001617	3300005455	Bacteria	12445
152	Ga0070663_100013772	3300005455	Bacteria	5172
153	Ga0070663_100017707	3300005455	Bacteria	4655
154	Ga0070663_100060405	3300005455	Bacteria	2726
155	Ga0070663_100069099	3300005455	Bacteria	2565
156	Ga0070663_100107074	3300005455	Bacteria	2095
157	Ga0070663_100120829	3300005455	Bacteria	1978
158	Ga0070663_100133827	3300005455	Bacteria	1886
159	Ga0070663_100178281	3300005455	Bacteria	1646
160	Ga0070663_100228371	3300005455	Bacteria	1464
161	Ga0070663_100304099	3300005455	Bacteria	1277
162	Ga0070663_100653446	3300005455	Bacteria	889
163	Ga0070663_100970206	3300005455	Bacteria	738
164	Ga0070663_100998469	3300005455	Bacteria	728
165	Ga0070678_100172923	3300005456	Bacteria	1761
166	Ga0070678_100180383	3300005456	Bacteria	1728
167	Ga0070678_100338860	3300005456	Bacteria	1289
168	Ga0070678_100440950	3300005456	Bacteria	1139
169	Ga0070678_100841395	3300005456	Bacteria	835
170	Ga0070678_100938685	3300005456	Bacteria	793
171	Ga0070662_100078918	3300005457	Bacteria	2447
172	Ga0070662_100157303	3300005457	Bacteria	1775
173	Ga0070662_101430535	3300005457	Bacteria	596
174	Ga0070681_10107206	3300005458	Bacteria	2735
175	Ga0070681_10158254	3300005458	Bacteria	2189
176	Ga0070681_10238607	3300005458	Bacteria	1732
177	Ga0070681_10296594	3300005458	Bacteria	1526
178	Ga0070681_10668877	3300005458	Bacteria	953
179	Ga0070681_10671259	3300005458	Bacteria	951
180	Ga0068867_100013262	3300005459	Bacteria	5838
181	Ga0070685_11237088	3300005466	Bacteria	568
182	Ga0070706_100121382	3300005467	Bacteria	2436
183	Ga0070706_100504924	3300005467	Bacteria	1125
184	Ga0070707_100063682	3300005468	Bacteria	3539
185	Ga0070707_100293160	3300005468	Bacteria	1581
186	Ga0070698_100161266	3300005471	Bacteria	2186
187	Ga0070698_102170651	3300005471	Bacteria	509
188	Ga0070699_100522276	3300005518	Bacteria	1079
189	Ga0070679_100181272	3300005530	Bacteria	2078
190	Ga0070679_100306162	3300005530	Bacteria	1539
191	Ga0070679_100675178	3300005530	Bacteria	976
192	Ga0070679_100683398	3300005530	Bacteria	969
193	Ga0070684_100002398	3300005535	Bacteria	13816
194	Ga0070684_100020732	3300005535	Bacteria	5453
195	Ga0070684_100056695	3300005535	Bacteria	3420
196	Ga0070684_101925507	3300005535	Bacteria	558
197	Ga0070697_100156166	3300005536	Bacteria	1926
198	Ga0068853_100008608	3300005539	Bacteria	8203
199	Ga0068853_100028547	3300005539	Bacteria	4693
200	Ga0068853_100031836	3300005539	Bacteria	4463
201	Ga0068853_100065956	3300005539	Bacteria	3143
202	Ga0068853_100069930	3300005539	Bacteria	3054
203	Ga0068853_100175967	3300005539	Unclassified	1938
204	Ga0068853_100248819	3300005539	Bacteria	1630
205	Ga0068853_100378925	3300005539	Bacteria	1321
206	Ga0068853_100425663	3300005539	Bacteria	1245
207	Ga0068853_100620502	3300005539	Bacteria	1028
208	Ga0068853_100791615	3300005539	Bacteria	908
209	Ga0068853_100930348	3300005539	Bacteria	835
210	Ga0068853_101096091	3300005539	Bacteria	768
211	Ga0070672_100312023	3300005543	Bacteria	1335
212	Ga0070672_100352051	3300005543	Bacteria	1255
213	Ga0070672_100672249	3300005543	Bacteria	905
214	Ga0070672_101516072	3300005543	Bacteria	601
215	Ga0070686_100040784	3300005544	Bacteria	2898
216	Ga0070686_100052465	3300005544	Bacteria	2600
217	Ga0070686_101102589	3300005544	Bacteria	656
218	Ga0070693_100201807	3300005547	Bacteria	1292
219	Ga0070693_100381253	3300005547	Bacteria	973
220	Ga0070693_100463741	3300005547	Bacteria	892
221	Ga0070693_100583522	3300005547	Bacteria	805
222	Ga0070665_100069837	3300005548	Bacteria	3520
223	Ga0070665_100095277	3300005548	Bacteria	2981
224	Ga0070665_100134698	3300005548	Bacteria	2472
225	Ga0070665_100147507	3300005548	Bacteria	2355
226	Ga0070665_100273585	3300005548	Bacteria	1691
227	Ga0070665_100447235	3300005548	Bacteria	1301
228	Ga0070665_100468900	3300005548	Bacteria	1269
229	Ga0070665_100471288	3300005548	Bacteria	1266
230	Ga0070665_100499618	3300005548	Bacteria	1227
231	Ga0070665_100711551	3300005548	Bacteria	1017
232	Ga0070665_100858381	3300005548	Bacteria	921
233	Ga0070665_101204475	3300005548	Bacteria	768
234	Ga0068855_100012639	3300005563	Bacteria	10189
235	Ga0068855_100015613	3300005563	Bacteria	9138
236	Ga0068855_100022376	3300005563	Bacteria	7574
237	Ga0068855_100027497	3300005563	Bacteria	6802
238	Ga0068855_100057875	3300005563	Bacteria	4542
239	Ga0068855_100076168	3300005563	Bacteria	3894
240	Ga0068855_100095251	3300005563	Bacteria	3431
241	Ga0068855_100330598	3300005563	Bacteria	1682
242	Ga0068855_100480372	3300005563	Bacteria	1353
243	Ga0068855_100920278	3300005563	Bacteria	923
244	Ga0068855_101616726	3300005563	Bacteria	663
245	Ga0070664_100230067	3300005564	Bacteria	1661
246	Ga0070664_100362891	3300005564	Bacteria	1319
247	Ga0068857_100002258	3300005577	Bacteria	15673
248	Ga0068857_100003161	3300005577	Bacteria	13656
249	Ga0068857_100010185	3300005577	Bacteria	8173
250	Ga0068857_100289188	3300005577	Bacteria	1509
251	Ga0068857_100373451	3300005577	Bacteria	1323
252	Ga0068857_100562818	3300005577	Bacteria	1075
253	Ga0068857_101491520	3300005577	Bacteria	659
254	Ga0068857_101721288	3300005577	Bacteria	613
255	Ga0068854_100017222	3300005578	Bacteria	4831
256	Ga0068854_100020463	3300005578	Bacteria	4477
257	Ga0068854_100031593	3300005578	Bacteria	3680
258	Ga0068854_101560552	3300005578	Bacteria	601
259	Ga0068856_100000226	3300005614	Bacteria	61246
260	Ga0068856_100010204	3300005614	Bacteria	9131
261	Ga0068856_100049871	3300005614	Bacteria	4127
262	Ga0068856_100142799	3300005614	Bacteria	2401
263	Ga0068856_100196418	3300005614	Bacteria	2032
264	Ga0068856_100421334	3300005614	Bacteria	1355
265	Ga0068856_100526882	3300005614	Bacteria	1203
266	Ga0068856_100698849	3300005614	Bacteria	1034
267	Ga0068856_100710359	3300005614	Bacteria	1025
268	Ga0068856_100747990	3300005614	Bacteria	998
269	Ga0068856_100843356	3300005614	Bacteria	936
270	Ga0070702_100571668	3300005615	Bacteria	843
271	Ga0070702_100891157	3300005615	Bacteria	696
272	Ga0068852_100002431	3300005616	Bacteria	12818
273	Ga0068852_100031602	3300005616	Bacteria	4371
274	Ga0068852_100076477	3300005616	Bacteria	2956
275	Ga0068852_100117614	3300005616	Bacteria	2427
276	Ga0068852_100132690	3300005616	Bacteria	2295
277	Ga0068852_100252975	3300005616	Bacteria	1688
278	Ga0068852_100327380	3300005616	Bacteria	1490
279	Ga0068852_100402000	3300005616	Bacteria	1347
280	Ga0068852_102506704	3300005616	Bacteria	536
281	Ga0068859_100309146	3300005617	Bacteria	1674
282	Ga0068859_102178498	3300005617	Bacteria	612
283	Ga0068864_100029851	3300005618	Bacteria	4621
284	Ga0068864_100798106	3300005618	Bacteria	928
285	Ga0068866_10291289	3300005718	Bacteria	1015
286	Ga0068866_10491085	3300005718	Bacteria	811
287	Ga0068866_10735271	3300005718	Bacteria	680
288	Ga0068861_100211073	3300005719	Bacteria	1635
289	Ga0068861_100263677	3300005719	Bacteria	1476
290	Ga0068861_101082535	3300005719	Bacteria	769
291	Ga0068851_10001066	3300005834	Bacteria	11866
292	Ga0068851_10049394	3300005834	Bacteria	2134
293	Ga0068851_10262813	3300005834	Bacteria	982
294	Ga0068870_10180895	3300005840	Bacteria	1265
295	Ga0068870_10645078	3300005840	Bacteria	725
296	Ga0068870_11253314	3300005840	Bacteria	539
297	Ga0068863_100354809	3300005841	Bacteria	1428
298	Ga0068863_101508062	3300005841	Bacteria	681
299	Ga0068863_102171307	3300005841	Bacteria	565
300	Ga0068858_100016403	3300005842	Bacteria	6955
301	Ga0068858_100213230	3300005842	Bacteria	1827
302	Ga0068858_100309745	3300005842	Bacteria	1507
303	Ga0068858_101409354	3300005842	Bacteria	686
304	Ga0068860_100002460	3300005843	Bacteria	19444
305	Ga0068860_100340148	3300005843	Bacteria	1475
306	Ga0068860_101022847	3300005843	Bacteria	844
307	Ga0068862_100020522	3300005844	Bacteria	5520
308	Ga0081455_10009815	3300005937	Bacteria	9803
309	Ga0081455_10013913	3300005937	Bacteria	7910
310	Ga0081455_10015806	3300005937	Bacteria	7310
311	Ga0081455_10023478	3300005937	Bacteria	5736
312	Ga0081455_10102876	3300005937	Bacteria	2289
313	Ga0081455_10681865	3300005937	Bacteria	657
314	Ga0081538_10176098	3300005981	Bacteria	924
315	Ga0081538_10192652	3300005981	Bacteria	852
316	Ga0081540_1001578	3300005983	Bacteria	19485
317	Ga0081540_1002067	3300005983	Bacteria	16739
318	Ga0081540_1003114	3300005983	Bacteria	13279
319	Ga0081540_1005059	3300005983	Bacteria	9895
320	Ga0081540_1006735	3300005983	Bacteria	8310
321	Ga0081540_1017895	3300005983	Bacteria	4369
322	Ga0081540_1021310	3300005983	Bacteria	3866
323	Ga0081540_1041491	3300005983	Bacteria	2385
324	Ga0081540_1047846	3300005983	Bacteria	2147
325	Ga0081540_1093992	3300005983	Bacteria	1311
326	Ga0081539_10039203	3300005985	Bacteria	2799
327	Ga0081539_10059269	3300005985	Bacteria	2108
328	Ga0081539_10145111	3300005985	Bacteria	1148
329	Ga0081539_10199121	3300005985	Bacteria	927
330	Ga0070717_10001762	3300006028	Bacteria	15078
331	Ga0070717_10024963	3300006028	Bacteria	4748
332	Ga0070717_10228465	3300006028	Bacteria	1638
333	Ga0070717_10318715	3300006028	Bacteria	1385
334	Ga0070717_10421975	3300006028	Bacteria	1200
335	Ga0075365_10033887	3300006038	Bacteria	3294
336	Ga0075365_10051175	3300006038	Bacteria	2727
337	Ga0075365_10123415	3300006038	Bacteria	1788
338	Ga0075365_10214546	3300006038	Bacteria	1349
339	Ga0075365_10597175	3300006038	Bacteria	781
340	Ga0075365_11225773	3300006038	Bacteria	528
341	Ga0075368_10051919	3300006042	Bacteria	1630
342	Ga0075363_100023753	3300006048	Bacteria	3111
343	Ga0075363_100068710	3300006048	Bacteria	1921
344	Ga0075363_100236537	3300006048	Bacteria	1049
345	Ga0075364_10030902	3300006051	Bacteria	3440
346	Ga0075364_10084117	3300006051	Bacteria	2106
347	Ga0075364_10089535	3300006051	Bacteria	2041
348	Ga0075364_10159677	3300006051	Bacteria	1521
349	Ga0075364_10370480	3300006051	Bacteria	977
350	Ga0075364_10447071	3300006051	Bacteria	883
351	Ga0075364_10752681	3300006051	Bacteria	665
352	Ga0075432_10113477	3300006058	Bacteria	1012
353	Ga0070715_10000142	3300006163	Bacteria	16844
354	Ga0070715_10076205	3300006163	Bacteria	1511
355	Ga0070715_10127809	3300006163	Bacteria	1219
356	Ga0070716_100014703	3300006173	Bacteria	4014
357	Ga0070716_100016170	3300006173	Bacteria	3846
358	Ga0070716_100039668	3300006173	Bacteria	2615
359	Ga0070716_100342471	3300006173	Bacteria	1055
360	Ga0070712_100033238	3300006175	Bacteria	3488
361	Ga0070712_100289008	3300006175	Bacteria	1323
362	Ga0070712_100513998	3300006175	Bacteria	1005
363	Ga0070712_101180036	3300006175	Bacteria	666
364	Ga0075362_10003230	3300006177	Bacteria	5653
365	Ga0075362_10118705	3300006177	Bacteria	1250
366	Ga0075362_10674164	3300006177	Bacteria	538
367	Ga0075367_10093934	3300006178	Bacteria	1827
368	Ga0075367_10160129	3300006178	Bacteria	1399
369	Ga0075367_10233413	3300006178	Bacteria	1152
370	Ga0075367_10306683	3300006178	Bacteria	1000
371	Ga0075367_10341589	3300006178	Bacteria	944
372	Ga0075367_10406940	3300006178	Bacteria	861
373	Ga0075367_10722313	3300006178	Bacteria	634
374	Ga0075369_10034895	3300006186	Bacteria	2136
375	Ga0075369_10038107	3300006186	Bacteria	2050
376	Ga0075369_10050459	3300006186	Bacteria	1799
377	Ga0075369_10129490	3300006186	Bacteria	1146
378	Ga0075369_10207236	3300006186	Bacteria	906
379	Ga0075369_10307338	3300006186	Bacteria	741
380	Ga0075366_10740502	3300006195	Bacteria	611
381	Ga0097621_100033447	3300006237	Bacteria	4095
382	Ga0097621_100065661	3300006237	Bacteria	2987
383	Ga0097621_101199837	3300006237	Bacteria	715
384	Ga0097621_101729311	3300006237	Bacteria	596
385	Ga0097621_101831625	3300006237	Bacteria	579
386	Ga0075370_10026584	3300006353	Bacteria	3206
387	Ga0075370_10052565	3300006353	Bacteria	2312
388	Ga0075370_10069844	3300006353	Bacteria	2008
389	Ga0075370_10071514	3300006353	Bacteria	1984
390	Ga0075370_10080674	3300006353	Bacteria	1869
391	Ga0075370_10174314	3300006353	Bacteria	1265
392	Ga0068871_100935367	3300006358	Bacteria	805
393	Ga0068871_101988180	3300006358	Bacteria	553
394	Ga0075428_100163023	3300006844	Bacteria	2419
395	Ga0075428_100609544	3300006844	Bacteria	1166
396	Ga0075431_100060144	3300006847	Bacteria	3921
397	Ga0075431_100235178	3300006847	Bacteria	1865
398	Ga0075433_10678733	3300006852	Bacteria	903
399	Ga0075434_100016095	3300006871	Bacteria	7187
400	Ga0075434_100058627	3300006871	Bacteria	3826
401	Ga0075434_100134130	3300006871	Bacteria	2496
402	Ga0075434_100898170	3300006871	Bacteria	901
403	Ga0075434_101969681	3300006871	Bacteria	590
404	Ga0075429_100034810	3300006880	Bacteria	4377
405	Ga0075429_100337561	3300006880	Bacteria	1319
406	Ga0068865_100083226	3300006881	Bacteria	2303
407	Ga0068865_100136862	3300006881	Bacteria	1842
408	Ga0068865_100598549	3300006881	Bacteria	931
409	Ga0075436_100395745	3300006914	Bacteria	1000
410	Ga0075436_100476830	3300006914	Bacteria	911
411	Ga0075436_100962980	3300006914	Bacteria	640
412	Ga0097620_100309192	3300006931	Bacteria	1674
413	Ga0097620_102178582	3300006931	Bacteria	612
414	Ga0099824_1003918	3300006942	Bacteria	21572
415	Ga0099824_1007227	3300006942	Bacteria	14828
416	Ga0099822_1001088	3300006943	Bacteria	30109
417	Ga0099822_1078530	3300006943	Bacteria	834
418	Ga0099823_1029624	3300006944	Bacteria	4626
419	Ga0075435_100052103	3300007076	Bacteria	3298
420	Ga0075435_100218296	3300007076	Bacteria	1619
421	Ga0075435_100779746	3300007076	Bacteria	832
422	Ga0099794_10015283	3300007265	Bacteria	3385
423	Ga0099794_10041037	3300007265	Bacteria	2202
424	Ga0099794_10096235	3300007265	Bacteria	1474
425	Ga0099795_10039500	3300007788	Bacteria	1671
426	Ga0099795_10181348	3300007788	Bacteria	879
427	Ga0099795_10343168	3300007788	Bacteria	666
428	Ga0105251_10150677	3300009011	Bacteria	1050
429	Ga0105244_10321948	3300009036	Bacteria	714
430	Ga0105250_10013173	3300009092	Bacteria	3402
431	Ga0105240_10007330	3300009093	Bacteria	16049
432	Ga0105240_10016091	3300009093	Bacteria	10134
433	Ga0105240_10017774	3300009093	Bacteria	9572
434	Ga0105240_10058218	3300009093	Bacteria	4824
435	Ga0105240_10105470	3300009093	Bacteria	3421
436	Ga0105240_10278161	3300009093	Bacteria	1924
437	Ga0105240_10280618	3300009093	Bacteria	1914
438	Ga0105240_10752660	3300009093	Bacteria	1059
439	Ga0105240_11499879	3300009093	Bacteria	707
440	Ga0105240_12212788	3300009093	Bacteria	570
441	Ga0105240_12619065	3300009093	Bacteria	521
442	Ga0111539_10014243	3300009094	Bacteria	9931
443	Ga0111539_10102329	3300009094	Bacteria	3362
444	Ga0111539_10858846	3300009094	Bacteria	1056
445	Ga0111539_11664195	3300009094	Bacteria	740
446	Ga0111539_11988175	3300009094	Bacteria	674
447	Ga0111539_12589340	3300009094	Bacteria	588
448	Ga0105245_10001330	3300009098	Bacteria	22369
449	Ga0105245_10303218	3300009098	Bacteria	1568
450	Ga0105245_10381536	3300009098	Bacteria	1404
451	Ga0105245_10672259	3300009098	Bacteria	1067
452	Ga0105245_11578142	3300009098	Bacteria	708
453	Ga0105245_13115743	3300009098	Bacteria	514
454	Ga0105247_10013516	3300009101	Bacteria	4895
455	Ga0105247_10075857	3300009101	Bacteria	2110
456	Ga0105247_10152871	3300009101	Bacteria	1522
457	Ga0105247_10251201	3300009101	Bacteria	1209
458	Ga0105247_10261660	3300009101	Bacteria	1186
459	Ga0105247_10628322	3300009101	Bacteria	800
460	Ga0105247_10979413	3300009101	Bacteria	659
461	Ga0105247_11118649	3300009101	Bacteria	622
462	Ga0114129_10088522	3300009147	Bacteria	4292
463	Ga0114129_10171539	3300009147	Bacteria	2957
464	Ga0114129_10224593	3300009147	Bacteria	2532
465	Ga0114129_12255374	3300009147	Bacteria	654
466	Ga0114129_12343340	3300009147	Bacteria	640
467	Ga0105243_10132936	3300009148	Bacteria	2113
468	Ga0105243_10167266	3300009148	Bacteria	1901
469	Ga0105243_10432001	3300009148	Bacteria	1231
470	Ga0105243_11796940	3300009148	Bacteria	644
471	Ga0105243_12016666	3300009148	Bacteria	612
472	Ga0105241_10004985	3300009174	Bacteria	9795
473	Ga0105241_10012838	3300009174	Bacteria	6148
474	Ga0105241_10042720	3300009174	Bacteria	3432
475	Ga0105241_11039440	3300009174	Bacteria	768
476	Ga0105241_11701089	3300009174	Bacteria	613
477	Ga0105242_10024046	3300009176	Bacteria	4809
478	Ga0105242_10091499	3300009176	Bacteria	2561
479	Ga0105242_10139076	3300009176	Bacteria	2105
480	Ga0105242_10151612	3300009176	Bacteria	2021
481	Ga0105242_10889906	3300009176	Bacteria	889
482	Ga0105248_10016524	3300009177	Bacteria	8126
483	Ga0105248_10156874	3300009177	Bacteria	2568
484	Ga0105248_10242659	3300009177	Bacteria	2028
485	Ga0105248_11245998	3300009177	Bacteria	841
486	Ga0105248_12745110	3300009177	Bacteria	562
487	Ga0105237_10031685	3300009545	Bacteria	5355
488	Ga0105237_10034896	3300009545	Bacteria	5090
489	Ga0105237_10117511	3300009545	Bacteria	2653
490	Ga0105237_10338462	3300009545	Bacteria	1509
491	Ga0105237_10387903	3300009545	Bacteria	1402
492	Ga0105237_10421004	3300009545	Bacteria	1341
493	Ga0105237_10791674	3300009545	Bacteria	955
494	Ga0105237_11188896	3300009545	Bacteria	769
495	Ga0105237_11704100	3300009545	Bacteria	638
496	Ga0105237_12314228	3300009545	Bacteria	547
497	Ga0105238_10001176	3300009551	Bacteria	26306
498	Ga0105238_10008364	3300009551	Bacteria	10352
499	Ga0105238_10009410	3300009551	Bacteria	9782
500	Ga0105238_10016536	3300009551	Bacteria	7468
501	Ga0105238_10025719	3300009551	Bacteria	6002
502	Ga0105238_10047748	3300009551	Bacteria	4316
503	Ga0105238_10071981	3300009551	Bacteria	3454
504	Ga0105238_10103072	3300009551	Bacteria	2835
505	Ga0105238_10256103	3300009551	Bacteria	1729
506	Ga0105238_10302412	3300009551	Bacteria	1583
507	Ga0105238_10487980	3300009551	Bacteria	1232
508	Ga0105238_10613912	3300009551	Bacteria	1096
509	Ga0105238_11069408	3300009551	Bacteria	829
510	Ga0105249_10223022	3300009553	Bacteria	1856
511	Ga0105249_10271171	3300009553	Bacteria	1691
512	Ga0105249_11137562	3300009553	Bacteria	851
513	Ga0099796_10041555	3300010159	Bacteria	1558
514	Ga0099796_10231971	3300010159	Bacteria	760
515	Ga0099796_10250122	3300010159	Bacteria	736
516	Ga0099796_10282900	3300010159	Bacteria	698
517	Ga0105239_10018610	3300010375	Bacteria	7673
518	Ga0105239_10020339	3300010375	Bacteria	7322
519	Ga0105239_10027329	3300010375	Bacteria	6281
520	Ga0105239_10041512	3300010375	Bacteria	5042
521	Ga0105239_10042922	3300010375	Bacteria	4955
522	Ga0105239_10061664	3300010375	Bacteria	4116
523	Ga0105239_10065510	3300010375	Bacteria	3990
524	Ga0105239_10153244	3300010375	Bacteria	2573
525	Ga0105239_10177235	3300010375	Bacteria	2384
526	Ga0105239_10221406	3300010375	Bacteria	2122
527	Ga0105239_10226845	3300010375	Bacteria	2096
528	Ga0105239_10375058	3300010375	Bacteria	1608
529	Ga0105239_10879664	3300010375	Bacteria	1028
530	Ga0105239_10982203	3300010375	Bacteria	970
531	Ga0105239_12231435	3300010375	Bacteria	637
532	Ga0105246_10044251	3300011119	Bacteria	3025
533	Ga0105246_10125389	3300011119	Bacteria	1910
534	Ga0105246_10635392	3300011119	Bacteria	927
535	Ga0105246_10811012	3300011119	Bacteria	831
536	Ga0105246_11876234	3300011119	Bacteria	575
537	Ga0157314_1004946	3300012500	Bacteria	997
538	Ga0157373_10849147	3300013100	Bacteria	675
539	Ga0157373_10906928	3300013100	Bacteria	654
540	Ga0157370_10071220	3300013104	Bacteria	3280
541	Ga0157370_10179368	3300013104	Bacteria	1968
542	Ga0157370_10369023	3300013104	Bacteria	1323
543	Ga0157369_10004958	3300013105	Bacteria	15596
544	Ga0157369_10013606	3300013105	Bacteria	9203
545	Ga0157369_10032971	3300013105	Bacteria	5693
546	Ga0157369_10038198	3300013105	Bacteria	5250
547	Ga0157369_10051880	3300013105	Bacteria	4438
548	Ga0157369_10209112	3300013105	Bacteria	2046
549	Ga0157369_10455473	3300013105	Bacteria	1325
550	Ga0157369_10549618	3300013105	Bacteria	1194
551	Ga0157369_10669218	3300013105	Bacteria	1070
552	Ga0157374_10266209	3300013296	Bacteria	1689
553	Ga0157374_10271110	3300013296	Bacteria	1673
554	Ga0157374_10280043	3300013296	Bacteria	1646
555	Ga0157374_10416043	3300013296	Bacteria	1342
556	Ga0157374_10450193	3300013296	Bacteria	1289
557	Ga0157378_10017461	3300013297	Bacteria	6298
558	Ga0157378_10474946	3300013297	Bacteria	1245
559	Ga0157378_10907460	3300013297	Bacteria	912
560	Ga0157378_11322924	3300013297	Bacteria	762
561	Ga0157378_11671899	3300013297	Bacteria	683
562	Ga0157378_12455873	3300013297	Bacteria	573
563	Ga0163162_10085469	3300013306	Bacteria	3232
564	Ga0163162_10231618	3300013306	Bacteria	1978
565	Ga0163162_10536080	3300013306	Bacteria	1299
566	Ga0163162_11523157	3300013306	Bacteria	762
567	Ga0163162_11699968	3300013306	Bacteria	721
568	Ga0157372_10192997	3300013307	Bacteria	2359
569	Ga0157372_10256059	3300013307	Bacteria	2032
570	Ga0157372_10981801	3300013307	Bacteria	978
571	Ga0157372_11371144	3300013307	Bacteria	815
572	Ga0157375_10208157	3300013308	Bacteria	2113
573	Ga0157375_10284537	3300013308	Bacteria	1817
574	Ga0157375_10461770	3300013308	Bacteria	1435
575	Ga0157375_10719804	3300013308	Bacteria	1151
576	Ga0157375_11270145	3300013308	Bacteria	865
577	Ga0157375_12342980	3300013308	Bacteria	637
578	Ga0157375_12735088	3300013308	Bacteria	590
579	Ga0163163_10066884	3300014325	Bacteria	3571
580	Ga0163163_10074160	3300014325	Bacteria	3394
581	Ga0163163_10345946	3300014325	Bacteria	1542
582	Ga0163163_10552014	3300014325	Bacteria	1215
583	Ga0163163_10833267	3300014325	Bacteria	986
584	Ga0163163_10990584	3300014325	Bacteria	904
585	Ga0157380_11657332	3300014326	Bacteria	696
586	Ga0157377_10274625	3300014745	Bacteria	1102
587	Ga0157377_10541539	3300014745	Bacteria	821
588	Ga0157379_10131610	3300014968	Bacteria	2252
589	Ga0157379_10789388	3300014968	Bacteria	896
590	Ga0157379_12121408	3300014968	Bacteria	557
591	Ga0157376_10017878	3300014969	Bacteria	5420
592	Ga0157376_10385807	3300014969	Bacteria	1351
593	Ga0157376_10603004	3300014969	Bacteria	1093
594	Ga0157376_11707501	3300014969	Bacteria	665
595	Ga0157376_12303365	3300014969	Bacteria	578
596	Ga0157376_12401247	3300014969	Bacteria	567
597	Ga0163161_10127290	3300017792	Bacteria	1919
598	Ga0163161_10762170	3300017792	Bacteria	810
599	Ga0163161_11035179	3300017792	Bacteria	702
600	Ga0206356_11248236	3300020070	Bacteria	1148
601	Ga0206356_11294382	3300020070	Bacteria	737
602	Ga0206353_10149257	3300020082	Bacteria	2062
603	Ga0206353_10204886	3300020082	Bacteria	2834
604	Ga0206353_10556547	3300020082	Bacteria	589
605	Ga0214544_1000003	3300021320	Bacteria	643752
606	Ga0214542_1000003	3300021321	Bacteria	435700
607	Ga0214545_1000004	3300021324	Bacteria	453352
608	Ga0214545_1029912	3300021324	Bacteria	2383
609	Ga0214543_1000007	3300021327	Bacteria	414744
610	Ga0213872_10189079	3300021361	Bacteria	887
611	Ga0213874_10029976	3300021377	Bacteria	1565
612	Ga0213874_10406190	3300021377	Bacteria	531
613	Ga0213876_10009446	3300021384	Bacteria	5249
614	Ga0213876_10193305	3300021384	Bacteria	1082
615	Ga0213876_10244266	3300021384	Bacteria	954
616	Ga0224712_10227970	3300022467	Bacteria	855
617	Ga0228598_1024086	3300024227	Bacteria	1198
618	Ga0209563_100565	3300025230	Bacteria	12334
619	Ga0209148_1004477	3300025254	Bacteria	3435
620	Ga0209233_1000798	3300025261	Bacteria	14123
621	Ga0209233_1003633	3300025261	Bacteria	5400
622	Ga0209455_1003734	3300025272	Bacteria	5257
623	Ga0209564_1009014	3300025295	Bacteria	4815
624	Ga0209564_1039702	3300025295	Bacteria	1289
625	Ga0209758_1000030	3300025297	Bacteria	509217
626	Ga0209758_1000277	3300025297	Bacteria	102106
627	Ga0209758_1001754	3300025297	Bacteria	24100
628	Ga0209758_1002104	3300025297	Bacteria	21134
629	Ga0209758_1003575	3300025297	Bacteria	13918
630	Ga0209758_1003837	3300025297	Bacteria	13190
631	Ga0209758_1010686	3300025297	Bacteria	5451
632	Ga0209758_1014379	3300025297	Bacteria	4215
633	Ga0209758_1113777	3300025297	Bacteria	743
634	Ga0209256_1005584	3300025299	Bacteria	7158
635	Ga0207426_1000271	3300025302	Bacteria	108392
636	Ga0207426_1010809	3300025302	Bacteria	3522
637	Ga0207426_1019983	3300025302	Bacteria	2334
638	Ga0209257_1000947	3300025304	Bacteria	40051
639	Ga0209257_1021088	3300025304	Bacteria	2380
640	Ga0209257_1077950	3300025304	Bacteria	857
641	Ga0207697_10038963	3300025315	Bacteria	1950
642	Ga0207697_10104487	3300025315	Bacteria	1210
643	Ga0207656_10045832	3300025321	Bacteria	1873
644	Ga0207656_10142053	3300025321	Bacteria	1132
645	Ga0207656_10586594	3300025321	Bacteria	569
646	Ga0207682_10079003	3300025893	Bacteria	1407
647	Ga0207692_10001326	3300025898	Bacteria	9217
648	Ga0207692_10005092	3300025898	Bacteria	5238
649	Ga0207692_10022778	3300025898	Bacteria	2888
650	Ga0207692_10065564	3300025898	Bacteria	1895
651	Ga0207692_10144626	3300025898	Bacteria	1356
652	Ga0207692_10777671	3300025898	Bacteria	625
653	Ga0207642_10048368	3300025899	Bacteria	1906
654	Ga0207642_10320818	3300025899	Bacteria	905
655	Ga0207710_10343557	3300025900	Bacteria	759
656	Ga0207688_10051906	3300025901	Bacteria	2297
657	Ga0207688_10078011	3300025901	Bacteria	1888
658	Ga0207688_10079764	3300025901	Bacteria	1867
659	Ga0207688_10428314	3300025901	Bacteria	823
660	Ga0207688_10525932	3300025901	Bacteria	742
661	Ga0207647_10012868	3300025904	Bacteria	5813
662	Ga0207647_10033957	3300025904	Bacteria	3261
663	Ga0207647_10258599	3300025904	Bacteria	997
664	Ga0207647_10380355	3300025904	Bacteria	797
665	Ga0207647_10380709	3300025904	Bacteria	797
666	Ga0207647_10678092	3300025904	Bacteria	563
667	Ga0207685_10000486	3300025905	Bacteria	6737
668	Ga0207685_10060098	3300025905	Bacteria	1501
669	Ga0207685_10215163	3300025905	Bacteria	911
670	Ga0207685_10291563	3300025905	Bacteria	804
671	Ga0207699_10000506	3300025906	Bacteria	19377
672	Ga0207699_10015549	3300025906	Bacteria	3956
673	Ga0207699_10026384	3300025906	Bacteria	3202
674	Ga0207699_10044225	3300025906	Bacteria	2591
675	Ga0207699_10153982	3300025906	Bacteria	1524
676	Ga0207699_10315035	3300025906	Bacteria	1096
677	Ga0207699_10936030	3300025906	Bacteria	640
678	Ga0207699_11129769	3300025906	Bacteria	580
679	Ga0207645_10126936	3300025907	Bacteria	1658
680	Ga0207645_10721795	3300025907	Bacteria	677
681	Ga0207645_10829394	3300025907	Bacteria	629
682	Ga0207643_10435686	3300025908	Bacteria	832
683	Ga0207643_10522758	3300025908	Bacteria	760
684	Ga0207643_10851225	3300025908	Bacteria	591
685	Ga0207705_10034716	3300025909	Bacteria	3607
686	Ga0207705_10038939	3300025909	Bacteria	3406
687	Ga0207705_10140511	3300025909	Bacteria	1803
688	Ga0207705_10822608	3300025909	Bacteria	721
689	Ga0207705_11032948	3300025909	Bacteria	634
690	Ga0207705_11250465	3300025909	Bacteria	568
691	Ga0207684_10230856	3300025910	Bacteria	1597
692	Ga0207684_10475581	3300025910	Bacteria	1072
693	Ga0207654_10000231	3300025911	Bacteria	34134
694	Ga0207654_10063022	3300025911	Bacteria	2174
695	Ga0207654_10150266	3300025911	Bacteria	1494
696	Ga0207707_10043667	3300025912	Bacteria	3908
697	Ga0207707_10081107	3300025912	Bacteria	2832
698	Ga0207707_10090186	3300025912	Bacteria	2679
699	Ga0207707_10172780	3300025912	Bacteria	1888
700	Ga0207707_10201739	3300025912	Bacteria	1734
701	Ga0207707_10499083	3300025912	Bacteria	1038
702	Ga0207695_10000059	3300025913	Bacteria	363920
703	Ga0207695_10005928	3300025913	Bacteria	16015
704	Ga0207695_10042112	3300025913	Bacteria	4882
705	Ga0207695_10133300	3300025913	Bacteria	2440
706	Ga0207695_10153709	3300025913	Bacteria	2238
707	Ga0207695_10172875	3300025913	Bacteria	2085
708	Ga0207695_10356682	3300025913	Bacteria	1349
709	Ga0207695_10979343	3300025913	Bacteria	725
710	Ga0207671_10087819	3300025914	Bacteria	2339
711	Ga0207671_10324699	3300025914	Bacteria	1218
712	Ga0207671_10565268	3300025914	Bacteria	907
713	Ga0207671_10615327	3300025914	Bacteria	865
714	Ga0207671_10856654	3300025914	Bacteria	719
715	Ga0207671_11260719	3300025914	Bacteria	577
716	Ga0207671_11313673	3300025914	Bacteria	563
717	Ga0207671_11555768	3300025914	Bacteria	509
718	Ga0207693_10004727	3300025915	Bacteria	11453
719	Ga0207693_10039692	3300025915	Bacteria	3706
720	Ga0207693_10094494	3300025915	Bacteria	2343
721	Ga0207693_10478865	3300025915	Bacteria	972
722	Ga0207693_11087339	3300025915	Bacteria	608
723	Ga0207663_10000159	3300025916	Bacteria	31170
724	Ga0207663_10012019	3300025916	Bacteria	4668
725	Ga0207663_10016632	3300025916	Bacteria	4084
726	Ga0207663_10086292	3300025916	Bacteria	2069
727	Ga0207663_10483656	3300025916	Bacteria	959
728	Ga0207660_10044422	3300025917	Bacteria	3126
729	Ga0207660_10217071	3300025917	Bacteria	1499
730	Ga0207660_10740811	3300025917	Bacteria	802
731	Ga0207662_10066579	3300025918	Bacteria	2170
732	Ga0207657_10007810	3300025919	Bacteria	10918
733	Ga0207657_10034251	3300025919	Bacteria	4569
734	Ga0207657_10076656	3300025919	Bacteria	2820
735	Ga0207657_10149631	3300025919	Bacteria	1902
736	Ga0207657_10420893	3300025919	Bacteria	1050
737	Ga0207657_10737686	3300025919	Bacteria	763
738	Ga0207649_10124846	3300025920	Bacteria	1740
739	Ga0207649_10370364	3300025920	Bacteria	1065
740	Ga0207649_10421063	3300025920	Bacteria	1003
741	Ga0207649_10480934	3300025920	Bacteria	942
742	Ga0207649_10521927	3300025920	Bacteria	906
743	Ga0207649_10695087	3300025920	Bacteria	788
744	Ga0207652_10009284	3300025921	Bacteria	7906
745	Ga0207652_10365568	3300025921	Bacteria	1302
746	Ga0207652_10658412	3300025921	Bacteria	936
747	Ga0207652_10900759	3300025921	Bacteria	781
748	Ga0207646_10050126	3300025922	Bacteria	3737
749	Ga0207646_10161338	3300025922	Bacteria	2023
750	Ga0207681_10457280	3300025923	Bacteria	1039
751	Ga0207694_10000719	3300025924	Bacteria	29735
752	Ga0207694_10003079	3300025924	Bacteria	13349
753	Ga0207694_10016413	3300025924	Bacteria	5591
754	Ga0207694_10018441	3300025924	Bacteria	5274
755	Ga0207694_10061921	3300025924	Bacteria	2912
756	Ga0207694_10176232	3300025924	Bacteria	1733
757	Ga0207694_10366480	3300025924	Bacteria	1194
758	Ga0207694_10727977	3300025924	Bacteria	837
759	Ga0207694_10833286	3300025924	Bacteria	779
760	Ga0207694_10864072	3300025924	Bacteria	765
761	Ga0207650_10769153	3300025925	Bacteria	815
762	Ga0207659_10696530	3300025926	Bacteria	870
763	Ga0207687_10042823	3300025927	Bacteria	3117
764	Ga0207700_10008950	3300025928	Bacteria	6232
765	Ga0207700_10021241	3300025928	Bacteria	4428
766	Ga0207700_10057543	3300025928	Bacteria	2932
767	Ga0207700_10475387	3300025928	Bacteria	1104
768	Ga0207700_10865670	3300025928	Bacteria	809
769	Ga0207700_10926456	3300025928	Bacteria	780
770	Ga0207664_10017733	3300025929	Bacteria	5227
771	Ga0207664_10081097	3300025929	Bacteria	2639
772	Ga0207664_10120467	3300025929	Bacteria	2195
773	Ga0207664_10968218	3300025929	Bacteria	763
774	Ga0207664_11100869	3300025929	Bacteria	710
775	Ga0207664_11161196	3300025929	Bacteria	689
776	Ga0207644_10085279	3300025931	Bacteria	2343
777	Ga0207644_10353809	3300025931	Bacteria	1193
778	Ga0207644_10949237	3300025931	Bacteria	721
779	Ga0207690_10059293	3300025932	Bacteria	2593
780	Ga0207690_10112928	3300025932	Bacteria	1960
781	Ga0207690_10419208	3300025932	Bacteria	1071
782	Ga0207690_10466414	3300025932	Bacteria	1017
783	Ga0207706_10042960	3300025933	Bacteria	4006
784	Ga0207706_10073375	3300025933	Bacteria	3009
785	Ga0207706_10226427	3300025933	Bacteria	1636
786	Ga0207686_10199013	3300025934	Bacteria	1434
787	Ga0207709_11291842	3300025935	Bacteria	603
788	Ga0207669_10002754	3300025937	Bacteria	7537
789	Ga0207669_10022732	3300025937	Bacteria	3336
790	Ga0207669_10116993	3300025937	Bacteria	1800
791	Ga0207669_10861909	3300025937	Bacteria	754
792	Ga0207704_10033006	3300025938	Bacteria	2938
793	Ga0207704_10158754	3300025938	Bacteria	1606
794	Ga0207704_10184750	3300025938	Bacteria	1510
795	Ga0207704_10294390	3300025938	Bacteria	1240
796	Ga0207704_10368569	3300025938	Bacteria	1124
797	Ga0207704_11548592	3300025938	Bacteria	569
798	Ga0207665_10002498	3300025939	Bacteria	12378
799	Ga0207665_10009386	3300025939	Bacteria	6419
800	Ga0207665_10028572	3300025939	Bacteria	3684
801	Ga0207665_10033938	3300025939	Bacteria	3385
802	Ga0207665_10038319	3300025939	Bacteria	3191
803	Ga0207665_10089691	3300025939	Bacteria	2130
804	Ga0207665_10826841	3300025939	Bacteria	733
805	Ga0207691_10072272	3300025940	Bacteria	3112
806	Ga0207691_10087699	3300025940	Bacteria	2792
807	Ga0207691_10214805	3300025940	Bacteria	1669
808	Ga0207711_10191755	3300025941	Bacteria	1863
809	Ga0207711_10352157	3300025941	Bacteria	1363
810	Ga0207689_10745291	3300025942	Bacteria	826
811	Ga0207689_11784599	3300025942	Bacteria	508
812	Ga0207661_10000430	3300025944	Bacteria	27090
813	Ga0207661_10015382	3300025944	Bacteria	5630
814	Ga0207661_10976355	3300025944	Bacteria	780
815	Ga0207661_11343236	3300025944	Bacteria	656
816	Ga0207679_10207293	3300025945	Bacteria	1642
817	Ga0207679_11307797	3300025945	Bacteria	665
818	Ga0207667_10008537	3300025949	Bacteria	12160
819	Ga0207667_10012011	3300025949	Bacteria	10022
820	Ga0207667_10058728	3300025949	Bacteria	4033
821	Ga0207667_10087250	3300025949	Bacteria	3228
822	Ga0207667_10112461	3300025949	Bacteria	2808
823	Ga0207667_10145576	3300025949	Bacteria	2439
824	Ga0207667_10155347	3300025949	Bacteria	2354
825	Ga0207667_10162378	3300025949	Bacteria	2298
826	Ga0207667_10541062	3300025949	Bacteria	1178
827	Ga0207667_10595148	3300025949	Bacteria	1115
828	Ga0207651_10011545	3300025960	Bacteria	4950
829	Ga0207651_10662404	3300025960	Bacteria	917
830	Ga0207668_10046931	3300025972	Bacteria	2955
831	Ga0207668_10295071	3300025972	Bacteria	1335
832	Ga0207668_11034619	3300025972	Bacteria	735
833	Ga0207668_11253174	3300025972	Bacteria	667
834	Ga0207668_11564208	3300025972	Bacteria	595
835	Ga0207668_11651253	3300025972	Bacteria	578
836	Ga0207640_10133473	3300025981	Bacteria	1798
837	Ga0207640_10139761	3300025981	Bacteria	1764
838	Ga0207640_10148865	3300025981	Bacteria	1717
839	Ga0207640_10179825	3300025981	Bacteria	1585
840	Ga0207640_11127481	3300025981	Bacteria	695
841	Ga0207640_11402572	3300025981	Bacteria	626
842	Ga0207640_11620844	3300025981	Bacteria	583
843	Ga0207658_10073830	3300025986	Bacteria	2590
844	Ga0207658_10707761	3300025986	Bacteria	910
845	Ga0207658_10917860	3300025986	Bacteria	798
846	Ga0207677_10130754	3300026023	Bacteria	1905
847	Ga0207677_10229755	3300026023	Bacteria	1494
848	Ga0207677_12310811	3300026023	Bacteria	500
849	Ga0207703_10419759	3300026035	Bacteria	1245
850	Ga0207703_10935997	3300026035	Bacteria	830
851	Ga0207639_10040400	3300026041	Bacteria	3481
852	Ga0207639_10049333	3300026041	Bacteria	3192
853	Ga0207639_10068565	3300026041	Bacteria	2764
854	Ga0207639_10085004	3300026041	Bacteria	2515
855	Ga0207639_10345733	3300026041	Bacteria	1327
856	Ga0207639_10357398	3300026041	Bacteria	1306
857	Ga0207639_10394909	3300026041	Bacteria	1245
858	Ga0207639_10523359	3300026041	Bacteria	1086
859	Ga0207639_10664678	3300026041	Bacteria	965
860	Ga0207639_11120161	3300026041	Bacteria	738
861	Ga0207678_10015894	3300026067	Bacteria	6613
862	Ga0207678_10027543	3300026067	Bacteria	4959
863	Ga0207678_10029065	3300026067	Bacteria	4824
864	Ga0207678_10030740	3300026067	Bacteria	4688
865	Ga0207678_10090465	3300026067	Bacteria	2616
866	Ga0207678_10111037	3300026067	Bacteria	2339
867	Ga0207678_10112828	3300026067	Bacteria	2319
868	Ga0207678_10131247	3300026067	Bacteria	2137
869	Ga0207678_10132940	3300026067	Bacteria	2123
870	Ga0207678_10190043	3300026067	Bacteria	1754
871	Ga0207678_10247182	3300026067	Bacteria	1527
872	Ga0207678_10673358	3300026067	Bacteria	910
873	Ga0207678_12010291	3300026067	Bacteria	503
874	Ga0207708_10152659	3300026075	Bacteria	1819
875	Ga0207702_10000191	3300026078	Bacteria	72810
876	Ga0207702_10000938	3300026078	Bacteria	30006
877	Ga0207702_10190101	3300026078	Bacteria	1896
878	Ga0207702_10364273	3300026078	Bacteria	1386
879	Ga0207702_10424492	3300026078	Bacteria	1286
880	Ga0207702_10815843	3300026078	Bacteria	922
881	Ga0207641_10566890	3300026088	Bacteria	1109
882	Ga0207641_10661808	3300026088	Bacteria	1026
883	Ga0207641_12109218	3300026088	Bacteria	564
884	Ga0207641_12174310	3300026088	Bacteria	555
885	Ga0207648_10055230	3300026089	Bacteria	3467
886	Ga0207648_10840419	3300026089	Bacteria	856
887	Ga0207676_10165042	3300026095	Bacteria	1923
888	Ga0207676_11865586	3300026095	Bacteria	600
889	Ga0207674_10006709	3300026116	Bacteria	13513
890	Ga0207674_10010337	3300026116	Bacteria	10580
891	Ga0207674_10011116	3300026116	Bacteria	10124
892	Ga0207674_10026497	3300026116	Bacteria	6153
893	Ga0207674_10286743	3300026116	Bacteria	1595
894	Ga0207674_10303229	3300026116	Bacteria	1546
895	Ga0207674_10351486	3300026116	Bacteria	1425
896	Ga0207674_10445440	3300026116	Bacteria	1252
897	Ga0207674_11558957	3300026116	Bacteria	629
898	Ga0207675_100304862	3300026118	Bacteria	1552
899	Ga0207683_10060949	3300026121	Bacteria	3318
900	Ga0207683_10067695	3300026121	Bacteria	3151
901	Ga0207683_10208077	3300026121	Bacteria	1780
902	Ga0207683_10270007	3300026121	Bacteria	1554
903	Ga0207698_10027187	3300026142	Bacteria	4058
904	Ga0207698_10084876	3300026142	Bacteria	2569
905	Ga0207698_10128949	3300026142	Bacteria	2158
906	Ga0207698_10378248	3300026142	Bacteria	1346
907	Ga0207698_10539375	3300026142	Bacteria	1141
908	Ga0207698_10673322	3300026142	Bacteria	1027
909	Ga0207698_10682806	3300026142	Bacteria	1020
910	Ga0207698_11259519	3300026142	Bacteria	754
911	Ga0207698_12221714	3300026142	Bacteria	561
912	Ga0209389_1000193	3300027296	Bacteria	44705
913	Ga0209389_1000207	3300027296	Bacteria	42300
914	Ga0209589_1000024	3300027357	Bacteria	169886
915	Ga0209589_1000025	3300027357	Bacteria	165546
916	Ga0209489_100039	3300027361	Bacteria	165546
917	Ga0209489_101741	3300027361	Bacteria	44747
918	Ga0209489_101963	3300027361	Bacteria	42342
919	Ga0209700_100043	3300027363	Bacteria	167890
920	Ga0209700_100420	3300027363	Bacteria	77617
921	Ga0209179_1066224	3300027512	Bacteria	788
922	Ga0209588_1004016	3300027671	Bacteria	4119
923	Ga0209588_1037418	3300027671	Bacteria	1562
924	Ga0207428_10710494	3300027907	Bacteria	718
925	Ga0265356_1021217	3300028017	Bacteria	703
926	Ga0268266_10004890	3300028379	Bacteria	12709
927	Ga0268266_10058860	3300028379	Bacteria	3309
928	Ga0268266_10108572	3300028379	Bacteria	2455
929	Ga0268266_10342069	3300028379	Bacteria	1404
930	Ga0268266_10471478	3300028379	Bacteria	1196
931	Ga0268266_10553457	3300028379	Bacteria	1102
932	Ga0268266_10675796	3300028379	Bacteria	994
933	Ga0268266_11926381	3300028379	Bacteria	565
934	Ga0268265_10680924	3300028380	Bacteria	991
935	Ga0268264_10000051	3300028381	Bacteria	321565
936	Ga0268264_10335416	3300028381	Bacteria	1435
937	Ga0268264_10775214	3300028381	Bacteria	957
938	Ga0268264_11332041	3300028381	Bacteria	728
939	Ga0265337_1007953	3300028556	Bacteria	3909
940	Ga0265326_10031478	3300028558	Bacteria	1511
941	Ga0265319_1014867	3300028563	Bacteria	3036
942	Ga0265334_10012764	3300028573	Bacteria	3525
943	Ga0265318_10036000	3300028577	Bacteria	1901
944	Ga0265323_10003727	3300028653	Bacteria	6664
945	Ga0265322_10134158	3300028654	Bacteria	706
946	Ga0265336_10000986	3300028666	Bacteria	14032
947	Ga0307517_10028420	3300028786	Bacteria	6664
948	Ga0307517_10257683	3300028786	Bacteria	1016
949	Ga0307517_10465156	3300028786	Bacteria	652
950	Ga0307515_10104336	3300028794	Bacteria	3388
951	Ga0265338_10000231	3300028800	Bacteria	103805
952	Ga0265338_10071491	3300028800	Bacteria	2967
953	Ga0265338_10354125	3300028800	Bacteria	1055
954	Ga0265324_10003261	3300029957	Bacteria	7808
955	Ga0307511_10121284	3300030521	Bacteria	1615
956	Ga0265763_1022818	3300030763	Bacteria	669
957	Ga0265330_10021301	3300031235	Bacteria	2960
958	Ga0265330_10051147	3300031235	Bacteria	1812
959	Ga0265328_10068027	3300031239	Bacteria	1308
960	Ga0265325_10015261	3300031241	Bacteria	4323
961	Ga0265325_10025399	3300031241	Bacteria	3217
962	Ga0265325_10345392	3300031241	Bacteria	658
963	Ga0265329_10048118	3300031242	Bacteria	1360
964	Ga0265329_10148201	3300031242	Bacteria	760
965	Ga0265340_10014636	3300031247	Bacteria	4091
966	Ga0265340_10098564	3300031247	Bacteria	1360
967	Ga0265339_10001183	3300031249	Bacteria	19723
968	Ga0265339_10001578	3300031249	Bacteria	16850
969	Ga0265339_10010637	3300031249	Bacteria	5704
970	Ga0265339_10042849	3300031249	Bacteria	2505
971	Ga0265339_10058306	3300031249	Bacteria	2085
972	Ga0265339_10123019	3300031249	Bacteria	1332
973	Ga0265339_10215776	3300031249	Bacteria	940
974	Ga0265339_10265242	3300031249	Bacteria	827
975	Ga0265331_10051543	3300031250	Bacteria	1969
976	Ga0265331_10054634	3300031250	Bacteria	1901
977	Ga0265331_10073986	3300031250	Bacteria	1590
978	Ga0265331_10169541	3300031250	Bacteria	988
979	Ga0265316_10086105	3300031344	Bacteria	2403
980	Ga0265316_10185317	3300031344	Bacteria	1548
981	Ga0265316_10434969	3300031344	Bacteria	942
982	Ga0265316_10808957	3300031344	Bacteria	657
983	Ga0265316_10877524	3300031344	Bacteria	627
984	Ga0307513_10499285	3300031456	Bacteria	934
985	Ga0307509_10171438	3300031507	Bacteria	2048
986	Ga0307509_10283550	3300031507	Bacteria	1416
987	Ga0307509_10662490	3300031507	Bacteria	712
988	Ga0307509_10715162	3300031507	Bacteria	668
989	Ga0307408_100653764	3300031548	Bacteria	940
990	Ga0307408_100814737	3300031548	Bacteria	848
991	Ga0265313_10001097	3300031595	Bacteria	26024
992	Ga0265313_10258073	3300031595	Bacteria	709
993	Ga0307508_10000152	3300031616	Bacteria	82883
994	Ga0307508_10032379	3300031616	Bacteria	4723
995	Ga0307508_10072313	3300031616	Bacteria	3023
996	Ga0307508_10371999	3300031616	Bacteria	1020
997	Ga0307508_10437615	3300031616	Bacteria	899
998	Ga0265314_10029892	3300031711	Bacteria	4042
999	Ga0265314_10036532	3300031711	Bacteria	3569
1000	Ga0265314_10055574	3300031711	Bacteria	2731
1001	Ga0265314_10194337	3300031711	Bacteria	1205
1002	Ga0265314_10226360	3300031711	Bacteria	1088
1003	Ga0265342_10001317	3300031712	Bacteria	23276
1004	Ga0265342_10006255	3300031712	Bacteria	8889
1005	Ga0265342_10038636	3300031712	Bacteria	2905
1006	Ga0265342_10569951	3300031712	Bacteria	573
1007	Ga0265342_10659980	3300031712	Bacteria	525
1008	Ga0307516_10007620	3300031730	Bacteria	12398
1009	Ga0307516_10027547	3300031730	Bacteria	5762
1010	Ga0307516_10042523	3300031730	Bacteria	4507
1011	Ga0307516_10136347	3300031730	Bacteria	2228
1012	Ga0307516_10258142	3300031730	Bacteria	1434
1013	Ga0307516_10382834	3300031730	Bacteria	1068
1014	Ga0307405_10406407	3300031731	Bacteria	1067
1015	Ga0307405_11841936	3300031731	Bacteria	539
1016	Ga0307413_10571877	3300031824	Bacteria	920
1017	Ga0307518_10435261	3300031838	Bacteria	711
1018	Ga0307410_11811919	3300031852	Bacteria	542
1019	Ga0307406_10036717	3300031901	Bacteria	3021
1020	Ga0307406_10543802	3300031901	Bacteria	949
1021	Ga0307406_11566333	3300031901	Bacteria	581
1022	Ga0307407_10319590	3300031903	Bacteria	1089
1023	Ga0307407_10448268	3300031903	Bacteria	936
1024	Ga0307412_10101287	3300031911	Bacteria	2038
1025	Ga0307412_10225589	3300031911	Bacteria	1439
1026	Ga0307412_10788372	3300031911	Bacteria	824
1027	Ga0307412_11096059	3300031911	Bacteria	708
1028	Ga0307409_101592038	3300031995	Bacteria	681
1029	Ga0307416_100348827	3300032002	Bacteria	1497
1030	Ga0307416_100905319	3300032002	Bacteria	982
1031	Ga0307416_101814770	3300032002	Bacteria	714
1032	Ga0307414_10061652	3300032004	Bacteria	2657
1033	Ga0307414_11497913	3300032004	Bacteria	628
1034	Ga0307411_11155785	3300032005	Bacteria	700
1035	Ga0307415_100057475	3300032126	Bacteria	2673
1036	Ga0307415_101202135	3300032126	Bacteria	714
1037	Ga0307507_10052199	3300033179	Bacteria	3923
1038	Ga0307507_10463381	3300033179	Bacteria	695
1039	Ga0307507_10604852	3300033179	Bacteria	565
1040	Ga0307510_10039048	3300033180	Bacteria	5238
1041	Ga0307510_10039183	3300033180	Bacteria	5225
1042	Ga0307510_10046218	3300033180	Bacteria	4684
1043	Ga0307510_10424581	3300033180	Bacteria	771
1044	Ga0307510_10522695	3300033180	Bacteria	631
1045	Ga0373930_0040142	3300034816	Bacteria	994
1046	Ga0373959_0062925	3300034820	Bacteria	825
1047	Ga0373926_0033617	3300035083	Bacteria	1813
1048	Ga0373926_0067816	3300035083	Bacteria	1307
1049	Ga0373926_0085904	3300035083	Bacteria	1167
1050	Ga0373934_0010358	3300035086	Bacteria	3499
1051	Ga0373934_0079839	3300035086	Bacteria	1314
1052	Ga0373934_0102394	3300035086	Bacteria	1158
1053	Ga0373934_0121746	3300035086	Bacteria	1062
1054	Ga0373934_0148705	3300035086	Bacteria	959
1055	Ga0373934_0401392	3300035086	Bacteria	573
1056	Ga0373940_0251784	3300035088	Bacteria	595
1057	Ga0373944_0191820	3300035089	Bacteria	736
1058	Ga0373951_0082011	3300035091	Bacteria	836
1059	Ga0373951_0135758	3300035091	Bacteria	680
1060	Ga0373952_0122542	3300035092	Bacteria	707
1061	Ga0373923_0027038	3300035111	Bacteria	2286
1062	Ga0373923_0285942	3300035111	Bacteria	778
1063	Ga0373932_0013863	3300035112	Bacteria	2015
1064	Ga0373936_0001116	3300035113	Bacteria	9626
1065	Ga0373936_0044023	3300035113	Bacteria	1795
1066	Ga0373936_0049476	3300035113	Bacteria	1698
1067	Ga0373936_0092843	3300035113	Bacteria	1267
1068	Ga0373936_0251883	3300035113	Bacteria	789
1069	Ga0373936_0526152	3300035113	Bacteria	551
1070	Ga0373941_0428519	3300035115	Bacteria	552
1071	Ga0373945_0009991	3300035116	Bacteria	3118
1072	Ga0373945_0042897	3300035116	Bacteria	1640
1073	Ga0373945_0121566	3300035116	Bacteria	1038
1074	Ga0373945_0255287	3300035116	Bacteria	741
1075	Ga0373953_0000719	3300035117	Bacteria	9150
1076	Ga0373953_0030660	3300035117	Bacteria	2086
1077	Ga0373953_0292447	3300035117	Bacteria	710
1078	Ga0373953_0335695	3300035117	Bacteria	661
1079	Ga0373954_0002198	3300035118	Bacteria	8102
1080	Ga0373954_0015399	3300035118	Bacteria	3418
1081	Ga0373954_0016751	3300035118	Bacteria	3285
1082	Ga0373956_0002899	3300035119	Bacteria	6942
1083	Ga0373956_0004758	3300035119	Bacteria	5434
1084	Ga0373956_0118838	3300035119	Bacteria	1234
1085	Ga0373956_0254837	3300035119	Bacteria	834
1086	Ga0373957_0016376	3300035120	Bacteria	2565
1087	Ga0373957_0063547	3300035120	Bacteria	1434
1088	Ga0373957_0074212	3300035120	Bacteria	1335
1089	Ga0373960_0391225	3300035121	Bacteria	535
1090	Ga0373960_0393440	3300035121	Bacteria	533
1091	Ga0373943_0005727	3300035170	Bacteria	5576
1092	Ga0373943_0008248	3300035170	Bacteria	4675
1093	Ga0373943_0065940	3300035170	Bacteria	1822
1094	Ga0373943_0381347	3300035170	Bacteria	812
1095	Ga0373943_0602671	3300035170	Bacteria	647
1096	Ga0373946_0000239	3300035171	Bacteria	17240
1097	Ga0373946_0028732	3300035171	Bacteria	2207
1098	Ga0373946_0061120	3300035171	Bacteria	1603
1099	Ga0373946_0098330	3300035171	Bacteria	1308
1100	Ga0373955_0000199	3300035172	Bacteria	24890
1101	Ga0373955_0000818	3300035172	Bacteria	13315
1102	Ga0373955_0075085	3300035172	Bacteria	1899
1103	Ga0373955_0111118	3300035172	Bacteria	1584
1104	Ga0373955_0159344	3300035172	Bacteria	1331
1105	Ga0373955_0307326	3300035172	Bacteria	957
1106	Ga0373955_0356233	3300035172	Bacteria	886
1107	Ga0373961_0409808	3300035241	Bacteria	522
1108	Ga0373962_0358696	3300035242	Bacteria	529
1109	Ga0373924_0007480	3300035410	Bacteria	3945
1110	Ga0373924_0016977	3300035410	Bacteria	2786
1111	Ga0373924_0024903	3300035410	Bacteria	2362
1112	Ga0373924_0042122	3300035410	Bacteria	1872
1113	Ga0373924_0535523	3300035410	Bacteria	527
1114	Ga0373931_0032072	3300035691	Bacteria	2716
1115	Ga0373931_0044855	3300035691	Bacteria	2333
1116	Ga0373931_0064253	3300035691	Bacteria	1986
1117	Ga0373931_0150142	3300035691	Bacteria	1357
1118	Ga0373931_0344280	3300035691	Bacteria	932
1119	Ga0373931_0436776	3300035691	Bacteria	835
1120	Ga0373931_1126917	3300035691	Bacteria	535
1121	Ga0373935_0000054	3300035692	Bacteria	46833
1122	Ga0373935_0001370	3300035692	Bacteria	13464
1123	Ga0373935_0011477	3300035692	Bacteria	5318
1124	Ga0373935_0101489	3300035692	Bacteria	1897
1125	Ga0373935_0110557	3300035692	Bacteria	1824
1126	Ga0373935_0260858	3300035692	Bacteria	1215
1127	Ga0373935_0316756	3300035692	Bacteria	1106
1128	Ga0373935_0446476	3300035692	Bacteria	934
1129	Ga0373935_0546269	3300035692	Bacteria	844
1130	Ga0373935_0764582	3300035692	Bacteria	712
1131	Ga0373927_0003159	3300035695	Bacteria	11896
1132	Ga0373927_0004401	3300035695	Bacteria	9875
1133	Ga0373927_0012773	3300035695	Bacteria	5588
1134	Ga0373927_0018834	3300035695	Bacteria	4529
1135	Ga0373927_0027567	3300035695	Bacteria	3708
1136	Ga0373927_0031599	3300035695	Bacteria	3449
1137	Ga0373927_0039534	3300035695	Bacteria	3061
1138	Ga0373927_0087351	3300035695	Bacteria	2024
1139	Ga0373927_0115547	3300035695	Bacteria	1749
1140	Ga0373927_0124166	3300035695	Bacteria	1685
1141	Ga0373927_0345506	3300035695	Bacteria	980
1142	Ga0373927_0367517	3300035695	Bacteria	948
1143	Ga0373933_0000018	3300035724	Bacteria	98044
1144	Ga0373933_0001735	3300035724	Bacteria	12656
1145	Ga0373933_0002567	3300035724	Bacteria	10181
1146	Ga0373933_0028845	3300035724	Bacteria	3203
1147	Ga0373933_0036434	3300035724	Bacteria	2879
1148	Ga0373933_0076293	3300035724	Bacteria	2047
1149	Ga0373933_0159586	3300035724	Bacteria	1431
1150	Ga0373933_0942630	3300035724	Bacteria	568
1151	Ga0373933_1153889	3300035724	Bacteria	511
1152	Ga0373947_0000480	3300035725	Bacteria	22933
1153	Ga0373947_0001754	3300035725	Bacteria	13269
1154	Ga0373947_0058838	3300035725	Bacteria	2329
1155	Ga0373947_0066381	3300035725	Bacteria	2202
1156	Ga0373947_0078762	3300035725	Bacteria	2035
1157	Ga0373947_0285143	3300035725	Bacteria	1098
1158	Ga0373947_0544756	3300035725	Bacteria	790
1159	Ga0373947_0654428	3300035725	Bacteria	716
1160	Ga0373947_0720127	3300035725	Bacteria	681
1161	Ga0373937_0000593	3300036401	Bacteria	32100
1162	Ga0373937_0008172	3300036401	Bacteria	9086
1163	Ga0373937_0411330	3300036401	Bacteria	1283
1164	Ga0373937_0549057	3300036401	Bacteria	1097
1165	Ga0373937_0679631	3300036401	Bacteria	975
1166	Ga0372808_003027	3300036459	Bacteria	2014
1167	Ga0373925_0000614	3300037068	Bacteria	34010
1168	Ga0373925_0003749	3300037068	Bacteria	11674
1169	Ga0373925_0014983	3300037068	Bacteria	5605
1170	Ga0373925_0089880	3300037068	Bacteria	2347
1171	Ga0373925_0098189	3300037068	Bacteria	2247
1172	Ga0373925_0265862	3300037068	Bacteria	1379
1173	Ga0373925_0302897	3300037068	Bacteria	1291
1174	Ga0373925_0423996	3300037068	Bacteria	1087
1175	Ga0373925_0461504	3300037068	Bacteria	1041
1176	Ga0373925_0687578	3300037068	Bacteria	843
1177	Ga0373925_1071193	3300037068	Bacteria	663
1178	Ga0395899_0056528	3300037312	Bacteria	2900
1179	Ga0395899_0539886	3300037312	Bacteria	751
1180	Ga0395899_0954435	3300037312	Bacteria	520
1181	Ga0395900_0001144	3300037418	Bacteria	33438
1182	Ga0395900_0043435	3300037418	Bacteria	4633
1183	Ga0395900_0186882	3300037418	Bacteria	2103
1184	Ga0395900_0850665	3300037418	Bacteria	838
1185	Ga0395900_0957673	3300037418	Bacteria	777
1186	Ga0395900_1430518	3300037418	Bacteria	604
1187	Ga0395900_1660003	3300037418	Bacteria	550
1188	Ga0395898_0127482	3300037466	Bacteria	2438
1189	Ga0395898_0147448	3300037466	Bacteria	2252
1190	Ga0395898_0164109	3300037466	Bacteria	2125
1191	Ga0395898_0502219	3300037466	Bacteria	1153
1192	Ga0395898_0655389	3300037466	Bacteria	992
1193	Ga0395898_0882592	3300037466	Bacteria	833
1194	Ga0395905_0001838	3300037471	Bacteria	24511
1195	Ga0395905_0121828	3300037471	Bacteria	2452
1196	Ga0395905_0483889	3300037471	Bacteria	1137
1197	Ga0436364_0151143	3300037853	Bacteria	1438
1198	Ga0436364_0261434	3300037853	Bacteria	3829
1199	Ga0436364_0313235	3300037853	Bacteria	21216
1200	Ga0436364_0395343	3300037853	Bacteria	883
1201	Ga0436364_0688885	3300037853	Bacteria	559
1202	Ga0436364_0813354	3300037853	Bacteria	753
1203	Ga0436364_1160315	3300037853	Bacteria	594
1204	Ga0436364_1336704	3300037853	Bacteria	3608
1205	Ga0395901_0017814	3300038443	Bacteria	7249
1206	Ga0395901_0048753	3300038443	Bacteria	4399
1207	Ga0395901_0101213	3300038443	Bacteria	3024
1208	Ga0395901_0127924	3300038443	Bacteria	2670
1209	Ga0395901_0150699	3300038443	Bacteria	2444
1210	Ga0395901_0248474	3300038443	Bacteria	1854
1211	Ga0395901_0964805	3300038443	Bacteria	830
1212	Ga0436365_0091550	3300039437	Bacteria	2318
1213	Ga0436365_0154023	3300039437	Bacteria	1429
1214	Ga0436365_0498505	3300039437	Bacteria	20124
1215	Ga0436365_0614752	3300039437	Bacteria	942
1216	Ga0436365_0639743	3300039437	Bacteria	522
1217	Ga0436365_0654142	3300039437	Bacteria	867
1218	Ga0436365_1450004	3300039437	Bacteria	801
1219	Ga0436365_1605795	3300039437	Bacteria	2093
1220	Ga0436365_1724305	3300039437	Bacteria	525
1221	Ga0436365_1732462	3300039437	Bacteria	3208
1222	Ga0436365_1889588	3300039437	Bacteria	2846
1223	Ga0436360_1197075	3300039438	Bacteria	506
1224	Ga0436360_1209100	3300039438	Bacteria	3127
1225	Ga0436360_1232651	3300039438	Bacteria	807
1226	Ga0436361_0145462	3300039447	Bacteria	778
1227	Ga0436361_0268492	3300039447	Bacteria	3221
1228	Ga0436361_0818581	3300039447	Bacteria	1604
1229	Ga0436361_1176445	3300039447	Bacteria	501
1230	Ga0436361_1180061	3300039447	Bacteria	588
1231	Ga0436363_0138910	3300039450	Bacteria	1382
1232	Ga0436363_0608793	3300039450	Bacteria	1140
1233	Ga0436363_0773580	3300039450	Bacteria	601
1234	Ga0436363_1286982	3300039450	Bacteria	947
1235	Ga0436363_1360357	3300039450	Bacteria	1017
1236	Ga0436362_0244792	3300039453	Bacteria	964
1237	Ga0436362_0317072	3300039453	Bacteria	1243
1238	Ga0436362_1075244	3300039453	Bacteria	4713
1239	Ga0439465_0025850	3300041413	Bacteria	1854
1240	Ga0439465_0176665	3300041413	Bacteria	771
1241	Ga0451787_535459	3300041441	Bacteria	732
1242	Ga0451791_0393229	3300041451	Bacteria	948
1243	Ga0451793_0803750	3300041452	Bacteria	742
1244	Ga0451793_1003685	3300041452	Bacteria	953
1245	Ga0451795_0667025	3300041456	Bacteria	1115
1246	Ga0451795_1535427	3300041456	Bacteria	545
1247	Ga0451800_0929583	3300041459	Bacteria	685
1248	Ga0451802_1712190	3300041460	Bacteria	600
1249	Ga0451804_0623873	3300041463	Bacteria	668
1250	Ga0451833_0865256	3300041491	Bacteria	1015
1251	Ga0451841_1450511	3300041498	Bacteria	904
1252	Ga0451851_0731422	3300041507	Bacteria	549
1253	Ga0451843_1492484	3300041509	Bacteria	546
1254	Ga0451853_2023067	3300041512	Bacteria	548
1255	Ga0451853_2906480	3300041512	Bacteria	1091
1256	Ga0439431_0057691	3300041997	Bacteria	1017
1257	Ga0439448_0205591	3300042005	Bacteria	691
1258	Ga0439432_225759	3300042006	Bacteria	540
1259	Ga0439455_0116715	3300042012	Bacteria	746
1260	Ga0439458_0082880	3300042157	Bacteria	820
1261	Ga0439459_0205886	3300042438	Bacteria	539
1262	Ga0439460_0338078	3300042461	Bacteria	530
1263	Ga0466969_0013537	3300044656	Bacteria	4296
1264	Ga0466969_0103012	3300044656	Bacteria	1342
1265	Ga0466972_0000497	3300044658	Bacteria	19771
1266	Ga0466972_0014152	3300044658	Bacteria	3998
1267	Ga0466972_0268726	3300044658	Bacteria	797
1268	Ga0466965_0035273	3300044683	Bacteria	2450
1269	Ga0466966_0023019	3300044684	Bacteria	4081
1270	Ga0466966_0199023	3300044684	Bacteria	1213
1271	Ga0466966_0382019	3300044684	Bacteria	846
1272	Ga0466961_0000065	3300044693	Bacteria	63259
1273	Ga0466961_0793523	3300044693	Bacteria	565
1274	Ga0466963_0324021	3300044694	Bacteria	1084
1275	Ga0466963_0364271	3300044694	Bacteria	1018
1276	Ga0466963_0403796	3300044694	Bacteria	963
1277	Ga0466964_0132381	3300044706	Bacteria	1137
1278	Ga0466971_0041124	3300044719	Bacteria	2076
1279	Ga0466971_0186235	3300044719	Bacteria	977
1280	Ga0466968_0006369	3300044735	Bacteria	4445
1281	Ga0466968_0052027	3300044735	Bacteria	1751
1282	Ga0466970_0204767	3300044765	Bacteria	1098
1283	Ga0466970_0437609	3300044765	Bacteria	749
1284	Ga0466970_0694283	3300044765	Bacteria	593
1285	Ga0466957_0110767	3300044842	Bacteria	1740
1286	Ga0466957_0638036	3300044842	Bacteria	748
1287	Ga0466957_0778308	3300044842	Bacteria	679
1288	Ga0466960_0000883	3300044901	Bacteria	10588
1289	Ga0466960_0182517	3300044901	Bacteria	1138
1290	Ga0466960_0253471	3300044901	Bacteria	978
1291	Ga0466959_0016271	3300045049	Bacteria	5432
1292	Ga0466959_0018727	3300045049	Bacteria	5085
1293	Ga0466959_0095649	3300045049	Bacteria	2130
1294	Ga0466959_0266255	3300045049	Bacteria	1179
1295	Ga0466959_0382838	3300045049	Bacteria	957
1296	Ga0466959_0627565	3300045049	Bacteria	722
1297	Ga0466959_1050661	3300045049	Bacteria	542
1298	Ga0451576_0565464	3300045051	Bacteria	1195
1299	Ga0466958_0122068	3300045836	Bacteria	1632
1300	Ga0466958_0710219	3300045836	Bacteria	655
1301	Ga0466967_0018140	3300045976	Bacteria	5615
1302	Ga0466967_0183596	3300045976	Bacteria	1974
1303	Ga0466967_0415444	3300045976	Bacteria	1310
1304	Ga0466967_0737902	3300045976	Bacteria	976
1305	Ga0466967_1571610	3300045976	Bacteria	655
1306	Ga0466967_1850186	3300045976	Bacteria	601
1307	Ga0466967_2489794	3300045976	Bacteria	512
1308	Ga0495617_055854	3300046452	Bacteria	1309
1309	Ga0495617_097904	3300046452	Bacteria	954
1310	Ga0495617_104342	3300046452	Bacteria	920
1311	Ga0495627_113749	3300046453	Bacteria	767
1312	Ga0495627_172980	3300046453	Bacteria	599
1313	Ga0495592_0000031	3300046454	Bacteria	128596
1314	Ga0495592_0022347	3300046454	Bacteria	4813
1315	Ga0495592_0033115	3300046454	Bacteria	3899
1316	Ga0495592_0050513	3300046454	Bacteria	3090
1317	Ga0495592_0058917	3300046454	Bacteria	2830
1318	Ga0495592_0081768	3300046454	Bacteria	2335
1319	Ga0495592_0256567	3300046454	Bacteria	1153
1320	Ga0495592_0392961	3300046454	Bacteria	880
1321	Ga0495603_0007344	3300046455	Bacteria	6627
1322	Ga0495603_0010261	3300046455	Bacteria	5670
1323	Ga0495603_0012131	3300046455	Bacteria	5219
1324	Ga0495603_0023201	3300046455	Bacteria	3756
1325	Ga0495603_0064265	3300046455	Bacteria	2164
1326	Ga0495603_0109653	3300046455	Bacteria	1610
1327	Ga0495603_0287126	3300046455	Bacteria	945
1328	Ga0495603_0452162	3300046455	Bacteria	736
1329	Ga0495590_0080375	3300046457	Bacteria	1148
1330	Ga0495590_0152973	3300046457	Bacteria	837
1331	Ga0495590_0160221	3300046457	Bacteria	818
1332	Ga0495590_0203104	3300046457	Bacteria	728
1333	Ga0495629_0000074	3300046459	Bacteria	87355
1334	Ga0495629_0000905	3300046459	Bacteria	23806
1335	Ga0495629_0004844	3300046459	Bacteria	10095
1336	Ga0495629_0010611	3300046459	Bacteria	6700
1337	Ga0495629_0110365	3300046459	Bacteria	1918
1338	Ga0495629_0518926	3300046459	Bacteria	802
1339	Ga0495629_0525198	3300046459	Bacteria	796
1340	Ga0495638_0012617	3300046460	Bacteria	5782
1341	Ga0495638_0178689	3300046460	Bacteria	1212
1342	Ga0495638_0223055	3300046460	Bacteria	1052
1343	Ga0495638_0418373	3300046460	Bacteria	691
1344	Ga0495641_0002422	3300046461	Bacteria	14739
1345	Ga0495641_0148101	3300046461	Bacteria	1049
1346	Ga0495641_0185217	3300046461	Bacteria	932
1347	Ga0495641_0221584	3300046461	Bacteria	849
1348	Ga0495641_0258768	3300046461	Bacteria	783
1349	Ga0495641_0284889	3300046461	Bacteria	744
1350	Ga0495651_0000747	3300046462	Bacteria	25154
1351	Ga0495651_0002254	3300046462	Bacteria	14903
1352	Ga0495651_0019700	3300046462	Bacteria	5229
1353	Ga0495651_0040296	3300046462	Bacteria	3633
1354	Ga0495651_0047292	3300046462	Bacteria	3327
1355	Ga0495651_0082515	3300046462	Bacteria	2425
1356	Ga0495651_0099980	3300046462	Bacteria	2161
1357	Ga0495651_0104034	3300046462	Bacteria	2108
1358	Ga0495651_0282841	3300046462	Bacteria	1120
1359	Ga0495651_0486698	3300046462	Bacteria	792
1360	Ga0495651_0494384	3300046462	Bacteria	784
1361	Ga0495651_0576201	3300046462	Bacteria	712
1362	Ga0495653_0000063	3300046463	Bacteria	93232
1363	Ga0495653_0013482	3300046463	Bacteria	6660
1364	Ga0495653_0042303	3300046463	Bacteria	3549
1365	Ga0495653_0048265	3300046463	Bacteria	3287
1366	Ga0495653_0199421	3300046463	Bacteria	1359
1367	Ga0495653_0288576	3300046463	Bacteria	1074
1368	Ga0495653_0545734	3300046463	Bacteria	718
1369	Ga0495650_0141653	3300046471	Bacteria	869
1370	Ga0495650_0300723	3300046471	Bacteria	537
1371	Ga0495580_0020307	3300046472	Bacteria	4919
1372	Ga0495580_0058030	3300046472	Bacteria	2724
1373	Ga0495580_0253300	3300046472	Bacteria	1205
1374	Ga0495580_0296601	3300046472	Bacteria	1101
1375	Ga0495582_0000059	3300046473	Bacteria	55798
1376	Ga0495582_0095791	3300046473	Bacteria	1658
1377	Ga0495582_0127859	3300046473	Bacteria	1434
1378	Ga0495605_0065260	3300046474	Bacteria	1732
1379	Ga0495605_0089609	3300046474	Bacteria	1427
1380	Ga0495605_0188483	3300046474	Bacteria	904
1381	Ga0495639_0000752	3300046475	Bacteria	14782
1382	Ga0495639_0085490	3300046475	Bacteria	1474
1383	Ga0495639_0229819	3300046475	Bacteria	914
1384	Ga0495639_0449957	3300046475	Bacteria	654
1385	Ga0495662_0000791	3300046476	Bacteria	15347
1386	Ga0495662_0084715	3300046476	Bacteria	1543
1387	Ga0495662_0104331	3300046476	Bacteria	1387
1388	Ga0495662_0131015	3300046476	Bacteria	1233
1389	Ga0495662_0447245	3300046476	Bacteria	634
1390	Ga0495662_0601648	3300046476	Bacteria	538
1391	Ga0495664_0000004	3300046477	Bacteria	489411
1392	Ga0495664_0006511	3300046477	Bacteria	6455
1393	Ga0495664_0019421	3300046477	Bacteria	3908
1394	Ga0495664_0032628	3300046477	Bacteria	3057
1395	Ga0495664_0073004	3300046477	Bacteria	2051
1396	Ga0495664_0132774	3300046477	Bacteria	1508
1397	Ga0495664_0161300	3300046477	Bacteria	1360
1398	Ga0495664_0176133	3300046477	Bacteria	1297
1399	Ga0495664_0251386	3300046477	Bacteria	1069
1400	Ga0495664_0512149	3300046477	Bacteria	716
1401	Ga0495584_0063639	3300046491	Bacteria	1854
1402	Ga0495584_0256800	3300046491	Bacteria	888
1403	Ga0495584_0304595	3300046491	Bacteria	809
1404	Ga0495584_0330011	3300046491	Bacteria	775
1405	Ga0495585_0104792	3300046492	Bacteria	1509
1406	Ga0495594_0004702	3300046499	Bacteria	7037
1407	Ga0495594_0116060	3300046499	Bacteria	1511
1408	Ga0495594_0135631	3300046499	Bacteria	1395
1409	Ga0495594_0419600	3300046499	Bacteria	761
1410	Ga0495596_0231920	3300046500	Bacteria	717
1411	Ga0495606_0047302	3300046507	Bacteria	2836
1412	Ga0495606_0312864	3300046507	Bacteria	847
1413	Ga0495606_0404102	3300046507	Bacteria	710
1414	Ga0495608_0000005	3300046511	Bacteria	350726
1415	Ga0495608_0002757	3300046511	Bacteria	12626
1416	Ga0495608_0006896	3300046511	Bacteria	8045
1417	Ga0495608_0035889	3300046511	Bacteria	3340
1418	Ga0495608_0052184	3300046511	Bacteria	2707
1419	Ga0495608_0089544	3300046511	Bacteria	1992
1420	Ga0495608_0217482	3300046511	Bacteria	1200
1421	Ga0495608_0244006	3300046511	Bacteria	1121
1422	Ga0495610_0098494	3300046512	Bacteria	1313
1423	Ga0495610_0177903	3300046512	Bacteria	887
1424	Ga0495616_0108943	3300046513	Bacteria	1289
1425	Ga0495616_0201456	3300046513	Bacteria	874
1426	Ga0495616_0216043	3300046513	Bacteria	837
1427	Ga0495616_0261852	3300046513	Bacteria	740
1428	Ga0495616_0456812	3300046513	Bacteria	516
1429	Ga0495618_0000095	3300046514	Bacteria	63583
1430	Ga0495618_0004070	3300046514	Bacteria	9019
1431	Ga0495618_0008695	3300046514	Bacteria	6136
1432	Ga0495618_0071368	3300046514	Bacteria	2209
1433	Ga0495618_0099368	3300046514	Bacteria	1862
1434	Ga0495618_0216196	3300046514	Bacteria	1210
1435	Ga0495618_0227846	3300046514	Bacteria	1174
1436	Ga0495618_0421544	3300046514	Bacteria	814
1437	Ga0495618_0481570	3300046514	Bacteria	750
1438	Ga0495620_0077823	3300046515	Bacteria	1346
1439	Ga0495620_0249775	3300046515	Bacteria	676
1440	Ga0495620_0267894	3300046515	Bacteria	650
1441	Ga0495628_0000001	3300046516	Bacteria	917742
1442	Ga0495628_0010455	3300046516	Bacteria	7881
1443	Ga0495628_0038765	3300046516	Bacteria	3812
1444	Ga0495628_0116075	3300046516	Bacteria	2056
1445	Ga0495628_0332989	3300046516	Bacteria	1118
1446	Ga0495628_0395253	3300046516	Bacteria	1011
1447	Ga0495628_0461871	3300046516	Bacteria	921
1448	Ga0495628_0576466	3300046516	Bacteria	806
1449	Ga0495628_0732884	3300046516	Bacteria	696
1450	Ga0495630_0001436	3300046517	Bacteria	16507
1451	Ga0495630_0025907	3300046517	Bacteria	4339
1452	Ga0495630_0128557	3300046517	Bacteria	1923
1453	Ga0495630_0894482	3300046517	Bacteria	676
1454	Ga0495630_1047167	3300046517	Bacteria	619
1455	Ga0495631_0091276	3300046518	Bacteria	1311
1456	Ga0495631_0110439	3300046518	Bacteria	1182
1457	Ga0495631_0204060	3300046518	Bacteria	845
1458	Ga0495631_0280378	3300046518	Bacteria	709
1459	Ga0495632_0056587	3300046519	Bacteria	1917
1460	Ga0495632_0204187	3300046519	Bacteria	899
1461	Ga0495632_0329844	3300046519	Bacteria	673
1462	Ga0495632_0410728	3300046519	Bacteria	590
1463	Ga0495643_0352466	3300046522	Bacteria	659
1464	Ga0495648_0010311	3300046524	Bacteria	7128
1465	Ga0495648_0060340	3300046524	Bacteria	2257
1466	Ga0495648_0156035	3300046524	Bacteria	1185
1467	Ga0495663_0173322	3300046525	Bacteria	744
1468	Ga0495663_0375520	3300046525	Bacteria	520
1469	Ga0495666_0077918	3300046526	Bacteria	1570
1470	Ga0495666_0112524	3300046526	Bacteria	1278
1471	Ga0495666_0468757	3300046526	Bacteria	564
1472	Ga0495652_0000002	3300046529	Bacteria	946606
1473	Ga0495652_0016115	3300046529	Bacteria	6686
1474	Ga0495652_0018298	3300046529	Bacteria	6248
1475	Ga0495652_0025560	3300046529	Bacteria	5221
1476	Ga0495652_0077790	3300046529	Bacteria	2748
1477	Ga0495652_0160009	3300046529	Bacteria	1749
1478	Ga0495652_0251810	3300046529	Bacteria	1308
1479	Ga0495652_0380051	3300046529	Bacteria	1005
1480	Ga0495652_0415973	3300046529	Bacteria	948
1481	Ga0495652_0704144	3300046529	Bacteria	679
1482	Ga0495665_0000395	3300046531	Bacteria	22177
1483	Ga0495665_0025644	3300046531	Bacteria	3166
1484	Ga0495665_0106925	3300046531	Bacteria	1468
1485	Ga0495665_0226982	3300046531	Bacteria	965
1486	Ga0495665_0299427	3300046531	Bacteria	824
1487	Ga0495665_0425756	3300046531	Bacteria	672
1488	Ga0495640_0000001	3300046533	Bacteria	853827
1489	Ga0495640_0006289	3300046533	Bacteria	9405
1490	Ga0495640_0009166	3300046533	Bacteria	7724
1491	Ga0495640_0019037	3300046533	Bacteria	5076
1492	Ga0495640_0084212	3300046533	Bacteria	2109
1493	Ga0495640_0219002	3300046533	Bacteria	1201
1494	Ga0495640_0516082	3300046533	Bacteria	726
1495	Ga0495586_0034629	3300046535	Bacteria	2713
1496	Ga0495586_0172076	3300046535	Bacteria	1224
1497	Ga0495586_0501033	3300046535	Bacteria	701
1498	Ga0495587_0000016	3300046536	Bacteria	185585
1499	Ga0495587_0001133	3300046536	Bacteria	17447
1500	Ga0495587_0004719	3300046536	Bacteria	8942
1501	Ga0495587_0018706	3300046536	Bacteria	4295
1502	Ga0495587_0086985	3300046536	Bacteria	1808
1503	Ga0495587_0169015	3300046536	Bacteria	1242
1504	Ga0495598_0017099	3300046537	Bacteria	1864
1505	Ga0495598_0047880	3300046537	Bacteria	1276
1506	Ga0495598_0233961	3300046537	Bacteria	675
1507	Ga0495609_0082640	3300046538	Bacteria	1403
1508	Ga0495609_0388479	3300046538	Bacteria	559
1509	Ga0495609_0397892	3300046538	Bacteria	551
1510	Ga0495621_0018991	3300046539	Bacteria	2239
1511	Ga0495621_0439857	3300046539	Bacteria	557
1512	Ga0495597_0084414	3300046542	Bacteria	1354
1513	Ga0495597_0172997	3300046542	Bacteria	876
1514	Ga0495645_0000002	3300046543	Bacteria	651644
1515	Ga0495645_0014971	3300046543	Bacteria	5511
1516	Ga0495645_0030559	3300046543	Bacteria	3923
1517	Ga0495645_0041807	3300046543	Bacteria	3342
1518	Ga0495645_0080716	3300046543	Bacteria	2334
1519	Ga0495645_0375973	3300046543	Bacteria	910
1520	Ga0495645_0400366	3300046543	Bacteria	875
1521	Ga0495622_0003110	3300046557	Bacteria	7863
1522	Ga0495622_0019491	3300046557	Bacteria	3157
1523	Ga0495622_0029280	3300046557	Bacteria	2573
1524	Ga0495622_0053500	3300046557	Bacteria	1873
1525	Ga0495622_0133626	3300046557	Bacteria	1129
1526	Ga0495622_0211488	3300046557	Bacteria	861
1527	Ga0495622_0264601	3300046557	Bacteria	754
1528	Ga0495622_0446226	3300046557	Bacteria	555
1529	Ga0495667_0000007	3300046559	Bacteria	234736
1530	Ga0495667_0002304	3300046559	Bacteria	12788
1531	Ga0495667_0006726	3300046559	Bacteria	7801
1532	Ga0495667_0007365	3300046559	Bacteria	7464
1533	Ga0495667_0030541	3300046559	Bacteria	3620
1534	Ga0495667_0149541	3300046559	Bacteria	1503
1535	Ga0495667_0516835	3300046559	Bacteria	747
1536	Ga0495667_0690408	3300046559	Bacteria	633
1537	Ga0495667_0722755	3300046559	Bacteria	616
1538	Ga0495656_0008268	3300046615	Bacteria	3710
1539	Ga0495656_0015791	3300046615	Bacteria	2856
1540	Ga0495656_0257911	3300046615	Bacteria	882
1541	Ga0495656_0576335	3300046615	Bacteria	601
1542	Ga0495668_0012470	3300046616	Bacteria	5039
1543	Ga0495668_0042110	3300046616	Bacteria	2543
1544	Ga0495668_0066918	3300046616	Bacteria	1976
1545	Ga0495668_0119168	3300046616	Bacteria	1443
1546	Ga0495668_0413717	3300046616	Bacteria	741
1547	Ga0495634_0000591	3300046642	Bacteria	35197
1548	Ga0495634_0001138	3300046642	Bacteria	24566
1549	Ga0495634_0004451	3300046642	Bacteria	10998
1550	Ga0495634_0023045	3300046642	Bacteria	4382
1551	Ga0495634_0030234	3300046642	Bacteria	3743
1552	Ga0495634_0077986	3300046642	Bacteria	2171
1553	Ga0495634_0155788	3300046642	Bacteria	1442
1554	Ga0495634_0633263	3300046642	Bacteria	619
1555	Ga0495634_0809530	3300046642	Bacteria	534
1556	Ga0495611_0067215	3300046648	Bacteria	1635
1557	Ga0495611_0088963	3300046648	Bacteria	1426
1558	Ga0495611_0105940	3300046648	Bacteria	1308
1559	Ga0495611_0359267	3300046648	Bacteria	668
1560	Ga0495611_0582538	3300046648	Bacteria	506
1561	Ga0495625_0109301	3300046660	Bacteria	1891
1562	Ga0495625_0149264	3300046660	Bacteria	1572
1563	Ga0495625_0169367	3300046660	Bacteria	1459
1564	Ga0495635_0000002	3300046663	Bacteria	490490
1565	Ga0495635_0000177	3300046663	Bacteria	40081
1566	Ga0495635_0006529	3300046663	Bacteria	8137
1567	Ga0495635_0007098	3300046663	Bacteria	7832
1568	Ga0495635_0009548	3300046663	Bacteria	6780
1569	Ga0495635_0015706	3300046663	Bacteria	5289
1570	Ga0495635_0104576	3300046663	Bacteria	1935
1571	Ga0495635_0157829	3300046663	Bacteria	1544
1572	Ga0495635_0355151	3300046663	Bacteria	977
1573	Ga0495635_0574441	3300046663	Bacteria	738
1574	Ga0495659_0059710	3300046664	Bacteria	1405
1575	Ga0495659_0068356	3300046664	Bacteria	1326
1576	Ga0495661_0279310	3300046665	Bacteria	842
1577	Ga0495661_0608421	3300046665	Bacteria	513
1578	Ga0495588_0019750	3300046674	Bacteria	3305
1579	Ga0495588_0086996	3300046674	Bacteria	1634
1580	Ga0495588_0114572	3300046674	Bacteria	1420
1581	Ga0495588_0626609	3300046674	Bacteria	563
1582	Ga0495657_0000668	3300046675	Bacteria	31053
1583	Ga0495657_0009885	3300046675	Bacteria	7195
1584	Ga0495657_0022274	3300046675	Bacteria	4541
1585	Ga0495657_0034954	3300046675	Bacteria	3487
1586	Ga0495657_0040513	3300046675	Bacteria	3194
1587	Ga0495657_0061302	3300046675	Bacteria	2488
1588	Ga0495657_0159119	3300046675	Bacteria	1398
1589	Ga0495657_0453023	3300046675	Bacteria	751
1590	Ga0495599_0000005	3300046678	Bacteria	300169
1591	Ga0495599_0009924	3300046678	Bacteria	5827
1592	Ga0495599_0025353	3300046678	Bacteria	3711
1593	Ga0495599_0026199	3300046678	Bacteria	3653
1594	Ga0495599_0038170	3300046678	Bacteria	3017
1595	Ga0495599_0134486	3300046678	Bacteria	1535
1596	Ga0495599_0176683	3300046678	Bacteria	1316
1597	Ga0495623_0000016	3300046679	Bacteria	113454
1598	Ga0495623_0031608	3300046679	Bacteria	3403
1599	Ga0495623_0033428	3300046679	Bacteria	3300
1600	Ga0495623_0035782	3300046679	Bacteria	3182
1601	Ga0495623_0082190	3300046679	Bacteria	1991
1602	Ga0495623_0165376	3300046679	Bacteria	1296
1603	Ga0495623_0575690	3300046679	Bacteria	587
1604	Ga0495646_0000002	3300046680	Bacteria	310568
1605	Ga0495646_0013078	3300046680	Bacteria	5275
1606	Ga0495646_0034160	3300046680	Bacteria	3159
1607	Ga0495646_0046032	3300046680	Bacteria	2662
1608	Ga0495646_0047265	3300046680	Bacteria	2620
1609	Ga0495646_0057809	3300046680	Bacteria	2320
1610	Ga0495646_0151207	3300046680	Bacteria	1291
1611	Ga0495646_0159777	3300046680	Bacteria	1248
1612	Ga0495646_0318664	3300046680	Bacteria	819
1613	Ga0495646_0402022	3300046680	Bacteria	712
1614	Ga0495647_0001377	3300046681	Bacteria	7500
1615	Ga0495647_0035883	3300046681	Bacteria	1864
1616	Ga0495647_0219952	3300046681	Bacteria	838
1617	Ga0495658_0020599	3300046683	Bacteria	3463
1618	Ga0495658_0021298	3300046683	Bacteria	3417
1619	Ga0495658_0424644	3300046683	Bacteria	848
1620	Ga0495658_0460166	3300046683	Bacteria	813
1621	Ga0495658_0787464	3300046683	Bacteria	609
1622	Ga0495658_0812894	3300046683	Bacteria	598
1623	Ga0495658_0863334	3300046683	Bacteria	579
1624	Ga0495669_0020093	3300046684	Bacteria	2887
1625	Ga0495669_0078976	3300046684	Bacteria	1508
1626	Ga0495669_0200177	3300046684	Bacteria	954
1627	Ga0495669_0337946	3300046684	Bacteria	727
1628	Ga0495669_0412764	3300046684	Bacteria	654
1629	Ga0495613_0013047	3300046689	Bacteria	6175
1630	Ga0495613_0014360	3300046689	Bacteria	5880
1631	Ga0495613_0082035	3300046689	Bacteria	2342
1632	Ga0495613_0127922	3300046689	Bacteria	1820
1633	Ga0495613_0164399	3300046689	Bacteria	1577
1634	Ga0495624_0002351	3300046690	Bacteria	14359
1635	Ga0495624_0030711	3300046690	Bacteria	3497
1636	Ga0495624_0073549	3300046690	Bacteria	2125
1637	Ga0495624_0087007	3300046690	Bacteria	1930
1638	Ga0495624_0110956	3300046690	Bacteria	1686
1639	Ga0495624_0168348	3300046690	Bacteria	1337
1640	Ga0495624_0356473	3300046690	Bacteria	880
1641	Ga0495624_0409751	3300046690	Bacteria	813
1642	Ga0495624_0511196	3300046690	Bacteria	718
1643	Ga0495624_0514198	3300046690	Bacteria	716
1644	Ga0495624_0627652	3300046690	Bacteria	640
1645	Ga0495624_0657035	3300046690	Bacteria	623
1646	Ga0495670_0089146	3300046691	Bacteria	1577
1647	Ga0495670_0358334	3300046691	Bacteria	785
1648	Ga0495671_0111840	3300046692	Bacteria	1334
1649	Ga0495671_0239690	3300046692	Bacteria	876
1650	Ga0495671_0301453	3300046692	Bacteria	771
1651	Ga0495649_0183678	3300046694	Bacteria	1090
1652	Ga0495649_0212344	3300046694	Bacteria	1002
1653	Ga0495649_0239331	3300046694	Bacteria	935
1654	Ga0495649_0358992	3300046694	Bacteria	735
1655	Ga0495649_0461445	3300046694	Bacteria	634
1656	Ga0495589_0124440	3300046794	Bacteria	1240
1657	Ga0495589_0158468	3300046794	Bacteria	1079
1658	Ga0495589_0338586	3300046794	Bacteria	694
1659	Ga0495600_0000018	3300046809	Bacteria	102683
1660	Ga0495600_0004584	3300046809	Bacteria	8286
1661	Ga0495600_0012765	3300046809	Bacteria	5262
1662	Ga0495600_0070618	3300046809	Bacteria	2282
1663	Ga0495600_0084705	3300046809	Bacteria	2068
1664	Ga0495600_0160080	3300046809	Bacteria	1455
1665	Ga0495600_0582801	3300046809	Bacteria	681
1666	Ga0495600_0622859	3300046809	Bacteria	654
1667	Ga0495660_0164136	3300046810	Bacteria	1087
1668	Ga0495660_0334767	3300046810	Bacteria	677
1669	Ga0495581_0000037	3300047315	Bacteria	47930
1670	Ga0495581_0045058	3300047315	Bacteria	2550
1671	Ga0495581_0131316	3300047315	Bacteria	1459
1672	Ga0495581_0133723	3300047315	Bacteria	1445
1673	Ga0495581_0272852	3300047315	Bacteria	989
1674	Ga0495581_0448354	3300047315	Bacteria	751
1675	Ga0495581_0477388	3300047315	Bacteria	725
1676	Ga0495581_0691038	3300047315	Bacteria	589
1677	Ga0495604_0000020	3300047317	Bacteria	171989
1678	Ga0495604_0001275	3300047317	Bacteria	20597
1679	Ga0495604_0007365	3300047317	Bacteria	8719
1680	Ga0495604_0018623	3300047317	Bacteria	5563
1681	Ga0495604_0032168	3300047317	Bacteria	4159
1682	Ga0495604_0082128	3300047317	Bacteria	2410
1683	Ga0495604_0113533	3300047317	Bacteria	1971
1684	Ga0495604_0616780	3300047317	Bacteria	694
1685	Ga0495604_0635027	3300047317	Bacteria	682
1686	Ga0495604_0647831	3300047317	Bacteria	674
1687	Ga0495604_0728982	3300047317	Bacteria	628
1688	Ga0495636_0018777	3300047318	Bacteria	2774
1689	Ga0495674_0000002	3300047319	Bacteria	642785
1690	Ga0495674_0000499	3300047319	Bacteria	35905
1691	Ga0495674_0005017	3300047319	Bacteria	12734
1692	Ga0495674_0044080	3300047319	Bacteria	3967
1693	Ga0495674_0086812	3300047319	Bacteria	2678
1694	Ga0495674_0099678	3300047319	Bacteria	2473
1695	Ga0495674_0220872	3300047319	Bacteria	1566
1696	Ga0495674_0818200	3300047319	Bacteria	723
1697	Ga0495674_0868761	3300047319	Bacteria	698
1698	Ga0495674_1010009	3300047319	Bacteria	637
1699	Ga0495674_1106996	3300047319	Bacteria	603
1700	Ga0495672_0013641	3300047320	Bacteria	5594
1701	Ga0495672_0028091	3300047320	Bacteria	3565
1702	Ga0495672_0258888	3300047320	Bacteria	841
1703	Ga0495676_0069502	3300047321	Bacteria	2717
1704	Ga0495676_0075034	3300047321	Bacteria	2587
1705	Ga0495676_0089343	3300047321	Bacteria	2309
1706	Ga0495676_0122334	3300047321	Bacteria	1891
1707	Ga0495676_0319451	3300047321	Bacteria	1043
1708	Ga0495676_0953973	3300047321	Bacteria	548
1709	Ga0495680_0000419	3300047322	Bacteria	47547
1710	Ga0495680_0002074	3300047322	Bacteria	20875
1711	Ga0495680_0009838	3300047322	Bacteria	8571
1712	Ga0495680_0012270	3300047322	Bacteria	7551
1713	Ga0495680_0624294	3300047322	Bacteria	719
1714	Ga0495683_0265448	3300047323	Bacteria	748
1715	Ga0495687_005403	3300047443	Bacteria	8156
1716	Ga0495687_132493	3300047443	Bacteria	880
1717	Ga0495675_0000120	3300047444	Bacteria	57071
1718	Ga0495675_0002352	3300047444	Bacteria	11285
1719	Ga0495675_0015644	3300047444	Bacteria	4796
1720	Ga0495675_0037539	3300047444	Bacteria	3085
1721	Ga0495675_0046509	3300047444	Bacteria	2762
1722	Ga0495675_0294773	3300047444	Bacteria	964
1723	Ga0495673_0032629	3300047469	Bacteria	2425
1724	Ga0495673_0040270	3300047469	Bacteria	2113
1725	Ga0495673_0057141	3300047469	Bacteria	1685
1726	Ga0495673_0172856	3300047469	Bacteria	822
1727	Ga0495673_0207119	3300047469	Bacteria	731
1728	Ga0495681_0146817	3300047470	Bacteria	992
1729	Ga0495684_0000016	3300047471	Bacteria	169338
1730	Ga0495684_0007725	3300047471	Bacteria	8326
1731	Ga0495684_0021892	3300047471	Bacteria	4922
1732	Ga0495684_0023415	3300047471	Bacteria	4747
1733	Ga0495684_0040890	3300047471	Bacteria	3553
1734	Ga0495684_0174480	3300047471	Bacteria	1596
1735	Ga0495686_0025572	3300047472	Bacteria	3869
1736	Ga0495686_0056057	3300047472	Bacteria	2463
1737	Ga0495686_0124577	3300047472	Bacteria	1533
1738	Ga0495686_0530044	3300047472	Bacteria	617
1739	Ga0495686_0550590	3300047472	Bacteria	602
1740	Ga0495593_0000788	3300047673	Bacteria	18351
1741	Ga0495593_0005179	3300047673	Bacteria	7710
1742	Ga0495593_0005685	3300047673	Bacteria	7356
1743	Ga0495593_0026001	3300047673	Bacteria	3236
1744	Ga0495593_0551329	3300047673	Bacteria	578
1745	Ga0495602_0000040	3300048088	Bacteria	127280
1746	Ga0495602_0027276	3300048088	Bacteria	5491
1747	Ga0495602_0036275	3300048088	Bacteria	4590
1748	Ga0495602_0052665	3300048088	Bacteria	3613
1749	Ga0495602_0055737	3300048088	Bacteria	3480
1750	Ga0495602_0226551	3300048088	Bacteria	1407
1751	Ga0495602_0546685	3300048088	Bacteria	803
1752	Ga0495602_0767968	3300048088	Bacteria	649
1753	Ga0495614_0007983	3300048089	Bacteria	4705
1754	Ga0495614_0176839	3300048089	Bacteria	959
1755	Ga0495626_0125603	3300048091	Bacteria	1099
1756	Ga0496100_0172101	3300048903	Bacteria	1560
1757	Ga0496100_0254003	3300048903	Bacteria	1301
1758	Ga0496100_0369272	3300048903	Bacteria	1087
1759	Ga0496100_0948889	3300048903	Bacteria	676
1760	Ga0496100_1056386	3300048903	Bacteria	639
1761	Ga0496100_1182351	3300048903	Bacteria	603
1762	Ga0496100_1277032	3300048903	Bacteria	579
1763	Ga0496101_0034495	3300048904	Bacteria	3574
1764	Ga0496101_0073059	3300048904	Bacteria	2519
1765	Ga0496101_0097237	3300048904	Bacteria	2198
1766	Ga0496101_0166163	3300048904	Bacteria	1694
1767	Ga0496101_0202981	3300048904	Bacteria	1533
1768	Ga0496101_0257871	3300048904	Bacteria	1359
1769	Ga0496101_0364378	3300048904	Bacteria	1136
1770	Ga0496101_0832850	3300048904	Bacteria	727
1771	Ga0496101_1006417	3300048904	Bacteria	655
1772	Ga0496101_1471264	3300048904	Bacteria	531
1773	Ga0496102_0008632	3300048905	Bacteria	8744
1774	Ga0496102_0031598	3300048905	Bacteria	4750
1775	Ga0496102_0034184	3300048905	Bacteria	4572
1776	Ga0496102_0244339	3300048905	Bacteria	1692
1777	Ga0496102_0547959	3300048905	Bacteria	1079
1778	Ga0496102_0583917	3300048905	Bacteria	1040
1779	Ga0496102_0800409	3300048905	Bacteria	865
1780	Ga0496102_0806927	3300048905	Bacteria	861
1781	Ga0496102_0866460	3300048905	Bacteria	825
1782	Ga0496102_0901427	3300048905	Bacteria	806
1783	Ga0496102_1318830	3300048905	Bacteria	641
1784	Ga0496102_1327764	3300048905	Bacteria	638
1785	Ga0496102_1931544	3300048905	Bacteria	507
1786	Ga0496103_0016325	3300048906	Bacteria	4431
1787	Ga0496103_0021897	3300048906	Bacteria	3846
1788	Ga0496103_0091558	3300048906	Bacteria	1919
1789	Ga0496103_0099128	3300048906	Bacteria	1843
1790	Ga0496103_0163739	3300048906	Bacteria	1427
1791	Ga0496103_0204316	3300048906	Bacteria	1270
1792	Ga0496103_1048926	3300048906	Bacteria	506
1793	Ga0496104_0006539	3300048907	Bacteria	10248
1794	Ga0496104_0026608	3300048907	Bacteria	5345
1795	Ga0496104_0038269	3300048907	Bacteria	4488
1796	Ga0496104_0065283	3300048907	Bacteria	3453
1797	Ga0496104_0111824	3300048907	Bacteria	2619
1798	Ga0496104_0428072	3300048907	Bacteria	1235
1799	Ga0496104_0453629	3300048907	Bacteria	1194
1800	Ga0496104_0781154	3300048907	Bacteria	861
1801	Ga0496104_1050514	3300048907	Bacteria	718
1802	Ga0496105_0002455	3300048908	Bacteria	13421
1803	Ga0496105_0030325	3300048908	Bacteria	4431
1804	Ga0496105_0068881	3300048908	Bacteria	2923
1805	Ga0496105_0076262	3300048908	Bacteria	2768
1806	Ga0496105_0141871	3300048908	Bacteria	1977
1807	Ga0496105_0275439	3300048908	Bacteria	1358
1808	Ga0496105_0277270	3300048908	Bacteria	1353
1809	Ga0496105_0318447	3300048908	Bacteria	1247
1810	Ga0496105_0320552	3300048908	Bacteria	1242
1811	Ga0496105_0393622	3300048908	Bacteria	1101
1812	Ga0496106_0001534	3300048909	Bacteria	17367
1813	Ga0496106_0001995	3300048909	Bacteria	15358
1814	Ga0496106_0008795	3300048909	Bacteria	7463
1815	Ga0496106_0094308	3300048909	Bacteria	2314
1816	Ga0496106_0191670	3300048909	Bacteria	1625
1817	Ga0496106_0224828	3300048909	Bacteria	1497
1818	Ga0496106_0340270	3300048909	Bacteria	1205
1819	Ga0496106_1201034	3300048909	Bacteria	591
1820	Ga0496107_0022069	3300048910	Bacteria	4497
1821	Ga0496107_0034750	3300048910	Bacteria	3611
1822	Ga0496107_0036678	3300048910	Bacteria	3517
1823	Ga0496107_0046141	3300048910	Bacteria	3136
1824	Ga0496107_0308158	3300048910	Bacteria	1178
1825	Ga0496107_0843143	3300048910	Bacteria	670
1826	Ga0496107_1060387	3300048910	Bacteria	586
1827	Ga0496108_0000438	3300048911	Bacteria	33500
1828	Ga0496108_0012472	3300048911	Bacteria	6921
1829	Ga0496108_0021757	3300048911	Bacteria	5272
1830	Ga0496108_0038372	3300048911	Bacteria	3990
1831	Ga0496108_0122384	3300048911	Bacteria	2232
1832	Ga0496108_0137500	3300048911	Bacteria	2103
1833	Ga0496108_0173021	3300048911	Bacteria	1869
1834	Ga0496108_0798319	3300048911	Bacteria	814
1835	Ga0496108_0819284	3300048911	Bacteria	802
1836	Ga0496108_1114671	3300048911	Bacteria	670
1837	Ga0496108_1184649	3300048911	Bacteria	646
1838	Ga0496109_0000284	3300048912	Bacteria	48342
1839	Ga0496109_0043538	3300048912	Bacteria	4069
1840	Ga0496109_0470010	3300048912	Bacteria	1187
1841	Ga0496109_0694018	3300048912	Bacteria	955
1842	Ga0496109_0992224	3300048912	Bacteria	777
1843	Ga0496109_1083057	3300048912	Bacteria	738
1844	Ga0496109_1658805	3300048912	Bacteria	573
1845	Ga0496109_1911874	3300048912	Bacteria	526
1846	Ga0496110_0062056	3300048913	Bacteria	3300
1847	Ga0496110_0068029	3300048913	Bacteria	3152
1848	Ga0496110_0102891	3300048913	Bacteria	2561
1849	Ga0496110_0273785	3300048913	Bacteria	1537
1850	Ga0496110_0624415	3300048913	Bacteria	976
1851	Ga0496110_0757704	3300048913	Bacteria	874
1852	Ga0496110_0859952	3300048913	Bacteria	812
1853	Ga0496111_0081890	3300048914	Bacteria	2356
1854	Ga0496111_0119147	3300048914	Bacteria	1949
1855	Ga0496111_0152057	3300048914	Bacteria	1717
1856	Ga0496111_0169557	3300048914	Bacteria	1622
1857	Ga0496111_0270613	3300048914	Bacteria	1260
1858	Ga0496111_0790167	3300048914	Bacteria	687
1859	Ga0496111_1160158	3300048914	Bacteria	549
1860	Ga0496112_0000585	3300048915	Bacteria	24994
1861	Ga0496112_0080259	3300048915	Bacteria	3226
1862	Ga0496112_0120515	3300048915	Bacteria	2593
1863	Ga0496112_0166442	3300048915	Bacteria	2170
1864	Ga0496112_0230290	3300048915	Bacteria	1807
1865	Ga0496112_0266633	3300048915	Bacteria	1661
1866	Ga0496112_0284172	3300048915	Bacteria	1601
1867	Ga0496112_0405137	3300048915	Bacteria	1303
1868	Ga0496112_0490151	3300048915	Bacteria	1165
1869	Ga0496112_0697194	3300048915	Bacteria	943
1870	Ga0496112_1235688	3300048915	Bacteria	663
1871	Ga0496112_1584877	3300048915	Bacteria	568
1872	Ga0496113_0011026	3300048916	Bacteria	6007
1873	Ga0496113_0026614	3300048916	Bacteria	4138
1874	Ga0496113_0055086	3300048916	Bacteria	2980
1875	Ga0496113_0118555	3300048916	Bacteria	2067
1876	Ga0496113_0136247	3300048916	Bacteria	1929
1877	Ga0496113_0312959	3300048916	Bacteria	1258
1878	Ga0496113_0338225	3300048916	Bacteria	1207
1879	Ga0496113_0627021	3300048916	Bacteria	860
1880	Ga0496114_0009020	3300048917	Bacteria	7906
1881	Ga0496114_0064801	3300048917	Bacteria	3061
1882	Ga0496114_0156134	3300048917	Bacteria	1981
1883	Ga0496114_0324333	3300048917	Bacteria	1361
1884	Ga0496114_0325866	3300048917	Bacteria	1358
1885	Ga0496114_0426291	3300048917	Bacteria	1175
1886	Ga0496114_0471420	3300048917	Bacteria	1111
1887	Ga0496114_0528635	3300048917	Bacteria	1043
1888	Ga0496114_0904625	3300048917	Bacteria	764
1889	Ga0496114_1412965	3300048917	Bacteria	583
1890	Ga0496114_1450629	3300048917	Bacteria	574
1891	Ga0496114_1451630	3300048917	Bacteria	574
1892	Ga0496115_0011183	3300048918	Bacteria	6724
1893	Ga0496115_0016440	3300048918	Bacteria	5635
1894	Ga0496115_0029989	3300048918	Bacteria	4276
1895	Ga0496115_0117096	3300048918	Bacteria	2192
1896	Ga0496115_0169678	3300048918	Bacteria	1804
1897	Ga0496115_0188253	3300048918	Bacteria	1705
1898	Ga0496115_0274322	3300048918	Bacteria	1385
1899	Ga0496115_0419143	3300048918	Bacteria	1085
1900	Ga0496115_0470202	3300048918	Bacteria	1013
1901	Ga0496115_0586665	3300048918	Bacteria	887
1902	Ga0496115_0691757	3300048918	Bacteria	802
1903	Ga0496116_0001323	3300048919	Bacteria	28218
1904	Ga0496116_0024301	3300048919	Bacteria	4486
1905	Ga0496116_0066599	3300048919	Bacteria	2304
1906	Ga0496116_0163623	3300048919	Bacteria	1217
1907	Ga0496117_0020401	3300048920	Bacteria	5403
1908	Ga0496117_0165583	3300048920	Bacteria	1290
1909	Ga0496117_0174216	3300048920	Bacteria	1245
1910	Ga0496117_0195291	3300048920	Bacteria	1148
1911	Ga0496117_0218397	3300048920	Bacteria	1063
1912	Ga0496117_0302647	3300048920	Bacteria	846
1913	Ga0496118_0026908	3300048921	Bacteria	4884
1914	Ga0496118_0040210	3300048921	Bacteria	3720
1915	Ga0496118_0063552	3300048921	Bacteria	2715
1916	Ga0496118_0101173	3300048921	Bacteria	1947
1917	Ga0496118_0491690	3300048921	Bacteria	612
1918	Ga0496118_0507052	3300048921	Bacteria	598
1919	Ga0496118_0613146	3300048921	Bacteria	518
1920	Ga0496119_0017786	3300048922	Bacteria	5329
1921	Ga0496119_0082087	3300048922	Bacteria	1854
1922	Ga0496119_0104400	3300048922	Bacteria	1585
1923	Ga0496120_0021553	3300048923	Bacteria	4071
1924	Ga0496120_0030676	3300048923	Bacteria	3263
1925	Ga0496120_0415894	3300048923	Bacteria	591
1926	Ga0496120_0470335	3300048923	Bacteria	544
1927	Ga0496120_0473539	3300048923	Bacteria	542
1928	Ga0496121_0000571	3300048924	Bacteria	69504
1929	Ga0496121_0002044	3300048924	Bacteria	31940
1930	Ga0496121_0046990	3300048924	Bacteria	3687
1931	Ga0496121_0048870	3300048924	Bacteria	3594
1932	Ga0496121_0067890	3300048924	Bacteria	2887
1933	Ga0496121_0090764	3300048924	Bacteria	2387
1934	Ga0496121_0123962	3300048924	Bacteria	1946
1935	Ga0496121_0164217	3300048924	Bacteria	1620
1936	Ga0496121_0171718	3300048924	Bacteria	1574
1937	Ga0496121_0184348	3300048924	Bacteria	1503
1938	Ga0496121_0319909	3300048924	Bacteria	1045
1939	Ga0496122_0154627	3300048925	Bacteria	1409
1940	Ga0496122_0616011	3300048925	Bacteria	505
1941	Ga0496123_0144677	3300048926	Bacteria	1293
1942	Ga0496123_0255727	3300048926	Bacteria	861
1943	Ga0496124_0001685	3300048927	Bacteria	31301
1944	Ga0496124_0026981	3300048927	Bacteria	5168
1945	Ga0496124_0218072	3300048927	Bacteria	1437
1946	Ga0496124_0256693	3300048927	Bacteria	1289
1947	Ga0496124_0281504	3300048927	Bacteria	1212
1948	Ga0496124_0654888	3300048927	Bacteria	673
1949	Ga0496125_0032494	3300048928	Bacteria	4635
1950	Ga0496125_0035490	3300048928	Bacteria	4372
1951	Ga0496125_0059320	3300048928	Bacteria	3084
1952	Ga0496125_0125905	3300048928	Bacteria	1816
1953	Ga0496125_0224641	3300048928	Bacteria	1206
1954	Ga0496125_0315102	3300048928	Bacteria	951
1955	Ga0496125_0389906	3300048928	Bacteria	818
1956	Ga0496125_0677463	3300048928	Bacteria	551
1957	Ga0496126_0008735	3300048929	Bacteria	10879
1958	Ga0496126_0009779	3300048929	Bacteria	10151
1959	Ga0496126_0018550	3300048929	Bacteria	6889
1960	Ga0496126_0029020	3300048929	Bacteria	5260
1961	Ga0496126_0031671	3300048929	Bacteria	4991
1962	Ga0496126_0057210	3300048929	Bacteria	3522
1963	Ga0496126_0070626	3300048929	Bacteria	3110
1964	Ga0496126_0113186	3300048929	Bacteria	2362
1965	Ga0496126_0134639	3300048929	Bacteria	2132
1966	Ga0496126_0149842	3300048929	Bacteria	2000
1967	Ga0496126_0173234	3300048929	Bacteria	1837
1968	Ga0496126_0255562	3300048929	Bacteria	1459
1969	Ga0496126_0270092	3300048929	Bacteria	1411
1970	Ga0496126_0349641	3300048929	Bacteria	1209
1971	Ga0496126_0354741	3300048929	Bacteria	1199
1972	Ga0496126_0413529	3300048929	Bacteria	1092
1973	Ga0496126_0419294	3300048929	Bacteria	1082
1974	Ga0496126_0522253	3300048929	Bacteria	946
1975	Ga0496126_0562359	3300048929	Bacteria	903
1976	Ga0496126_0675228	3300048929	Bacteria	805
1977	Ga0496126_0795270	3300048929	Bacteria	726
1978	Ga0496126_0979244	3300048929	Bacteria	636
1979	Ga0496126_1193529	3300048929	Bacteria	560
1980	Ga0496126_1239175	3300048929	Bacteria	546
1981	Ga0495678_154151	3300049459	Bacteria	739
1982	Ga0495682_0358164	3300049460	Bacteria	514
1983	Ga0501032_0059108	3300049569	Bacteria	2573
1984	Ga0501032_0274914	3300049569	Bacteria	1091
1985	Ga0501032_0972893	3300049569	Bacteria	533
1986	Ga0501033_0220433	3300049570	Bacteria	1350
1987	Ga0501033_0273525	3300049570	Bacteria	1193
1988	Ga0501033_0278441	3300049570	Bacteria	1181
1989	Ga0501034_0405199	3300049571	Bacteria	1286
1990	Ga0501034_0767732	3300049571	Bacteria	858
1991	Ga0501036_0124859	3300049572	Bacteria	2173
1992	Ga0501036_0166110	3300049572	Bacteria	1860
1993	Ga0501036_0850474	3300049572	Bacteria	750
1994	Ga0501038_0061479	3300049574	Bacteria	3212
1995	Ga0501038_0222174	3300049574	Bacteria	1506
1996	Ga0501038_0744438	3300049574	Bacteria	731
1997	Ga0501038_1220482	3300049574	Bacteria	545
1998	Ga0501040_0399717	3300049576	Bacteria	987
1999	Ga0501041_0197103	3300049577	Bacteria	1262
2000	Ga0501043_0048149	3300049579	Bacteria	3351
2001	Ga0501043_0251060	3300049579	Bacteria	1362
2002	Ga0501043_0306881	3300049579	Bacteria	1212
2003	Ga0501046_0036129	3300049580	Bacteria	3978
2004	Ga0501046_0519479	3300049580	Bacteria	851
2005	Ga0501047_0002848	3300049581	Bacteria	16404
2006	Ga0501047_0077773	3300049581	Bacteria	3191
2007	Ga0501047_0467581	3300049581	Bacteria	1089
2008	Ga0501048_0254235	3300049582	Bacteria	1248
2009	Ga0501048_0362458	3300049582	Bacteria	1034
2010	Ga0501048_0495041	3300049582	Bacteria	876
2011	Ga0501067_0032060	3300049583	Bacteria	2916
2012	Ga0501067_0074398	3300049583	Bacteria	1882
2013	Ga0501068_0124797	3300049584	Bacteria	1607
2014	Ga0501069_0286967	3300049585	Bacteria	964
2015	Ga0501070_0146861	3300049586	Bacteria	1946
2016	Ga0501070_0660192	3300049586	Bacteria	830
2017	Ga0501071_0056899	3300049587	Bacteria	2825
2018	Ga0501073_0043252	3300049589	Bacteria	3176
2019	Ga0501073_0073690	3300049589	Bacteria	2377
2020	Ga0501073_0219916	3300049589	Bacteria	1312
2021	Ga0501073_0334837	3300049589	Bacteria	1045
2022	Ga0501074_0005315	3300049590	Bacteria	9269
2023	Ga0501079_0307239	3300049741	Bacteria	1241
2024	Ga0501079_0410878	3300049741	Bacteria	1062
2025	Ga0501079_1074768	3300049741	Bacteria	634
2026	Ga0501080_0006064	3300049742	Bacteria	10835
2027	Ga0501080_0311423	3300049742	Bacteria	1427
2028	Ga0501080_0468873	3300049742	Bacteria	1127
2029	Ga0501081_0257903	3300049743	Bacteria	1274
2030	Ga0501081_0433734	3300049743	Bacteria	975
2031	Ga0501083_0860449	3300049744	Bacteria	590
2032	Ga0501035_0136353	3300049822	Bacteria	2136
2033	Ga0501035_0632365	3300049822	Bacteria	869
2034	Ga0501035_0764179	3300049822	Bacteria	774
2035	Ga0501044_0016124	3300049823	Bacteria	8032
2036	Ga0501044_0049800	3300049823	Bacteria	4324
2037	Ga0501044_0179696	3300049823	Bacteria	2083
2038	Ga0501044_0652166	3300049823	Bacteria	941
2039	Ga0501045_0105438	3300049824	Bacteria	2089
2040	Ga0501045_0619580	3300049824	Bacteria	801
2041	nmdc:mga03683_286311_c1	3300050489	Bacteria	771
2042	nmdc:mga03683_30854_c1	3300050489	Bacteria	2146
2043	nmdc:mga03683_479326_c1	3300050489	Bacteria	601
2044	nmdc:mga03n38_188992_c1	3300050490	Bacteria	1060
2045	nmdc:mga03n38_34172_c1	3300050490	Bacteria	2169
2046	nmdc:mga03n38_434546_c1	3300050490	Bacteria	728
2047	nmdc:mga03n38_45365_c1	3300050490	Bacteria	1935
2048	nmdc:mga00v17_278308_c1	3300050491	Bacteria	1086
2049	nmdc:mga00v17_317595_c1	3300050491	Bacteria	1012
2050	nmdc:mga00v17_387419_c1	3300050491	Bacteria	908
2051	nmdc:mga00v17_431530_c1	3300050491	Bacteria	856
2052	nmdc:mga00v17_616155_c1	3300050491	Bacteria	699
2053	nmdc:mga00v17_756718_c1	3300050491	Bacteria	621
2054	nmdc:mga00v17_76573_c1	3300050491	Bacteria	2081
2055	nmdc:mga00v17_965789_c1	3300050491	Bacteria	537
2056	nmdc:mga0yw44_12384_c1	3300050492	Bacteria	4443
2057	nmdc:mga0yw44_172237_c1	3300050492	Bacteria	1422
2058	nmdc:mga0yw44_190475_c1	3300050492	Bacteria	1353
2059	nmdc:mga0yw44_693367_c1	3300050492	Bacteria	692
2060	nmdc:mga0k408_251209_c1	3300050493	Bacteria	1056
2061	nmdc:mga0k408_578034_c1	3300050493	Bacteria	663
2062	nmdc:mga06z11_182981_c1	3300050494	Bacteria	1209
2063	nmdc:mga06z11_19827_c1	3300050494	Bacteria	3100
2064	nmdc:mga06z11_282421_c1	3300050494	Bacteria	984
2065	nmdc:mga06z11_363165_c1	3300050494	Bacteria	868
2066	nmdc:mga06z11_47647_c1	3300050494	Bacteria	2177
2067	nmdc:mga06z11_54694_c1	3300050494	Bacteria	2058
2068	nmdc:mga06z11_768576_c1	3300050494	Bacteria	587
2069	nmdc:mga04h51_130708_c1	3300050495	Bacteria	944
2070	nmdc:mga04h51_239723_c1	3300050495	Bacteria	724
2071	nmdc:mga04h51_92585_c1	3300050495	Bacteria	1090
2072	nmdc:mga07m45_200312_c1	3300050496	Bacteria	1161
2073	nmdc:mga07m45_239927_c1	3300050496	Bacteria	1055
2074	nmdc:mga07m45_266390_c1	3300050496	Bacteria	997
2075	nmdc:mga07m45_275749_c1	3300050496	Bacteria	978
2076	nmdc:mga07m45_28602_c1	3300050496	Bacteria	3077
2077	nmdc:mga07m45_29520_c1	3300050496	Bacteria	3033
2078	nmdc:mga07m45_529485_c1	3300050496	Bacteria	682
2079	nmdc:mga05p37_28545_c1	3300050507	Bacteria	6804
2080	nmdc:mga05p37_48772_c1	3300050507	Bacteria	5207
2081	nmdc:mga09592_1688243_c1	3300050508	Bacteria	511
2082	nmdc:mga09592_34344_c1	3300050508	Bacteria	4239
2083	nmdc:mga0qj67_1096168_c1	3300050509	Bacteria	622
2084	nmdc:mga0qj67_37098_c1	3300050509	Bacteria	3817
2085	nmdc:mga0qj67_78645_c1	3300050509	Bacteria	2640
2086	nmdc:mga06r32_17491_c1	3300050510	Bacteria	6544
2087	nmdc:mga06r32_189093_c1	3300050510	Bacteria	2046
2088	nmdc:mga06r32_53540_c1	3300050510	Bacteria	3866
2089	nmdc:mga06r32_736371_c1	3300050510	Bacteria	950
2090	nmdc:mga08y16_300083_c1	3300050511	Bacteria	1656
2091	nmdc:mga08y16_635893_c1	3300050511	Bacteria	1073
2092	nmdc:mga08y16_718715_c1	3300050511	Bacteria	997
2093	nmdc:mga08y16_978873_c1	3300050511	Bacteria	827
2094	nmdc:mga0n895_105804_c1	3300050512	Bacteria	2826
2095	nmdc:mga0n895_189953_c1	3300050512	Bacteria	2085
2096	nmdc:mga0n895_2721_c1	3300050512	Bacteria	13944
2097	nmdc:mga0n895_321200_c1	3300050512	Bacteria	1569
2098	nmdc:mga0n895_75845_c1	3300050512	Bacteria	3343
2099	nmdc:mga0rr50_1083035_c1	3300050513	Bacteria	682
2100	nmdc:mga0rr50_44122_c1	3300050513	Bacteria	3268
2101	nmdc:mga0rr50_664891_c1	3300050513	Bacteria	889
2102	nmdc:mga0rr50_698674_c1	3300050513	Bacteria	866
2103	nmdc:mga0rr50_701828_c1	3300050513	Bacteria	863
2104	nmdc:mga0rr50_861669_c1	3300050513	Bacteria	772
2105	nmdc:mga08x19_1016069_c1	3300050514	Bacteria	589
2106	nmdc:mga08x19_498553_c1	3300050514	Bacteria	859
2107	nmdc:mga08x19_77858_c1	3300050514	Bacteria	2172
2108	nmdc:mga0sz30_280780_c1	3300050516	Bacteria	742
2109	nmdc:mga0sz30_88030_c1	3300050516	Bacteria	1349
2110	Ga0495601_0000018	3300053077	Bacteria	171665
2111	Ga0495601_0019541	3300053077	Bacteria	4132
2112	Ga0495601_0030604	3300053077	Bacteria	3342
2113	Ga0495601_0035735	3300053077	Bacteria	3102
2114	Ga0495601_0040201	3300053077	Bacteria	2929
2115	Ga0495601_0091902	3300053077	Bacteria	1954
2116	Ga0495601_0093583	3300053077	Bacteria	1936
2117	Ga0495601_0122638	3300053077	Bacteria	1689
2118	Ga0495601_0125618	3300053077	Bacteria	1669
2119	Ga0495601_0269962	3300053077	Bacteria	1110
2120	Ga0495601_0696208	3300053077	Bacteria	648
2121	Ga0495601_0704688	3300053077	Bacteria	644
2122	Ga0495601_0869703	3300053077	Bacteria	570
2123	Ga0495612_0000011	3300053078	Bacteria	224729
2124	Ga0495612_0001975	3300053078	Bacteria	8448
2125	Ga0495612_0006146	3300053078	Bacteria	4941
2126	Ga0495612_0024569	3300053078	Bacteria	2419
2127	Ga0495612_0076662	3300053078	Bacteria	1400
2128	Ga0495612_0109677	3300053078	Bacteria	1180
2129	Ga0495612_0384480	3300053078	Bacteria	636
2130	Ga0500635_0016395	3300053080	Bacteria	2203
2131	Ga0500635_0025320	3300053080	Bacteria	1869
2132	Ga0500635_0089583	3300053080	Bacteria	1117
2133	Ga0495655_0130740	3300053083	Bacteria	773
2134	Ga0495655_0356130	3300053083	Bacteria	513
2135	Ga0495595_0000043	3300053084	Bacteria	63655
2136	Ga0495595_0002892	3300053084	Bacteria	6767
2137	Ga0495595_0015891	3300053084	Bacteria	3213
2138	Ga0495595_0016609	3300053084	Bacteria	3153
2139	Ga0495595_0147656	3300053084	Bacteria	1156
2140	Ga0495595_0429577	3300053084	Bacteria	671
2141	Ga0495619_0000014	3300053085	Bacteria	261449
2142	Ga0495619_0001423	3300053085	Bacteria	15727
2143	Ga0495619_0080775	3300053085	Bacteria	2188
2144	Ga0495619_0120706	3300053085	Bacteria	1797
2145	Ga0495619_0129420	3300053085	Bacteria	1734
2146	Ga0495619_0227205	3300053085	Bacteria	1293
2147	Ga0495619_0382003	3300053085	Bacteria	973
2148	Ga0495619_0520388	3300053085	Bacteria	817
2149	Ga0495619_0884681	3300053085	Bacteria	601
2150	Ga0495619_0948984	3300053085	Bacteria	577
2151	Ga0500578_0122394	3300053086	Bacteria	1635
2152	Ga0500578_0139550	3300053086	Bacteria	1516
2153	Ga0500643_000028	3300053087	Bacteria	245672
2154	Ga0500643_036793	3300053087	Bacteria	1461
2155	Ga0500644_0067991	3300053088	Bacteria	1276
2156	Ga0500644_0116428	3300053088	Bacteria	1036
2157	Ga0500644_0259831	3300053088	Bacteria	734
2158	Ga0500647_0091934	3300053091	Bacteria	1452
2159	Ga0500583_0036746	3300053092	Bacteria	2195
2160	Ga0500583_0161888	3300053092	Bacteria	1114
2161	Ga0500651_0059720	3300053093	Bacteria	2384
2162	Ga0500651_0229155	3300053093	Bacteria	1087
2163	Ga0500566_0000351	3300053094	Bacteria	25000
2164	Ga0500566_0000748	3300053094	Bacteria	18276
2165	Ga0500566_0000805	3300053094	Bacteria	17856
2166	Ga0500566_0040219	3300053094	Bacteria	2702
2167	Ga0500566_0152017	3300053094	Bacteria	1216
2168	Ga0500640_000160	3300053095	Bacteria	13515
2169	Ga0500640_008838	3300053095	Bacteria	4004
2170	Ga0500641_0019232	3300053096	Bacteria	2580
2171	Ga0500641_0033909	3300053096	Bacteria	2029
2172	Ga0500641_0034964	3300053096	Bacteria	2003
2173	Ga0500648_276319	3300053097	Bacteria	762
2174	Ga0500650_0424858	3300053098	Bacteria	572
2175	Ga0500554_000880	3300053102	Bacteria	5880
2176	Ga0500554_009167	3300053102	Bacteria	2359
2177	Ga0500555_001161	3300053103	Bacteria	8660
2178	Ga0500556_0003427	3300053104	Bacteria	4668
2179	Ga0500557_000188	3300053105	Bacteria	10841
2180	Ga0500558_154518	3300053106	Bacteria	848
2181	Ga0500562_010404	3300053108	Bacteria	2357
2182	Ga0500569_003580	3300053109	Bacteria	3189
2183	Ga0500569_125030	3300053109	Bacteria	858
2184	Ga0500572_000802	3300053111	Bacteria	10030
2185	Ga0500572_001393	3300053111	Bacteria	6657
2186	Ga0500575_167463	3300053112	Bacteria	711
2187	Ga0500582_231104	3300053114	Bacteria	607
2188	Ga0500591_013535	3300053115	Bacteria	3908
2189	Ga0500592_002927	3300053116	Bacteria	2739
2190	Ga0500594_0104232	3300053118	Bacteria	876
2191	Ga0500595_000141	3300053119	Bacteria	46988
2192	Ga0500595_004565	3300053119	Bacteria	6181
2193	Ga0500595_008908	3300053119	Bacteria	4076
2194	Ga0500595_022398	3300053119	Bacteria	2238
2195	Ga0500595_156506	3300053119	Bacteria	635
2196	Ga0500597_179602	3300053120	Bacteria	898
2197	Ga0500607_039518	3300053121	Bacteria	2560
2198	Ga0500608_026925	3300053122	Bacteria	2706
2199	Ga0500608_039171	3300053122	Bacteria	2269
2200	Ga0500608_056386	3300053122	Bacteria	1882
2201	Ga0500608_314637	3300053122	Bacteria	573
2202	Ga0500614_003628	3300053123	Bacteria	3313
2203	Ga0500614_010756	3300053123	Bacteria	1969
2204	Ga0500618_001915	3300053125	Bacteria	8595
2205	Ga0500621_111173	3300053126	Bacteria	1070
2206	Ga0500621_248181	3300053126	Bacteria	599
2207	Ga0500642_0000174	3300053130	Bacteria	26656
2208	Ga0500642_0126476	3300053130	Bacteria	1197
2209	Ga0500642_0452795	3300053130	Bacteria	550
2210	Ga0500655_008727	3300053133	Bacteria	1823
2211	Ga0500655_075069	3300053133	Bacteria	691
2212	Ga0500658_0158521	3300053134	Bacteria	1023
2213	Ga0500658_0296464	3300053134	Bacteria	743
2214	Ga0500559_0000188	3300053136	Bacteria	49358
2215	Ga0500559_0001967	3300053136	Bacteria	11097
2216	Ga0500559_0004335	3300053136	Bacteria	6764
2217	Ga0500559_0023885	3300053136	Bacteria	2597
2218	Ga0500559_0145643	3300053136	Bacteria	1110
2219	Ga0500559_0152662	3300053136	Bacteria	1084
2220	Ga0500564_154711	3300053138	Bacteria	974
2221	Ga0500568_0020354	3300053139	Bacteria	2871
2222	Ga0500568_0025065	3300053139	Bacteria	2520
2223	Ga0500577_0375039	3300053142	Bacteria	622
2224	Ga0500588_0208010	3300053146	Bacteria	726
2225	Ga0500589_046415	3300053147	Bacteria	2023
2226	Ga0500589_148201	3300053147	Bacteria	958
2227	Ga0500589_332243	3300053147	Bacteria	527
2228	Ga0500590_046965	3300053148	Bacteria	2205
2229	Ga0500590_082369	3300053148	Bacteria	1578
2230	Ga0500590_172010	3300053148	Bacteria	951
2231	Ga0500590_345196	3300053148	Bacteria	535
2232	Ga0500603_000092	3300053150	Bacteria	21528
2233	Ga0500603_000875	3300053150	Bacteria	7184
2234	Ga0500603_008687	3300053150	Bacteria	2261
2235	Ga0500603_013513	3300053150	Bacteria	1894
2236	Ga0500603_018478	3300053150	Bacteria	1680
2237	Ga0500603_040443	3300053150	Bacteria	1242
2238	Ga0500604_0000612	3300053151	Bacteria	9791
2239	Ga0500604_0096308	3300053151	Bacteria	971
2240	Ga0500616_0000408	3300053153	Bacteria	58453
2241	Ga0500616_0047993	3300053153	Bacteria	2265
2242	Ga0500616_0053817	3300053153	Bacteria	2110
2243	Ga0500619_008874	3300053154	Bacteria	2466
2244	Ga0500620_003602	3300053155	Bacteria	3337
2245	Ga0500622_0007870	3300053156	Bacteria	6003
2246	Ga0500627_0004834	3300053158	Bacteria	4388
2247	Ga0500630_011856	3300053159	Bacteria	4295
2248	Ga0500633_0018216	3300053160	Bacteria	2077
2249	Ga0500634_0098285	3300053161	Bacteria	1471
2250	Ga0500634_0100498	3300053161	Bacteria	1448
2251	Ga0500638_007151	3300053162	Bacteria	4641
2252	Ga0500638_015245	3300053162	Bacteria	3522
2253	Ga0500638_025201	3300053162	Bacteria	2842
2254	Ga0500638_066776	3300053162	Bacteria	1723
2255	Ga0500638_147861	3300053162	Bacteria	1048
2256	Ga0500638_235497	3300053162	Bacteria	748
2257	Ga0500639_000103	3300053163	Bacteria	39784
2258	Ga0500639_026472	3300053163	Bacteria	3065
2259	Ga0500639_171719	3300053163	Bacteria	971
2260	Ga0500639_185848	3300053163	Bacteria	912
2261	Ga0500636_0000632	3300053177	Bacteria	18995
2262	Ga0500636_0010870	3300053177	Bacteria	5319
2263	Ga0500636_0046327	3300053177	Bacteria	2563
2264	Ga0500636_0109020	3300053177	Bacteria	1566
2265	Ga0500636_0207255	3300053177	Bacteria	1032
2266	Ga0500637_0005224	3300053178	Bacteria	6265
2267	Ga0500637_0304974	3300053178	Bacteria	866
2268	Ga0500637_0364364	3300053178	Bacteria	764
2269	Ga0500637_0367613	3300053178	Bacteria	759
2270	Ga0500649_035325	3300053722	Bacteria	2103
2271	Ga0500576_081112	3300053725	Bacteria	1370
2272	Ga0500611_158575	3300053727	Bacteria	625
2273	Ga0500657_133472	3300053728	Bacteria	957
2274	Ga0500625_021497	3300053729	Bacteria	3042
2275	Ga0500625_238836	3300053729	Bacteria	556
2276	Ga0500645_013567	3300053730	Bacteria	2612
2277	Ga0500645_045912	3300053730	Bacteria	1282
2278	Ga0500645_077697	3300053730	Bacteria	948
2279	Ga0500609_023155	3300053731	Bacteria	850
2280	Ga0500552_017561	3300053733	Bacteria	982
2281	Ga0500596_000547	3300053735	Bacteria	7142
2282	Ga0500596_009662	3300053735	Bacteria	1501
2283	Ga0500596_028122	3300053735	Bacteria	865
2284	Ga0500599_017378	3300053736	Bacteria	999
2285	Ga0500601_000917	3300053737	Bacteria	3504
2286	Ga0500587_016817	3300053739	Bacteria	936
2287	Ga0500661_000372	3300055283	Bacteria	8285
2288	Ga0500661_011050	3300055283	Bacteria	1638
2289	Ga0500661_029988	3300055283	Bacteria	960
2290	Ga0590075_128154	3300059424	Bacteria	666
2291	Ga0501082_0332462	3300060353	Bacteria	1324
2292	Ga0501082_0495098	3300060353	Bacteria	1068
2293	Ga0501082_0660211	3300060353	Bacteria	915
2294	Ga0501082_0686713	3300060353	Bacteria	896
2295	Ga0501082_1041088	3300060353	Bacteria	716
2296	Ga0466962_0071550	3300061719	Bacteria	1657
2297	Ga0530510_0195100	3300061734	Bacteria	1503

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300037853	Ga0436364_0313235	Ga0436364_0313235_14810_15205	119
2	3300006914	Ga0075436_100476830	Ga0075436_1004768302	120
3	3300025939	Ga0207665_10089691	Ga0207665_100896912	120
4	3300037853	Ga0436364_0395343	Ga0436364_0395343_183_563	120
5	3300039447	Ga0436361_0145462	Ga0436361_0145462_345_755	120
6	3300039453	Ga0436362_0244792	Ga0436362_0244792_134_514	120
7	3300050514	nmdc:mga08x19_1016069_c1	nmdc:mga08x19_1016069_c1_155_550	120
8	3300006847	Ga0075431_100235178	Ga0075431_1002351783	121
9	3300006871	Ga0075434_100898170	Ga0075434_1008981701	121
10	3300006880	Ga0075429_100337561	Ga0075429_1003375612	121
11	3300009147	Ga0114129_10224593	Ga0114129_102245932	121
12	3300049574	Ga0501038_1220482	Ga0501038_1220482_110_487	121
13	3300050508	nmdc:mga09592_1688243_c1	nmdc:mga09592_1688243_c1_70_447	121
14	3300050509	nmdc:mga0qj67_78645_c1	nmdc:mga0qj67_78645_c1_1935_2312	121
15	3300050510	nmdc:mga06r32_189093_c1	nmdc:mga06r32_189093_c1_1278_1655	121
16	3300050510	nmdc:mga06r32_736371_c1	nmdc:mga06r32_736371_c1_547_924	121
17	3300060353	Ga0501082_0660211	Ga0501082_0660211_114_491	121
18	3300006852	Ga0075433_10678733	Ga0075433_106787332	122
19	3300006871	Ga0075434_100016095	Ga0075434_1000160952	122
20	3300007076	Ga0075435_100218296	Ga0075435_1002182962	122
21	3300009094	Ga0111539_10014243	Ga0111539_100142431	122
22	3300027907	Ga0207428_10710494	Ga0207428_107104941	122
23	3300050511	nmdc:mga08y16_635893_c1	nmdc:mga08y16_635893_c1_105_482	122
24	3300050512	nmdc:mga0n895_75845_c1	nmdc:mga0n895_75845_c1_847_1224	122
25	3300050513	nmdc:mga0rr50_664891_c1	nmdc:mga0rr50_664891_c1_252_629	122
26	3300003323	rootH1_10275241	rootH1_102752411	123
27	3300005334	Ga0068869_100714947	Ga0068869_1007149472	123
28	3300005335	Ga0070666_10165378	Ga0070666_101653782	123
29	3300005335	Ga0070666_10846708	Ga0070666_108467081	123
30	3300005338	Ga0068868_100010097	Ga0068868_1000100979	123
31	3300005435	Ga0070714_101076938	Ga0070714_1010769381	123
32	3300005458	Ga0070681_10671259	Ga0070681_106712592	123
33	3300005539	Ga0068853_100175967	Ga0068853_1001759672	123
34	3300005543	Ga0070672_100312023	Ga0070672_1003120232	123
35	3300005544	Ga0070686_100040784	Ga0070686_1000407843	123
36	3300005563	Ga0068855_100480372	Ga0068855_1004803722	123
37	3300005617	Ga0068859_100309146	Ga0068859_1003091463	123
38	3300005718	Ga0068866_10735271	Ga0068866_107352711	123
39	3300005834	Ga0068851_10262813	Ga0068851_102628132	123
40	3300005841	Ga0068863_102171307	Ga0068863_1021713071	123
41	3300005842	Ga0068858_100016403	Ga0068858_1000164032	123
42	3300006028	Ga0070717_10228465	Ga0070717_102284652	123
43	3300006028	Ga0070717_10318715	Ga0070717_103187152	123
44	3300006051	Ga0075364_10370480	Ga0075364_103704801	123
45	3300006177	Ga0075362_10674164	Ga0075362_106741642	123
46	3300006178	Ga0075367_10306683	Ga0075367_103066833	123
47	3300006237	Ga0097621_100033447	Ga0097621_1000334472	123
48	3300006844	Ga0075428_100163023	Ga0075428_1001630232	123
49	3300006880	Ga0075429_100034810	Ga0075429_1000348103	123
50	3300006931	Ga0097620_100309192	Ga0097620_1003091921	123
51	3300009098	Ga0105245_10001330	Ga0105245_100013303	123
52	3300009147	Ga0114129_10088522	Ga0114129_100885223	123
53	3300009147	Ga0114129_12255374	Ga0114129_122553741	123
54	3300009148	Ga0105243_10432001	Ga0105243_104320012	123
55	3300009176	Ga0105242_10091499	Ga0105242_100914992	123
56	3300009177	Ga0105248_10016524	Ga0105248_100165246	123
57	3300009545	Ga0105237_10338462	Ga0105237_103384622	123
58	3300009551	Ga0105238_10071981	Ga0105238_100719813	123
59	3300010375	Ga0105239_10221406	Ga0105239_102214062	123
60	3300010375	Ga0105239_10375058	Ga0105239_103750582	123
61	3300013297	Ga0157378_10474946	Ga0157378_104749462	123
62	3300014968	Ga0157379_10131610	Ga0157379_101316101	123
63	3300024227	Ga0228598_1024086	Ga0228598_10240861	123
64	3300025906	Ga0207699_11129769	Ga0207699_111297691	123
65	3300025912	Ga0207707_10499083	Ga0207707_104990832	123
66	3300025928	Ga0207700_10926456	Ga0207700_109264562	123
67	3300025929	Ga0207664_11161196	Ga0207664_111611961	123
68	3300028800	Ga0265338_10071491	Ga0265338_100714912	123
69	3300031241	Ga0265325_10015261	Ga0265325_100152613	123
70	3300031242	Ga0265329_10048118	Ga0265329_100481182	123
71	3300031247	Ga0265340_10098564	Ga0265340_100985642	123
72	3300031249	Ga0265339_10001183	Ga0265339_100011837	123
73	3300031249	Ga0265339_10010637	Ga0265339_100106374	123
74	3300031250	Ga0265331_10051543	Ga0265331_100515433	123
75	3300031595	Ga0265313_10001097	Ga0265313_100010979	123
76	3300031711	Ga0265314_10029892	Ga0265314_100298922	123
77	3300031711	Ga0265314_10194337	Ga0265314_101943371	123
78	3300031712	Ga0265342_10001317	Ga0265342_1000131722	123
79	3300031712	Ga0265342_10038636	Ga0265342_100386364	123
80	3300035083	Ga0373926_0067816	Ga0373926_0067816_787_1161	123
81	3300035086	Ga0373934_0121746	Ga0373934_0121746_657_1034	123
82	3300035086	Ga0373934_0148705	Ga0373934_0148705_32_412	123
83	3300035113	Ga0373936_0001116	Ga0373936_0001116_8547_8921	123
84	3300035116	Ga0373945_0009991	Ga0373945_0009991_1254_1628	123
85	3300035117	Ga0373953_0000719	Ga0373953_0000719_485_859	123
86	3300035117	Ga0373953_0292447	Ga0373953_0292447_294_674	123
87	3300035117	Ga0373953_0335695	Ga0373953_0335695_253_630	123
88	3300035118	Ga0373954_0016751	Ga0373954_0016751_1074_1448	123
89	3300035119	Ga0373956_0118838	Ga0373956_0118838_633_1010	123
90	3300035119	Ga0373956_0254837	Ga0373956_0254837_324_704	123
91	3300035120	Ga0373957_0016376	Ga0373957_0016376_1491_1871	123
92	3300035120	Ga0373957_0074212	Ga0373957_0074212_373_747	123
93	3300035170	Ga0373943_0008248	Ga0373943_0008248_3615_3989	123
94	3300035170	Ga0373943_0381347	Ga0373943_0381347_399_776	123
95	3300035171	Ga0373946_0000239	Ga0373946_0000239_722_1096	123
96	3300035171	Ga0373946_0098330	Ga0373946_0098330_714_1091	123
97	3300035172	Ga0373955_0000199	Ga0373955_0000199_12776_13150	123
98	3300035172	Ga0373955_0000818	Ga0373955_0000818_790_1170	123
99	3300035172	Ga0373955_0159344	Ga0373955_0159344_136_513	123
100	3300035172	Ga0373955_0307326	Ga0373955_0307326_223_597	123
101	3300035410	Ga0373924_0024903	Ga0373924_0024903_629_1009	123
102	3300035410	Ga0373924_0042122	Ga0373924_0042122_1137_1511	123
103	3300035692	Ga0373935_0000054	Ga0373935_0000054_3975_4349	123
104	3300035692	Ga0373935_0011477	Ga0373935_0011477_320_700	123
105	3300035692	Ga0373935_0110557	Ga0373935_0110557_1273_1650	123
106	3300035695	Ga0373927_0012773	Ga0373927_0012773_5137_5511	123
107	3300035695	Ga0373927_0031599	Ga0373927_0031599_515_889	123
108	3300035695	Ga0373927_0115547	Ga0373927_0115547_302_682	123
109	3300035724	Ga0373933_0001735	Ga0373933_0001735_3331_3705	123
110	3300035724	Ga0373933_0002567	Ga0373933_0002567_4553_4933	123
111	3300035724	Ga0373933_0076293	Ga0373933_0076293_1602_1979	123
112	3300035725	Ga0373947_0001754	Ga0373947_0001754_1713_2087	123
113	3300035725	Ga0373947_0066381	Ga0373947_0066381_475_849	123
114	3300035725	Ga0373947_0078762	Ga0373947_0078762_611_988	123
115	3300035725	Ga0373947_0654428	Ga0373947_0654428_101_481	123
116	3300036401	Ga0373937_0000593	Ga0373937_0000593_9228_9602	123
117	3300036401	Ga0373937_0008172	Ga0373937_0008172_7173_7553	123
118	3300036401	Ga0373937_0549057	Ga0373937_0549057_192_569	123
119	3300037068	Ga0373925_0000614	Ga0373925_0000614_506_880	123
120	3300037068	Ga0373925_0014983	Ga0373925_0014983_859_1239	123
121	3300037068	Ga0373925_0302897	Ga0373925_0302897_202_579	123
122	3300037418	Ga0395900_0850665	Ga0395900_0850665_184_558	123
123	3300037466	Ga0395898_0164109	Ga0395898_0164109_298_672	123
124	3300037853	Ga0436364_0261434	Ga0436364_0261434_115_498	123
125	3300037853	Ga0436364_1160315	Ga0436364_1160315_111_494	123
126	3300039447	Ga0436361_0818581	Ga0436361_0818581_724_1101	123
127	3300042005	Ga0439448_0205591	Ga0439448_0205591_100_504	123
128	3300046454	Ga0495592_0000031	Ga0495592_0000031_95042_95416	123
129	3300046454	Ga0495592_0256567	Ga0495592_0256567_225_602	123
130	3300046455	Ga0495603_0007344	Ga0495603_0007344_1299_1673	123
131	3300046455	Ga0495603_0287126	Ga0495603_0287126_422_802	123
132	3300046455	Ga0495603_0452162	Ga0495603_0452162_218_595	123
133	3300046459	Ga0495629_0004844	Ga0495629_0004844_5252_5632	123
134	3300046459	Ga0495629_0518926	Ga0495629_0518926_260_637	123
135	3300046461	Ga0495641_0185217	Ga0495641_0185217_425_799	123
136	3300046461	Ga0495641_0284889	Ga0495641_0284889_165_545	123
137	3300046462	Ga0495651_0000747	Ga0495651_0000747_5610_5990	123
138	3300046462	Ga0495651_0002254	Ga0495651_0002254_3036_3410	123
139	3300046462	Ga0495651_0040296	Ga0495651_0040296_1236_1613	123
140	3300046462	Ga0495651_0282841	Ga0495651_0282841_402_776	123
141	3300046463	Ga0495653_0000063	Ga0495653_0000063_36764_37138	123
142	3300046463	Ga0495653_0013482	Ga0495653_0013482_1060_1440	123
143	3300046472	Ga0495580_0058030	Ga0495580_0058030_20_394	123
144	3300046476	Ga0495662_0000791	Ga0495662_0000791_11453_11827	123
145	3300046476	Ga0495662_0084715	Ga0495662_0084715_647_1027	123
146	3300046477	Ga0495664_0000004	Ga0495664_0000004_438367_438741	123
147	3300046477	Ga0495664_0161300	Ga0495664_0161300_501_878	123
148	3300046477	Ga0495664_0176133	Ga0495664_0176133_359_739	123
149	3300046499	Ga0495594_0419600	Ga0495594_0419600_168_545	123
150	3300046511	Ga0495608_0000005	Ga0495608_0000005_104795_105169	123
151	3300046511	Ga0495608_0002757	Ga0495608_0002757_5908_6288	123
152	3300046511	Ga0495608_0089544	Ga0495608_0089544_716_1090	123
153	3300046511	Ga0495608_0244006	Ga0495608_0244006_449_826	123
154	3300046514	Ga0495618_0000095	Ga0495618_0000095_33170_33544	123
155	3300046514	Ga0495618_0004070	Ga0495618_0004070_1649_2029	123
156	3300046516	Ga0495628_0000001	Ga0495628_0000001_438356_438730	123
157	3300046516	Ga0495628_0332989	Ga0495628_0332989_460_837	123
158	3300046517	Ga0495630_0001436	Ga0495630_0001436_11614_11988	123
159	3300046526	Ga0495666_0112524	Ga0495666_0112524_656_1030	123
160	3300046529	Ga0495652_0000002	Ga0495652_0000002_652890_653264	123
161	3300046529	Ga0495652_0016115	Ga0495652_0016115_4981_5361	123
162	3300046529	Ga0495652_0077790	Ga0495652_0077790_653_1030	123
163	3300046531	Ga0495665_0299427	Ga0495665_0299427_382_759	123
164	3300046533	Ga0495640_0000001	Ga0495640_0000001_746894_747268	123
165	3300046533	Ga0495640_0006289	Ga0495640_0006289_7164_7544	123
166	3300046535	Ga0495586_0501033	Ga0495586_0501033_101_475	123
167	3300046536	Ga0495587_0000016	Ga0495587_0000016_17702_18076	123
168	3300046536	Ga0495587_0001133	Ga0495587_0001133_1014_1394	123
169	3300046536	Ga0495587_0169015	Ga0495587_0169015_128_505	123
170	3300046543	Ga0495645_0000002	Ga0495645_0000002_438369_438743	123
171	3300046543	Ga0495645_0041807	Ga0495645_0041807_289_669	123
172	3300046543	Ga0495645_0375973	Ga0495645_0375973_360_737	123
173	3300046557	Ga0495622_0133626	Ga0495622_0133626_144_518	123
174	3300046559	Ga0495667_0000007	Ga0495667_0000007_231104_231478	123
175	3300046559	Ga0495667_0002304	Ga0495667_0002304_7157_7537	123
176	3300046559	Ga0495667_0516835	Ga0495667_0516835_185_562	123
177	3300046642	Ga0495634_0000591	Ga0495634_0000591_17609_17983	123
178	3300046642	Ga0495634_0004451	Ga0495634_0004451_7842_8222	123
179	3300046663	Ga0495635_0000002	Ga0495635_0000002_48194_48568	123
180	3300046663	Ga0495635_0007098	Ga0495635_0007098_2235_2615	123
181	3300046663	Ga0495635_0104576	Ga0495635_0104576_95_472	123
182	3300046675	Ga0495657_0000668	Ga0495657_0000668_19898_20272	123
183	3300046675	Ga0495657_0009885	Ga0495657_0009885_5868_6248	123
184	3300046678	Ga0495599_0000005	Ga0495599_0000005_266591_266965	123
185	3300046678	Ga0495599_0009924	Ga0495599_0009924_4346_4726	123
186	3300046679	Ga0495623_0000016	Ga0495623_0000016_90541_90915	123
187	3300046679	Ga0495623_0031608	Ga0495623_0031608_2131_2508	123
188	3300046679	Ga0495623_0165376	Ga0495623_0165376_126_506	123
189	3300046680	Ga0495646_0000002	Ga0495646_0000002_33146_33520	123
190	3300046680	Ga0495646_0013078	Ga0495646_0013078_1002_1382	123
191	3300046680	Ga0495646_0151207	Ga0495646_0151207_562_939	123
192	3300046683	Ga0495658_0021298	Ga0495658_0021298_1970_2347	123
193	3300046689	Ga0495613_0164399	Ga0495613_0164399_935_1315	123
194	3300046690	Ga0495624_0030711	Ga0495624_0030711_500_874	123
195	3300046690	Ga0495624_0110956	Ga0495624_0110956_162_536	123
196	3300046690	Ga0495624_0511196	Ga0495624_0511196_202_579	123
197	3300046809	Ga0495600_0000018	Ga0495600_0000018_29621_29995	123
198	3300046809	Ga0495600_0004584	Ga0495600_0004584_5097_5477	123
199	3300047315	Ga0495581_0131316	Ga0495581_0131316_401_775	123
200	3300047317	Ga0495604_0000020	Ga0495604_0000020_59392_59766	123
201	3300047317	Ga0495604_0007365	Ga0495604_0007365_2953_3333	123
202	3300047317	Ga0495604_0018623	Ga0495604_0018623_3441_3818	123
203	3300047317	Ga0495604_0616780	Ga0495604_0616780_104_481	123
204	3300047319	Ga0495674_0000002	Ga0495674_0000002_438357_438731	123
205	3300047319	Ga0495674_0005017	Ga0495674_0005017_7119_7499	123
206	3300047319	Ga0495674_0086812	Ga0495674_0086812_1067_1444	123
207	3300047321	Ga0495676_0089343	Ga0495676_0089343_1859_2239	123
208	3300047321	Ga0495676_0953973	Ga0495676_0953973_107_481	123
209	3300047322	Ga0495680_0000419	Ga0495680_0000419_17181_17555	123
210	3300047322	Ga0495680_0009838	Ga0495680_0009838_2925_3305	123
211	3300047444	Ga0495675_0000120	Ga0495675_0000120_5315_5689	123
212	3300047444	Ga0495675_0002352	Ga0495675_0002352_9901_10281	123
213	3300047444	Ga0495675_0046509	Ga0495675_0046509_309_686	123
214	3300047471	Ga0495684_0000016	Ga0495684_0000016_30073_30447	123
215	3300047471	Ga0495684_0007725	Ga0495684_0007725_6448_6828	123
216	3300047673	Ga0495593_0005179	Ga0495593_0005179_3042_3422	123
217	3300047673	Ga0495593_0005685	Ga0495593_0005685_5277_5651	123
218	3300048088	Ga0495602_0000040	Ga0495602_0000040_92667_93041	123
219	3300048088	Ga0495602_0052665	Ga0495602_0052665_3186_3563	123
220	3300048903	Ga0496100_1277032	Ga0496100_1277032_109_492	123
221	3300048918	Ga0496115_0117096	Ga0496115_0117096_1040_1423	123
222	3300049741	Ga0501079_1074768	Ga0501079_1074768_65_442	123
223	3300049743	Ga0501081_0433734	Ga0501081_0433734_359_742	123
224	3300049824	Ga0501045_0105438	Ga0501045_0105438_1344_1727	123
225	3300050491	nmdc:mga00v17_387419_c1	nmdc:mga00v17_387419_c1_306_680	123
226	3300050491	nmdc:mga00v17_965789_c1	nmdc:mga00v17_965789_c1_101_475	123
227	3300050507	nmdc:mga05p37_28545_c1	nmdc:mga05p37_28545_c1_3194_3577	123
228	3300050508	nmdc:mga09592_34344_c1	nmdc:mga09592_34344_c1_2186_2569	123
229	3300050509	nmdc:mga0qj67_37098_c1	nmdc:mga0qj67_37098_c1_1874_2257	123
230	3300050510	nmdc:mga06r32_17491_c1	nmdc:mga06r32_17491_c1_928_1311	123
231	3300050513	nmdc:mga0rr50_698674_c1	nmdc:mga0rr50_698674_c1_482_856	123
232	3300053077	Ga0495601_0000018	Ga0495601_0000018_44269_44643	123
233	3300053077	Ga0495601_0019541	Ga0495601_0019541_843_1223	123
234	3300053077	Ga0495601_0030604	Ga0495601_0030604_999_1376	123
235	3300053077	Ga0495601_0696208	Ga0495601_0696208_244_621	123
236	3300053078	Ga0495612_0000011	Ga0495612_0000011_191036_191410	123
237	3300053078	Ga0495612_0001975	Ga0495612_0001975_2844_3224	123
238	3300053078	Ga0495612_0024569	Ga0495612_0024569_890_1267	123
239	3300053084	Ga0495595_0000043	Ga0495595_0000043_30240_30614	123
240	3300053084	Ga0495595_0002892	Ga0495595_0002892_1067_1447	123
241	3300053084	Ga0495595_0429577	Ga0495595_0429577_199_576	123
242	3300053085	Ga0495619_0000014	Ga0495619_0000014_93523_93897	123
243	3300053085	Ga0495619_0001423	Ga0495619_0001423_8117_8497	123
244	3300053085	Ga0495619_0129420	Ga0495619_0129420_289_666	123
245	3300061734	Ga0530510_0195100	Ga0530510_0195100_608_991	123
246	2010549000	RicEn_C4668	RicEn_83160	124
247	3300000549	LJQas_1009814	LJQas_10098142	124
248	3300001979	JGI24740J21852_10014220	JGI24740J21852_100142202	124
249	3300001989	JGI24739J22299_10023325	JGI24739J22299_100233252	124
250	3300001990	JGI24737J22298_10003163	JGI24737J22298_100031634	124
251	3300001991	JGI24743J22301_10087977	JGI24743J22301_100879771	124
252	3300002067	JGI24735J21928_10017746	JGI24735J21928_100177462	124
253	3300002075	JGI24738J21930_10112739	JGI24738J21930_101127391	124
254	3300002075	JGI24738J21930_10150900	JGI24738J21930_101509001	124
255	3300003203	JGI25406J46586_10032061	JGI25406J46586_100320614	124
256	3300003203	JGI25406J46586_10061139	JGI25406J46586_100611392	124
257	3300003214	JGI25165J46597_1009495	JGI25165J46597_10094951	124
258	3300003215	JGI25153J46596_10001036	JGI25153J46596_100010366	124
259	3300003215	JGI25153J46596_10001434	JGI25153J46596_100014346	124
260	3300003215	JGI25153J46596_10014875	JGI25153J46596_100148754	124
261	3300003354	JGI25160J50197_1005929	JGI25160J50197_10059294	124
262	3300003354	JGI25160J50197_1032056	JGI25160J50197_10320562	124
263	3300003374	JGI25161J50226_1023803	JGI25161J50226_10238031	124
264	3300003659	JGI25404J52841_10007694	JGI25404J52841_100076941	124
265	3300003659	JGI25404J52841_10017399	JGI25404J52841_100173992	124
266	3300003659	JGI25404J52841_10050009	JGI25404J52841_100500092	124
267	3300003659	JGI25404J52841_10054189	JGI25404J52841_100541892	124
268	3300003659	JGI25404J52841_10127690	JGI25404J52841_101276901	124
269	3300003759	Ga0055525_1013753	Ga0055525_10137531	124
270	3300003762	Ga0055542_1003359	Ga0055542_10033593	124
271	3300003771	Ga0055526_1081179	Ga0055526_10811791	124
272	3300003775	Ga0055524_1037374	Ga0055524_10373742	124
273	3300003794	Ga0055531_10009226	Ga0055531_100092264	124
274	3300003911	JGI25405J52794_10041171	JGI25405J52794_100411711	124
275	3300004625	Ga0055543_1005963	Ga0055543_10059632	124
276	3300005262	Ga0065165_1000370	Ga0065165_100037047	124
277	3300005262	Ga0065165_1001957	Ga0065165_100195713	124
278	3300005262	Ga0065165_1012954	Ga0065165_10129541	124
279	3300005262	Ga0065165_1036364	Ga0065165_10363642	124
280	3300005327	Ga0070658_10052967	Ga0070658_100529674	124
281	3300005327	Ga0070658_10182731	Ga0070658_101827312	124
282	3300005327	Ga0070658_10344093	Ga0070658_103440932	124
283	3300005327	Ga0070658_11669040	Ga0070658_116690401	124
284	3300005328	Ga0070676_10072058	Ga0070676_100720582	124
285	3300005328	Ga0070676_10153492	Ga0070676_101534922	124
286	3300005328	Ga0070676_11208732	Ga0070676_112087321	124
287	3300005329	Ga0070683_100007348	Ga0070683_1000073483	124
288	3300005329	Ga0070683_100014102	Ga0070683_1000141024	124
289	3300005329	Ga0070683_100019323	Ga0070683_1000193232	124
290	3300005329	Ga0070683_100560193	Ga0070683_1005601932	124
291	3300005329	Ga0070683_100713510	Ga0070683_1007135102	124
292	3300005329	Ga0070683_101046195	Ga0070683_1010461951	124
293	3300005330	Ga0070690_100649243	Ga0070690_1006492431	124
294	3300005331	Ga0070670_100432329	Ga0070670_1004323291	124
295	3300005331	Ga0070670_100959526	Ga0070670_1009595262	124
296	3300005331	Ga0070670_101734830	Ga0070670_1017348301	124
297	3300005334	Ga0068869_100123175	Ga0068869_1001231751	124
298	3300005334	Ga0068869_100333594	Ga0068869_1003335941	124
299	3300005335	Ga0070666_10431689	Ga0070666_104316892	124
300	3300005335	Ga0070666_10764375	Ga0070666_107643751	124
301	3300005336	Ga0070680_100014896	Ga0070680_1000148966	124
302	3300005336	Ga0070680_100182700	Ga0070680_1001827003	124
303	3300005336	Ga0070680_100210876	Ga0070680_1002108762	124
304	3300005336	Ga0070680_100256045	Ga0070680_1002560452	124
305	3300005336	Ga0070680_100349370	Ga0070680_1003493701	124
306	3300005336	Ga0070680_100569126	Ga0070680_1005691261	124
307	3300005337	Ga0070682_100435079	Ga0070682_1004350792	124
308	3300005337	Ga0070682_100463102	Ga0070682_1004631021	124
309	3300005337	Ga0070682_100504965	Ga0070682_1005049652	124
310	3300005337	Ga0070682_100513760	Ga0070682_1005137602	124
311	3300005338	Ga0068868_100140749	Ga0068868_1001407493	124
312	3300005338	Ga0068868_100354237	Ga0068868_1003542372	124
313	3300005338	Ga0068868_100711114	Ga0068868_1007111142	124
314	3300005339	Ga0070660_100048440	Ga0070660_1000484404	124
315	3300005339	Ga0070660_100096889	Ga0070660_1000968894	124
316	3300005339	Ga0070660_100156286	Ga0070660_1001562862	124
317	3300005339	Ga0070660_100287309	Ga0070660_1002873092	124
318	3300005339	Ga0070660_100687503	Ga0070660_1006875032	124
319	3300005339	Ga0070660_101570552	Ga0070660_1015705521	124
320	3300005341	Ga0070691_10132112	Ga0070691_101321121	124
321	3300005343	Ga0070687_100354749	Ga0070687_1003547492	124
322	3300005344	Ga0070661_100084872	Ga0070661_1000848723	124
323	3300005344	Ga0070661_100108901	Ga0070661_1001089013	124
324	3300005344	Ga0070661_100163847	Ga0070661_1001638471	124
325	3300005344	Ga0070661_100458814	Ga0070661_1004588141	124
326	3300005347	Ga0070668_100060350	Ga0070668_1000603503	124
327	3300005347	Ga0070668_100076663	Ga0070668_1000766633	124
328	3300005347	Ga0070668_100109241	Ga0070668_1001092411	124
329	3300005347	Ga0070668_100377604	Ga0070668_1003776041	124
330	3300005347	Ga0070668_100496898	Ga0070668_1004968982	124
331	3300005347	Ga0070668_100761206	Ga0070668_1007612061	124
332	3300005347	Ga0070668_101459951	Ga0070668_1014599512	124
333	3300005353	Ga0070669_100132844	Ga0070669_1001328444	124
334	3300005353	Ga0070669_100169476	Ga0070669_1001694763	124
335	3300005353	Ga0070669_100226036	Ga0070669_1002260361	124
336	3300005353	Ga0070669_100378653	Ga0070669_1003786532	124
337	3300005354	Ga0070675_100968149	Ga0070675_1009681492	124
338	3300005355	Ga0070671_100223510	Ga0070671_1002235102	124
339	3300005355	Ga0070671_100907339	Ga0070671_1009073392	124
340	3300005355	Ga0070671_100919334	Ga0070671_1009193342	124
341	3300005355	Ga0070671_101041645	Ga0070671_1010416452	124
342	3300005356	Ga0070674_100056209	Ga0070674_1000562093	124
343	3300005356	Ga0070674_100766298	Ga0070674_1007662982	124
344	3300005364	Ga0070673_100062374	Ga0070673_1000623743	124
345	3300005364	Ga0070673_100306532	Ga0070673_1003065322	124
346	3300005364	Ga0070673_100310488	Ga0070673_1003104882	124
347	3300005364	Ga0070673_101324270	Ga0070673_1013242701	124
348	3300005366	Ga0070659_100060577	Ga0070659_1000605773	124
349	3300005366	Ga0070659_100168002	Ga0070659_1001680022	124
350	3300005366	Ga0070659_100265067	Ga0070659_1002650672	124
351	3300005366	Ga0070659_101797704	Ga0070659_1017977041	124
352	3300005367	Ga0070667_100069250	Ga0070667_1000692503	124
353	3300005367	Ga0070667_100385893	Ga0070667_1003858931	124
354	3300005367	Ga0070667_100464948	Ga0070667_1004649482	124
355	3300005367	Ga0070667_101016640	Ga0070667_1010166402	124
356	3300005367	Ga0070667_101243977	Ga0070667_1012439772	124
357	3300005434	Ga0070709_10000683	Ga0070709_1000068317	124
358	3300005434	Ga0070709_10004671	Ga0070709_100046712	124
359	3300005434	Ga0070709_10120413	Ga0070709_101204133	124
360	3300005434	Ga0070709_10186461	Ga0070709_101864612	124
361	3300005434	Ga0070709_10218560	Ga0070709_102185602	124
362	3300005434	Ga0070709_10292584	Ga0070709_102925842	124
363	3300005434	Ga0070709_10809591	Ga0070709_108095911	124
364	3300005434	Ga0070709_11154328	Ga0070709_111543281	124
365	3300005435	Ga0070714_100019867	Ga0070714_1000198674	124
366	3300005435	Ga0070714_100113094	Ga0070714_1001130942	124
367	3300005435	Ga0070714_100145442	Ga0070714_1001454422	124
368	3300005435	Ga0070714_100237304	Ga0070714_1002373042	124
369	3300005435	Ga0070714_101028335	Ga0070714_1010283352	124
370	3300005435	Ga0070714_101817227	Ga0070714_1018172271	124
371	3300005436	Ga0070713_100009227	Ga0070713_1000092275	124
372	3300005436	Ga0070713_100045222	Ga0070713_1000452222	124
373	3300005436	Ga0070713_100235133	Ga0070713_1002351332	124
374	3300005436	Ga0070713_100568151	Ga0070713_1005681512	124
375	3300005437	Ga0070710_10001685	Ga0070710_100016852	124
376	3300005437	Ga0070710_10006030	Ga0070710_100060304	124
377	3300005437	Ga0070710_10059987	Ga0070710_100599872	124
378	3300005437	Ga0070710_10069934	Ga0070710_100699342	124
379	3300005437	Ga0070710_10741593	Ga0070710_107415932	124
380	3300005438	Ga0070701_10055320	Ga0070701_100553202	124
381	3300005439	Ga0070711_100004348	Ga0070711_10000434810	124
382	3300005439	Ga0070711_100005547	Ga0070711_1000055472	124
383	3300005439	Ga0070711_100012443	Ga0070711_1000124432	124
384	3300005439	Ga0070711_100196211	Ga0070711_1001962111	124
385	3300005439	Ga0070711_100203341	Ga0070711_1002033412	124
386	3300005439	Ga0070711_100226323	Ga0070711_1002263232	124
387	3300005439	Ga0070711_100651518	Ga0070711_1006515181	124
388	3300005441	Ga0070700_100176685	Ga0070700_1001766852	124
389	3300005445	Ga0070708_100486836	Ga0070708_1004868362	124
390	3300005455	Ga0070663_100001617	Ga0070663_10000161711	124
391	3300005455	Ga0070663_100013772	Ga0070663_1000137727	124
392	3300005455	Ga0070663_100017707	Ga0070663_1000177076	124
393	3300005455	Ga0070663_100060405	Ga0070663_1000604052	124
394	3300005455	Ga0070663_100069099	Ga0070663_1000690993	124
395	3300005455	Ga0070663_100107074	Ga0070663_1001070742	124
396	3300005455	Ga0070663_100120829	Ga0070663_1001208292	124
397	3300005455	Ga0070663_100133827	Ga0070663_1001338272	124
398	3300005455	Ga0070663_100178281	Ga0070663_1001782811	124
399	3300005455	Ga0070663_100228371	Ga0070663_1002283712	124
400	3300005455	Ga0070663_100304099	Ga0070663_1003040992	124
401	3300005455	Ga0070663_100653446	Ga0070663_1006534462	124
402	3300005455	Ga0070663_100970206	Ga0070663_1009702061	124
403	3300005455	Ga0070663_100998469	Ga0070663_1009984692	124
404	3300005456	Ga0070678_100172923	Ga0070678_1001729232	124
405	3300005456	Ga0070678_100180383	Ga0070678_1001803832	124
406	3300005456	Ga0070678_100338860	Ga0070678_1003388602	124
407	3300005456	Ga0070678_100440950	Ga0070678_1004409502	124
408	3300005456	Ga0070678_100841395	Ga0070678_1008413951	124
409	3300005456	Ga0070678_100938685	Ga0070678_1009386852	124
410	3300005457	Ga0070662_100078918	Ga0070662_1000789183	124
411	3300005457	Ga0070662_100157303	Ga0070662_1001573032	124
412	3300005457	Ga0070662_101430535	Ga0070662_1014305351	124
413	3300005458	Ga0070681_10107206	Ga0070681_101072061	124
414	3300005458	Ga0070681_10158254	Ga0070681_101582542	124
415	3300005458	Ga0070681_10238607	Ga0070681_102386071	124
416	3300005458	Ga0070681_10296594	Ga0070681_102965942	124
417	3300005458	Ga0070681_10668877	Ga0070681_106688771	124
418	3300005459	Ga0068867_100013262	Ga0068867_1000132622	124
419	3300005466	Ga0070685_11237088	Ga0070685_112370881	124
420	3300005467	Ga0070706_100121382	Ga0070706_1001213821	124
421	3300005467	Ga0070706_100504924	Ga0070706_1005049242	124
422	3300005468	Ga0070707_100063682	Ga0070707_1000636822	124
423	3300005468	Ga0070707_100293160	Ga0070707_1002931602	124
424	3300005471	Ga0070698_100161266	Ga0070698_1001612662	124
425	3300005471	Ga0070698_102170651	Ga0070698_1021706511	124
426	3300005518	Ga0070699_100522276	Ga0070699_1005222762	124
427	3300005530	Ga0070679_100181272	Ga0070679_1001812723	124
428	3300005530	Ga0070679_100306162	Ga0070679_1003061622	124
429	3300005530	Ga0070679_100675178	Ga0070679_1006751781	124
430	3300005530	Ga0070679_100683398	Ga0070679_1006833982	124
431	3300005535	Ga0070684_100002398	Ga0070684_1000023984	124
432	3300005535	Ga0070684_100020732	Ga0070684_1000207322	124
433	3300005535	Ga0070684_100056695	Ga0070684_1000566952	124
434	3300005535	Ga0070684_101925507	Ga0070684_1019255071	124
435	3300005536	Ga0070697_100156166	Ga0070697_1001561664	124
436	3300005539	Ga0068853_100008608	Ga0068853_1000086085	124
437	3300005539	Ga0068853_100028547	Ga0068853_1000285475	124
438	3300005539	Ga0068853_100031836	Ga0068853_1000318364	124
439	3300005539	Ga0068853_100065956	Ga0068853_1000659562	124
440	3300005539	Ga0068853_100069930	Ga0068853_1000699302	124
441	3300005539	Ga0068853_100248819	Ga0068853_1002488192	124
442	3300005539	Ga0068853_100378925	Ga0068853_1003789251	124
443	3300005539	Ga0068853_100425663	Ga0068853_1004256631	124
444	3300005539	Ga0068853_100620502	Ga0068853_1006205021	124
445	3300005539	Ga0068853_100791615	Ga0068853_1007916151	124
446	3300005539	Ga0068853_100930348	Ga0068853_1009303481	124
447	3300005539	Ga0068853_101096091	Ga0068853_1010960911	124
448	3300005543	Ga0070672_100352051	Ga0070672_1003520512	124
449	3300005543	Ga0070672_100672249	Ga0070672_1006722492	124
450	3300005543	Ga0070672_101516072	Ga0070672_1015160722	124
451	3300005544	Ga0070686_100052465	Ga0070686_1000524651	124
452	3300005544	Ga0070686_101102589	Ga0070686_1011025891	124
453	3300005547	Ga0070693_100201807	Ga0070693_1002018072	124
454	3300005547	Ga0070693_100381253	Ga0070693_1003812532	124
455	3300005547	Ga0070693_100463741	Ga0070693_1004637411	124
456	3300005547	Ga0070693_100583522	Ga0070693_1005835222	124
457	3300005548	Ga0070665_100069837	Ga0070665_1000698372	124
458	3300005548	Ga0070665_100095277	Ga0070665_1000952772	124
459	3300005548	Ga0070665_100134698	Ga0070665_1001346982	124
460	3300005548	Ga0070665_100147507	Ga0070665_1001475072	124
461	3300005548	Ga0070665_100273585	Ga0070665_1002735852	124
462	3300005548	Ga0070665_100447235	Ga0070665_1004472352	124
463	3300005548	Ga0070665_100468900	Ga0070665_1004689001	124
464	3300005548	Ga0070665_100471288	Ga0070665_1004712882	124
465	3300005548	Ga0070665_100499618	Ga0070665_1004996182	124
466	3300005548	Ga0070665_100711551	Ga0070665_1007115512	124
467	3300005548	Ga0070665_100858381	Ga0070665_1008583812	124
468	3300005548	Ga0070665_101204475	Ga0070665_1012044752	124
469	3300005563	Ga0068855_100012639	Ga0068855_10001263910	124
470	3300005563	Ga0068855_100015613	Ga0068855_1000156136	124
471	3300005563	Ga0068855_100022376	Ga0068855_1000223764	124
472	3300005563	Ga0068855_100027497	Ga0068855_1000274978	124
473	3300005563	Ga0068855_100057875	Ga0068855_1000578752	124
474	3300005563	Ga0068855_100076168	Ga0068855_1000761682	124
475	3300005563	Ga0068855_100095251	Ga0068855_1000952514	124
476	3300005563	Ga0068855_100330598	Ga0068855_1003305983	124
477	3300005563	Ga0068855_100920278	Ga0068855_1009202782	124
478	3300005563	Ga0068855_101616726	Ga0068855_1016167262	124
479	3300005564	Ga0070664_100230067	Ga0070664_1002300672	124
480	3300005564	Ga0070664_100362891	Ga0070664_1003628911	124
481	3300005577	Ga0068857_100002258	Ga0068857_1000022586	124
482	3300005577	Ga0068857_100003161	Ga0068857_1000031617	124
483	3300005577	Ga0068857_100010185	Ga0068857_10001018510	124
484	3300005577	Ga0068857_100289188	Ga0068857_1002891882	124
485	3300005577	Ga0068857_100373451	Ga0068857_1003734512	124
486	3300005577	Ga0068857_100562818	Ga0068857_1005628182	124
487	3300005577	Ga0068857_101491520	Ga0068857_1014915201	124
488	3300005577	Ga0068857_101721288	Ga0068857_1017212882	124
489	3300005578	Ga0068854_100017222	Ga0068854_1000172223	124
490	3300005578	Ga0068854_100020463	Ga0068854_1000204632	124
491	3300005578	Ga0068854_100031593	Ga0068854_1000315933	124
492	3300005578	Ga0068854_101560552	Ga0068854_1015605521	124
493	3300005614	Ga0068856_100000226	Ga0068856_10000022631	124
494	3300005614	Ga0068856_100010204	Ga0068856_1000102042	124
495	3300005614	Ga0068856_100049871	Ga0068856_1000498712	124
496	3300005614	Ga0068856_100142799	Ga0068856_1001427992	124
497	3300005614	Ga0068856_100196418	Ga0068856_1001964182	124
498	3300005614	Ga0068856_100421334	Ga0068856_1004213341	124
499	3300005614	Ga0068856_100526882	Ga0068856_1005268822	124
500	3300005614	Ga0068856_100698849	Ga0068856_1006988492	124
501	3300005614	Ga0068856_100710359	Ga0068856_1007103592	124
502	3300005614	Ga0068856_100747990	Ga0068856_1007479902	124
503	3300005614	Ga0068856_100843356	Ga0068856_1008433562	124
504	3300005615	Ga0070702_100571668	Ga0070702_1005716682	124
505	3300005615	Ga0070702_100891157	Ga0070702_1008911572	124
506	3300005616	Ga0068852_100002431	Ga0068852_10000243110	124
507	3300005616	Ga0068852_100031602	Ga0068852_1000316022	124
508	3300005616	Ga0068852_100076477	Ga0068852_1000764772	124
509	3300005616	Ga0068852_100117614	Ga0068852_1001176142	124
510	3300005616	Ga0068852_100132690	Ga0068852_1001326902	124
511	3300005616	Ga0068852_100252975	Ga0068852_1002529752	124
512	3300005616	Ga0068852_100327380	Ga0068852_1003273802	124
513	3300005616	Ga0068852_100402000	Ga0068852_1004020002	124
514	3300005616	Ga0068852_102506704	Ga0068852_1025067041	124
515	3300005617	Ga0068859_102178498	Ga0068859_1021784981	124
516	3300005618	Ga0068864_100029851	Ga0068864_1000298514	124
517	3300005618	Ga0068864_100798106	Ga0068864_1007981062	124
518	3300005718	Ga0068866_10291289	Ga0068866_102912892	124
519	3300005718	Ga0068866_10491085	Ga0068866_104910852	124
520	3300005719	Ga0068861_100211073	Ga0068861_1002110732	124
521	3300005719	Ga0068861_100263677	Ga0068861_1002636772	124
522	3300005719	Ga0068861_101082535	Ga0068861_1010825352	124
523	3300005834	Ga0068851_10001066	Ga0068851_100010664	124
524	3300005834	Ga0068851_10049394	Ga0068851_100493942	124
525	3300005840	Ga0068870_10180895	Ga0068870_101808952	124
526	3300005840	Ga0068870_10645078	Ga0068870_106450781	124
527	3300005840	Ga0068870_11253314	Ga0068870_112533142	124
528	3300005841	Ga0068863_100354809	Ga0068863_1003548091	124
529	3300005841	Ga0068863_101508062	Ga0068863_1015080622	124
530	3300005842	Ga0068858_100213230	Ga0068858_1002132302	124
531	3300005842	Ga0068858_100309745	Ga0068858_1003097452	124
532	3300005842	Ga0068858_101409354	Ga0068858_1014093541	124
533	3300005843	Ga0068860_100002460	Ga0068860_10000246012	124
534	3300005843	Ga0068860_100340148	Ga0068860_1003401482	124
535	3300005843	Ga0068860_101022847	Ga0068860_1010228472	124
536	3300005844	Ga0068862_100020522	Ga0068862_1000205224	124
537	3300005937	Ga0081455_10009815	Ga0081455_1000981513	124
538	3300005937	Ga0081455_10013913	Ga0081455_100139135	124
539	3300005937	Ga0081455_10015806	Ga0081455_100158062	124
540	3300005937	Ga0081455_10023478	Ga0081455_100234782	124
541	3300005937	Ga0081455_10102876	Ga0081455_101028762	124
542	3300005937	Ga0081455_10681865	Ga0081455_106818651	124
543	3300005981	Ga0081538_10176098	Ga0081538_101760982	124
544	3300005981	Ga0081538_10192652	Ga0081538_101926522	124
545	3300005983	Ga0081540_1001578	Ga0081540_10015788	124
546	3300005983	Ga0081540_1002067	Ga0081540_10020678	124
547	3300005983	Ga0081540_1003114	Ga0081540_100311415	124
548	3300005983	Ga0081540_1005059	Ga0081540_10050592	124
549	3300005983	Ga0081540_1006735	Ga0081540_10067353	124
550	3300005983	Ga0081540_1017895	Ga0081540_10178952	124
551	3300005983	Ga0081540_1021310	Ga0081540_10213102	124
552	3300005983	Ga0081540_1041491	Ga0081540_10414914	124
553	3300005983	Ga0081540_1047846	Ga0081540_10478463	124
554	3300005983	Ga0081540_1093992	Ga0081540_10939922	124
555	3300005985	Ga0081539_10039203	Ga0081539_100392031	124
556	3300005985	Ga0081539_10059269	Ga0081539_100592691	124
557	3300005985	Ga0081539_10145111	Ga0081539_101451112	124
558	3300005985	Ga0081539_10199121	Ga0081539_101991211	124
559	3300006028	Ga0070717_10001762	Ga0070717_1000176215	124
560	3300006028	Ga0070717_10024963	Ga0070717_100249632	124
561	3300006028	Ga0070717_10421975	Ga0070717_104219752	124
562	3300006038	Ga0075365_10033887	Ga0075365_100338873	124
563	3300006038	Ga0075365_10051175	Ga0075365_100511753	124
564	3300006038	Ga0075365_10123415	Ga0075365_101234153	124
565	3300006038	Ga0075365_10214546	Ga0075365_102145462	124
566	3300006038	Ga0075365_10597175	Ga0075365_105971751	124
567	3300006038	Ga0075365_11225773	Ga0075365_112257731	124
568	3300006042	Ga0075368_10051919	Ga0075368_100519192	124
569	3300006048	Ga0075363_100023753	Ga0075363_1000237532	124
570	3300006048	Ga0075363_100068710	Ga0075363_1000687102	124
571	3300006048	Ga0075363_100236537	Ga0075363_1002365372	124
572	3300006051	Ga0075364_10030902	Ga0075364_100309023	124
573	3300006051	Ga0075364_10084117	Ga0075364_100841172	124
574	3300006051	Ga0075364_10089535	Ga0075364_100895353	124
575	3300006051	Ga0075364_10159677	Ga0075364_101596772	124
576	3300006051	Ga0075364_10447071	Ga0075364_104470712	124
577	3300006051	Ga0075364_10752681	Ga0075364_107526811	124
578	3300006058	Ga0075432_10113477	Ga0075432_101134772	124
579	3300006163	Ga0070715_10000142	Ga0070715_100001429	124
580	3300006163	Ga0070715_10076205	Ga0070715_100762052	124
581	3300006163	Ga0070715_10127809	Ga0070715_101278091	124
582	3300006173	Ga0070716_100014703	Ga0070716_1000147032	124
583	3300006173	Ga0070716_100016170	Ga0070716_1000161702	124
584	3300006173	Ga0070716_100039668	Ga0070716_1000396684	124
585	3300006173	Ga0070716_100342471	Ga0070716_1003424712	124
586	3300006175	Ga0070712_100033238	Ga0070712_1000332382	124
587	3300006175	Ga0070712_100289008	Ga0070712_1002890082	124
588	3300006175	Ga0070712_100513998	Ga0070712_1005139981	124
589	3300006175	Ga0070712_101180036	Ga0070712_1011800362	124
590	3300006177	Ga0075362_10003230	Ga0075362_100032302	124
591	3300006177	Ga0075362_10118705	Ga0075362_101187052	124
592	3300006178	Ga0075367_10093934	Ga0075367_100939342	124
593	3300006178	Ga0075367_10160129	Ga0075367_101601292	124
594	3300006178	Ga0075367_10233413	Ga0075367_102334132	124
595	3300006178	Ga0075367_10341589	Ga0075367_103415892	124
596	3300006178	Ga0075367_10406940	Ga0075367_104069402	124
597	3300006178	Ga0075367_10722313	Ga0075367_107223131	124
598	3300006186	Ga0075369_10034895	Ga0075369_100348952	124
599	3300006186	Ga0075369_10038107	Ga0075369_100381073	124
600	3300006186	Ga0075369_10050459	Ga0075369_100504593	124
601	3300006186	Ga0075369_10129490	Ga0075369_101294901	124
602	3300006186	Ga0075369_10207236	Ga0075369_102072362	124
603	3300006186	Ga0075369_10307338	Ga0075369_103073382	124
604	3300006195	Ga0075366_10740502	Ga0075366_107405021	124
605	3300006237	Ga0097621_100065661	Ga0097621_1000656612	124
606	3300006237	Ga0097621_101199837	Ga0097621_1011998372	124
607	3300006237	Ga0097621_101729311	Ga0097621_1017293111	124
608	3300006237	Ga0097621_101831625	Ga0097621_1018316251	124
609	3300006353	Ga0075370_10026584	Ga0075370_100265844	124
610	3300006353	Ga0075370_10052565	Ga0075370_100525652	124
611	3300006353	Ga0075370_10069844	Ga0075370_100698442	124
612	3300006353	Ga0075370_10071514	Ga0075370_100715141	124
613	3300006353	Ga0075370_10080674	Ga0075370_100806742	124
614	3300006353	Ga0075370_10174314	Ga0075370_101743141	124
615	3300006358	Ga0068871_100935367	Ga0068871_1009353671	124
616	3300006358	Ga0068871_101988180	Ga0068871_1019881802	124
617	3300006844	Ga0075428_100609544	Ga0075428_1006095442	124
618	3300006847	Ga0075431_100060144	Ga0075431_1000601443	124
619	3300006871	Ga0075434_100058627	Ga0075434_1000586273	124
620	3300006871	Ga0075434_100134130	Ga0075434_1001341301	124
621	3300006871	Ga0075434_101969681	Ga0075434_1019696811	124
622	3300006881	Ga0068865_100083226	Ga0068865_1000832262	124
623	3300006881	Ga0068865_100136862	Ga0068865_1001368623	124
624	3300006881	Ga0068865_100598549	Ga0068865_1005985492	124
625	3300006914	Ga0075436_100395745	Ga0075436_1003957451	124
626	3300006914	Ga0075436_100962980	Ga0075436_1009629801	124
627	3300006931	Ga0097620_102178582	Ga0097620_1021785821	124
628	3300006942	Ga0099824_1003918	Ga0099824_100391812	124
629	3300006942	Ga0099824_1007227	Ga0099824_10072272	124
630	3300006943	Ga0099822_1001088	Ga0099822_100108825	124
631	3300006943	Ga0099822_1078530	Ga0099822_10785301	124
632	3300006944	Ga0099823_1029624	Ga0099823_10296242	124
633	3300007076	Ga0075435_100052103	Ga0075435_1000521032	124
634	3300007076	Ga0075435_100779746	Ga0075435_1007797462	124
635	3300007265	Ga0099794_10015283	Ga0099794_100152832	124
636	3300007265	Ga0099794_10041037	Ga0099794_100410371	124
637	3300007265	Ga0099794_10096235	Ga0099794_100962351	124
638	3300007788	Ga0099795_10039500	Ga0099795_100395001	124
639	3300007788	Ga0099795_10181348	Ga0099795_101813482	124
640	3300007788	Ga0099795_10343168	Ga0099795_103431682	124
641	3300009011	Ga0105251_10150677	Ga0105251_101506772	124
642	3300009036	Ga0105244_10321948	Ga0105244_103219482	124
643	3300009092	Ga0105250_10013173	Ga0105250_100131732	124
644	3300009093	Ga0105240_10007330	Ga0105240_100073308	124
645	3300009093	Ga0105240_10016091	Ga0105240_100160914	124
646	3300009093	Ga0105240_10017774	Ga0105240_100177743	124
647	3300009093	Ga0105240_10058218	Ga0105240_100582187	124
648	3300009093	Ga0105240_10105470	Ga0105240_101054701	124
649	3300009093	Ga0105240_10278161	Ga0105240_102781612	124
650	3300009093	Ga0105240_10280618	Ga0105240_102806182	124
651	3300009093	Ga0105240_10752660	Ga0105240_107526601	124
652	3300009093	Ga0105240_11499879	Ga0105240_114998791	124
653	3300009093	Ga0105240_12212788	Ga0105240_122127882	124
654	3300009093	Ga0105240_12619065	Ga0105240_126190651	124
655	3300009094	Ga0111539_10102329	Ga0111539_101023292	124
656	3300009094	Ga0111539_10858846	Ga0111539_108588462	124
657	3300009094	Ga0111539_11664195	Ga0111539_116641952	124
658	3300009094	Ga0111539_11988175	Ga0111539_119881751	124
659	3300009094	Ga0111539_12589340	Ga0111539_125893401	124
660	3300009098	Ga0105245_10303218	Ga0105245_103032182	124
661	3300009098	Ga0105245_10381536	Ga0105245_103815361	124
662	3300009098	Ga0105245_10672259	Ga0105245_106722592	124
663	3300009098	Ga0105245_11578142	Ga0105245_115781421	124
664	3300009098	Ga0105245_13115743	Ga0105245_131157431	124
665	3300009101	Ga0105247_10013516	Ga0105247_100135161	124
666	3300009101	Ga0105247_10075857	Ga0105247_100758572	124
667	3300009101	Ga0105247_10152871	Ga0105247_101528712	124
668	3300009101	Ga0105247_10251201	Ga0105247_102512011	124
669	3300009101	Ga0105247_10261660	Ga0105247_102616602	124
670	3300009101	Ga0105247_10628322	Ga0105247_106283222	124
671	3300009101	Ga0105247_10979413	Ga0105247_109794132	124
672	3300009101	Ga0105247_11118649	Ga0105247_111186491	124
673	3300009147	Ga0114129_10171539	Ga0114129_101715393	124
674	3300009147	Ga0114129_12343340	Ga0114129_123433401	124
675	3300009148	Ga0105243_10132936	Ga0105243_101329361	124
676	3300009148	Ga0105243_10167266	Ga0105243_101672662	124
677	3300009148	Ga0105243_11796940	Ga0105243_117969402	124
678	3300009148	Ga0105243_12016666	Ga0105243_120166661	124
679	3300009174	Ga0105241_10004985	Ga0105241_100049851	124
680	3300009174	Ga0105241_10012838	Ga0105241_100128382	124
681	3300009174	Ga0105241_10042720	Ga0105241_100427203	124
682	3300009174	Ga0105241_11039440	Ga0105241_110394401	124
683	3300009174	Ga0105241_11701089	Ga0105241_117010891	124
684	3300009176	Ga0105242_10024046	Ga0105242_100240464	124
685	3300009176	Ga0105242_10139076	Ga0105242_101390762	124
686	3300009176	Ga0105242_10151612	Ga0105242_101516123	124
687	3300009176	Ga0105242_10889906	Ga0105242_108899062	124
688	3300009177	Ga0105248_10156874	Ga0105248_101568742	124
689	3300009177	Ga0105248_10242659	Ga0105248_102426592	124
690	3300009177	Ga0105248_11245998	Ga0105248_112459982	124
691	3300009177	Ga0105248_12745110	Ga0105248_127451102	124
692	3300009545	Ga0105237_10031685	Ga0105237_100316852	124
693	3300009545	Ga0105237_10034896	Ga0105237_100348963	124
694	3300009545	Ga0105237_10117511	Ga0105237_101175112	124
695	3300009545	Ga0105237_10387903	Ga0105237_103879031	124
696	3300009545	Ga0105237_10421004	Ga0105237_104210042	124
697	3300009545	Ga0105237_10791674	Ga0105237_107916742	124
698	3300009545	Ga0105237_11188896	Ga0105237_111888961	124
699	3300009545	Ga0105237_11704100	Ga0105237_117041001	124
700	3300009545	Ga0105237_12314228	Ga0105237_123142281	124
701	3300009551	Ga0105238_10001176	Ga0105238_100011768	124
702	3300009551	Ga0105238_10008364	Ga0105238_100083643	124
703	3300009551	Ga0105238_10009410	Ga0105238_100094104	124
704	3300009551	Ga0105238_10016536	Ga0105238_100165362	124
705	3300009551	Ga0105238_10025719	Ga0105238_100257193	124
706	3300009551	Ga0105238_10047748	Ga0105238_100477484	124
707	3300009551	Ga0105238_10103072	Ga0105238_101030722	124
708	3300009551	Ga0105238_10256103	Ga0105238_102561033	124
709	3300009551	Ga0105238_10302412	Ga0105238_103024121	124
710	3300009551	Ga0105238_10487980	Ga0105238_104879802	124
711	3300009551	Ga0105238_10613912	Ga0105238_106139121	124
712	3300009551	Ga0105238_11069408	Ga0105238_110694082	124
713	3300009553	Ga0105249_10223022	Ga0105249_102230222	124
714	3300009553	Ga0105249_10271171	Ga0105249_102711712	124
715	3300009553	Ga0105249_11137562	Ga0105249_111375621	124
716	3300010159	Ga0099796_10041555	Ga0099796_100415552	124
717	3300010159	Ga0099796_10231971	Ga0099796_102319711	124
718	3300010159	Ga0099796_10250122	Ga0099796_102501222	124
719	3300010159	Ga0099796_10282900	Ga0099796_102829001	124
720	3300010375	Ga0105239_10018610	Ga0105239_100186102	124
721	3300010375	Ga0105239_10020339	Ga0105239_100203392	124
722	3300010375	Ga0105239_10027329	Ga0105239_100273293	124
723	3300010375	Ga0105239_10041512	Ga0105239_100415124	124
724	3300010375	Ga0105239_10042922	Ga0105239_100429223	124
725	3300010375	Ga0105239_10061664	Ga0105239_100616642	124
726	3300010375	Ga0105239_10065510	Ga0105239_100655105	124
727	3300010375	Ga0105239_10153244	Ga0105239_101532442	124
728	3300010375	Ga0105239_10177235	Ga0105239_101772353	124
729	3300010375	Ga0105239_10226845	Ga0105239_102268452	124
730	3300010375	Ga0105239_10879664	Ga0105239_108796641	124
731	3300010375	Ga0105239_10982203	Ga0105239_109822031	124
732	3300010375	Ga0105239_12231435	Ga0105239_122314351	124
733	3300011119	Ga0105246_10044251	Ga0105246_100442514	124
734	3300011119	Ga0105246_10125389	Ga0105246_101253893	124
735	3300011119	Ga0105246_10635392	Ga0105246_106353922	124
736	3300011119	Ga0105246_10811012	Ga0105246_108110121	124
737	3300011119	Ga0105246_11876234	Ga0105246_118762341	124
738	3300012500	Ga0157314_1004946	Ga0157314_10049462	124
739	3300013100	Ga0157373_10849147	Ga0157373_108491471	124
740	3300013100	Ga0157373_10906928	Ga0157373_109069281	124
741	3300013104	Ga0157370_10071220	Ga0157370_100712202	124
742	3300013104	Ga0157370_10179368	Ga0157370_101793682	124
743	3300013104	Ga0157370_10369023	Ga0157370_103690232	124
744	3300013105	Ga0157369_10004958	Ga0157369_100049582	124
745	3300013105	Ga0157369_10013606	Ga0157369_100136062	124
746	3300013105	Ga0157369_10032971	Ga0157369_100329712	124
747	3300013105	Ga0157369_10038198	Ga0157369_100381983	124
748	3300013105	Ga0157369_10051880	Ga0157369_100518806	124
749	3300013105	Ga0157369_10209112	Ga0157369_102091122	124
750	3300013105	Ga0157369_10455473	Ga0157369_104554732	124
751	3300013105	Ga0157369_10549618	Ga0157369_105496181	124
752	3300013105	Ga0157369_10669218	Ga0157369_106692181	124
753	3300013296	Ga0157374_10266209	Ga0157374_102662092	124
754	3300013296	Ga0157374_10271110	Ga0157374_102711102	124
755	3300013296	Ga0157374_10280043	Ga0157374_102800432	124
756	3300013296	Ga0157374_10416043	Ga0157374_104160432	124
757	3300013296	Ga0157374_10450193	Ga0157374_104501932	124
758	3300013297	Ga0157378_10017461	Ga0157378_100174614	124
759	3300013297	Ga0157378_10907460	Ga0157378_109074601	124
760	3300013297	Ga0157378_11322924	Ga0157378_113229242	124
761	3300013297	Ga0157378_11671899	Ga0157378_116718992	124
762	3300013297	Ga0157378_12455873	Ga0157378_124558732	124
763	3300013306	Ga0163162_10085469	Ga0163162_100854693	124
764	3300013306	Ga0163162_10231618	Ga0163162_102316182	124
765	3300013306	Ga0163162_10536080	Ga0163162_105360802	124
766	3300013306	Ga0163162_11523157	Ga0163162_115231572	124
767	3300013306	Ga0163162_11699968	Ga0163162_116999681	124
768	3300013307	Ga0157372_10192997	Ga0157372_101929972	124
769	3300013307	Ga0157372_10256059	Ga0157372_102560594	124
770	3300013307	Ga0157372_10981801	Ga0157372_109818011	124
771	3300013307	Ga0157372_11371144	Ga0157372_113711441	124
772	3300013308	Ga0157375_10208157	Ga0157375_102081573	124
773	3300013308	Ga0157375_10284537	Ga0157375_102845372	124
774	3300013308	Ga0157375_10461770	Ga0157375_104617702	124
775	3300013308	Ga0157375_10719804	Ga0157375_107198042	124
776	3300013308	Ga0157375_11270145	Ga0157375_112701452	124
777	3300013308	Ga0157375_12342980	Ga0157375_123429801	124
778	3300013308	Ga0157375_12735088	Ga0157375_127350881	124
779	3300014325	Ga0163163_10066884	Ga0163163_100668842	124
780	3300014325	Ga0163163_10074160	Ga0163163_100741602	124
781	3300014325	Ga0163163_10345946	Ga0163163_103459462	124
782	3300014325	Ga0163163_10552014	Ga0163163_105520142	124
783	3300014325	Ga0163163_10833267	Ga0163163_108332671	124
784	3300014325	Ga0163163_10990584	Ga0163163_109905842	124
785	3300014326	Ga0157380_11657332	Ga0157380_116573321	124
786	3300014745	Ga0157377_10274625	Ga0157377_102746252	124
787	3300014745	Ga0157377_10541539	Ga0157377_105415392	124
788	3300014968	Ga0157379_10789388	Ga0157379_107893882	124
789	3300014968	Ga0157379_12121408	Ga0157379_121214082	124
790	3300014969	Ga0157376_10017878	Ga0157376_100178783	124
791	3300014969	Ga0157376_10385807	Ga0157376_103858071	124
792	3300014969	Ga0157376_10603004	Ga0157376_106030042	124
793	3300014969	Ga0157376_11707501	Ga0157376_117075012	124
794	3300014969	Ga0157376_12303365	Ga0157376_123033651	124
795	3300014969	Ga0157376_12401247	Ga0157376_124012471	124
796	3300017792	Ga0163161_10127290	Ga0163161_101272902	124
797	3300017792	Ga0163161_10762170	Ga0163161_107621701	124
798	3300017792	Ga0163161_11035179	Ga0163161_110351791	124
799	3300020070	Ga0206356_11248236	Ga0206356_112482361	124
800	3300020070	Ga0206356_11294382	Ga0206356_112943821	124
801	3300020082	Ga0206353_10149257	Ga0206353_101492572	124
802	3300020082	Ga0206353_10204886	Ga0206353_102048863	124
803	3300020082	Ga0206353_10556547	Ga0206353_105565472	124
804	3300021320	Ga0214544_1000003	Ga0214544_1000003387	124
805	3300021321	Ga0214542_1000003	Ga0214542_1000003377	124
806	3300021324	Ga0214545_1000004	Ga0214545_1000004390	124
807	3300021324	Ga0214545_1029912	Ga0214545_10299123	124
808	3300021327	Ga0214543_1000007	Ga0214543_100000727	124
809	3300021361	Ga0213872_10189079	Ga0213872_101890792	124
810	3300021377	Ga0213874_10029976	Ga0213874_100299762	124
811	3300021377	Ga0213874_10406190	Ga0213874_104061901	124
812	3300021384	Ga0213876_10009446	Ga0213876_100094465	124
813	3300021384	Ga0213876_10193305	Ga0213876_101933052	124
814	3300021384	Ga0213876_10244266	Ga0213876_102442662	124
815	3300022467	Ga0224712_10227970	Ga0224712_102279702	124
816	3300025230	Ga0209563_100565	Ga0209563_10056512	124
817	3300025254	Ga0209148_1004477	Ga0209148_10044774	124
818	3300025261	Ga0209233_1000798	Ga0209233_100079811	124
819	3300025261	Ga0209233_1003633	Ga0209233_10036333	124
820	3300025272	Ga0209455_1003734	Ga0209455_10037342	124
821	3300025295	Ga0209564_1009014	Ga0209564_10090144	124
822	3300025295	Ga0209564_1039702	Ga0209564_10397022	124
823	3300025297	Ga0209758_1000030	Ga0209758_1000030454	124
824	3300025297	Ga0209758_1000277	Ga0209758_100027778	124
825	3300025297	Ga0209758_1001754	Ga0209758_100175423	124
826	3300025297	Ga0209758_1002104	Ga0209758_100210410	124
827	3300025297	Ga0209758_1003575	Ga0209758_100357510	124
828	3300025297	Ga0209758_1003837	Ga0209758_10038375	124
829	3300025297	Ga0209758_1010686	Ga0209758_10106864	124
830	3300025297	Ga0209758_1014379	Ga0209758_10143794	124
831	3300025297	Ga0209758_1113777	Ga0209758_11137772	124
832	3300025299	Ga0209256_1005584	Ga0209256_10055843	124
833	3300025302	Ga0207426_1000271	Ga0207426_100027121	124
834	3300025302	Ga0207426_1010809	Ga0207426_10108094	124
835	3300025302	Ga0207426_1019983	Ga0207426_10199833	124
836	3300025304	Ga0209257_1000947	Ga0209257_100094729	124
837	3300025304	Ga0209257_1021088	Ga0209257_10210883	124
838	3300025304	Ga0209257_1077950	Ga0209257_10779501	124
839	3300025315	Ga0207697_10038963	Ga0207697_100389631	124
840	3300025315	Ga0207697_10104487	Ga0207697_101044871	124
841	3300025321	Ga0207656_10045832	Ga0207656_100458322	124
842	3300025321	Ga0207656_10142053	Ga0207656_101420532	124
843	3300025321	Ga0207656_10586594	Ga0207656_105865942	124
844	3300025893	Ga0207682_10079003	Ga0207682_100790032	124
845	3300025898	Ga0207692_10001326	Ga0207692_100013262	124
846	3300025898	Ga0207692_10005092	Ga0207692_100050924	124
847	3300025898	Ga0207692_10022778	Ga0207692_100227782	124
848	3300025898	Ga0207692_10065564	Ga0207692_100655642	124
849	3300025898	Ga0207692_10144626	Ga0207692_101446262	124
850	3300025898	Ga0207692_10777671	Ga0207692_107776712	124
851	3300025899	Ga0207642_10048368	Ga0207642_100483682	124
852	3300025899	Ga0207642_10320818	Ga0207642_103208182	124
853	3300025900	Ga0207710_10343557	Ga0207710_103435571	124
854	3300025901	Ga0207688_10051906	Ga0207688_100519063	124
855	3300025901	Ga0207688_10078011	Ga0207688_100780112	124
856	3300025901	Ga0207688_10079764	Ga0207688_100797643	124
857	3300025901	Ga0207688_10428314	Ga0207688_104283141	124
858	3300025901	Ga0207688_10525932	Ga0207688_105259322	124
859	3300025904	Ga0207647_10012868	Ga0207647_100128683	124
860	3300025904	Ga0207647_10033957	Ga0207647_100339571	124
861	3300025904	Ga0207647_10258599	Ga0207647_102585992	124
862	3300025904	Ga0207647_10380355	Ga0207647_103803551	124
863	3300025904	Ga0207647_10380709	Ga0207647_103807091	124
864	3300025904	Ga0207647_10678092	Ga0207647_106780922	124
865	3300025905	Ga0207685_10000486	Ga0207685_100004862	124
866	3300025905	Ga0207685_10060098	Ga0207685_100600982	124
867	3300025905	Ga0207685_10215163	Ga0207685_102151631	124
868	3300025905	Ga0207685_10291563	Ga0207685_102915632	124
869	3300025906	Ga0207699_10000506	Ga0207699_1000050617	124
870	3300025906	Ga0207699_10015549	Ga0207699_100155495	124
871	3300025906	Ga0207699_10026384	Ga0207699_100263842	124
872	3300025906	Ga0207699_10044225	Ga0207699_100442252	124
873	3300025906	Ga0207699_10153982	Ga0207699_101539822	124
874	3300025906	Ga0207699_10315035	Ga0207699_103150352	124
875	3300025906	Ga0207699_10936030	Ga0207699_109360301	124
876	3300025907	Ga0207645_10126936	Ga0207645_101269362	124
877	3300025907	Ga0207645_10721795	Ga0207645_107217951	124
878	3300025907	Ga0207645_10829394	Ga0207645_108293941	124
879	3300025908	Ga0207643_10435686	Ga0207643_104356861	124
880	3300025908	Ga0207643_10522758	Ga0207643_105227582	124
881	3300025908	Ga0207643_10851225	Ga0207643_108512251	124
882	3300025909	Ga0207705_10034716	Ga0207705_100347163	124
883	3300025909	Ga0207705_10038939	Ga0207705_100389392	124
884	3300025909	Ga0207705_10140511	Ga0207705_101405112	124
885	3300025909	Ga0207705_10822608	Ga0207705_108226082	124
886	3300025909	Ga0207705_11032948	Ga0207705_110329481	124
887	3300025909	Ga0207705_11250465	Ga0207705_112504651	124
888	3300025910	Ga0207684_10230856	Ga0207684_102308562	124
889	3300025910	Ga0207684_10475581	Ga0207684_104755812	124
890	3300025911	Ga0207654_10000231	Ga0207654_100002313	124
891	3300025911	Ga0207654_10063022	Ga0207654_100630221	124
892	3300025911	Ga0207654_10150266	Ga0207654_101502662	124
893	3300025912	Ga0207707_10043667	Ga0207707_100436672	124
894	3300025912	Ga0207707_10081107	Ga0207707_100811072	124
895	3300025912	Ga0207707_10090186	Ga0207707_100901862	124
896	3300025912	Ga0207707_10172780	Ga0207707_101727803	124
897	3300025912	Ga0207707_10201739	Ga0207707_102017392	124
898	3300025913	Ga0207695_10000059	Ga0207695_100000599	124
899	3300025913	Ga0207695_10005928	Ga0207695_100059288	124
900	3300025913	Ga0207695_10042112	Ga0207695_100421125	124
901	3300025913	Ga0207695_10133300	Ga0207695_101333005	124
902	3300025913	Ga0207695_10153709	Ga0207695_101537093	124
903	3300025913	Ga0207695_10172875	Ga0207695_101728752	124
904	3300025913	Ga0207695_10356682	Ga0207695_103566822	124
905	3300025913	Ga0207695_10979343	Ga0207695_109793431	124
906	3300025914	Ga0207671_10087819	Ga0207671_100878192	124
907	3300025914	Ga0207671_10324699	Ga0207671_103246991	124
908	3300025914	Ga0207671_10565268	Ga0207671_105652682	124
909	3300025914	Ga0207671_10615327	Ga0207671_106153272	124
910	3300025914	Ga0207671_10856654	Ga0207671_108566542	124
911	3300025914	Ga0207671_11260719	Ga0207671_112607191	124
912	3300025914	Ga0207671_11313673	Ga0207671_113136731	124
913	3300025914	Ga0207671_11555768	Ga0207671_115557681	124
914	3300025915	Ga0207693_10004727	Ga0207693_100047274	124
915	3300025915	Ga0207693_10039692	Ga0207693_100396922	124
916	3300025915	Ga0207693_10094494	Ga0207693_100944942	124
917	3300025915	Ga0207693_10478865	Ga0207693_104788652	124
918	3300025915	Ga0207693_11087339	Ga0207693_110873391	124
919	3300025916	Ga0207663_10000159	Ga0207663_1000015927	124
920	3300025916	Ga0207663_10012019	Ga0207663_100120192	124
921	3300025916	Ga0207663_10016632	Ga0207663_100166324	124
922	3300025916	Ga0207663_10086292	Ga0207663_100862923	124
923	3300025916	Ga0207663_10483656	Ga0207663_104836561	124
924	3300025917	Ga0207660_10044422	Ga0207660_100444222	124
925	3300025917	Ga0207660_10217071	Ga0207660_102170712	124
926	3300025917	Ga0207660_10740811	Ga0207660_107408112	124
927	3300025918	Ga0207662_10066579	Ga0207662_100665792	124
928	3300025919	Ga0207657_10007810	Ga0207657_100078105	124
929	3300025919	Ga0207657_10034251	Ga0207657_100342512	124
930	3300025919	Ga0207657_10076656	Ga0207657_100766562	124
931	3300025919	Ga0207657_10149631	Ga0207657_101496312	124
932	3300025919	Ga0207657_10420893	Ga0207657_104208932	124
933	3300025919	Ga0207657_10737686	Ga0207657_107376862	124
934	3300025920	Ga0207649_10124846	Ga0207649_101248462	124
935	3300025920	Ga0207649_10370364	Ga0207649_103703642	124
936	3300025920	Ga0207649_10421063	Ga0207649_104210632	124
937	3300025920	Ga0207649_10480934	Ga0207649_104809341	124
938	3300025920	Ga0207649_10521927	Ga0207649_105219271	124
939	3300025920	Ga0207649_10695087	Ga0207649_106950871	124
940	3300025921	Ga0207652_10009284	Ga0207652_100092845	124
941	3300025921	Ga0207652_10365568	Ga0207652_103655682	124
942	3300025921	Ga0207652_10658412	Ga0207652_106584122	124
943	3300025921	Ga0207652_10900759	Ga0207652_109007591	124
944	3300025922	Ga0207646_10050126	Ga0207646_100501264	124
945	3300025922	Ga0207646_10161338	Ga0207646_101613382	124
946	3300025923	Ga0207681_10457280	Ga0207681_104572801	124
947	3300025924	Ga0207694_10000719	Ga0207694_1000071921	124
948	3300025924	Ga0207694_10003079	Ga0207694_100030797	124
949	3300025924	Ga0207694_10016413	Ga0207694_100164133	124
950	3300025924	Ga0207694_10018441	Ga0207694_100184414	124
951	3300025924	Ga0207694_10061921	Ga0207694_100619212	124
952	3300025924	Ga0207694_10176232	Ga0207694_101762322	124
953	3300025924	Ga0207694_10366480	Ga0207694_103664802	124
954	3300025924	Ga0207694_10727977	Ga0207694_107279772	124
955	3300025924	Ga0207694_10833286	Ga0207694_108332862	124
956	3300025924	Ga0207694_10864072	Ga0207694_108640721	124
957	3300025925	Ga0207650_10769153	Ga0207650_107691531	124
958	3300025926	Ga0207659_10696530	Ga0207659_106965302	124
959	3300025927	Ga0207687_10042823	Ga0207687_100428232	124
960	3300025928	Ga0207700_10008950	Ga0207700_100089507	124
961	3300025928	Ga0207700_10021241	Ga0207700_100212412	124
962	3300025928	Ga0207700_10057543	Ga0207700_100575432	124
963	3300025928	Ga0207700_10475387	Ga0207700_104753872	124
964	3300025928	Ga0207700_10865670	Ga0207700_108656702	124
965	3300025929	Ga0207664_10017733	Ga0207664_100177337	124
966	3300025929	Ga0207664_10081097	Ga0207664_100810972	124
967	3300025929	Ga0207664_10120467	Ga0207664_101204672	124
968	3300025929	Ga0207664_10968218	Ga0207664_109682182	124
969	3300025929	Ga0207664_11100869	Ga0207664_111008691	124
970	3300025931	Ga0207644_10085279	Ga0207644_100852791	124
971	3300025931	Ga0207644_10353809	Ga0207644_103538092	124
972	3300025931	Ga0207644_10949237	Ga0207644_109492371	124
973	3300025932	Ga0207690_10059293	Ga0207690_100592932	124
974	3300025932	Ga0207690_10112928	Ga0207690_101129282	124
975	3300025932	Ga0207690_10419208	Ga0207690_104192081	124
976	3300025932	Ga0207690_10466414	Ga0207690_104664142	124
977	3300025933	Ga0207706_10042960	Ga0207706_100429604	124
978	3300025933	Ga0207706_10073375	Ga0207706_100733753	124
979	3300025933	Ga0207706_10226427	Ga0207706_102264272	124
980	3300025934	Ga0207686_10199013	Ga0207686_101990132	124
981	3300025935	Ga0207709_11291842	Ga0207709_112918421	124
982	3300025937	Ga0207669_10002754	Ga0207669_100027546	124
983	3300025937	Ga0207669_10022732	Ga0207669_100227323	124
984	3300025937	Ga0207669_10116993	Ga0207669_101169932	124
985	3300025937	Ga0207669_10861909	Ga0207669_108619092	124
986	3300025938	Ga0207704_10033006	Ga0207704_100330062	124
987	3300025938	Ga0207704_10158754	Ga0207704_101587542	124
988	3300025938	Ga0207704_10184750	Ga0207704_101847502	124
989	3300025938	Ga0207704_10294390	Ga0207704_102943902	124
990	3300025938	Ga0207704_10368569	Ga0207704_103685692	124
991	3300025938	Ga0207704_11548592	Ga0207704_115485921	124
992	3300025939	Ga0207665_10002498	Ga0207665_100024989	124
993	3300025939	Ga0207665_10009386	Ga0207665_100093864	124
994	3300025939	Ga0207665_10028572	Ga0207665_100285722	124
995	3300025939	Ga0207665_10033938	Ga0207665_100339381	124
996	3300025939	Ga0207665_10038319	Ga0207665_100383192	124
997	3300025939	Ga0207665_10826841	Ga0207665_108268412	124
998	3300025940	Ga0207691_10072272	Ga0207691_100722723	124
999	3300025940	Ga0207691_10087699	Ga0207691_100876992	124
1000	3300025940	Ga0207691_10214805	Ga0207691_102148052	124
1001	3300025941	Ga0207711_10191755	Ga0207711_101917552	124
1002	3300025941	Ga0207711_10352157	Ga0207711_103521572	124
1003	3300025942	Ga0207689_10745291	Ga0207689_107452911	124
1004	3300025942	Ga0207689_11784599	Ga0207689_117845991	124
1005	3300025944	Ga0207661_10000430	Ga0207661_1000043016	124
1006	3300025944	Ga0207661_10015382	Ga0207661_100153824	124
1007	3300025944	Ga0207661_10976355	Ga0207661_109763551	124
1008	3300025944	Ga0207661_11343236	Ga0207661_113432361	124
1009	3300025945	Ga0207679_10207293	Ga0207679_102072932	124
1010	3300025945	Ga0207679_11307797	Ga0207679_113077972	124
1011	3300025949	Ga0207667_10008537	Ga0207667_1000853714	124
1012	3300025949	Ga0207667_10012011	Ga0207667_100120119	124
1013	3300025949	Ga0207667_10058728	Ga0207667_100587282	124
1014	3300025949	Ga0207667_10087250	Ga0207667_100872502	124
1015	3300025949	Ga0207667_10112461	Ga0207667_101124612	124
1016	3300025949	Ga0207667_10145576	Ga0207667_101455762	124
1017	3300025949	Ga0207667_10155347	Ga0207667_101553473	124
1018	3300025949	Ga0207667_10162378	Ga0207667_101623782	124
1019	3300025949	Ga0207667_10541062	Ga0207667_105410622	124
1020	3300025949	Ga0207667_10595148	Ga0207667_105951482	124
1021	3300025960	Ga0207651_10011545	Ga0207651_100115453	124
1022	3300025960	Ga0207651_10662404	Ga0207651_106624041	124
1023	3300025972	Ga0207668_10046931	Ga0207668_100469312	124
1024	3300025972	Ga0207668_10295071	Ga0207668_102950711	124
1025	3300025972	Ga0207668_11034619	Ga0207668_110346191	124
1026	3300025972	Ga0207668_11253174	Ga0207668_112531742	124
1027	3300025972	Ga0207668_11564208	Ga0207668_115642081	124
1028	3300025972	Ga0207668_11651253	Ga0207668_116512531	124
1029	3300025981	Ga0207640_10133473	Ga0207640_101334732	124
1030	3300025981	Ga0207640_10139761	Ga0207640_101397612	124
1031	3300025981	Ga0207640_10148865	Ga0207640_101488652	124
1032	3300025981	Ga0207640_10179825	Ga0207640_101798252	124
1033	3300025981	Ga0207640_11127481	Ga0207640_111274812	124
1034	3300025981	Ga0207640_11402572	Ga0207640_114025721	124
1035	3300025981	Ga0207640_11620844	Ga0207640_116208441	124
1036	3300025986	Ga0207658_10073830	Ga0207658_100738302	124
1037	3300025986	Ga0207658_10707761	Ga0207658_107077612	124
1038	3300025986	Ga0207658_10917860	Ga0207658_109178601	124
1039	3300026023	Ga0207677_10130754	Ga0207677_101307542	124
1040	3300026023	Ga0207677_10229755	Ga0207677_102297552	124
1041	3300026023	Ga0207677_12310811	Ga0207677_123108111	124
1042	3300026035	Ga0207703_10419759	Ga0207703_104197592	124
1043	3300026035	Ga0207703_10935997	Ga0207703_109359972	124
1044	3300026041	Ga0207639_10040400	Ga0207639_100404002	124
1045	3300026041	Ga0207639_10049333	Ga0207639_100493332	124
1046	3300026041	Ga0207639_10068565	Ga0207639_100685652	124
1047	3300026041	Ga0207639_10085004	Ga0207639_100850042	124
1048	3300026041	Ga0207639_10345733	Ga0207639_103457332	124
1049	3300026041	Ga0207639_10357398	Ga0207639_103573982	124
1050	3300026041	Ga0207639_10394909	Ga0207639_103949091	124
1051	3300026041	Ga0207639_10523359	Ga0207639_105233591	124
1052	3300026041	Ga0207639_10664678	Ga0207639_106646782	124
1053	3300026041	Ga0207639_11120161	Ga0207639_111201612	124
1054	3300026067	Ga0207678_10015894	Ga0207678_100158947	124
1055	3300026067	Ga0207678_10027543	Ga0207678_100275432	124
1056	3300026067	Ga0207678_10029065	Ga0207678_100290651	124
1057	3300026067	Ga0207678_10030740	Ga0207678_100307401	124
1058	3300026067	Ga0207678_10090465	Ga0207678_100904651	124
1059	3300026067	Ga0207678_10111037	Ga0207678_101110372	124
1060	3300026067	Ga0207678_10112828	Ga0207678_101128282	124
1061	3300026067	Ga0207678_10131247	Ga0207678_101312473	124
1062	3300026067	Ga0207678_10132940	Ga0207678_101329402	124
1063	3300026067	Ga0207678_10190043	Ga0207678_101900432	124
1064	3300026067	Ga0207678_10247182	Ga0207678_102471822	124
1065	3300026067	Ga0207678_10673358	Ga0207678_106733581	124
1066	3300026067	Ga0207678_12010291	Ga0207678_120102911	124
1067	3300026075	Ga0207708_10152659	Ga0207708_101526592	124
1068	3300026078	Ga0207702_10000191	Ga0207702_1000019146	124
1069	3300026078	Ga0207702_10000938	Ga0207702_1000093820	124
1070	3300026078	Ga0207702_10190101	Ga0207702_101901012	124
1071	3300026078	Ga0207702_10364273	Ga0207702_103642732	124
1072	3300026078	Ga0207702_10424492	Ga0207702_104244922	124
1073	3300026078	Ga0207702_10815843	Ga0207702_108158431	124
1074	3300026088	Ga0207641_10566890	Ga0207641_105668902	124
1075	3300026088	Ga0207641_10661808	Ga0207641_106618081	124
1076	3300026088	Ga0207641_12109218	Ga0207641_121092182	124
1077	3300026088	Ga0207641_12174310	Ga0207641_121743101	124
1078	3300026089	Ga0207648_10055230	Ga0207648_100552302	124
1079	3300026089	Ga0207648_10840419	Ga0207648_108404191	124
1080	3300026095	Ga0207676_10165042	Ga0207676_101650423	124
1081	3300026095	Ga0207676_11865586	Ga0207676_118655862	124
1082	3300026116	Ga0207674_10006709	Ga0207674_100067099	124
1083	3300026116	Ga0207674_10010337	Ga0207674_100103372	124
1084	3300026116	Ga0207674_10011116	Ga0207674_1001111610	124
1085	3300026116	Ga0207674_10026497	Ga0207674_100264972	124
1086	3300026116	Ga0207674_10286743	Ga0207674_102867432	124
1087	3300026116	Ga0207674_10303229	Ga0207674_103032291	124
1088	3300026116	Ga0207674_10351486	Ga0207674_103514862	124
1089	3300026116	Ga0207674_10445440	Ga0207674_104454402	124
1090	3300026116	Ga0207674_11558957	Ga0207674_115589572	124
1091	3300026118	Ga0207675_100304862	Ga0207675_1003048622	124
1092	3300026121	Ga0207683_10060949	Ga0207683_100609493	124
1093	3300026121	Ga0207683_10067695	Ga0207683_100676954	124
1094	3300026121	Ga0207683_10208077	Ga0207683_102080772	124
1095	3300026121	Ga0207683_10270007	Ga0207683_102700072	124
1096	3300026142	Ga0207698_10027187	Ga0207698_100271872	124
1097	3300026142	Ga0207698_10084876	Ga0207698_100848762	124
1098	3300026142	Ga0207698_10128949	Ga0207698_101289492	124
1099	3300026142	Ga0207698_10378248	Ga0207698_103782482	124
1100	3300026142	Ga0207698_10539375	Ga0207698_105393752	124
1101	3300026142	Ga0207698_10673322	Ga0207698_106733222	124
1102	3300026142	Ga0207698_10682806	Ga0207698_106828062	124
1103	3300026142	Ga0207698_11259519	Ga0207698_112595192	124
1104	3300026142	Ga0207698_12221714	Ga0207698_122217142	124
1105	3300027296	Ga0209389_1000193	Ga0209389_100019319	124
1106	3300027296	Ga0209389_1000207	Ga0209389_100020723	124
1107	3300027357	Ga0209589_1000024	Ga0209589_1000024147	124
1108	3300027357	Ga0209589_1000025	Ga0209589_100002531	124
1109	3300027361	Ga0209489_100039	Ga0209489_10003931	124
1110	3300027361	Ga0209489_101741	Ga0209489_10174119	124
1111	3300027361	Ga0209489_101963	Ga0209489_10196323	124
1112	3300027363	Ga0209700_100043	Ga0209700_10004334	124
1113	3300027363	Ga0209700_100420	Ga0209700_10042026	124
1114	3300027512	Ga0209179_1066224	Ga0209179_10662242	124
1115	3300027671	Ga0209588_1004016	Ga0209588_10040165	124
1116	3300027671	Ga0209588_1037418	Ga0209588_10374182	124
1117	3300028017	Ga0265356_1021217	Ga0265356_10212172	124
1118	3300028379	Ga0268266_10004890	Ga0268266_100048904	124
1119	3300028379	Ga0268266_10058860	Ga0268266_100588602	124
1120	3300028379	Ga0268266_10108572	Ga0268266_101085721	124
1121	3300028379	Ga0268266_10342069	Ga0268266_103420692	124
1122	3300028379	Ga0268266_10471478	Ga0268266_104714782	124
1123	3300028379	Ga0268266_10553457	Ga0268266_105534572	124
1124	3300028379	Ga0268266_10675796	Ga0268266_106757962	124
1125	3300028379	Ga0268266_11926381	Ga0268266_119263811	124
1126	3300028380	Ga0268265_10680924	Ga0268265_106809242	124
1127	3300028381	Ga0268264_10000051	Ga0268264_10000051267	124
1128	3300028381	Ga0268264_10335416	Ga0268264_103354162	124
1129	3300028381	Ga0268264_10775214	Ga0268264_107752142	124
1130	3300028381	Ga0268264_11332041	Ga0268264_113320411	124
1131	3300028556	Ga0265337_1007953	Ga0265337_10079531	124
1132	3300028558	Ga0265326_10031478	Ga0265326_100314782	124
1133	3300028563	Ga0265319_1014867	Ga0265319_10148673	124
1134	3300028573	Ga0265334_10012764	Ga0265334_100127644	124
1135	3300028577	Ga0265318_10036000	Ga0265318_100360002	124
1136	3300028653	Ga0265323_10003727	Ga0265323_100037271	124
1137	3300028654	Ga0265322_10134158	Ga0265322_101341581	124
1138	3300028666	Ga0265336_10000986	Ga0265336_100009867	124
1139	3300028786	Ga0307517_10028420	Ga0307517_100284205	124
1140	3300028786	Ga0307517_10257683	Ga0307517_102576832	124
1141	3300028786	Ga0307517_10465156	Ga0307517_104651562	124
1142	3300028794	Ga0307515_10104336	Ga0307515_101043363	124
1143	3300028800	Ga0265338_10000231	Ga0265338_1000023120	124
1144	3300028800	Ga0265338_10354125	Ga0265338_103541252	124
1145	3300029957	Ga0265324_10003261	Ga0265324_100032614	124
1146	3300030521	Ga0307511_10121284	Ga0307511_101212842	124
1147	3300030763	Ga0265763_1022818	Ga0265763_10228182	124
1148	3300031235	Ga0265330_10021301	Ga0265330_100213012	124
1149	3300031235	Ga0265330_10051147	Ga0265330_100511472	124
1150	3300031239	Ga0265328_10068027	Ga0265328_100680271	124
1151	3300031241	Ga0265325_10025399	Ga0265325_100253991	124
1152	3300031241	Ga0265325_10345392	Ga0265325_103453921	124
1153	3300031242	Ga0265329_10148201	Ga0265329_101482012	124
1154	3300031247	Ga0265340_10014636	Ga0265340_100146364	124
1155	3300031249	Ga0265339_10001578	Ga0265339_100015788	124
1156	3300031249	Ga0265339_10042849	Ga0265339_100428492	124
1157	3300031249	Ga0265339_10058306	Ga0265339_100583062	124
1158	3300031249	Ga0265339_10123019	Ga0265339_101230192	124
1159	3300031249	Ga0265339_10215776	Ga0265339_102157762	124
1160	3300031249	Ga0265339_10265242	Ga0265339_102652422	124
1161	3300031250	Ga0265331_10054634	Ga0265331_100546342	124
1162	3300031250	Ga0265331_10073986	Ga0265331_100739862	124
1163	3300031250	Ga0265331_10169541	Ga0265331_101695412	124
1164	3300031344	Ga0265316_10086105	Ga0265316_100861053	124
1165	3300031344	Ga0265316_10185317	Ga0265316_101853172	124
1166	3300031344	Ga0265316_10434969	Ga0265316_104349692	124
1167	3300031344	Ga0265316_10808957	Ga0265316_108089571	124
1168	3300031344	Ga0265316_10877524	Ga0265316_108775241	124
1169	3300031456	Ga0307513_10499285	Ga0307513_104992852	124
1170	3300031507	Ga0307509_10171438	Ga0307509_101714382	124
1171	3300031507	Ga0307509_10283550	Ga0307509_102835502	124
1172	3300031507	Ga0307509_10662490	Ga0307509_106624902	124
1173	3300031507	Ga0307509_10715162	Ga0307509_107151621	124
1174	3300031548	Ga0307408_100653764	Ga0307408_1006537642	124
1175	3300031548	Ga0307408_100814737	Ga0307408_1008147371	124
1176	3300031595	Ga0265313_10258073	Ga0265313_102580732	124
1177	3300031616	Ga0307508_10000152	Ga0307508_1000015253	124
1178	3300031616	Ga0307508_10032379	Ga0307508_100323793	124
1179	3300031616	Ga0307508_10072313	Ga0307508_100723133	124
1180	3300031616	Ga0307508_10371999	Ga0307508_103719991	124
1181	3300031616	Ga0307508_10437615	Ga0307508_104376151	124
1182	3300031711	Ga0265314_10036532	Ga0265314_100365324	124
1183	3300031711	Ga0265314_10055574	Ga0265314_100555743	124
1184	3300031711	Ga0265314_10226360	Ga0265314_102263602	124
1185	3300031712	Ga0265342_10006255	Ga0265342_100062552	124
1186	3300031712	Ga0265342_10569951	Ga0265342_105699511	124
1187	3300031712	Ga0265342_10659980	Ga0265342_106599801	124
1188	3300031730	Ga0307516_10007620	Ga0307516_100076205	124
1189	3300031730	Ga0307516_10027547	Ga0307516_100275474	124
1190	3300031730	Ga0307516_10042523	Ga0307516_100425235	124
1191	3300031730	Ga0307516_10136347	Ga0307516_101363472	124
1192	3300031730	Ga0307516_10258142	Ga0307516_102581421	124
1193	3300031730	Ga0307516_10382834	Ga0307516_103828342	124
1194	3300031731	Ga0307405_10406407	Ga0307405_104064072	124
1195	3300031731	Ga0307405_11841936	Ga0307405_118419362	124
1196	3300031824	Ga0307413_10571877	Ga0307413_105718772	124
1197	3300031838	Ga0307518_10435261	Ga0307518_104352612	124
1198	3300031852	Ga0307410_11811919	Ga0307410_118119192	124
1199	3300031901	Ga0307406_10036717	Ga0307406_100367172	124
1200	3300031901	Ga0307406_10543802	Ga0307406_105438022	124
1201	3300031901	Ga0307406_11566333	Ga0307406_115663332	124
1202	3300031903	Ga0307407_10319590	Ga0307407_103195902	124
1203	3300031903	Ga0307407_10448268	Ga0307407_104482682	124
1204	3300031911	Ga0307412_10101287	Ga0307412_101012871	124
1205	3300031911	Ga0307412_10225589	Ga0307412_102255892	124
1206	3300031911	Ga0307412_10788372	Ga0307412_107883722	124
1207	3300031911	Ga0307412_11096059	Ga0307412_110960592	124
1208	3300031995	Ga0307409_101592038	Ga0307409_1015920382	124
1209	3300032002	Ga0307416_100348827	Ga0307416_1003488272	124
1210	3300032002	Ga0307416_100905319	Ga0307416_1009053192	124
1211	3300032002	Ga0307416_101814770	Ga0307416_1018147701	124
1212	3300032004	Ga0307414_10061652	Ga0307414_100616523	124
1213	3300032004	Ga0307414_11497913	Ga0307414_114979131	124
1214	3300032005	Ga0307411_11155785	Ga0307411_111557851	124
1215	3300032126	Ga0307415_100057475	Ga0307415_1000574752	124
1216	3300032126	Ga0307415_101202135	Ga0307415_1012021352	124
1217	3300033179	Ga0307507_10052199	Ga0307507_100521994	124
1218	3300033179	Ga0307507_10463381	Ga0307507_104633812	124
1219	3300033179	Ga0307507_10604852	Ga0307507_106048522	124
1220	3300033180	Ga0307510_10039048	Ga0307510_100390481	124
1221	3300033180	Ga0307510_10039183	Ga0307510_100391832	124
1222	3300033180	Ga0307510_10046218	Ga0307510_100462183	124
1223	3300033180	Ga0307510_10424581	Ga0307510_104245812	124
1224	3300033180	Ga0307510_10522695	Ga0307510_105226951	124
1225	3300034816	Ga0373930_0040142	Ga0373930_0040142_50_424	124
1226	3300034820	Ga0373959_0062925	Ga0373959_0062925_48_425	124
1227	3300035083	Ga0373926_0033617	Ga0373926_0033617_92_466	124
1228	3300035083	Ga0373926_0085904	Ga0373926_0085904_654_1031	124
1229	3300035086	Ga0373934_0010358	Ga0373934_0010358_3091_3465	124
1230	3300035086	Ga0373934_0079839	Ga0373934_0079839_375_752	124
1231	3300035086	Ga0373934_0102394	Ga0373934_0102394_94_468	124
1232	3300035086	Ga0373934_0401392	Ga0373934_0401392_162_539	124
1233	3300035088	Ga0373940_0251784	Ga0373940_0251784_37_414	124
1234	3300035089	Ga0373944_0191820	Ga0373944_0191820_32_409	124
1235	3300035091	Ga0373951_0082011	Ga0373951_0082011_31_408	124
1236	3300035091	Ga0373951_0135758	Ga0373951_0135758_70_492	124
1237	3300035092	Ga0373952_0122542	Ga0373952_0122542_79_453	124
1238	3300035111	Ga0373923_0027038	Ga0373923_0027038_801_1178	124
1239	3300035111	Ga0373923_0285942	Ga0373923_0285942_190_567	124
1240	3300035112	Ga0373932_0013863	Ga0373932_0013863_18_392	124
1241	3300035113	Ga0373936_0044023	Ga0373936_0044023_956_1333	124
1242	3300035113	Ga0373936_0049476	Ga0373936_0049476_880_1254	124
1243	3300035113	Ga0373936_0092843	Ga0373936_0092843_771_1148	124
1244	3300035113	Ga0373936_0251883	Ga0373936_0251883_326_700	124
1245	3300035113	Ga0373936_0526152	Ga0373936_0526152_91_465	124
1246	3300035115	Ga0373941_0428519	Ga0373941_0428519_49_423	124
1247	3300035116	Ga0373945_0042897	Ga0373945_0042897_409_786	124
1248	3300035116	Ga0373945_0121566	Ga0373945_0121566_250_624	124
1249	3300035116	Ga0373945_0255287	Ga0373945_0255287_262_636	124
1250	3300035117	Ga0373953_0030660	Ga0373953_0030660_500_874	124
1251	3300035118	Ga0373954_0002198	Ga0373954_0002198_2792_3166	124
1252	3300035118	Ga0373954_0015399	Ga0373954_0015399_3008_3385	124
1253	3300035119	Ga0373956_0002899	Ga0373956_0002899_1993_2367	124
1254	3300035119	Ga0373956_0004758	Ga0373956_0004758_2366_2743	124
1255	3300035120	Ga0373957_0063547	Ga0373957_0063547_297_671	124
1256	3300035121	Ga0373960_0391225	Ga0373960_0391225_126_503	124
1257	3300035121	Ga0373960_0393440	Ga0373960_0393440_52_429	124
1258	3300035170	Ga0373943_0005727	Ga0373943_0005727_4153_4530	124
1259	3300035170	Ga0373943_0065940	Ga0373943_0065940_883_1260	124
1260	3300035170	Ga0373943_0602671	Ga0373943_0602671_38_415	124
1261	3300035171	Ga0373946_0028732	Ga0373946_0028732_843_1220	124
1262	3300035171	Ga0373946_0061120	Ga0373946_0061120_1018_1392	124
1263	3300035172	Ga0373955_0075085	Ga0373955_0075085_568_945	124
1264	3300035172	Ga0373955_0111118	Ga0373955_0111118_73_447	124
1265	3300035172	Ga0373955_0356233	Ga0373955_0356233_249_626	124
1266	3300035241	Ga0373961_0409808	Ga0373961_0409808_28_438	124
1267	3300035242	Ga0373962_0358696	Ga0373962_0358696_70_447	124
1268	3300035410	Ga0373924_0007480	Ga0373924_0007480_355_729	124
1269	3300035410	Ga0373924_0016977	Ga0373924_0016977_1586_1963	124
1270	3300035410	Ga0373924_0535523	Ga0373924_0535523_58_435	124
1271	3300035691	Ga0373931_0032072	Ga0373931_0032072_1252_1626	124
1272	3300035691	Ga0373931_0044855	Ga0373931_0044855_1711_2088	124
1273	3300035691	Ga0373931_0064253	Ga0373931_0064253_1192_1569	124
1274	3300035691	Ga0373931_0150142	Ga0373931_0150142_704_1078	124
1275	3300035691	Ga0373931_0344280	Ga0373931_0344280_139_516	124
1276	3300035691	Ga0373931_0436776	Ga0373931_0436776_311_685	124
1277	3300035691	Ga0373931_1126917	Ga0373931_1126917_71_448	124
1278	3300035692	Ga0373935_0001370	Ga0373935_0001370_998_1375	124
1279	3300035692	Ga0373935_0101489	Ga0373935_0101489_1249_1626	124
1280	3300035692	Ga0373935_0260858	Ga0373935_0260858_505_879	124
1281	3300035692	Ga0373935_0316756	Ga0373935_0316756_373_747	124
1282	3300035692	Ga0373935_0446476	Ga0373935_0446476_531_908	124
1283	3300035692	Ga0373935_0546269	Ga0373935_0546269_244_621	124
1284	3300035692	Ga0373935_0764582	Ga0373935_0764582_308_685	124
1285	3300035695	Ga0373927_0003159	Ga0373927_0003159_9289_9666	124
1286	3300035695	Ga0373927_0004401	Ga0373927_0004401_4915_5292	124
1287	3300035695	Ga0373927_0018834	Ga0373927_0018834_2348_2725	124
1288	3300035695	Ga0373927_0027567	Ga0373927_0027567_1179_1553	124
1289	3300035695	Ga0373927_0039534	Ga0373927_0039534_416_790	124
1290	3300035695	Ga0373927_0087351	Ga0373927_0087351_789_1163	124
1291	3300035695	Ga0373927_0124166	Ga0373927_0124166_327_701	124
1292	3300035695	Ga0373927_0345506	Ga0373927_0345506_343_717	124
1293	3300035695	Ga0373927_0367517	Ga0373927_0367517_79_453	124
1294	3300035724	Ga0373933_0000018	Ga0373933_0000018_62459_62836	124
1295	3300035724	Ga0373933_0028845	Ga0373933_0028845_2199_2573	124
1296	3300035724	Ga0373933_0036434	Ga0373933_0036434_2366_2740	124
1297	3300035724	Ga0373933_0159586	Ga0373933_0159586_774_1151	124
1298	3300035724	Ga0373933_0942630	Ga0373933_0942630_73_450	124
1299	3300035724	Ga0373933_1153889	Ga0373933_1153889_94_471	124
1300	3300035725	Ga0373947_0000480	Ga0373947_0000480_2144_2521	124
1301	3300035725	Ga0373947_0058838	Ga0373947_0058838_1917_2294	124
1302	3300035725	Ga0373947_0285143	Ga0373947_0285143_300_674	124
1303	3300035725	Ga0373947_0544756	Ga0373947_0544756_402_776	124
1304	3300035725	Ga0373947_0720127	Ga0373947_0720127_114_491	124
1305	3300036401	Ga0373937_0411330	Ga0373937_0411330_207_581	124
1306	3300036401	Ga0373937_0679631	Ga0373937_0679631_301_678	124
1307	3300036459	Ga0372808_003027	Ga0372808_003027_577_954	124
1308	3300037068	Ga0373925_0003749	Ga0373925_0003749_7328_7705	124
1309	3300037068	Ga0373925_0089880	Ga0373925_0089880_1145_1519	124
1310	3300037068	Ga0373925_0098189	Ga0373925_0098189_1816_2190	124
1311	3300037068	Ga0373925_0265862	Ga0373925_0265862_296_670	124
1312	3300037068	Ga0373925_0423996	Ga0373925_0423996_326_703	124
1313	3300037068	Ga0373925_0461504	Ga0373925_0461504_148_522	124
1314	3300037068	Ga0373925_0687578	Ga0373925_0687578_50_424	124
1315	3300037068	Ga0373925_1071193	Ga0373925_1071193_21_395	124
1316	3300037312	Ga0395899_0056528	Ga0395899_0056528_1608_1985	124
1317	3300037312	Ga0395899_0539886	Ga0395899_0539886_123_497	124
1318	3300037312	Ga0395899_0954435	Ga0395899_0954435_26_403	124
1319	3300037418	Ga0395900_0001144	Ga0395900_0001144_9466_9840	124
1320	3300037418	Ga0395900_0043435	Ga0395900_0043435_3698_4075	124
1321	3300037418	Ga0395900_0186882	Ga0395900_0186882_762_1139	124
1322	3300037418	Ga0395900_0957673	Ga0395900_0957673_79_453	124
1323	3300037418	Ga0395900_1430518	Ga0395900_1430518_92_469	124
1324	3300037418	Ga0395900_1660003	Ga0395900_1660003_161_535	124
1325	3300037466	Ga0395898_0127482	Ga0395898_0127482_869_1246	124
1326	3300037466	Ga0395898_0147448	Ga0395898_0147448_1594_1968	124
1327	3300037466	Ga0395898_0502219	Ga0395898_0502219_285_659	124
1328	3300037466	Ga0395898_0655389	Ga0395898_0655389_480_857	124
1329	3300037466	Ga0395898_0882592	Ga0395898_0882592_154_528	124
1330	3300037471	Ga0395905_0001838	Ga0395905_0001838_9421_9795	124
1331	3300037471	Ga0395905_0121828	Ga0395905_0121828_1402_1779	124
1332	3300037471	Ga0395905_0483889	Ga0395905_0483889_740_1117	124
1333	3300037853	Ga0436364_0151143	Ga0436364_0151143_182_556	124
1334	3300037853	Ga0436364_0688885	Ga0436364_0688885_132_506	124
1335	3300037853	Ga0436364_0813354	Ga0436364_0813354_145_519	124
1336	3300037853	Ga0436364_1336704	Ga0436364_1336704_344_718	124
1337	3300038443	Ga0395901_0017814	Ga0395901_0017814_4882_5256	124
1338	3300038443	Ga0395901_0048753	Ga0395901_0048753_1026_1403	124
1339	3300038443	Ga0395901_0101213	Ga0395901_0101213_1234_1608	124
1340	3300038443	Ga0395901_0127924	Ga0395901_0127924_1987_2361	124
1341	3300038443	Ga0395901_0150699	Ga0395901_0150699_579_956	124
1342	3300038443	Ga0395901_0248474	Ga0395901_0248474_825_1199	124
1343	3300038443	Ga0395901_0964805	Ga0395901_0964805_318_695	124
1344	3300039437	Ga0436365_0091550	Ga0436365_0091550_81_458	124
1345	3300039437	Ga0436365_0154023	Ga0436365_0154023_702_1076	124
1346	3300039437	Ga0436365_0498505	Ga0436365_0498505_13027_13401	124
1347	3300039437	Ga0436365_0614752	Ga0436365_0614752_457_834	124
1348	3300039437	Ga0436365_0639743	Ga0436365_0639743_100_474	124
1349	3300039437	Ga0436365_0654142	Ga0436365_0654142_367_765	124
1350	3300039437	Ga0436365_1450004	Ga0436365_1450004_292_666	124
1351	3300039437	Ga0436365_1605795	Ga0436365_1605795_198_572	124
1352	3300039437	Ga0436365_1724305	Ga0436365_1724305_102_476	124
1353	3300039437	Ga0436365_1732462	Ga0436365_1732462_1771_2145	124
1354	3300039437	Ga0436365_1889588	Ga0436365_1889588_1192_1566	124
1355	3300039438	Ga0436360_1197075	Ga0436360_1197075_43_417	124
1356	3300039438	Ga0436360_1209100	Ga0436360_1209100_1062_1436	124
1357	3300039438	Ga0436360_1232651	Ga0436360_1232651_303_680	124
1358	3300039447	Ga0436361_0268492	Ga0436361_0268492_1278_1652	124
1359	3300039447	Ga0436361_1176445	Ga0436361_1176445_79_453	124
1360	3300039447	Ga0436361_1180061	Ga0436361_1180061_180_554	124
1361	3300039450	Ga0436363_0138910	Ga0436363_0138910_124_498	124
1362	3300039450	Ga0436363_0608793	Ga0436363_0608793_112_486	124
1363	3300039450	Ga0436363_0773580	Ga0436363_0773580_115_489	124
1364	3300039450	Ga0436363_1286982	Ga0436363_1286982_158_532	124
1365	3300039450	Ga0436363_1360357	Ga0436363_1360357_560_937	124
1366	3300039453	Ga0436362_0317072	Ga0436362_0317072_27_404	124
1367	3300039453	Ga0436362_1075244	Ga0436362_1075244_1997_2371	124
1368	3300041413	Ga0439465_0025850	Ga0439465_0025850_1317_1694	124
1369	3300041413	Ga0439465_0176665	Ga0439465_0176665_340_717	124
1370	3300041441	Ga0451787_535459	Ga0451787_535459_118_495	124
1371	3300041451	Ga0451791_0393229	Ga0451791_0393229_460_837	124
1372	3300041452	Ga0451793_0803750	Ga0451793_0803750_270_644	124
1373	3300041452	Ga0451793_1003685	Ga0451793_1003685_325_699	124
1374	3300041456	Ga0451795_0667025	Ga0451795_0667025_586_960	124
1375	3300041456	Ga0451795_1535427	Ga0451795_1535427_102_479	124
1376	3300041459	Ga0451800_0929583	Ga0451800_0929583_277_657	124
1377	3300041460	Ga0451802_1712190	Ga0451802_1712190_95_469	124
1378	3300041463	Ga0451804_0623873	Ga0451804_0623873_80_460	124
1379	3300041491	Ga0451833_0865256	Ga0451833_0865256_589_963	124
1380	3300041498	Ga0451841_1450511	Ga0451841_1450511_471_845	124
1381	3300041507	Ga0451851_0731422	Ga0451851_0731422_144_518	124
1382	3300041509	Ga0451843_1492484	Ga0451843_1492484_99_473	124
1383	3300041512	Ga0451853_2023067	Ga0451853_2023067_135_509	124
1384	3300041512	Ga0451853_2906480	Ga0451853_2906480_394_771	124
1385	3300041997	Ga0439431_0057691	Ga0439431_0057691_85_462	124
1386	3300042006	Ga0439432_225759	Ga0439432_225759_73_447	124
1387	3300042012	Ga0439455_0116715	Ga0439455_0116715_338_712	124
1388	3300042157	Ga0439458_0082880	Ga0439458_0082880_357_734	124
1389	3300042438	Ga0439459_0205886	Ga0439459_0205886_134_508	124
1390	3300042461	Ga0439460_0338078	Ga0439460_0338078_27_401	124
1391	3300044656	Ga0466969_0013537	Ga0466969_0013537_668_1042	124
1392	3300044656	Ga0466969_0103012	Ga0466969_0103012_144_521	124
1393	3300044658	Ga0466972_0000497	Ga0466972_0000497_9841_10215	124
1394	3300044658	Ga0466972_0014152	Ga0466972_0014152_2750_3124	124
1395	3300044658	Ga0466972_0268726	Ga0466972_0268726_124_498	124
1396	3300044683	Ga0466965_0035273	Ga0466965_0035273_169_543	124
1397	3300044684	Ga0466966_0023019	Ga0466966_0023019_815_1189	124
1398	3300044684	Ga0466966_0199023	Ga0466966_0199023_631_1008	124
1399	3300044684	Ga0466966_0382019	Ga0466966_0382019_29_418	124
1400	3300044693	Ga0466961_0000065	Ga0466961_0000065_13130_13504	124
1401	3300044693	Ga0466961_0793523	Ga0466961_0793523_53_427	124
1402	3300044694	Ga0466963_0324021	Ga0466963_0324021_167_541	124
1403	3300044694	Ga0466963_0364271	Ga0466963_0364271_136_522	124
1404	3300044694	Ga0466963_0403796	Ga0466963_0403796_520_894	124
1405	3300044706	Ga0466964_0132381	Ga0466964_0132381_239_613	124
1406	3300044719	Ga0466971_0041124	Ga0466971_0041124_227_601	124
1407	3300044719	Ga0466971_0186235	Ga0466971_0186235_429_818	124
1408	3300044735	Ga0466968_0006369	Ga0466968_0006369_599_973	124
1409	3300044735	Ga0466968_0052027	Ga0466968_0052027_716_1090	124
1410	3300044765	Ga0466970_0204767	Ga0466970_0204767_150_524	124
1411	3300044765	Ga0466970_0437609	Ga0466970_0437609_173_565	124
1412	3300044765	Ga0466970_0694283	Ga0466970_0694283_107_484	124
1413	3300044842	Ga0466957_0110767	Ga0466957_0110767_60_434	124
1414	3300044842	Ga0466957_0638036	Ga0466957_0638036_72_446	124
1415	3300044842	Ga0466957_0778308	Ga0466957_0778308_49_423	124
1416	3300044901	Ga0466960_0000883	Ga0466960_0000883_3184_3558	124
1417	3300044901	Ga0466960_0182517	Ga0466960_0182517_265_639	124
1418	3300044901	Ga0466960_0253471	Ga0466960_0253471_329_703	124
1419	3300045049	Ga0466959_0016271	Ga0466959_0016271_339_716	124
1420	3300045049	Ga0466959_0018727	Ga0466959_0018727_3381_3755	124
1421	3300045049	Ga0466959_0095649	Ga0466959_0095649_1452_1826	124
1422	3300045049	Ga0466959_0266255	Ga0466959_0266255_566_940	124
1423	3300045049	Ga0466959_0382838	Ga0466959_0382838_394_768	124
1424	3300045049	Ga0466959_0627565	Ga0466959_0627565_64_438	124
1425	3300045049	Ga0466959_1050661	Ga0466959_1050661_120_494	124
1426	3300045051	Ga0451576_0565464	Ga0451576_0565464_791_1168	124
1427	3300045836	Ga0466958_0122068	Ga0466958_0122068_86_460	124
1428	3300045836	Ga0466958_0710219	Ga0466958_0710219_143_517	124
1429	3300045976	Ga0466967_0018140	Ga0466967_0018140_916_1302	124
1430	3300045976	Ga0466967_0183596	Ga0466967_0183596_1266_1640	124
1431	3300045976	Ga0466967_0415444	Ga0466967_0415444_855_1232	124
1432	3300045976	Ga0466967_0737902	Ga0466967_0737902_57_434	124
1433	3300045976	Ga0466967_1571610	Ga0466967_1571610_139_513	124
1434	3300045976	Ga0466967_1850186	Ga0466967_1850186_182_556	124
1435	3300045976	Ga0466967_2489794	Ga0466967_2489794_123_497	124
1436	3300046452	Ga0495617_055854	Ga0495617_055854_827_1201	124
1437	3300046452	Ga0495617_097904	Ga0495617_097904_157_534	124
1438	3300046452	Ga0495617_104342	Ga0495617_104342_154_528	124
1439	3300046453	Ga0495627_113749	Ga0495627_113749_296_673	124
1440	3300046453	Ga0495627_172980	Ga0495627_172980_183_557	124
1441	3300046454	Ga0495592_0022347	Ga0495592_0022347_2367_2741	124
1442	3300046454	Ga0495592_0033115	Ga0495592_0033115_370_744	124
1443	3300046454	Ga0495592_0050513	Ga0495592_0050513_964_1338	124
1444	3300046454	Ga0495592_0058917	Ga0495592_0058917_390_767	124
1445	3300046454	Ga0495592_0081768	Ga0495592_0081768_1461_1838	124
1446	3300046454	Ga0495592_0392961	Ga0495592_0392961_417_791	124
1447	3300046455	Ga0495603_0010261	Ga0495603_0010261_5127_5504	124
1448	3300046455	Ga0495603_0012131	Ga0495603_0012131_1873_2247	124
1449	3300046455	Ga0495603_0023201	Ga0495603_0023201_1061_1438	124
1450	3300046455	Ga0495603_0064265	Ga0495603_0064265_138_512	124
1451	3300046455	Ga0495603_0109653	Ga0495603_0109653_207_581	124
1452	3300046457	Ga0495590_0080375	Ga0495590_0080375_696_1070	124
1453	3300046457	Ga0495590_0152973	Ga0495590_0152973_175_549	124
1454	3300046457	Ga0495590_0160221	Ga0495590_0160221_25_402	124
1455	3300046457	Ga0495590_0203104	Ga0495590_0203104_112_486	124
1456	3300046459	Ga0495629_0000074	Ga0495629_0000074_25169_25546	124
1457	3300046459	Ga0495629_0000905	Ga0495629_0000905_7390_7764	124
1458	3300046459	Ga0495629_0010611	Ga0495629_0010611_2831_3205	124
1459	3300046459	Ga0495629_0110365	Ga0495629_0110365_453_830	124
1460	3300046459	Ga0495629_0525198	Ga0495629_0525198_226_603	124
1461	3300046460	Ga0495638_0012617	Ga0495638_0012617_4682_5056	124
1462	3300046460	Ga0495638_0178689	Ga0495638_0178689_275_652	124
1463	3300046460	Ga0495638_0223055	Ga0495638_0223055_25_402	124
1464	3300046460	Ga0495638_0418373	Ga0495638_0418373_93_470	124
1465	3300046461	Ga0495641_0002422	Ga0495641_0002422_2252_2629	124
1466	3300046461	Ga0495641_0148101	Ga0495641_0148101_575_949	124
1467	3300046461	Ga0495641_0221584	Ga0495641_0221584_440_814	124
1468	3300046461	Ga0495641_0258768	Ga0495641_0258768_11_388	124
1469	3300046462	Ga0495651_0019700	Ga0495651_0019700_2071_2445	124
1470	3300046462	Ga0495651_0047292	Ga0495651_0047292_2157_2534	124
1471	3300046462	Ga0495651_0082515	Ga0495651_0082515_54_428	124
1472	3300046462	Ga0495651_0099980	Ga0495651_0099980_1309_1683	124
1473	3300046462	Ga0495651_0104034	Ga0495651_0104034_1010_1384	124
1474	3300046462	Ga0495651_0486698	Ga0495651_0486698_87_464	124
1475	3300046462	Ga0495651_0494384	Ga0495651_0494384_297_671	124
1476	3300046462	Ga0495651_0576201	Ga0495651_0576201_312_695	124
1477	3300046463	Ga0495653_0042303	Ga0495653_0042303_282_656	124
1478	3300046463	Ga0495653_0048265	Ga0495653_0048265_2866_3243	124
1479	3300046463	Ga0495653_0199421	Ga0495653_0199421_349_726	124
1480	3300046463	Ga0495653_0288576	Ga0495653_0288576_591_965	124
1481	3300046463	Ga0495653_0545734	Ga0495653_0545734_309_683	124
1482	3300046471	Ga0495650_0141653	Ga0495650_0141653_68_445	124
1483	3300046471	Ga0495650_0300723	Ga0495650_0300723_59_433	124
1484	3300046472	Ga0495580_0020307	Ga0495580_0020307_4288_4665	124
1485	3300046472	Ga0495580_0253300	Ga0495580_0253300_772_1149	124
1486	3300046472	Ga0495580_0296601	Ga0495580_0296601_117_491	124
1487	3300046473	Ga0495582_0000059	Ga0495582_0000059_39815_40192	124
1488	3300046473	Ga0495582_0095791	Ga0495582_0095791_510_884	124
1489	3300046473	Ga0495582_0127859	Ga0495582_0127859_293_667	124
1490	3300046474	Ga0495605_0065260	Ga0495605_0065260_35_409	124
1491	3300046474	Ga0495605_0089609	Ga0495605_0089609_452_829	124
1492	3300046474	Ga0495605_0188483	Ga0495605_0188483_217_591	124
1493	3300046475	Ga0495639_0000752	Ga0495639_0000752_7598_7975	124
1494	3300046475	Ga0495639_0085490	Ga0495639_0085490_156_530	124
1495	3300046475	Ga0495639_0229819	Ga0495639_0229819_386_760	124
1496	3300046475	Ga0495639_0449957	Ga0495639_0449957_185_562	124
1497	3300046476	Ga0495662_0104331	Ga0495662_0104331_87_464	124
1498	3300046476	Ga0495662_0131015	Ga0495662_0131015_84_458	124
1499	3300046476	Ga0495662_0447245	Ga0495662_0447245_211_585	124
1500	3300046476	Ga0495662_0601648	Ga0495662_0601648_104_481	124
1501	3300046477	Ga0495664_0006511	Ga0495664_0006511_6021_6398	124
1502	3300046477	Ga0495664_0019421	Ga0495664_0019421_1892_2266	124
1503	3300046477	Ga0495664_0032628	Ga0495664_0032628_1726_2103	124
1504	3300046477	Ga0495664_0073004	Ga0495664_0073004_87_461	124
1505	3300046477	Ga0495664_0132774	Ga0495664_0132774_374_748	124
1506	3300046477	Ga0495664_0251386	Ga0495664_0251386_211_588	124
1507	3300046477	Ga0495664_0512149	Ga0495664_0512149_149_523	124
1508	3300046491	Ga0495584_0063639	Ga0495584_0063639_1280_1654	124
1509	3300046491	Ga0495584_0256800	Ga0495584_0256800_231_605	124
1510	3300046491	Ga0495584_0304595	Ga0495584_0304595_355_732	124
1511	3300046491	Ga0495584_0330011	Ga0495584_0330011_383_757	124
1512	3300046492	Ga0495585_0104792	Ga0495585_0104792_898_1272	124
1513	3300046499	Ga0495594_0004702	Ga0495594_0004702_5712_6089	124
1514	3300046499	Ga0495594_0116060	Ga0495594_0116060_367_741	124
1515	3300046499	Ga0495594_0135631	Ga0495594_0135631_220_594	124
1516	3300046500	Ga0495596_0231920	Ga0495596_0231920_291_665	124
1517	3300046507	Ga0495606_0047302	Ga0495606_0047302_1453_1827	124
1518	3300046507	Ga0495606_0312864	Ga0495606_0312864_38_418	124
1519	3300046507	Ga0495606_0404102	Ga0495606_0404102_270_647	124
1520	3300046511	Ga0495608_0006896	Ga0495608_0006896_5661_6038	124
1521	3300046511	Ga0495608_0035889	Ga0495608_0035889_126_500	124
1522	3300046511	Ga0495608_0052184	Ga0495608_0052184_255_629	124
1523	3300046511	Ga0495608_0217482	Ga0495608_0217482_502_876	124
1524	3300046512	Ga0495610_0098494	Ga0495610_0098494_910_1284	124
1525	3300046512	Ga0495610_0177903	Ga0495610_0177903_22_396	124
1526	3300046513	Ga0495616_0108943	Ga0495616_0108943_397_771	124
1527	3300046513	Ga0495616_0201456	Ga0495616_0201456_296_673	124
1528	3300046513	Ga0495616_0216043	Ga0495616_0216043_343_717	124
1529	3300046513	Ga0495616_0261852	Ga0495616_0261852_306_680	124
1530	3300046513	Ga0495616_0456812	Ga0495616_0456812_34_411	124
1531	3300046514	Ga0495618_0008695	Ga0495618_0008695_2616_2993	124
1532	3300046514	Ga0495618_0071368	Ga0495618_0071368_278_655	124
1533	3300046514	Ga0495618_0099368	Ga0495618_0099368_429_803	124
1534	3300046514	Ga0495618_0216196	Ga0495618_0216196_68_445	124
1535	3300046514	Ga0495618_0227846	Ga0495618_0227846_498_872	124
1536	3300046514	Ga0495618_0421544	Ga0495618_0421544_407_781	124
1537	3300046514	Ga0495618_0481570	Ga0495618_0481570_308_682	124
1538	3300046515	Ga0495620_0077823	Ga0495620_0077823_644_1018	124
1539	3300046515	Ga0495620_0249775	Ga0495620_0249775_11_385	124
1540	3300046515	Ga0495620_0267894	Ga0495620_0267894_167_544	124
1541	3300046516	Ga0495628_0010455	Ga0495628_0010455_5610_5984	124
1542	3300046516	Ga0495628_0038765	Ga0495628_0038765_2652_3026	124
1543	3300046516	Ga0495628_0116075	Ga0495628_0116075_115_492	124
1544	3300046516	Ga0495628_0395253	Ga0495628_0395253_411_785	124
1545	3300046516	Ga0495628_0461871	Ga0495628_0461871_393_767	124
1546	3300046516	Ga0495628_0576466	Ga0495628_0576466_53_430	124
1547	3300046516	Ga0495628_0732884	Ga0495628_0732884_296_670	124
1548	3300046517	Ga0495630_0025907	Ga0495630_0025907_3313_3690	124
1549	3300046517	Ga0495630_0128557	Ga0495630_0128557_1039_1416	124
1550	3300046517	Ga0495630_0894482	Ga0495630_0894482_11_385	124
1551	3300046517	Ga0495630_1047167	Ga0495630_1047167_84_458	124
1552	3300046518	Ga0495631_0091276	Ga0495631_0091276_67_444	124
1553	3300046518	Ga0495631_0110439	Ga0495631_0110439_522_899	124
1554	3300046518	Ga0495631_0204060	Ga0495631_0204060_155_529	124
1555	3300046518	Ga0495631_0280378	Ga0495631_0280378_312_686	124
1556	3300046519	Ga0495632_0056587	Ga0495632_0056587_730_1104	124
1557	3300046519	Ga0495632_0204187	Ga0495632_0204187_484_861	124
1558	3300046519	Ga0495632_0329844	Ga0495632_0329844_246_620	124
1559	3300046519	Ga0495632_0410728	Ga0495632_0410728_58_432	124
1560	3300046522	Ga0495643_0352466	Ga0495643_0352466_202_576	124
1561	3300046524	Ga0495648_0010311	Ga0495648_0010311_6270_6644	124
1562	3300046524	Ga0495648_0060340	Ga0495648_0060340_585_959	124
1563	3300046524	Ga0495648_0156035	Ga0495648_0156035_14_388	124
1564	3300046525	Ga0495663_0173322	Ga0495663_0173322_343_720	124
1565	3300046525	Ga0495663_0375520	Ga0495663_0375520_106_483	124
1566	3300046526	Ga0495666_0077918	Ga0495666_0077918_481_858	124
1567	3300046526	Ga0495666_0468757	Ga0495666_0468757_160_537	124
1568	3300046529	Ga0495652_0018298	Ga0495652_0018298_249_626	124
1569	3300046529	Ga0495652_0025560	Ga0495652_0025560_1789_2163	124
1570	3300046529	Ga0495652_0160009	Ga0495652_0160009_295_669	124
1571	3300046529	Ga0495652_0251810	Ga0495652_0251810_178_555	124
1572	3300046529	Ga0495652_0380051	Ga0495652_0380051_152_526	124
1573	3300046529	Ga0495652_0415973	Ga0495652_0415973_432_806	124
1574	3300046529	Ga0495652_0704144	Ga0495652_0704144_18_392	124
1575	3300046531	Ga0495665_0000395	Ga0495665_0000395_18161_18538	124
1576	3300046531	Ga0495665_0025644	Ga0495665_0025644_2741_3115	124
1577	3300046531	Ga0495665_0106925	Ga0495665_0106925_211_585	124
1578	3300046531	Ga0495665_0226982	Ga0495665_0226982_37_414	124
1579	3300046531	Ga0495665_0425756	Ga0495665_0425756_150_527	124
1580	3300046533	Ga0495640_0009166	Ga0495640_0009166_4816_5193	124
1581	3300046533	Ga0495640_0019037	Ga0495640_0019037_1345_1722	124
1582	3300046533	Ga0495640_0084212	Ga0495640_0084212_1420_1794	124
1583	3300046533	Ga0495640_0219002	Ga0495640_0219002_330_704	124
1584	3300046533	Ga0495640_0516082	Ga0495640_0516082_148_522	124
1585	3300046535	Ga0495586_0034629	Ga0495586_0034629_1377_1754	124
1586	3300046535	Ga0495586_0172076	Ga0495586_0172076_730_1107	124
1587	3300046536	Ga0495587_0004719	Ga0495587_0004719_846_1220	124
1588	3300046536	Ga0495587_0018706	Ga0495587_0018706_111_488	124
1589	3300046536	Ga0495587_0086985	Ga0495587_0086985_297_671	124
1590	3300046537	Ga0495598_0017099	Ga0495598_0017099_191_565	124
1591	3300046537	Ga0495598_0047880	Ga0495598_0047880_344_718	124
1592	3300046537	Ga0495598_0233961	Ga0495598_0233961_221_598	124
1593	3300046538	Ga0495609_0082640	Ga0495609_0082640_558_932	124
1594	3300046538	Ga0495609_0388479	Ga0495609_0388479_133_507	124
1595	3300046538	Ga0495609_0397892	Ga0495609_0397892_47_424	124
1596	3300046539	Ga0495621_0018991	Ga0495621_0018991_298_672	124
1597	3300046539	Ga0495621_0439857	Ga0495621_0439857_129_503	124
1598	3300046542	Ga0495597_0084414	Ga0495597_0084414_631_1005	124
1599	3300046542	Ga0495597_0172997	Ga0495597_0172997_371_748	124
1600	3300046543	Ga0495645_0014971	Ga0495645_0014971_4651_5028	124
1601	3300046543	Ga0495645_0030559	Ga0495645_0030559_2092_2466	124
1602	3300046543	Ga0495645_0080716	Ga0495645_0080716_424_798	124
1603	3300046543	Ga0495645_0400366	Ga0495645_0400366_405_779	124
1604	3300046557	Ga0495622_0003110	Ga0495622_0003110_129_506	124
1605	3300046557	Ga0495622_0019491	Ga0495622_0019491_1572_1946	124
1606	3300046557	Ga0495622_0029280	Ga0495622_0029280_535_912	124
1607	3300046557	Ga0495622_0053500	Ga0495622_0053500_1368_1742	124
1608	3300046557	Ga0495622_0211488	Ga0495622_0211488_308_685	124
1609	3300046557	Ga0495622_0264601	Ga0495622_0264601_257_631	124
1610	3300046557	Ga0495622_0446226	Ga0495622_0446226_30_404	124
1611	3300046559	Ga0495667_0006726	Ga0495667_0006726_5549_5923	124
1612	3300046559	Ga0495667_0007365	Ga0495667_0007365_1027_1404	124
1613	3300046559	Ga0495667_0030541	Ga0495667_0030541_113_490	124
1614	3300046559	Ga0495667_0149541	Ga0495667_0149541_992_1366	124
1615	3300046559	Ga0495667_0690408	Ga0495667_0690408_191_565	124
1616	3300046559	Ga0495667_0722755	Ga0495667_0722755_63_437	124
1617	3300046615	Ga0495656_0008268	Ga0495656_0008268_1386_1760	124
1618	3300046615	Ga0495656_0015791	Ga0495656_0015791_1462_1839	124
1619	3300046615	Ga0495656_0257911	Ga0495656_0257911_465_842	124
1620	3300046615	Ga0495656_0576335	Ga0495656_0576335_74_448	124
1621	3300046616	Ga0495668_0012470	Ga0495668_0012470_3512_3886	124
1622	3300046616	Ga0495668_0042110	Ga0495668_0042110_1119_1493	124
1623	3300046616	Ga0495668_0066918	Ga0495668_0066918_395_772	124
1624	3300046616	Ga0495668_0119168	Ga0495668_0119168_749_1123	124
1625	3300046616	Ga0495668_0413717	Ga0495668_0413717_37_411	124
1626	3300046642	Ga0495634_0001138	Ga0495634_0001138_13404_13781	124
1627	3300046642	Ga0495634_0023045	Ga0495634_0023045_2106_2480	124
1628	3300046642	Ga0495634_0030234	Ga0495634_0030234_759_1133	124
1629	3300046642	Ga0495634_0077986	Ga0495634_0077986_1571_1945	124
1630	3300046642	Ga0495634_0155788	Ga0495634_0155788_148_525	124
1631	3300046642	Ga0495634_0633263	Ga0495634_0633263_190_564	124
1632	3300046642	Ga0495634_0809530	Ga0495634_0809530_52_426	124
1633	3300046648	Ga0495611_0067215	Ga0495611_0067215_305_679	124
1634	3300046648	Ga0495611_0088963	Ga0495611_0088963_103_477	124
1635	3300046648	Ga0495611_0105940	Ga0495611_0105940_168_545	124
1636	3300046648	Ga0495611_0359267	Ga0495611_0359267_48_422	124
1637	3300046648	Ga0495611_0582538	Ga0495611_0582538_72_446	124
1638	3300046660	Ga0495625_0109301	Ga0495625_0109301_1325_1699	124
1639	3300046660	Ga0495625_0149264	Ga0495625_0149264_297_674	124
1640	3300046660	Ga0495625_0169367	Ga0495625_0169367_1021_1395	124
1641	3300046663	Ga0495635_0000177	Ga0495635_0000177_3377_3754	124
1642	3300046663	Ga0495635_0006529	Ga0495635_0006529_2769_3143	124
1643	3300046663	Ga0495635_0009548	Ga0495635_0009548_4610_4987	124
1644	3300046663	Ga0495635_0015706	Ga0495635_0015706_3276_3650	124
1645	3300046663	Ga0495635_0157829	Ga0495635_0157829_38_412	124
1646	3300046663	Ga0495635_0355151	Ga0495635_0355151_410_784	124
1647	3300046663	Ga0495635_0574441	Ga0495635_0574441_310_684	124
1648	3300046664	Ga0495659_0059710	Ga0495659_0059710_71_445	124
1649	3300046664	Ga0495659_0068356	Ga0495659_0068356_435_812	124
1650	3300046665	Ga0495661_0279310	Ga0495661_0279310_60_434	124
1651	3300046665	Ga0495661_0608421	Ga0495661_0608421_91_465	124
1652	3300046674	Ga0495588_0019750	Ga0495588_0019750_1201_1578	124
1653	3300046674	Ga0495588_0086996	Ga0495588_0086996_207_581	124
1654	3300046674	Ga0495588_0114572	Ga0495588_0114572_979_1353	124
1655	3300046674	Ga0495588_0626609	Ga0495588_0626609_14_391	124
1656	3300046675	Ga0495657_0022274	Ga0495657_0022274_1098_1475	124
1657	3300046675	Ga0495657_0034954	Ga0495657_0034954_1073_1447	124
1658	3300046675	Ga0495657_0040513	Ga0495657_0040513_2087_2461	124
1659	3300046675	Ga0495657_0061302	Ga0495657_0061302_1727_2101	124
1660	3300046675	Ga0495657_0159119	Ga0495657_0159119_912_1289	124
1661	3300046675	Ga0495657_0453023	Ga0495657_0453023_257_631	124
1662	3300046678	Ga0495599_0025353	Ga0495599_0025353_3269_3646	124
1663	3300046678	Ga0495599_0026199	Ga0495599_0026199_672_1046	124
1664	3300046678	Ga0495599_0038170	Ga0495599_0038170_2197_2571	124
1665	3300046678	Ga0495599_0134486	Ga0495599_0134486_956_1330	124
1666	3300046678	Ga0495599_0176683	Ga0495599_0176683_11_388	124
1667	3300046679	Ga0495623_0033428	Ga0495623_0033428_107_481	124
1668	3300046679	Ga0495623_0035782	Ga0495623_0035782_2673_3050	124
1669	3300046679	Ga0495623_0082190	Ga0495623_0082190_296_670	124
1670	3300046679	Ga0495623_0575690	Ga0495623_0575690_58_432	124
1671	3300046680	Ga0495646_0034160	Ga0495646_0034160_2534_2911	124
1672	3300046680	Ga0495646_0046032	Ga0495646_0046032_1138_1515	124
1673	3300046680	Ga0495646_0047265	Ga0495646_0047265_241_615	124
1674	3300046680	Ga0495646_0057809	Ga0495646_0057809_1258_1632	124
1675	3300046680	Ga0495646_0159777	Ga0495646_0159777_223_597	124
1676	3300046680	Ga0495646_0318664	Ga0495646_0318664_248_625	124
1677	3300046680	Ga0495646_0402022	Ga0495646_0402022_306_680	124
1678	3300046681	Ga0495647_0001377	Ga0495647_0001377_3589_3966	124
1679	3300046681	Ga0495647_0035883	Ga0495647_0035883_234_608	124
1680	3300046681	Ga0495647_0219952	Ga0495647_0219952_80_454	124
1681	3300046683	Ga0495658_0020599	Ga0495658_0020599_1028_1405	124
1682	3300046683	Ga0495658_0424644	Ga0495658_0424644_236_613	124
1683	3300046683	Ga0495658_0460166	Ga0495658_0460166_194_568	124
1684	3300046683	Ga0495658_0787464	Ga0495658_0787464_21_395	124
1685	3300046683	Ga0495658_0812894	Ga0495658_0812894_203_580	124
1686	3300046683	Ga0495658_0863334	Ga0495658_0863334_112_486	124
1687	3300046684	Ga0495669_0020093	Ga0495669_0020093_2265_2639	124
1688	3300046684	Ga0495669_0078976	Ga0495669_0078976_335_709	124
1689	3300046684	Ga0495669_0200177	Ga0495669_0200177_491_868	124
1690	3300046684	Ga0495669_0337946	Ga0495669_0337946_197_574	124
1691	3300046684	Ga0495669_0412764	Ga0495669_0412764_257_634	124
1692	3300046689	Ga0495613_0013047	Ga0495613_0013047_3679_4056	124
1693	3300046689	Ga0495613_0014360	Ga0495613_0014360_949_1323	124
1694	3300046689	Ga0495613_0082035	Ga0495613_0082035_1333_1707	124
1695	3300046689	Ga0495613_0127922	Ga0495613_0127922_876_1253	124
1696	3300046690	Ga0495624_0002351	Ga0495624_0002351_12310_12687	124
1697	3300046690	Ga0495624_0073549	Ga0495624_0073549_261_638	124
1698	3300046690	Ga0495624_0087007	Ga0495624_0087007_1205_1579	124
1699	3300046690	Ga0495624_0168348	Ga0495624_0168348_197_628	124
1700	3300046690	Ga0495624_0356473	Ga0495624_0356473_16_393	124
1701	3300046690	Ga0495624_0409751	Ga0495624_0409751_342_716	124
1702	3300046690	Ga0495624_0514198	Ga0495624_0514198_262_636	124
1703	3300046690	Ga0495624_0627652	Ga0495624_0627652_81_458	124
1704	3300046690	Ga0495624_0657035	Ga0495624_0657035_190_564	124
1705	3300046691	Ga0495670_0089146	Ga0495670_0089146_1145_1519	124
1706	3300046691	Ga0495670_0358334	Ga0495670_0358334_297_674	124
1707	3300046692	Ga0495671_0111840	Ga0495671_0111840_262_636	124
1708	3300046692	Ga0495671_0239690	Ga0495671_0239690_16_390	124
1709	3300046692	Ga0495671_0301453	Ga0495671_0301453_83_457	124
1710	3300046694	Ga0495649_0183678	Ga0495649_0183678_187_564	124
1711	3300046694	Ga0495649_0212344	Ga0495649_0212344_495_869	124
1712	3300046694	Ga0495649_0239331	Ga0495649_0239331_128_502	124
1713	3300046694	Ga0495649_0358992	Ga0495649_0358992_13_387	124
1714	3300046694	Ga0495649_0461445	Ga0495649_0461445_23_397	124
1715	3300046794	Ga0495589_0124440	Ga0495589_0124440_132_509	124
1716	3300046794	Ga0495589_0158468	Ga0495589_0158468_151_525	124
1717	3300046794	Ga0495589_0338586	Ga0495589_0338586_290_667	124
1718	3300046809	Ga0495600_0012765	Ga0495600_0012765_2116_2490	124
1719	3300046809	Ga0495600_0070618	Ga0495600_0070618_712_1089	124
1720	3300046809	Ga0495600_0084705	Ga0495600_0084705_1584_1958	124
1721	3300046809	Ga0495600_0160080	Ga0495600_0160080_261_638	124
1722	3300046809	Ga0495600_0582801	Ga0495600_0582801_181_561	124
1723	3300046809	Ga0495600_0622859	Ga0495600_0622859_171_545	124
1724	3300046810	Ga0495660_0164136	Ga0495660_0164136_328_705	124
1725	3300046810	Ga0495660_0334767	Ga0495660_0334767_78_452	124
1726	3300047315	Ga0495581_0000037	Ga0495581_0000037_21067_21444	124
1727	3300047315	Ga0495581_0045058	Ga0495581_0045058_361_735	124
1728	3300047315	Ga0495581_0133723	Ga0495581_0133723_17_391	124
1729	3300047315	Ga0495581_0272852	Ga0495581_0272852_124_498	124
1730	3300047315	Ga0495581_0448354	Ga0495581_0448354_229_603	124
1731	3300047315	Ga0495581_0477388	Ga0495581_0477388_161_589	124
1732	3300047315	Ga0495581_0691038	Ga0495581_0691038_18_395	124
1733	3300047317	Ga0495604_0001275	Ga0495604_0001275_10755_11129	124
1734	3300047317	Ga0495604_0032168	Ga0495604_0032168_3318_3692	124
1735	3300047317	Ga0495604_0082128	Ga0495604_0082128_1312_1686	124
1736	3300047317	Ga0495604_0113533	Ga0495604_0113533_482_859	124
1737	3300047317	Ga0495604_0635027	Ga0495604_0635027_253_627	124
1738	3300047317	Ga0495604_0647831	Ga0495604_0647831_245_619	124
1739	3300047317	Ga0495604_0728982	Ga0495604_0728982_34_408	124
1740	3300047318	Ga0495636_0018777	Ga0495636_0018777_1457_1834	124
1741	3300047319	Ga0495674_0000499	Ga0495674_0000499_20622_20999	124
1742	3300047319	Ga0495674_0044080	Ga0495674_0044080_809_1183	124
1743	3300047319	Ga0495674_0099678	Ga0495674_0099678_1301_1675	124
1744	3300047319	Ga0495674_0220872	Ga0495674_0220872_733_1107	124
1745	3300047319	Ga0495674_0818200	Ga0495674_0818200_91_465	124
1746	3300047319	Ga0495674_0868761	Ga0495674_0868761_185_562	124
1747	3300047319	Ga0495674_1010009	Ga0495674_1010009_156_533	124
1748	3300047319	Ga0495674_1106996	Ga0495674_1106996_127_501	124
1749	3300047320	Ga0495672_0013641	Ga0495672_0013641_3089_3463	124
1750	3300047320	Ga0495672_0028091	Ga0495672_0028091_2129_2503	124
1751	3300047320	Ga0495672_0258888	Ga0495672_0258888_68_442	124
1752	3300047321	Ga0495676_0069502	Ga0495676_0069502_789_1166	124
1753	3300047321	Ga0495676_0075034	Ga0495676_0075034_2028_2402	124
1754	3300047321	Ga0495676_0122334	Ga0495676_0122334_1098_1472	124
1755	3300047321	Ga0495676_0319451	Ga0495676_0319451_282_656	124
1756	3300047322	Ga0495680_0002074	Ga0495680_0002074_7689_8063	124
1757	3300047322	Ga0495680_0012270	Ga0495680_0012270_869_1246	124
1758	3300047322	Ga0495680_0624294	Ga0495680_0624294_37_411	124
1759	3300047323	Ga0495683_0265448	Ga0495683_0265448_43_417	124
1760	3300047443	Ga0495687_005403	Ga0495687_005403_5063_5437	124
1761	3300047443	Ga0495687_132493	Ga0495687_132493_108_482	124
1762	3300047444	Ga0495675_0015644	Ga0495675_0015644_2915_3289	124
1763	3300047444	Ga0495675_0037539	Ga0495675_0037539_1503_1877	124
1764	3300047444	Ga0495675_0294773	Ga0495675_0294773_145_522	124
1765	3300047469	Ga0495673_0032629	Ga0495673_0032629_615_989	124
1766	3300047469	Ga0495673_0040270	Ga0495673_0040270_1506_1880	124
1767	3300047469	Ga0495673_0057141	Ga0495673_0057141_1208_1582	124
1768	3300047469	Ga0495673_0172856	Ga0495673_0172856_320_694	124
1769	3300047469	Ga0495673_0207119	Ga0495673_0207119_67_444	124
1770	3300047470	Ga0495681_0146817	Ga0495681_0146817_364_741	124
1771	3300047471	Ga0495684_0021892	Ga0495684_0021892_2479_2856	124
1772	3300047471	Ga0495684_0023415	Ga0495684_0023415_282_656	124
1773	3300047471	Ga0495684_0040890	Ga0495684_0040890_3117_3491	124
1774	3300047471	Ga0495684_0174480	Ga0495684_0174480_122_499	124
1775	3300047472	Ga0495686_0025572	Ga0495686_0025572_204_581	124
1776	3300047472	Ga0495686_0056057	Ga0495686_0056057_563_937	124
1777	3300047472	Ga0495686_0124577	Ga0495686_0124577_345_719	124
1778	3300047472	Ga0495686_0530044	Ga0495686_0530044_112_486	124
1779	3300047472	Ga0495686_0550590	Ga0495686_0550590_173_547	124
1780	3300047673	Ga0495593_0000788	Ga0495593_0000788_7123_7500	124
1781	3300047673	Ga0495593_0026001	Ga0495593_0026001_2401_2775	124
1782	3300047673	Ga0495593_0551329	Ga0495593_0551329_176_550	124
1783	3300048088	Ga0495602_0027276	Ga0495602_0027276_2726_3100	124
1784	3300048088	Ga0495602_0036275	Ga0495602_0036275_2337_2714	124
1785	3300048088	Ga0495602_0055737	Ga0495602_0055737_863_1237	124
1786	3300048088	Ga0495602_0226551	Ga0495602_0226551_701_1078	124
1787	3300048088	Ga0495602_0546685	Ga0495602_0546685_369_752	124
1788	3300048088	Ga0495602_0767968	Ga0495602_0767968_107_484	124
1789	3300048089	Ga0495614_0007983	Ga0495614_0007983_1805_2182	124
1790	3300048089	Ga0495614_0176839	Ga0495614_0176839_105_479	124
1791	3300048091	Ga0495626_0125603	Ga0495626_0125603_697_1074	124
1792	3300048903	Ga0496100_0172101	Ga0496100_0172101_112_486	124
1793	3300048903	Ga0496100_0254003	Ga0496100_0254003_768_1145	124
1794	3300048903	Ga0496100_0369272	Ga0496100_0369272_419_793	124
1795	3300048903	Ga0496100_0948889	Ga0496100_0948889_234_611	124
1796	3300048903	Ga0496100_1056386	Ga0496100_1056386_245_619	124
1797	3300048903	Ga0496100_1182351	Ga0496100_1182351_132_506	124
1798	3300048904	Ga0496101_0034495	Ga0496101_0034495_2819_3193	124
1799	3300048904	Ga0496101_0073059	Ga0496101_0073059_900_1277	124
1800	3300048904	Ga0496101_0097237	Ga0496101_0097237_86_460	124
1801	3300048904	Ga0496101_0166163	Ga0496101_0166163_890_1264	124
1802	3300048904	Ga0496101_0202981	Ga0496101_0202981_1144_1518	124
1803	3300048904	Ga0496101_0257871	Ga0496101_0257871_368_742	124
1804	3300048904	Ga0496101_0364378	Ga0496101_0364378_410_787	124
1805	3300048904	Ga0496101_0832850	Ga0496101_0832850_32_409	124
1806	3300048904	Ga0496101_1006417	Ga0496101_1006417_72_449	124
1807	3300048904	Ga0496101_1471264	Ga0496101_1471264_100_474	124
1808	3300048905	Ga0496102_0008632	Ga0496102_0008632_4079_4453	124
1809	3300048905	Ga0496102_0031598	Ga0496102_0031598_2581_2955	124
1810	3300048905	Ga0496102_0034184	Ga0496102_0034184_1819_2193	124
1811	3300048905	Ga0496102_0244339	Ga0496102_0244339_108_485	124
1812	3300048905	Ga0496102_0547959	Ga0496102_0547959_498_875	124
1813	3300048905	Ga0496102_0583917	Ga0496102_0583917_83_457	124
1814	3300048905	Ga0496102_0800409	Ga0496102_0800409_365_742	124
1815	3300048905	Ga0496102_0806927	Ga0496102_0806927_174_551	124
1816	3300048905	Ga0496102_0866460	Ga0496102_0866460_161_538	124
1817	3300048905	Ga0496102_0901427	Ga0496102_0901427_40_417	124
1818	3300048905	Ga0496102_1318830	Ga0496102_1318830_158_535	124
1819	3300048905	Ga0496102_1327764	Ga0496102_1327764_15_389	124
1820	3300048905	Ga0496102_1931544	Ga0496102_1931544_98_472	124
1821	3300048906	Ga0496103_0016325	Ga0496103_0016325_18_392	124
1822	3300048906	Ga0496103_0021897	Ga0496103_0021897_1858_2232	124
1823	3300048906	Ga0496103_0091558	Ga0496103_0091558_732_1109	124
1824	3300048906	Ga0496103_0099128	Ga0496103_0099128_1324_1698	124
1825	3300048906	Ga0496103_0163739	Ga0496103_0163739_942_1319	124
1826	3300048906	Ga0496103_0204316	Ga0496103_0204316_155_529	124
1827	3300048906	Ga0496103_1048926	Ga0496103_1048926_116_493	124
1828	3300048907	Ga0496104_0006539	Ga0496104_0006539_1845_2219	124
1829	3300048907	Ga0496104_0026608	Ga0496104_0026608_14_388	124
1830	3300048907	Ga0496104_0038269	Ga0496104_0038269_369_743	124
1831	3300048907	Ga0496104_0065283	Ga0496104_0065283_365_739	124
1832	3300048907	Ga0496104_0111824	Ga0496104_0111824_501_878	124
1833	3300048907	Ga0496104_0428072	Ga0496104_0428072_225_602	124
1834	3300048907	Ga0496104_0453629	Ga0496104_0453629_26_403	124
1835	3300048907	Ga0496104_0781154	Ga0496104_0781154_193_567	124
1836	3300048907	Ga0496104_1050514	Ga0496104_1050514_99_476	124
1837	3300048908	Ga0496105_0002455	Ga0496105_0002455_8638_9012	124
1838	3300048908	Ga0496105_0030325	Ga0496105_0030325_1810_2184	124
1839	3300048908	Ga0496105_0068881	Ga0496105_0068881_2178_2552	124
1840	3300048908	Ga0496105_0076262	Ga0496105_0076262_1371_1745	124
1841	3300048908	Ga0496105_0141871	Ga0496105_0141871_24_398	124
1842	3300048908	Ga0496105_0275439	Ga0496105_0275439_463_840	124
1843	3300048908	Ga0496105_0277270	Ga0496105_0277270_148_522	124
1844	3300048908	Ga0496105_0318447	Ga0496105_0318447_234_611	124
1845	3300048908	Ga0496105_0320552	Ga0496105_0320552_351_728	124
1846	3300048908	Ga0496105_0393622	Ga0496105_0393622_495_917	124
1847	3300048909	Ga0496106_0001534	Ga0496106_0001534_2383_2760	124
1848	3300048909	Ga0496106_0001995	Ga0496106_0001995_1212_1589	124
1849	3300048909	Ga0496106_0008795	Ga0496106_0008795_571_945	124
1850	3300048909	Ga0496106_0094308	Ga0496106_0094308_633_1007	124
1851	3300048909	Ga0496106_0191670	Ga0496106_0191670_132_506	124
1852	3300048909	Ga0496106_0224828	Ga0496106_0224828_167_544	124
1853	3300048909	Ga0496106_0340270	Ga0496106_0340270_298_675	124
1854	3300048909	Ga0496106_1201034	Ga0496106_1201034_176_553	124
1855	3300048910	Ga0496107_0022069	Ga0496107_0022069_3393_3767	124
1856	3300048910	Ga0496107_0034750	Ga0496107_0034750_189_563	124
1857	3300048910	Ga0496107_0036678	Ga0496107_0036678_238_612	124
1858	3300048910	Ga0496107_0046141	Ga0496107_0046141_330_707	124
1859	3300048910	Ga0496107_0308158	Ga0496107_0308158_87_464	124
1860	3300048910	Ga0496107_0843143	Ga0496107_0843143_168_545	124
1861	3300048910	Ga0496107_1060387	Ga0496107_1060387_133_510	124
1862	3300048911	Ga0496108_0000438	Ga0496108_0000438_19356_19733	124
1863	3300048911	Ga0496108_0012472	Ga0496108_0012472_1435_1857	124
1864	3300048911	Ga0496108_0021757	Ga0496108_0021757_3887_4261	124
1865	3300048911	Ga0496108_0038372	Ga0496108_0038372_3001_3378	124
1866	3300048911	Ga0496108_0122384	Ga0496108_0122384_340_717	124
1867	3300048911	Ga0496108_0137500	Ga0496108_0137500_89_463	124
1868	3300048911	Ga0496108_0173021	Ga0496108_0173021_111_485	124
1869	3300048911	Ga0496108_0798319	Ga0496108_0798319_331_708	124
1870	3300048911	Ga0496108_0819284	Ga0496108_0819284_368_742	124
1871	3300048911	Ga0496108_1114671	Ga0496108_1114671_45_422	124
1872	3300048911	Ga0496108_1184649	Ga0496108_1184649_72_446	124
1873	3300048912	Ga0496109_0000284	Ga0496109_0000284_19181_19558	124
1874	3300048912	Ga0496109_0043538	Ga0496109_0043538_49_423	124
1875	3300048912	Ga0496109_0470010	Ga0496109_0470010_464_838	124
1876	3300048912	Ga0496109_0694018	Ga0496109_0694018_334_711	124
1877	3300048912	Ga0496109_0992224	Ga0496109_0992224_230_604	124
1878	3300048912	Ga0496109_1083057	Ga0496109_1083057_41_418	124
1879	3300048912	Ga0496109_1658805	Ga0496109_1658805_130_504	124
1880	3300048912	Ga0496109_1911874	Ga0496109_1911874_34_408	124
1881	3300048913	Ga0496110_0062056	Ga0496110_0062056_533_907	124
1882	3300048913	Ga0496110_0068029	Ga0496110_0068029_2453_2827	124
1883	3300048913	Ga0496110_0102891	Ga0496110_0102891_93_467	124
1884	3300048913	Ga0496110_0273785	Ga0496110_0273785_1037_1414	124
1885	3300048913	Ga0496110_0624415	Ga0496110_0624415_255_632	124
1886	3300048913	Ga0496110_0757704	Ga0496110_0757704_447_821	124
1887	3300048913	Ga0496110_0859952	Ga0496110_0859952_245_619	124
1888	3300048914	Ga0496111_0081890	Ga0496111_0081890_1791_2165	124
1889	3300048914	Ga0496111_0119147	Ga0496111_0119147_355_732	124
1890	3300048914	Ga0496111_0152057	Ga0496111_0152057_138_512	124
1891	3300048914	Ga0496111_0169557	Ga0496111_0169557_762_1139	124
1892	3300048914	Ga0496111_0270613	Ga0496111_0270613_78_455	124
1893	3300048914	Ga0496111_0790167	Ga0496111_0790167_59_481	124
1894	3300048914	Ga0496111_1160158	Ga0496111_1160158_50_424	124
1895	3300048915	Ga0496112_0000585	Ga0496112_0000585_24241_24618	124
1896	3300048915	Ga0496112_0080259	Ga0496112_0080259_2235_2612	124
1897	3300048915	Ga0496112_0120515	Ga0496112_0120515_1153_1530	124
1898	3300048915	Ga0496112_0166442	Ga0496112_0166442_642_1016	124
1899	3300048915	Ga0496112_0230290	Ga0496112_0230290_392_814	124
1900	3300048915	Ga0496112_0266633	Ga0496112_0266633_1017_1427	124
1901	3300048915	Ga0496112_0284172	Ga0496112_0284172_402_776	124
1902	3300048915	Ga0496112_0405137	Ga0496112_0405137_531_905	124
1903	3300048915	Ga0496112_0490151	Ga0496112_0490151_394_771	124
1904	3300048915	Ga0496112_0697194	Ga0496112_0697194_515_889	124
1905	3300048915	Ga0496112_1235688	Ga0496112_1235688_250_624	124
1906	3300048915	Ga0496112_1584877	Ga0496112_1584877_96_470	124
1907	3300048916	Ga0496113_0011026	Ga0496113_0011026_5393_5770	124
1908	3300048916	Ga0496113_0026614	Ga0496113_0026614_1603_1977	124
1909	3300048916	Ga0496113_0055086	Ga0496113_0055086_649_1026	124
1910	3300048916	Ga0496113_0118555	Ga0496113_0118555_1582_1956	124
1911	3300048916	Ga0496113_0136247	Ga0496113_0136247_21_395	124
1912	3300048916	Ga0496113_0312959	Ga0496113_0312959_202_576	124
1913	3300048916	Ga0496113_0338225	Ga0496113_0338225_25_399	124
1914	3300048916	Ga0496113_0627021	Ga0496113_0627021_365_739	124
1915	3300048917	Ga0496114_0009020	Ga0496114_0009020_2342_2716	124
1916	3300048917	Ga0496114_0064801	Ga0496114_0064801_830_1204	124
1917	3300048917	Ga0496114_0156134	Ga0496114_0156134_979_1356	124
1918	3300048917	Ga0496114_0324333	Ga0496114_0324333_816_1190	124
1919	3300048917	Ga0496114_0325866	Ga0496114_0325866_887_1261	124
1920	3300048917	Ga0496114_0426291	Ga0496114_0426291_14_391	124
1921	3300048917	Ga0496114_0471420	Ga0496114_0471420_53_430	124
1922	3300048917	Ga0496114_0528635	Ga0496114_0528635_122_499	124
1923	3300048917	Ga0496114_0904625	Ga0496114_0904625_365_742	124
1924	3300048917	Ga0496114_1412965	Ga0496114_1412965_31_408	124
1925	3300048917	Ga0496114_1450629	Ga0496114_1450629_25_402	124
1926	3300048917	Ga0496114_1451630	Ga0496114_1451630_66_440	124
1927	3300048918	Ga0496115_0011183	Ga0496115_0011183_567_941	124
1928	3300048918	Ga0496115_0016440	Ga0496115_0016440_161_538	124
1929	3300048918	Ga0496115_0029989	Ga0496115_0029989_1434_1811	124
1930	3300048918	Ga0496115_0169678	Ga0496115_0169678_1328_1705	124
1931	3300048918	Ga0496115_0188253	Ga0496115_0188253_31_426	124
1932	3300048918	Ga0496115_0274322	Ga0496115_0274322_237_614	124
1933	3300048918	Ga0496115_0419143	Ga0496115_0419143_237_614	124
1934	3300048918	Ga0496115_0470202	Ga0496115_0470202_349_726	124
1935	3300048918	Ga0496115_0586665	Ga0496115_0586665_11_388	124
1936	3300048918	Ga0496115_0691757	Ga0496115_0691757_46_420	124
1937	3300048919	Ga0496116_0001323	Ga0496116_0001323_26889_27266	124
1938	3300048919	Ga0496116_0024301	Ga0496116_0024301_344_718	124
1939	3300048919	Ga0496116_0066599	Ga0496116_0066599_1082_1459	124
1940	3300048919	Ga0496116_0163623	Ga0496116_0163623_483_857	124
1941	3300048920	Ga0496117_0020401	Ga0496117_0020401_2917_3294	124
1942	3300048920	Ga0496117_0165583	Ga0496117_0165583_430_807	124
1943	3300048920	Ga0496117_0174216	Ga0496117_0174216_210_587	124
1944	3300048920	Ga0496117_0195291	Ga0496117_0195291_630_1004	124
1945	3300048920	Ga0496117_0218397	Ga0496117_0218397_502_879	124
1946	3300048920	Ga0496117_0302647	Ga0496117_0302647_87_494	124
1947	3300048921	Ga0496118_0026908	Ga0496118_0026908_71_445	124
1948	3300048921	Ga0496118_0040210	Ga0496118_0040210_1223_1597	124
1949	3300048921	Ga0496118_0063552	Ga0496118_0063552_739_1113	124
1950	3300048921	Ga0496118_0101173	Ga0496118_0101173_1118_1492	124
1951	3300048921	Ga0496118_0491690	Ga0496118_0491690_157_531	124
1952	3300048921	Ga0496118_0507052	Ga0496118_0507052_183_560	124
1953	3300048921	Ga0496118_0613146	Ga0496118_0613146_127_504	124
1954	3300048922	Ga0496119_0017786	Ga0496119_0017786_3536_3910	124
1955	3300048922	Ga0496119_0082087	Ga0496119_0082087_544_918	124
1956	3300048922	Ga0496119_0104400	Ga0496119_0104400_1099_1473	124
1957	3300048923	Ga0496120_0021553	Ga0496120_0021553_2304_2678	124
1958	3300048923	Ga0496120_0030676	Ga0496120_0030676_2805_3179	124
1959	3300048923	Ga0496120_0415894	Ga0496120_0415894_153_530	124
1960	3300048923	Ga0496120_0470335	Ga0496120_0470335_121_495	124
1961	3300048923	Ga0496120_0473539	Ga0496120_0473539_90_467	124
1962	3300048924	Ga0496121_0000571	Ga0496121_0000571_16808_17185	124
1963	3300048924	Ga0496121_0002044	Ga0496121_0002044_14415_14792	124
1964	3300048924	Ga0496121_0046990	Ga0496121_0046990_1509_1883	124
1965	3300048924	Ga0496121_0048870	Ga0496121_0048870_1102_1476	124
1966	3300048924	Ga0496121_0067890	Ga0496121_0067890_58_432	124
1967	3300048924	Ga0496121_0090764	Ga0496121_0090764_1909_2283	124
1968	3300048924	Ga0496121_0123962	Ga0496121_0123962_500_874	124
1969	3300048924	Ga0496121_0164217	Ga0496121_0164217_258_632	124
1970	3300048924	Ga0496121_0171718	Ga0496121_0171718_356_733	124
1971	3300048924	Ga0496121_0184348	Ga0496121_0184348_677_1084	124
1972	3300048924	Ga0496121_0319909	Ga0496121_0319909_654_1031	124
1973	3300048925	Ga0496122_0154627	Ga0496122_0154627_575_961	124
1974	3300048925	Ga0496122_0616011	Ga0496122_0616011_82_456	124
1975	3300048926	Ga0496123_0144677	Ga0496123_0144677_494_871	124
1976	3300048926	Ga0496123_0255727	Ga0496123_0255727_130_516	124
1977	3300048927	Ga0496124_0001685	Ga0496124_0001685_11242_11619	124
1978	3300048927	Ga0496124_0026981	Ga0496124_0026981_299_679	124
1979	3300048927	Ga0496124_0218072	Ga0496124_0218072_177_551	124
1980	3300048927	Ga0496124_0256693	Ga0496124_0256693_779_1153	124
1981	3300048927	Ga0496124_0281504	Ga0496124_0281504_682_1065	124
1982	3300048927	Ga0496124_0654888	Ga0496124_0654888_143_517	124
1983	3300048928	Ga0496125_0032494	Ga0496125_0032494_2338_2715	124
1984	3300048928	Ga0496125_0035490	Ga0496125_0035490_529_903	124
1985	3300048928	Ga0496125_0059320	Ga0496125_0059320_1716_2093	124
1986	3300048928	Ga0496125_0125905	Ga0496125_0125905_1151_1528	124
1987	3300048928	Ga0496125_0224641	Ga0496125_0224641_445_825	124
1988	3300048928	Ga0496125_0315102	Ga0496125_0315102_232_606	124
1989	3300048928	Ga0496125_0389906	Ga0496125_0389906_101_478	124
1990	3300048928	Ga0496125_0677463	Ga0496125_0677463_29_409	124
1991	3300048929	Ga0496126_0008735	Ga0496126_0008735_610_987	124
1992	3300048929	Ga0496126_0009779	Ga0496126_0009779_8359_8733	124
1993	3300048929	Ga0496126_0018550	Ga0496126_0018550_4760_5137	124
1994	3300048929	Ga0496126_0029020	Ga0496126_0029020_3020_3394	124
1995	3300048929	Ga0496126_0031671	Ga0496126_0031671_864_1238	124
1996	3300048929	Ga0496126_0057210	Ga0496126_0057210_2279_2656	124
1997	3300048929	Ga0496126_0070626	Ga0496126_0070626_304_681	124
1998	3300048929	Ga0496126_0113186	Ga0496126_0113186_538_912	124
1999	3300048929	Ga0496126_0134639	Ga0496126_0134639_823_1200	124
2000	3300048929	Ga0496126_0149842	Ga0496126_0149842_145_519	124
2001	3300048929	Ga0496126_0173234	Ga0496126_0173234_906_1283	124
2002	3300048929	Ga0496126_0255562	Ga0496126_0255562_509_886	124
2003	3300048929	Ga0496126_0270092	Ga0496126_0270092_632_1009	124
2004	3300048929	Ga0496126_0349641	Ga0496126_0349641_793_1167	124
2005	3300048929	Ga0496126_0354741	Ga0496126_0354741_810_1187	124
2006	3300048929	Ga0496126_0413529	Ga0496126_0413529_610_984	124
2007	3300048929	Ga0496126_0419294	Ga0496126_0419294_666_1043	124
2008	3300048929	Ga0496126_0522253	Ga0496126_0522253_520_894	124
2009	3300048929	Ga0496126_0562359	Ga0496126_0562359_179_556	124
2010	3300048929	Ga0496126_0675228	Ga0496126_0675228_302_679	124
2011	3300048929	Ga0496126_0795270	Ga0496126_0795270_302_709	124
2012	3300048929	Ga0496126_0979244	Ga0496126_0979244_128_505	124
2013	3300048929	Ga0496126_1193529	Ga0496126_1193529_26_400	124
2014	3300048929	Ga0496126_1239175	Ga0496126_1239175_121_498	124
2015	3300049459	Ga0495678_154151	Ga0495678_154151_62_436	124
2016	3300049460	Ga0495682_0358164	Ga0495682_0358164_11_385	124
2017	3300049569	Ga0501032_0059108	Ga0501032_0059108_972_1352	124
2018	3300049569	Ga0501032_0274914	Ga0501032_0274914_165_575	124
2019	3300049569	Ga0501032_0972893	Ga0501032_0972893_84_461	124
2020	3300049570	Ga0501033_0220433	Ga0501033_0220433_674_1054	124
2021	3300049570	Ga0501033_0273525	Ga0501033_0273525_107_487	124
2022	3300049570	Ga0501033_0278441	Ga0501033_0278441_771_1145	124
2023	3300049571	Ga0501034_0405199	Ga0501034_0405199_579_989	124
2024	3300049571	Ga0501034_0767732	Ga0501034_0767732_111_491	124
2025	3300049572	Ga0501036_0124859	Ga0501036_0124859_1555_1935	124
2026	3300049572	Ga0501036_0166110	Ga0501036_0166110_149_526	124
2027	3300049572	Ga0501036_0850474	Ga0501036_0850474_359_736	124
2028	3300049574	Ga0501038_0061479	Ga0501038_0061479_606_983	124
2029	3300049574	Ga0501038_0222174	Ga0501038_0222174_215_595	124
2030	3300049574	Ga0501038_0744438	Ga0501038_0744438_327_704	124
2031	3300049576	Ga0501040_0399717	Ga0501040_0399717_324_701	124
2032	3300049577	Ga0501041_0197103	Ga0501041_0197103_218_595	124
2033	3300049579	Ga0501043_0048149	Ga0501043_0048149_2025_2405	124
2034	3300049579	Ga0501043_0251060	Ga0501043_0251060_379_759	124
2035	3300049579	Ga0501043_0306881	Ga0501043_0306881_632_1042	124
2036	3300049580	Ga0501046_0036129	Ga0501046_0036129_3398_3772	124
2037	3300049580	Ga0501046_0519479	Ga0501046_0519479_211_591	124
2038	3300049581	Ga0501047_0002848	Ga0501047_0002848_6149_6523	124
2039	3300049581	Ga0501047_0077773	Ga0501047_0077773_1479_1856	124
2040	3300049581	Ga0501047_0467581	Ga0501047_0467581_82_462	124
2041	3300049582	Ga0501048_0254235	Ga0501048_0254235_779_1174	124
2042	3300049582	Ga0501048_0362458	Ga0501048_0362458_49_423	124
2043	3300049582	Ga0501048_0495041	Ga0501048_0495041_198_575	124
2044	3300049583	Ga0501067_0032060	Ga0501067_0032060_1003_1383	124
2045	3300049583	Ga0501067_0074398	Ga0501067_0074398_930_1307	124
2046	3300049584	Ga0501068_0124797	Ga0501068_0124797_58_438	124
2047	3300049585	Ga0501069_0286967	Ga0501069_0286967_400_780	124
2048	3300049586	Ga0501070_0146861	Ga0501070_0146861_198_578	124
2049	3300049586	Ga0501070_0660192	Ga0501070_0660192_414_791	124
2050	3300049587	Ga0501071_0056899	Ga0501071_0056899_1807_2184	124
2051	3300049589	Ga0501073_0043252	Ga0501073_0043252_1620_1994	124
2052	3300049589	Ga0501073_0073690	Ga0501073_0073690_697_1089	124
2053	3300049589	Ga0501073_0219916	Ga0501073_0219916_684_1064	124
2054	3300049589	Ga0501073_0334837	Ga0501073_0334837_586_963	124
2055	3300049590	Ga0501074_0005315	Ga0501074_0005315_3532_3906	124
2056	3300049741	Ga0501079_0307239	Ga0501079_0307239_485_862	124
2057	3300049741	Ga0501079_0410878	Ga0501079_0410878_197_577	124
2058	3300049742	Ga0501080_0006064	Ga0501080_0006064_6320_6694	124
2059	3300049742	Ga0501080_0311423	Ga0501080_0311423_325_702	124
2060	3300049742	Ga0501080_0468873	Ga0501080_0468873_267_647	124
2061	3300049743	Ga0501081_0257903	Ga0501081_0257903_87_464	124
2062	3300049744	Ga0501083_0860449	Ga0501083_0860449_34_426	124
2063	3300049822	Ga0501035_0136353	Ga0501035_0136353_859_1269	124
2064	3300049822	Ga0501035_0632365	Ga0501035_0632365_229_606	124
2065	3300049822	Ga0501035_0764179	Ga0501035_0764179_157_537	124
2066	3300049823	Ga0501044_0016124	Ga0501044_0016124_2780_3154	124
2067	3300049823	Ga0501044_0049800	Ga0501044_0049800_3272_3652	124
2068	3300049823	Ga0501044_0179696	Ga0501044_0179696_1515_1895	124
2069	3300049823	Ga0501044_0652166	Ga0501044_0652166_186_566	124
2070	3300049824	Ga0501045_0619580	Ga0501045_0619580_127_507	124
2071	3300050489	nmdc:mga03683_286311_c1	nmdc:mga03683_286311_c1_229_633	124
2072	3300050489	nmdc:mga03683_30854_c1	nmdc:mga03683_30854_c1_1279_1656	124
2073	3300050489	nmdc:mga03683_479326_c1	nmdc:mga03683_479326_c1_152_529	124
2074	3300050490	nmdc:mga03n38_188992_c1	nmdc:mga03n38_188992_c1_301_675	124
2075	3300050490	nmdc:mga03n38_34172_c1	nmdc:mga03n38_34172_c1_535_909	124
2076	3300050490	nmdc:mga03n38_434546_c1	nmdc:mga03n38_434546_c1_138_515	124
2077	3300050490	nmdc:mga03n38_45365_c1	nmdc:mga03n38_45365_c1_359_763	124
2078	3300050491	nmdc:mga00v17_278308_c1	nmdc:mga00v17_278308_c1_362_736	124
2079	3300050491	nmdc:mga00v17_317595_c1	nmdc:mga00v17_317595_c1_565_939	124
2080	3300050491	nmdc:mga00v17_431530_c1	nmdc:mga00v17_431530_c1_60_437	124
2081	3300050491	nmdc:mga00v17_616155_c1	nmdc:mga00v17_616155_c1_109_483	124
2082	3300050491	nmdc:mga00v17_756718_c1	nmdc:mga00v17_756718_c1_212_589	124
2083	3300050491	nmdc:mga00v17_76573_c1	nmdc:mga00v17_76573_c1_314_688	124
2084	3300050492	nmdc:mga0yw44_12384_c1	nmdc:mga0yw44_12384_c1_1791_2165	124
2085	3300050492	nmdc:mga0yw44_172237_c1	nmdc:mga0yw44_172237_c1_322_699	124
2086	3300050492	nmdc:mga0yw44_190475_c1	nmdc:mga0yw44_190475_c1_772_1149	124
2087	3300050492	nmdc:mga0yw44_693367_c1	nmdc:mga0yw44_693367_c1_158_532	124
2088	3300050493	nmdc:mga0k408_251209_c1	nmdc:mga0k408_251209_c1_650_1024	124
2089	3300050493	nmdc:mga0k408_578034_c1	nmdc:mga0k408_578034_c1_274_651	124
2090	3300050494	nmdc:mga06z11_182981_c1	nmdc:mga06z11_182981_c1_584_958	124
2091	3300050494	nmdc:mga06z11_19827_c1	nmdc:mga06z11_19827_c1_988_1362	124
2092	3300050494	nmdc:mga06z11_282421_c1	nmdc:mga06z11_282421_c1_315_692	124
2093	3300050494	nmdc:mga06z11_363165_c1	nmdc:mga06z11_363165_c1_90_464	124
2094	3300050494	nmdc:mga06z11_47647_c1	nmdc:mga06z11_47647_c1_826_1200	124
2095	3300050494	nmdc:mga06z11_54694_c1	nmdc:mga06z11_54694_c1_796_1173	124
2096	3300050494	nmdc:mga06z11_768576_c1	nmdc:mga06z11_768576_c1_93_470	124
2097	3300050495	nmdc:mga04h51_130708_c1	nmdc:mga04h51_130708_c1_371_748	124
2098	3300050495	nmdc:mga04h51_239723_c1	nmdc:mga04h51_239723_c1_12_386	124
2099	3300050495	nmdc:mga04h51_92585_c1	nmdc:mga04h51_92585_c1_28_402	124
2100	3300050496	nmdc:mga07m45_200312_c1	nmdc:mga07m45_200312_c1_336_710	124
2101	3300050496	nmdc:mga07m45_239927_c1	nmdc:mga07m45_239927_c1_381_755	124
2102	3300050496	nmdc:mga07m45_266390_c1	nmdc:mga07m45_266390_c1_403_780	124
2103	3300050496	nmdc:mga07m45_275749_c1	nmdc:mga07m45_275749_c1_284_661	124
2104	3300050496	nmdc:mga07m45_28602_c1	nmdc:mga07m45_28602_c1_406_783	124
2105	3300050496	nmdc:mga07m45_29520_c1	nmdc:mga07m45_29520_c1_193_570	124
2106	3300050496	nmdc:mga07m45_529485_c1	nmdc:mga07m45_529485_c1_52_426	124
2107	3300050507	nmdc:mga05p37_48772_c1	nmdc:mga05p37_48772_c1_1245_1622	124
2108	3300050509	nmdc:mga0qj67_1096168_c1	nmdc:mga0qj67_1096168_c1_226_603	124
2109	3300050510	nmdc:mga06r32_53540_c1	nmdc:mga06r32_53540_c1_1102_1476	124
2110	3300050511	nmdc:mga08y16_300083_c1	nmdc:mga08y16_300083_c1_1163_1540	124
2111	3300050511	nmdc:mga08y16_718715_c1	nmdc:mga08y16_718715_c1_537_911	124
2112	3300050511	nmdc:mga08y16_978873_c1	nmdc:mga08y16_978873_c1_123_500	124
2113	3300050512	nmdc:mga0n895_105804_c1	nmdc:mga0n895_105804_c1_251_625	124
2114	3300050512	nmdc:mga0n895_189953_c1	nmdc:mga0n895_189953_c1_423_800	124
2115	3300050512	nmdc:mga0n895_2721_c1	nmdc:mga0n895_2721_c1_3749_4123	124
2116	3300050512	nmdc:mga0n895_321200_c1	nmdc:mga0n895_321200_c1_23_400	124
2117	3300050513	nmdc:mga0rr50_1083035_c1	nmdc:mga0rr50_1083035_c1_194_589	124
2118	3300050513	nmdc:mga0rr50_44122_c1	nmdc:mga0rr50_44122_c1_2610_2984	124
2119	3300050513	nmdc:mga0rr50_701828_c1	nmdc:mga0rr50_701828_c1_168_545	124
2120	3300050513	nmdc:mga0rr50_861669_c1	nmdc:mga0rr50_861669_c1_271_645	124
2121	3300050514	nmdc:mga08x19_498553_c1	nmdc:mga08x19_498553_c1_23_400	124
2122	3300050514	nmdc:mga08x19_77858_c1	nmdc:mga08x19_77858_c1_465_839	124
2123	3300050516	nmdc:mga0sz30_280780_c1	nmdc:mga0sz30_280780_c1_318_695	124
2124	3300050516	nmdc:mga0sz30_88030_c1	nmdc:mga0sz30_88030_c1_173_550	124
2125	3300053077	Ga0495601_0035735	Ga0495601_0035735_633_1007	124
2126	3300053077	Ga0495601_0040201	Ga0495601_0040201_80_454	124
2127	3300053077	Ga0495601_0091902	Ga0495601_0091902_54_428	124
2128	3300053077	Ga0495601_0093583	Ga0495601_0093583_1006_1383	124
2129	3300053077	Ga0495601_0122638	Ga0495601_0122638_430_807	124
2130	3300053077	Ga0495601_0125618	Ga0495601_0125618_105_482	124
2131	3300053077	Ga0495601_0269962	Ga0495601_0269962_581_958	124
2132	3300053077	Ga0495601_0704688	Ga0495601_0704688_175_549	124
2133	3300053077	Ga0495601_0869703	Ga0495601_0869703_32_409	124
2134	3300053078	Ga0495612_0006146	Ga0495612_0006146_571_945	124
2135	3300053078	Ga0495612_0076662	Ga0495612_0076662_194_571	124
2136	3300053078	Ga0495612_0109677	Ga0495612_0109677_773_1147	124
2137	3300053078	Ga0495612_0384480	Ga0495612_0384480_179_556	124
2138	3300053080	Ga0500635_0016395	Ga0500635_0016395_1558_1935	124
2139	3300053080	Ga0500635_0025320	Ga0500635_0025320_660_1037	124
2140	3300053080	Ga0500635_0089583	Ga0500635_0089583_180_557	124
2141	3300053083	Ga0495655_0130740	Ga0495655_0130740_319_693	124
2142	3300053083	Ga0495655_0356130	Ga0495655_0356130_82_456	124
2143	3300053084	Ga0495595_0015891	Ga0495595_0015891_26_403	124
2144	3300053084	Ga0495595_0016609	Ga0495595_0016609_236_610	124
2145	3300053084	Ga0495595_0147656	Ga0495595_0147656_29_412	124
2146	3300053085	Ga0495619_0080775	Ga0495619_0080775_733_1107	124
2147	3300053085	Ga0495619_0120706	Ga0495619_0120706_21_395	124
2148	3300053085	Ga0495619_0227205	Ga0495619_0227205_585_968	124
2149	3300053085	Ga0495619_0382003	Ga0495619_0382003_580_957	124
2150	3300053085	Ga0495619_0520388	Ga0495619_0520388_52_483	124
2151	3300053085	Ga0495619_0884681	Ga0495619_0884681_62_436	124
2152	3300053085	Ga0495619_0948984	Ga0495619_0948984_132_506	124
2153	3300053086	Ga0500578_0122394	Ga0500578_0122394_1144_1521	124
2154	3300053086	Ga0500578_0139550	Ga0500578_0139550_579_953	124
2155	3300053087	Ga0500643_000028	Ga0500643_000028_217179_217553	124
2156	3300053087	Ga0500643_036793	Ga0500643_036793_756_1130	124
2157	3300053088	Ga0500644_0067991	Ga0500644_0067991_655_1032	124
2158	3300053088	Ga0500644_0116428	Ga0500644_0116428_566_943	124
2159	3300053088	Ga0500644_0259831	Ga0500644_0259831_90_464	124
2160	3300053091	Ga0500647_0091934	Ga0500647_0091934_1066_1440	124
2161	3300053092	Ga0500583_0036746	Ga0500583_0036746_528_902	124
2162	3300053092	Ga0500583_0161888	Ga0500583_0161888_249_626	124
2163	3300053093	Ga0500651_0059720	Ga0500651_0059720_750_1127	124
2164	3300053093	Ga0500651_0229155	Ga0500651_0229155_343_720	124
2165	3300053094	Ga0500566_0000351	Ga0500566_0000351_5618_5992	124
2166	3300053094	Ga0500566_0000748	Ga0500566_0000748_13880_14257	124
2167	3300053094	Ga0500566_0000805	Ga0500566_0000805_7562_7939	124
2168	3300053094	Ga0500566_0040219	Ga0500566_0040219_129_506	124
2169	3300053094	Ga0500566_0152017	Ga0500566_0152017_771_1148	124
2170	3300053095	Ga0500640_000160	Ga0500640_000160_2059_2436	124
2171	3300053095	Ga0500640_008838	Ga0500640_008838_783_1157	124
2172	3300053096	Ga0500641_0019232	Ga0500641_0019232_1271_1645	124
2173	3300053096	Ga0500641_0033909	Ga0500641_0033909_92_469	124
2174	3300053096	Ga0500641_0034964	Ga0500641_0034964_1448_1825	124
2175	3300053097	Ga0500648_276319	Ga0500648_276319_287_664	124
2176	3300053098	Ga0500650_0424858	Ga0500650_0424858_106_483	124
2177	3300053102	Ga0500554_000880	Ga0500554_000880_3870_4247	124
2178	3300053102	Ga0500554_009167	Ga0500554_009167_1930_2304	124
2179	3300053103	Ga0500555_001161	Ga0500555_001161_1309_1683	124
2180	3300053104	Ga0500556_0003427	Ga0500556_0003427_3985_4359	124
2181	3300053105	Ga0500557_000188	Ga0500557_000188_12_386	124
2182	3300053106	Ga0500558_154518	Ga0500558_154518_379_756	124
2183	3300053108	Ga0500562_010404	Ga0500562_010404_1797_2171	124
2184	3300053109	Ga0500569_003580	Ga0500569_003580_2753_3127	124
2185	3300053109	Ga0500569_125030	Ga0500569_125030_380_754	124
2186	3300053111	Ga0500572_000802	Ga0500572_000802_5446_5820	124
2187	3300053111	Ga0500572_001393	Ga0500572_001393_2818_3195	124
2188	3300053112	Ga0500575_167463	Ga0500575_167463_121_498	124
2189	3300053114	Ga0500582_231104	Ga0500582_231104_223_597	124
2190	3300053115	Ga0500591_013535	Ga0500591_013535_730_1107	124
2191	3300053116	Ga0500592_002927	Ga0500592_002927_1430_1804	124
2192	3300053118	Ga0500594_0104232	Ga0500594_0104232_467_844	124
2193	3300053119	Ga0500595_000141	Ga0500595_000141_14237_14611	124
2194	3300053119	Ga0500595_004565	Ga0500595_004565_1485_1859	124
2195	3300053119	Ga0500595_008908	Ga0500595_008908_3396_3773	124
2196	3300053119	Ga0500595_022398	Ga0500595_022398_1256_1630	124
2197	3300053119	Ga0500595_156506	Ga0500595_156506_222_596	124
2198	3300053120	Ga0500597_179602	Ga0500597_179602_337_714	124
2199	3300053121	Ga0500607_039518	Ga0500607_039518_601_975	124
2200	3300053122	Ga0500608_026925	Ga0500608_026925_460_837	124
2201	3300053122	Ga0500608_039171	Ga0500608_039171_685_1062	124
2202	3300053122	Ga0500608_056386	Ga0500608_056386_17_391	124
2203	3300053122	Ga0500608_314637	Ga0500608_314637_79_453	124
2204	3300053123	Ga0500614_003628	Ga0500614_003628_1119_1496	124
2205	3300053123	Ga0500614_010756	Ga0500614_010756_1200_1574	124
2206	3300053125	Ga0500618_001915	Ga0500618_001915_4158_4535	124
2207	3300053126	Ga0500621_111173	Ga0500621_111173_651_1025	124
2208	3300053126	Ga0500621_248181	Ga0500621_248181_190_564	124
2209	3300053130	Ga0500642_0000174	Ga0500642_0000174_23010_23384	124
2210	3300053130	Ga0500642_0126476	Ga0500642_0126476_20_394	124
2211	3300053130	Ga0500642_0452795	Ga0500642_0452795_42_416	124
2212	3300053133	Ga0500655_008727	Ga0500655_008727_920_1297	124
2213	3300053133	Ga0500655_075069	Ga0500655_075069_166_540	124
2214	3300053134	Ga0500658_0158521	Ga0500658_0158521_79_456	124
2215	3300053134	Ga0500658_0296464	Ga0500658_0296464_340_714	124
2216	3300053136	Ga0500559_0000188	Ga0500559_0000188_932_1309	124
2217	3300053136	Ga0500559_0001967	Ga0500559_0001967_176_550	124
2218	3300053136	Ga0500559_0004335	Ga0500559_0004335_2743_3120	124
2219	3300053136	Ga0500559_0023885	Ga0500559_0023885_341_718	124
2220	3300053136	Ga0500559_0145643	Ga0500559_0145643_200_574	124
2221	3300053136	Ga0500559_0152662	Ga0500559_0152662_330_707	124
2222	3300053138	Ga0500564_154711	Ga0500564_154711_283_657	124
2223	3300053139	Ga0500568_0020354	Ga0500568_0020354_1113_1490	124
2224	3300053139	Ga0500568_0025065	Ga0500568_0025065_919_1293	124
2225	3300053142	Ga0500577_0375039	Ga0500577_0375039_230_604	124
2226	3300053146	Ga0500588_0208010	Ga0500588_0208010_48_422	124
2227	3300053147	Ga0500589_046415	Ga0500589_046415_170_547	124
2228	3300053147	Ga0500589_148201	Ga0500589_148201_309_686	124
2229	3300053147	Ga0500589_332243	Ga0500589_332243_66_443	124
2230	3300053148	Ga0500590_046965	Ga0500590_046965_613_987	124
2231	3300053148	Ga0500590_082369	Ga0500590_082369_787_1164	124
2232	3300053148	Ga0500590_172010	Ga0500590_172010_209_586	124
2233	3300053148	Ga0500590_345196	Ga0500590_345196_82_456	124
2234	3300053150	Ga0500603_000092	Ga0500603_000092_12442_12819	124
2235	3300053150	Ga0500603_000875	Ga0500603_000875_393_770	124
2236	3300053150	Ga0500603_008687	Ga0500603_008687_220_597	124
2237	3300053150	Ga0500603_013513	Ga0500603_013513_108_482	124
2238	3300053150	Ga0500603_018478	Ga0500603_018478_1084_1458	124
2239	3300053150	Ga0500603_040443	Ga0500603_040443_723_1097	124
2240	3300053151	Ga0500604_0000612	Ga0500604_0000612_5868_6278	124
2241	3300053151	Ga0500604_0096308	Ga0500604_0096308_47_424	124
2242	3300053153	Ga0500616_0000408	Ga0500616_0000408_39341_39718	124
2243	3300053153	Ga0500616_0047993	Ga0500616_0047993_1800_2174	124
2244	3300053153	Ga0500616_0053817	Ga0500616_0053817_1331_1738	124
2245	3300053154	Ga0500619_008874	Ga0500619_008874_275_649	124
2246	3300053155	Ga0500620_003602	Ga0500620_003602_221_595	124
2247	3300053156	Ga0500622_0007870	Ga0500622_0007870_303_677	124
2248	3300053158	Ga0500627_0004834	Ga0500627_0004834_3720_4094	124
2249	3300053159	Ga0500630_011856	Ga0500630_011856_2674_3051	124
2250	3300053160	Ga0500633_0018216	Ga0500633_0018216_390_764	124
2251	3300053161	Ga0500634_0098285	Ga0500634_0098285_1077_1454	124
2252	3300053161	Ga0500634_0100498	Ga0500634_0100498_10_384	124
2253	3300053162	Ga0500638_007151	Ga0500638_007151_48_422	124
2254	3300053162	Ga0500638_015245	Ga0500638_015245_537_914	124
2255	3300053162	Ga0500638_025201	Ga0500638_025201_1637_2011	124
2256	3300053162	Ga0500638_066776	Ga0500638_066776_393_767	124
2257	3300053162	Ga0500638_147861	Ga0500638_147861_149_526	124
2258	3300053162	Ga0500638_235497	Ga0500638_235497_210_587	124
2259	3300053163	Ga0500639_000103	Ga0500639_000103_25843_26220	124
2260	3300053163	Ga0500639_026472	Ga0500639_026472_588_962	124
2261	3300053163	Ga0500639_171719	Ga0500639_171719_295_672	124
2262	3300053163	Ga0500639_185848	Ga0500639_185848_100_477	124
2263	3300053177	Ga0500636_0000632	Ga0500636_0000632_9217_9594	124
2264	3300053177	Ga0500636_0010870	Ga0500636_0010870_2870_3244	124
2265	3300053177	Ga0500636_0046327	Ga0500636_0046327_1804_2178	124
2266	3300053177	Ga0500636_0109020	Ga0500636_0109020_851_1228	124
2267	3300053177	Ga0500636_0207255	Ga0500636_0207255_170_547	124
2268	3300053178	Ga0500637_0005224	Ga0500637_0005224_1973_2350	124
2269	3300053178	Ga0500637_0304974	Ga0500637_0304974_271_648	124
2270	3300053178	Ga0500637_0364364	Ga0500637_0364364_26_400	124
2271	3300053178	Ga0500637_0367613	Ga0500637_0367613_50_424	124
2272	3300053722	Ga0500649_035325	Ga0500649_035325_59_433	124
2273	3300053725	Ga0500576_081112	Ga0500576_081112_637_1014	124
2274	3300053727	Ga0500611_158575	Ga0500611_158575_204_578	124
2275	3300053728	Ga0500657_133472	Ga0500657_133472_524_901	124
2276	3300053729	Ga0500625_021497	Ga0500625_021497_408_782	124
2277	3300053729	Ga0500625_238836	Ga0500625_238836_38_412	124
2278	3300053730	Ga0500645_013567	Ga0500645_013567_610_987	124
2279	3300053730	Ga0500645_045912	Ga0500645_045912_313_687	124
2280	3300053730	Ga0500645_077697	Ga0500645_077697_537_911	124
2281	3300053731	Ga0500609_023155	Ga0500609_023155_374_748	124
2282	3300053733	Ga0500552_017561	Ga0500552_017561_436_810	124
2283	3300053735	Ga0500596_000547	Ga0500596_000547_2132_2509	124
2284	3300053735	Ga0500596_009662	Ga0500596_009662_318_695	124
2285	3300053735	Ga0500596_028122	Ga0500596_028122_408_782	124
2286	3300053736	Ga0500599_017378	Ga0500599_017378_457_831	124
2287	3300053737	Ga0500601_000917	Ga0500601_000917_275_649	124
2288	3300053739	Ga0500587_016817	Ga0500587_016817_34_411	124
2289	3300055283	Ga0500661_000372	Ga0500661_000372_342_716	124
2290	3300055283	Ga0500661_011050	Ga0500661_011050_731_1108	124
2291	3300055283	Ga0500661_029988	Ga0500661_029988_466_840	124
2292	3300059424	Ga0590075_128154	Ga0590075_128154_217_591	124
2293	3300060353	Ga0501082_0332462	Ga0501082_0332462_438_815	124
2294	3300060353	Ga0501082_0495098	Ga0501082_0495098_98_475	124
2295	3300060353	Ga0501082_0686713	Ga0501082_0686713_281_691	124
2296	3300060353	Ga0501082_1041088	Ga0501082_1041088_305_700	124
2297	3300061719	Ga0466962_0071550	Ga0466962_0071550_457_846	124

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

33

145

0.96 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
7cci-assembly1.cif.gz_A	acinetobacter baumannii response regulator ader with disordered n terminus	0.9421	2	121
3a0u-assembly1.cif.gz_A	crystal structure of response regulator protein trra (tm1360) from thermotoga maritima in complex with mg(2+)-bef (wild type)	0.9278	1	119
6tne-assembly1.cif.gz_A	crystal structure of receiver domain from hybrid histidine kinase ccka	0.9257	3	119
3q15-assembly2.cif.gz_D-3	crystal structure of raph complexed with spo0f	0.9203	3	117
3a0u-assembly1.cif.gz_A	crystal structure of response regulator protein trra (tm1360) from thermotoga maritima in complex with mg(2+)-bef (wild type)	0.9202	1	119

ID	Description	Score	Start	End	Superfamily
af_I1NCE1_621_722_3.40.50.2300	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator	0.9776	2	71	3.40.50.2300
af_O69730_8_88_3.40.50.2300	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator	0.9621	1	83	3.40.50.2300
af_A0A0P0W8Y3_12_90_3.40.50.2300	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator	0.9545	3	78	3.40.50.2300
af_O69730_8_88_3.40.50.2300	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator	0.9508	1	83	3.40.50.2300
af_P0AE88_2_83_3.40.50.2300	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator	0.9501	3	85	3.40.50.2300

ID	Description	Score	Start	End	GO Terms
AF-A0A537LCA5-F1-model_v4	Response regulator	0.9994	1	123	GO:0000160
AF-A0A1M5XF64-F1-model_v4	Response regulator receiver domain-containing protein	0.9982	1	124	GO:0000160
AF-A0A5R8YCC4-F1-model_v4	Response regulator	0.9977	1	123	GO:0000160
AF-A0A327JQK9-F1-model_v4	Response regulator	0.997	1	123	GO:0000160 GO:0003677
AF-E0MS95-F1-model_v4	Response regulator receiver	0.9968	1	120	GO:0000160

Feature Viewer

pLDDT	pTM	Quality
92.84	0.88	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F496651

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF00072

Response_reg

Response regulator receiver domain

33

145

0.96

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map