F496588

General Info

Members Datasets Scaffolds Average Seq Length
2241 850 2023 145

Family's Representative Sequence

Representative Sequence 3300005983|Ga0081540_1010468|Ga0081540_10104683
Length 164
Sequence VLGWRDLKDFDKNKKGSEGMDGVSVGVLDHFNIRTRHLAETVRFYEDVLGLEKGPRPDFAFPGAWMYSEGKAVVHLVDISPTAEPQKPDSGVVHHVAFVSSGFDGMKQRLAAKGMKFDSRQVPGGDLWQLFVHDPNGVMIELNYEAAREQGAAPAEMADDIGRQ

Samples

Sample ID Description Type Environment
1 2010549000 Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes Metagenome Endosphere
2 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
3 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
4 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
5 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
6 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
7 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
8 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
9 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
10 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
11 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
12 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
13 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
14 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
15 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
16 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
17 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
18 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
19 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
20 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
21 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
22 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
23 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
24 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
25 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
26 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
27 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
28 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
29 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
30 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
31 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
32 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
33 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
34 2791355199
35 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
36 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
37 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
38 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
39 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
40 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
41 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
42 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
43 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
44 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
45 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
46 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
47 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
48 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
49 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
50 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
51 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
52 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
53 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
54 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
55 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
56 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
57 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
58 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
59 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
60 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
61 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
62 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
63 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
64 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
65 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
66 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
67 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
68 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
69 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
70 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
71 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
72 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
73 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
74 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
75 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
76 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
77 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
78 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
79 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
80 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
81 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
82 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
83 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
84 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
85 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
86 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
87 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
88 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
89 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
90 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
91 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
92 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
93 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
94 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
95 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
96 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
97 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
98 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
99 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
100 2904699407
101 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
102 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
103 2906610324
104 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
105 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
106 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
107 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
108 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
109 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
110 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
111 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
112 2922368715
113 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
114 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
115 2922425934
116 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
117 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
118 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
119 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
120 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
121 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
122 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
123 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
124 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
125 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
126 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
127 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
128 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
129 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
130 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
131 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
132 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
133 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
134 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
135 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
136 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
137 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
138 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
139 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
140 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
141 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
142 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
143 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
144 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
145 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
146 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
147 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
148 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
149 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
150 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
151 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
152 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
153 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
154 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
155 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
156 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
157 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
158 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
159 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
160 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
161 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
162 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
163 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
164 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
165 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
166 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
167 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
168 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
169 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
170 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
171 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
172 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
173 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
174 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
175 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
176 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
177 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
178 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
179 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
180 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
181 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
182 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
183 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
184 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
185 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
186 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
187 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
188 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
189 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
190 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
191 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
192 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
193 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
194 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
195 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
196 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
197 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
198 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
199 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
200 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
201 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
202 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
203 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
204 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
205 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
206 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
207 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
208 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
209 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
210 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
211 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
212 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
213 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
214 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
215 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
216 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
217 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
218 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
219 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
220 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
221 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
222 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
223 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
224 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
225 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
226 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
227 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
228 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
229 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
230 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
231 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
232 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
233 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
234 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
235 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
236 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
237 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
238 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
239 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
240 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
241 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
242 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
243 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
244 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
245 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
246 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
247 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
248 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
249 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
250 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
251 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
252 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
253 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
254 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
255 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
256 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
257 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
258 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
259 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
260 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
261 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
262 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
263 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
264 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
265 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
266 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
267 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
268 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
269 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
270 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
271 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
272 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
273 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
274 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
275 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
276 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
277 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
278 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
279 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
280 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
281 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
282 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
283 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
284 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
285 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
286 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
287 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
288 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
289 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
290 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
291 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
292 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
293 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
294 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
295 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
296 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
297 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
298 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
299 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
300 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
301 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
302 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
303 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
304 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
305 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
306 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
307 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
308 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
309 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
310 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
311 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
312 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
313 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
314 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
315 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
316 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
317 3300012490 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 Metagenome Rhizosphere
318 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
319 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
320 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
321 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
322 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
323 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
324 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
325 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
326 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
327 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
328 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
329 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
330 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
331 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
332 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
333 3300019188 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE2 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
334 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
335 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
336 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
337 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
338 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
339 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
340 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
341 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
342 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
343 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
344 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
345 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
346 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
347 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
348 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
349 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
350 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
351 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
352 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
353 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
354 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
355 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
356 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
357 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
358 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
359 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
360 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
361 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
362 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
363 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
364 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
365 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
366 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
367 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
368 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
369 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
370 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
371 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
372 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
373 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
374 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
375 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
376 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
377 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
378 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
379 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
380 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
381 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
382 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
383 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
384 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
385 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
386 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
387 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
388 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
389 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
390 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
391 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
392 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
393 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
394 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
395 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
396 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
397 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
398 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
399 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
400 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
401 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
402 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
403 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
404 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
405 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
406 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
407 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
408 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
409 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
410 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
411 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
412 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
413 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
414 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
415 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
416 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
417 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
418 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
419 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
420 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
421 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
422 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
423 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
424 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
425 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
426 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
427 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
428 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
429 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
430 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
431 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
432 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
433 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
434 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
435 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
436 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
437 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
438 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
439 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
440 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
441 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
442 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
443 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
444 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
445 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
446 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
447 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
448 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
449 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
450 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
451 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
452 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
453 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
454 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
455 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
456 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
457 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
458 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
459 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
460 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
461 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
462 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
463 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
464 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
465 3300031810 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRA1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Unclassified
466 3300031815 Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRA2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Unclassified
467 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
468 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
469 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
470 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
471 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
472 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
473 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
474 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
475 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
476 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
477 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
478 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
479 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
480 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
481 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
482 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
483 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
484 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
485 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
486 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
487 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
488 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
489 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
490 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
491 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
492 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
493 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
494 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
495 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
496 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
497 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
498 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
499 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
500 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
501 3300036242 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRI5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
502 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
503 3300036458 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
504 3300036534 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
505 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
506 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
507 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
508 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
509 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
510 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
511 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
512 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
513 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
514 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
515 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
516 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
517 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
518 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
519 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
520 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
521 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
522 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
523 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
524 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
525 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
526 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
527 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
528 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
529 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
530 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
531 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
532 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
533 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
534 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
535 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
536 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
537 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
538 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
539 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
540 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
541 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
542 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
543 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
544 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
545 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
546 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
547 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
548 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
549 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
550 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
551 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
552 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
553 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
554 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
555 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
556 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
557 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
558 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
559 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
560 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
561 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
562 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
563 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
564 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
565 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
566 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
567 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
568 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
569 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
570 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
571 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
572 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
573 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
574 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
575 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
576 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
577 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
578 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
579 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
580 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
581 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
582 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
583 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
584 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
585 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
586 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
587 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
588 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
589 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
590 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
591 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
592 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
593 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
594 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
595 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
596 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
597 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
598 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
599 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
600 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
601 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
602 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
603 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
604 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
605 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
606 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
607 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
608 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
609 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
610 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
611 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
612 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
613 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
614 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
615 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
616 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
617 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
618 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
619 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
620 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
621 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
622 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
623 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
624 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
625 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
626 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
627 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
628 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
629 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
630 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
631 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
632 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
633 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
634 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
635 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
636 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
637 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
638 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
639 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
640 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
641 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
642 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
643 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
644 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
645 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
646 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
647 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
648 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
649 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
650 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
651 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
652 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
653 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
654 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
655 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
656 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
657 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
658 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
659 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
660 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
661 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
662 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
663 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
664 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
665 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
666 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
667 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
668 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
669 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
670 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
671 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
672 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
673 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
674 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
675 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
676 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
677 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
678 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
679 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
680 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
681 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
682 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
683 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
684 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
685 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
686 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
687 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
688 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
689 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
690 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
691 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
692 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
693 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
694 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
695 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
696 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
697 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
698 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
699 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
700 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
701 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
702 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
703 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
704 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
705 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
706 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
707 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
708 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
709 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
710 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
711 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
712 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
713 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
714 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
715 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
716 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
717 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
718 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
719 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
720 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
721 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
722 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
723 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
724 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
725 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
726 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
727 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
728 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
729 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
730 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
731 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
732 3300053114 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 endosphere Metagenome Endosphere
733 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
734 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
735 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
736 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
737 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
738 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
739 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
740 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
741 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
742 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
743 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
744 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
745 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
746 3300053144 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 endosphere Metagenome Endosphere
747 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
748 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
749 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
750 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
751 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
752 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
753 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
754 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
755 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
756 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
757 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
758 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
759 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
760 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
761 3300053728 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 endosphere Metagenome Endosphere
762 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
763 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
764 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
765 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
766 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
767 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
768 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
769 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
770 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
771 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
772 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
773 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
774 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
775 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
776 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
777 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
778 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
779 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
780 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
781 3300059509 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
782 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
783 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
784 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
785 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
786 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
787 3300059607 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
788 3300059609 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 227R_SD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
789 3300059622 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
790 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
791 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
792 3300059625 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 151R_CD_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
793 3300059628 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 160R_AD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
794 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
795 3300059631 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 168R_SD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
796 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
797 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
798 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
799 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
800 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
801 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
802 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
803 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
804 3300059649 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
805 3300059654 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 148R_CW_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
806 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
807 3300059656 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 153R_AW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
808 3300059659 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 157R_AD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
809 3300059660 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 161R_SW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
810 3300060243 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 1R_CW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
811 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
812 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
813 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
814 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
815 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
816 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
817 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
818 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
819 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
820 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
821 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
822 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
823 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
824 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
825 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
826 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
827 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
828 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
829 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
830 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
831 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
832 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
833 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
834 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
835 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
836 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
837 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
838 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
839 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
840 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
841 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
842 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
843 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
844 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
845 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
846 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
847 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
848 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
849 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
850 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 86.05
Metatranscriptomes 4.43
Isolates 9.53

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.07
Nodule 7.85
Rhizoplane 5.93
Rhizosphere 66.85
Stem 0
Stem Tuber 0
Unclassified 8.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 RicEn_FSXC13370_b1 2010549000 Bacteria 853
2 JGI24739J22299_10030467 3300001989 Bacteria 1870
3 JGI24739J22299_10046355 3300001989 Bacteria 1423
4 JGI24743J22301_10146283 3300001991 Bacteria 528
5 JGI24745J21846_1028407 3300002073 Bacteria 671
6 JGI24749J21850_1075797 3300002076 Bacteria 524
7 JGI24742J22300_10059793 3300002244 Bacteria 699
8 JGI25406J46586_10011488 3300003203 Bacteria 3883
9 JGI25406J46586_10016664 3300003203 Bacteria 3058
10 JGI25153J46596_10008505 3300003215 Bacteria 4896
11 JGI25153J46596_10010083 3300003215 Bacteria 4310
12 JGI25153J46596_10014699 3300003215 Bacteria 3237
13 JGI25153J46596_10038357 3300003215 Bacteria 1511
14 JGI25153J46596_10139394 3300003215 Bacteria 530
15 JGI25160J50197_1013715 3300003354 Bacteria 2747
16 JGI25404J52841_10045597 3300003659 Bacteria 924
17 JGI25404J52841_10056933 3300003659 Bacteria 820
18 JGI25404J52841_10095922 3300003659 Bacteria 621
19 Ga0055539_1020392 3300003752 Bacteria 791
20 Ga0055529_1023165 3300003763 Bacteria 769
21 Ga0055526_1022250 3300003771 Bacteria 2164
22 Ga0055526_1044691 3300003771 Bacteria 1067
23 Ga0055531_10001869 3300003794 Bacteria 14783
24 Ga0058863_11742447 3300004799 Bacteria 606
25 Ga0058861_11838611 3300004800 Bacteria 727
26 Ga0058860_11966111 3300004801 Bacteria 755
27 Ga0058860_12114306 3300004801 Bacteria 810
28 Ga0058860_12129102 3300004801 Bacteria 704
29 Ga0058862_12886227 3300004803 Bacteria 931
30 Ga0065165_1000611 3300005262 Bacteria 51919
31 Ga0065165_1000654 3300005262 Bacteria 50027
32 Ga0065165_1010849 3300005262 Bacteria 3880
33 Ga0065165_1014739 3300005262 Bacteria 3019
34 Ga0065715_10366381 3300005293 Bacteria 927
35 Ga0070658_10026123 3300005327 Bacteria 4685
36 Ga0070658_10092442 3300005327 Bacteria 2494
37 Ga0070658_10225256 3300005327 Bacteria 1586
38 Ga0070658_10283047 3300005327 Bacteria 1411
39 Ga0070658_10363423 3300005327 Bacteria 1240
40 Ga0070676_10115789 3300005328 Bacteria 1675
41 Ga0070676_10662692 3300005328 Bacteria 759
42 Ga0070676_11226654 3300005328 Bacteria 571
43 Ga0070683_100033154 3300005329 Bacteria 4707
44 Ga0070683_100090421 3300005329 Bacteria 2874
45 Ga0070683_100179689 3300005329 Bacteria 2008
46 Ga0070690_100083437 3300005330 Bacteria 2093
47 Ga0070670_100196746 3300005331 Bacteria 1751
48 Ga0070670_100296160 3300005331 Bacteria 1414
49 Ga0070677_10385846 3300005333 Bacteria 735
50 Ga0068869_100064053 3300005334 Bacteria 2703
51 Ga0068869_100104355 3300005334 Bacteria 2148
52 Ga0068869_100434467 3300005334 Bacteria 1085
53 Ga0068869_100496759 3300005334 Bacteria 1018
54 Ga0068869_100752073 3300005334 Bacteria 835
55 Ga0070666_10303843 3300005335 Bacteria 1136
56 Ga0070666_10314810 3300005335 Bacteria 1116
57 Ga0070666_10463918 3300005335 Bacteria 916
58 Ga0070680_100012506 3300005336 Bacteria 6597
59 Ga0070680_100021861 3300005336 Bacteria 5088
60 Ga0070680_100057435 3300005336 Bacteria 3182
61 Ga0070680_100311639 3300005336 Bacteria 1335
62 Ga0070680_100751443 3300005336 Bacteria 840
63 Ga0070682_100006487 3300005337 Bacteria 6576
64 Ga0070682_100582578 3300005337 Bacteria 880
65 Ga0070682_100935830 3300005337 Bacteria 715
66 Ga0068868_100038515 3300005338 Bacteria 3711
67 Ga0068868_100054227 3300005338 Bacteria 3159
68 Ga0068868_100238636 3300005338 Bacteria 1526
69 Ga0068868_100352418 3300005338 Bacteria 1261
70 Ga0068868_101070782 3300005338 Bacteria 741
71 Ga0070660_100031842 3300005339 Bacteria 3964
72 Ga0070660_100708023 3300005339 Bacteria 844
73 Ga0070689_100636686 3300005340 Unclassified 926
74 Ga0070689_100949864 3300005340 Bacteria 763
75 Ga0070691_10182990 3300005341 Bacteria 1092
76 Ga0070691_10452199 3300005341 Bacteria 734
77 Ga0070661_100073259 3300005344 Bacteria 2521
78 Ga0070661_100242088 3300005344 Bacteria 1389
79 Ga0070661_100283896 3300005344 Bacteria 1285
80 Ga0070661_100925575 3300005344 Bacteria 720
81 Ga0070661_101136794 3300005344 Bacteria 652
82 Ga0070692_10257788 3300005345 Bacteria 1047
83 Ga0070668_100077863 3300005347 Bacteria 2592
84 Ga0070668_100144165 3300005347 Bacteria 1921
85 Ga0070668_100273071 3300005347 Bacteria 1410
86 Ga0070668_100301700 3300005347 Bacteria 1343
87 Ga0070668_100331293 3300005347 Bacteria 1284
88 Ga0070668_100375678 3300005347 Bacteria 1209
89 Ga0070668_100800166 3300005347 Bacteria 837
90 Ga0070668_100840852 3300005347 Bacteria 817
91 Ga0070668_100965311 3300005347 Bacteria 764
92 Ga0070669_100284212 3300005353 Bacteria 1326
93 Ga0070669_100848037 3300005353 Unclassified 778
94 Ga0070669_101016002 3300005353 Bacteria 712
95 Ga0070669_101865949 3300005353 Bacteria 525
96 Ga0070675_100185365 3300005354 Bacteria 1801
97 Ga0070675_100451855 3300005354 Bacteria 1152
98 Ga0070675_100547088 3300005354 Bacteria 1047
99 Ga0070675_100918645 3300005354 Bacteria 802
100 Ga0070671_100204966 3300005355 Bacteria 1673
101 Ga0070671_100292085 3300005355 Bacteria 1387
102 Ga0070671_100415573 3300005355 Bacteria 1152
103 Ga0070671_100896181 3300005355 Bacteria 775
104 Ga0070674_100073507 3300005356 Bacteria 2423
105 Ga0070674_100151114 3300005356 Bacteria 1753
106 Ga0070674_100381587 3300005356 Bacteria 1147
107 Ga0070674_100575965 3300005356 Bacteria 948
108 Ga0070673_100318710 3300005364 Bacteria 1373
109 Ga0070673_101832151 3300005364 Bacteria 575
110 Ga0070688_100080916 3300005365 Bacteria 2102
111 Ga0070688_100638521 3300005365 Bacteria 819
112 Ga0070659_100089592 3300005366 Bacteria 2464
113 Ga0070659_100152735 3300005366 Bacteria 1884
114 Ga0070659_100162618 3300005366 Bacteria 1826
115 Ga0070659_100314242 3300005366 Bacteria 1309
116 Ga0070667_100159197 3300005367 Bacteria 1988
117 Ga0070667_100326851 3300005367 Bacteria 1385
118 Ga0070667_100697140 3300005367 Bacteria 939
119 Ga0070709_10018677 3300005434 Bacteria 3998
120 Ga0070709_10022697 3300005434 Bacteria 3675
121 Ga0070709_10070933 3300005434 Bacteria 2247
122 Ga0070714_100040114 3300005435 Bacteria 3946
123 Ga0070714_100040203 3300005435 Bacteria 3941
124 Ga0070714_100076117 3300005435 Bacteria 2913
125 Ga0070714_100158355 3300005435 Bacteria 2046
126 Ga0070714_100185602 3300005435 Bacteria 1895
127 Ga0070714_100258835 3300005435 Bacteria 1611
128 Ga0070714_100350226 3300005435 Bacteria 1387
129 Ga0070713_100010724 3300005436 Bacteria 6636
130 Ga0070713_100030898 3300005436 Bacteria 4260
131 Ga0070713_100050580 3300005436 Bacteria 3433
132 Ga0070713_100422772 3300005436 Bacteria 1248
133 Ga0070713_100500403 3300005436 Bacteria 1147
134 Ga0070713_101062571 3300005436 Bacteria 782
135 Ga0070713_101339509 3300005436 Bacteria 694
136 Ga0070710_10000725 3300005437 Bacteria 15717
137 Ga0070710_10003810 3300005437 Bacteria 7134
138 Ga0070710_10006126 3300005437 Bacteria 5753
139 Ga0070710_10068175 3300005437 Bacteria 2043
140 Ga0070701_10224185 3300005438 Bacteria 1123
141 Ga0070701_10243543 3300005438 Bacteria 1083
142 Ga0070711_100011590 3300005439 Bacteria 5479
143 Ga0070711_100207959 3300005439 Bacteria 1514
144 Ga0070711_100227652 3300005439 Bacteria 1452
145 Ga0070711_100540088 3300005439 Bacteria 966
146 Ga0070711_100746439 3300005439 Bacteria 827
147 Ga0070711_101217559 3300005439 Bacteria 652
148 Ga0070711_101481997 3300005439 Bacteria 592
149 Ga0070700_100189928 3300005441 Bacteria 1435
150 Ga0070700_100249862 3300005441 Bacteria 1271
151 Ga0070694_100196413 3300005444 Bacteria 1501
152 Ga0070663_100008002 3300005455 Bacteria 6477
153 Ga0070663_100046554 3300005455 Bacteria 3069
154 Ga0070663_100050416 3300005455 Bacteria 2960
155 Ga0070663_100085912 3300005455 Bacteria 2322
156 Ga0070663_100110392 3300005455 Bacteria 2065
157 Ga0070663_100124599 3300005455 Bacteria 1950
158 Ga0070663_100250630 3300005455 Bacteria 1401
159 Ga0070663_100292355 3300005455 Bacteria 1302
160 Ga0070663_100319210 3300005455 Bacteria 1248
161 Ga0070678_100021665 3300005456 Bacteria 4243
162 Ga0070678_100196527 3300005456 Bacteria 1662
163 Ga0070678_100352029 3300005456 Bacteria 1267
164 Ga0070678_100509962 3300005456 Bacteria 1062
165 Ga0070678_100550164 3300005456 Bacteria 1024
166 Ga0070678_101178734 3300005456 Bacteria 710
167 Ga0070662_100075473 3300005457 Bacteria 2497
168 Ga0070662_100220056 3300005457 Bacteria 1514
169 Ga0070662_100293943 3300005457 Bacteria 1318
170 Ga0070662_101649461 3300005457 Bacteria 553
171 Ga0070681_10054112 3300005458 Bacteria 3999
172 Ga0070681_10082833 3300005458 Bacteria 3162
173 Ga0070681_10318071 3300005458 Bacteria 1466
174 Ga0070681_10419909 3300005458 Bacteria 1249
175 Ga0070681_10886401 3300005458 Bacteria 810
176 Ga0068867_100210459 3300005459 Bacteria 1561
177 Ga0068867_100435605 3300005459 Bacteria 1114
178 Ga0068867_100629616 3300005459 Bacteria 939
179 Ga0068867_101445523 3300005459 Bacteria 639
180 Ga0070685_10416786 3300005466 Bacteria 933
181 Ga0070685_10971966 3300005466 Bacteria 636
182 Ga0070706_100182280 3300005467 Bacteria 1961
183 Ga0070707_100172001 3300005468 Bacteria 2111
184 Ga0070698_100068577 3300005471 Bacteria 3564
185 Ga0070699_100384256 3300005518 Bacteria 1268
186 Ga0070679_100002694 3300005530 Bacteria 16173
187 Ga0070679_100003367 3300005530 Bacteria 14649
188 Ga0070679_100037652 3300005530 Bacteria 4807
189 Ga0070679_100044161 3300005530 Bacteria 4440
190 Ga0070679_100079804 3300005530 Bacteria 3262
191 Ga0070679_100259634 3300005530 Bacteria 1692
192 Ga0070679_100393123 3300005530 Bacteria 1333
193 Ga0070679_100395699 3300005530 Bacteria 1328
194 Ga0070684_100000621 3300005535 Bacteria 24483
195 Ga0070684_100025802 3300005535 Bacteria 4943
196 Ga0070684_100224803 3300005535 Bacteria 1713
197 Ga0070684_100398622 3300005535 Bacteria 1268
198 Ga0070684_100667030 3300005535 Bacteria 969
199 Ga0070684_101450648 3300005535 Bacteria 646
200 Ga0070684_101459194 3300005535 Bacteria 644
201 Ga0070697_100604655 3300005536 Bacteria 964
202 Ga0070697_100946412 3300005536 Bacteria 765
203 Ga0070697_100999211 3300005536 Bacteria 744
204 Ga0068853_100104507 3300005539 Bacteria 2507
205 Ga0068853_100123009 3300005539 Bacteria 2316
206 Ga0068853_100160683 3300005539 Bacteria 2027
207 Ga0068853_101075122 3300005539 Bacteria 776
208 Ga0068853_102030517 3300005539 Bacteria 557
209 Ga0070672_100098775 3300005543 Bacteria 2365
210 Ga0070672_100189663 3300005543 Bacteria 1716
211 Ga0070672_100472896 3300005543 Bacteria 1082
212 Ga0070672_100508232 3300005543 Bacteria 1043
213 Ga0070672_100911007 3300005543 Bacteria 777
214 Ga0070686_100364357 3300005544 Bacteria 1090
215 Ga0070686_100818745 3300005544 Bacteria 752
216 Ga0070696_100252699 3300005546 Bacteria 1334
217 Ga0070693_100401216 3300005547 Bacteria 951
218 Ga0070693_100582955 3300005547 Bacteria 805
219 Ga0070665_100054703 3300005548 Bacteria 4002
220 Ga0070665_100085554 3300005548 Bacteria 3158
221 Ga0070665_100100540 3300005548 Bacteria 2896
222 Ga0070665_100130873 3300005548 Bacteria 2511
223 Ga0070665_100283940 3300005548 Bacteria 1657
224 Ga0070665_100379633 3300005548 Bacteria 1420
225 Ga0070665_100743911 3300005548 Bacteria 994
226 Ga0070665_100790059 3300005548 Bacteria 962
227 Ga0070665_100878323 3300005548 Bacteria 909
228 Ga0070665_100957142 3300005548 Bacteria 868
229 Ga0070704_100188055 3300005549 Bacteria 1658
230 Ga0070704_100951090 3300005549 Bacteria 775
231 Ga0068855_100103169 3300005563 Bacteria 3281
232 Ga0068855_100122647 3300005563 Bacteria 2973
233 Ga0068855_100134366 3300005563 Bacteria 2823
234 Ga0068855_100147281 3300005563 Bacteria 2679
235 Ga0068855_100326887 3300005563 Bacteria 1693
236 Ga0068855_101694620 3300005563 Bacteria 645
237 Ga0070664_100293540 3300005564 Bacteria 1468
238 Ga0070664_100405212 3300005564 Bacteria 1247
239 Ga0070664_100894092 3300005564 Bacteria 833
240 Ga0070664_101165437 3300005564 Bacteria 726
241 Ga0070664_101482887 3300005564 Bacteria 642
242 Ga0068857_100043499 3300005577 Bacteria 3983
243 Ga0068857_100261709 3300005577 Bacteria 1588
244 Ga0068857_100274618 3300005577 Bacteria 1549
245 Ga0068854_100034085 3300005578 Bacteria 3554
246 Ga0068854_100219702 3300005578 Bacteria 1503
247 Ga0068854_100262734 3300005578 Bacteria 1383
248 Ga0068854_100850635 3300005578 Bacteria 798
249 Ga0068854_101793262 3300005578 Bacteria 562
250 Ga0068856_100000201 3300005614 Bacteria 63742
251 Ga0068856_100035420 3300005614 Bacteria 4892
252 Ga0068856_100555071 3300005614 Bacteria 1170
253 Ga0068856_100563438 3300005614 Bacteria 1160
254 Ga0068856_100625091 3300005614 Bacteria 1098
255 Ga0068856_100715027 3300005614 Bacteria 1022
256 Ga0068856_100730298 3300005614 Bacteria 1010
257 Ga0068856_100759672 3300005614 Bacteria 989
258 Ga0068856_101308636 3300005614 Bacteria 740
259 Ga0070702_100079418 3300005615 Bacteria 1961
260 Ga0070702_100272169 3300005615 Bacteria 1158
261 Ga0068852_100039116 3300005616 Bacteria 3991
262 Ga0068852_100302407 3300005616 Bacteria 1549
263 Ga0068852_100742036 3300005616 Bacteria 994
264 Ga0068852_100829663 3300005616 Bacteria 939
265 Ga0068852_101053874 3300005616 Bacteria 833
266 Ga0068852_101164194 3300005616 Bacteria 792
267 Ga0068852_101488739 3300005616 Bacteria 699
268 Ga0068859_100045251 3300005617 Bacteria 4422
269 Ga0068859_100116420 3300005617 Bacteria 2737
270 Ga0068859_100325593 3300005617 Bacteria 1631
271 Ga0068859_100372061 3300005617 Bacteria 1524
272 Ga0068859_100641261 3300005617 Bacteria 1154
273 Ga0068859_101121064 3300005617 Bacteria 866
274 Ga0068864_100062298 3300005618 Bacteria 3232
275 Ga0068864_100110512 3300005618 Bacteria 2448
276 Ga0068864_100167663 3300005618 Bacteria 2000
277 Ga0068864_100194200 3300005618 Bacteria 1862
278 Ga0068864_100544648 3300005618 Bacteria 1121
279 Ga0068864_100597428 3300005618 Bacteria 1071
280 Ga0068864_101241333 3300005618 Bacteria 745
281 Ga0068866_10092168 3300005718 Bacteria 1653
282 Ga0068866_10340513 3300005718 Bacteria 950
283 Ga0068866_10981205 3300005718 Bacteria 599
284 Ga0068861_100189930 3300005719 Bacteria 1716
285 Ga0068861_100212459 3300005719 Bacteria 1630
286 Ga0068861_100580845 3300005719 Bacteria 1026
287 Ga0068851_10153668 3300005834 Bacteria 1260
288 Ga0068851_10510849 3300005834 Bacteria 722
289 Ga0068851_10581373 3300005834 Bacteria 680
290 Ga0068870_10079790 3300005840 Bacteria 1806
291 Ga0068870_10080681 3300005840 Bacteria 1798
292 Ga0068870_10867191 3300005840 Unclassified 635
293 Ga0068863_100443923 3300005841 Bacteria 1273
294 Ga0068863_100448929 3300005841 Bacteria 1265
295 Ga0068863_100450100 3300005841 Bacteria 1264
296 Ga0068863_100498598 3300005841 Bacteria 1199
297 Ga0068863_101561969 3300005841 Bacteria 669
298 Ga0068858_100155075 3300005842 Bacteria 2154
299 Ga0068858_100200946 3300005842 Bacteria 1885
300 Ga0068858_100325967 3300005842 Bacteria 1468
301 Ga0068858_100576219 3300005842 Bacteria 1091
302 Ga0068858_102001293 3300005842 Bacteria 573
303 Ga0068860_100000289 3300005843 Bacteria 71608
304 Ga0068860_100222875 3300005843 Bacteria 1831
305 Ga0068860_100596626 3300005843 Bacteria 1110
306 Ga0068860_100807480 3300005843 Bacteria 951
307 Ga0068860_101613271 3300005843 Bacteria 671
308 Ga0068860_102659985 3300005843 Bacteria 519
309 Ga0068862_100068226 3300005844 Bacteria 3067
310 Ga0068862_100148045 3300005844 Bacteria 2088
311 Ga0068862_100777127 3300005844 Bacteria 934
312 Ga0068862_100826161 3300005844 Bacteria 906
313 Ga0068862_101356472 3300005844 Bacteria 713
314 Ga0068862_102654913 3300005844 Bacteria 512
315 Ga0081455_10012314 3300005937 Bacteria 8534
316 Ga0081455_10019799 3300005937 Bacteria 6355
317 Ga0081455_10020159 3300005937 Bacteria 6290
318 Ga0081455_10026512 3300005937 Bacteria 5327
319 Ga0081455_10228020 3300005937 Bacteria 1377
320 Ga0081455_10318556 3300005937 Bacteria 1109
321 Ga0081538_10073885 3300005981 Bacteria 1860
322 Ga0081538_10200242 3300005981 Bacteria 821
323 Ga0081540_1002792 3300005983 Bacteria 14160
324 Ga0081540_1004157 3300005983 Bacteria 11154
325 Ga0081540_1004365 3300005983 Bacteria 10809
326 Ga0081540_1004412 3300005983 Bacteria 10739
327 Ga0081540_1010468 3300005983 Bacteria 6274
328 Ga0081540_1011178 3300005983 Bacteria 6022
329 Ga0081540_1020291 3300005983 Bacteria 4004
330 Ga0081540_1021342 3300005983 Bacteria 3861
331 Ga0081540_1027604 3300005983 Bacteria 3211
332 Ga0081540_1047429 3300005983 Bacteria 2161
333 Ga0081540_1138186 3300005983 Bacteria 983
334 Ga0081540_1182984 3300005983 Bacteria 782
335 Ga0081540_1329606 3300005983 Bacteria 523
336 Ga0081539_10000148 3300005985 Bacteria 163442
337 Ga0081539_10035694 3300005985 Bacteria 2984
338 Ga0081539_10039795 3300005985 Bacteria 2769
339 Ga0081539_10294315 3300005985 Bacteria 701
340 Ga0070717_10029353 3300006028 Bacteria 4411
341 Ga0070717_10299725 3300006028 Bacteria 1429
342 Ga0070717_10542485 3300006028 Bacteria 1053
343 Ga0075365_10055792 3300006038 Bacteria 2624
344 Ga0075365_10057415 3300006038 Bacteria 2589
345 Ga0075365_10079199 3300006038 Bacteria 2223
346 Ga0075365_10190605 3300006038 Bacteria 1435
347 Ga0075365_10223168 3300006038 Bacteria 1322
348 Ga0075365_10252505 3300006038 Bacteria 1239
349 Ga0075365_10300150 3300006038 Bacteria 1130
350 Ga0075365_10322125 3300006038 Bacteria 1088
351 Ga0075365_10537433 3300006038 Bacteria 827
352 Ga0075365_10672456 3300006038 Bacteria 732
353 Ga0075365_10764004 3300006038 Bacteria 682
354 Ga0075368_10009440 3300006042 Bacteria 3510
355 Ga0075368_10060534 3300006042 Bacteria 1515
356 Ga0075368_10095443 3300006042 Bacteria 1218
357 Ga0075368_10164519 3300006042 Bacteria 931
358 Ga0075368_10436626 3300006042 Bacteria 578
359 Ga0075363_100001658 3300006048 Bacteria 8613
360 Ga0075363_100018361 3300006048 Bacteria 3484
361 Ga0075363_100091755 3300006048 Bacteria 1672
362 Ga0075364_10183293 3300006051 Bacteria 1417
363 Ga0075364_10278796 3300006051 Bacteria 1137
364 Ga0075364_10341441 3300006051 Bacteria 1020
365 Ga0075364_10369721 3300006051 Bacteria 978
366 Ga0070715_10010336 3300006163 Bacteria 3323
367 Ga0070715_10076947 3300006163 Bacteria 1505
368 Ga0070716_100002224 3300006173 Bacteria 8938
369 Ga0070716_100030041 3300006173 Bacteria 2944
370 Ga0070716_100143794 3300006173 Bacteria 1525
371 Ga0070716_100220639 3300006173 Bacteria 1273
372 Ga0070716_100435461 3300006173 Bacteria 952
373 Ga0070716_100523351 3300006173 Bacteria 879
374 Ga0070716_100577656 3300006173 Bacteria 842
375 Ga0070712_100004628 3300006175 Bacteria 8502
376 Ga0070712_100014309 3300006175 Bacteria 5093
377 Ga0070712_100086834 3300006175 Bacteria 2281
378 Ga0070712_100565823 3300006175 Bacteria 959
379 Ga0075362_10110127 3300006177 Bacteria 1295
380 Ga0075362_10152013 3300006177 Bacteria 1111
381 Ga0075362_10240965 3300006177 Bacteria 888
382 Ga0075367_10012122 3300006178 Bacteria 4586
383 Ga0075367_10140376 3300006178 Bacteria 1496
384 Ga0075367_10157514 3300006178 Bacteria 1411
385 Ga0075367_10172009 3300006178 Bacteria 1349
386 Ga0075367_10187755 3300006178 Bacteria 1289
387 Ga0075369_10000436 3300006186 Bacteria 12671
388 Ga0075369_10053430 3300006186 Bacteria 1753
389 Ga0075369_10145064 3300006186 Bacteria 1084
390 Ga0075369_10295003 3300006186 Bacteria 756
391 Ga0075369_10323508 3300006186 Bacteria 722
392 Ga0075369_10388069 3300006186 Bacteria 657
393 Ga0075366_10134039 3300006195 Bacteria 1495
394 Ga0075366_10151310 3300006195 Bacteria 1405
395 Ga0075366_10392801 3300006195 Bacteria 853
396 Ga0075366_10747867 3300006195 Bacteria 608
397 Ga0097621_100134641 3300006237 Bacteria 2106
398 Ga0097621_100300980 3300006237 Bacteria 1416
399 Ga0097621_100407749 3300006237 Bacteria 1218
400 Ga0097621_100524074 3300006237 Bacteria 1076
401 Ga0097621_101003470 3300006237 Bacteria 781
402 Ga0097621_101293430 3300006237 Bacteria 689
403 Ga0097621_101678804 3300006237 Bacteria 605
404 Ga0075370_10014796 3300006353 Bacteria 4165
405 Ga0075370_10045719 3300006353 Bacteria 2476
406 Ga0075370_10177681 3300006353 Bacteria 1252
407 Ga0075370_10276393 3300006353 Bacteria 997
408 Ga0075370_10377231 3300006353 Bacteria 849
409 Ga0075370_10645121 3300006353 Bacteria 642
410 Ga0075370_11023539 3300006353 Bacteria 506
411 Ga0068871_100126964 3300006358 Bacteria 2159
412 Ga0068871_100163833 3300006358 Bacteria 1902
413 Ga0068871_100238761 3300006358 Bacteria 1579
414 Ga0068871_100530958 3300006358 Bacteria 1064
415 Ga0068871_100586524 3300006358 Bacteria 1013
416 Ga0068871_101230935 3300006358 Bacteria 703
417 Ga0068871_101555752 3300006358 Bacteria 625
418 Ga0075428_100138656 3300006844 Bacteria 2644
419 Ga0075428_100310635 3300006844 Bacteria 1695
420 Ga0075434_100016398 3300006871 Bacteria 7122
421 Ga0075434_100746125 3300006871 Bacteria 996
422 Ga0068865_100049382 3300006881 Bacteria 2900
423 Ga0068865_100147740 3300006881 Bacteria 1780
424 Ga0068865_100677655 3300006881 Bacteria 879
425 Ga0075436_100263610 3300006914 Bacteria 1229
426 Ga0075436_101071749 3300006914 Bacteria 606
427 Ga0097620_100045247 3300006931 Bacteria 4422
428 Ga0097620_100116421 3300006931 Bacteria 2737
429 Ga0097620_100325590 3300006931 Bacteria 1631
430 Ga0097620_100372083 3300006931 Bacteria 1524
431 Ga0097620_100641253 3300006931 Bacteria 1154
432 Ga0097620_101121146 3300006931 Bacteria 866
433 Ga0099825_1022051 3300006941 Bacteria 4193
434 Ga0099824_1006466 3300006942 Bacteria 16057
435 Ga0099824_1021711 3300006942 Bacteria 4409
436 Ga0099822_1008625 3300006943 Bacteria 13004
437 Ga0099823_1036144 3300006944 Bacteria 3812
438 Ga0075435_100354531 3300007076 Bacteria 1258
439 Ga0075435_101075977 3300007076 Bacteria 703
440 Ga0099795_10050414 3300007788 Bacteria 1514
441 Ga0099795_10097600 3300007788 Bacteria 1148
442 Ga0105240_10005244 3300009093 Bacteria 19360
443 Ga0105240_10056701 3300009093 Bacteria 4901
444 Ga0105240_10071943 3300009093 Bacteria 4275
445 Ga0105240_10108339 3300009093 Bacteria 3366
446 Ga0105240_10433839 3300009093 Bacteria 1474
447 Ga0105240_10611102 3300009093 Bacteria 1199
448 Ga0105240_10997916 3300009093 Bacteria 896
449 Ga0105240_11193506 3300009093 Bacteria 806
450 Ga0105240_11533319 3300009093 Bacteria 698
451 Ga0105240_12114414 3300009093 Bacteria 584
452 Ga0105240_12575919 3300009093 Bacteria 526
453 Ga0111539_10166745 3300009094 Bacteria 2575
454 Ga0111539_10923273 3300009094 Bacteria 1015
455 Ga0111539_11493297 3300009094 Bacteria 784
456 Ga0111539_13050948 3300009094 Bacteria 541
457 Ga0105245_10136956 3300009098 Bacteria 2302
458 Ga0105245_10137179 3300009098 Bacteria 2300
459 Ga0105245_10359854 3300009098 Bacteria 1444
460 Ga0105245_10384631 3300009098 Bacteria 1398
461 Ga0105245_10934213 3300009098 Bacteria 910
462 Ga0105245_12081003 3300009098 Bacteria 621
463 Ga0105247_10050303 3300009101 Bacteria 2564
464 Ga0105247_10084071 3300009101 Bacteria 2011
465 Ga0105247_10111201 3300009101 Bacteria 1764
466 Ga0105247_10173716 3300009101 Bacteria 1434
467 Ga0105247_10326703 3300009101 Bacteria 1072
468 Ga0105247_10626035 3300009101 Bacteria 801
469 Ga0105247_11489960 3300009101 Bacteria 551
470 Ga0114129_10094982 3300009147 Bacteria 4129
471 Ga0114129_11046888 3300009147 Bacteria 1025
472 Ga0105243_10348898 3300009148 Bacteria 1358
473 Ga0105243_10425063 3300009148 Bacteria 1240
474 Ga0105243_10426587 3300009148 Bacteria 1238
475 Ga0105243_10482934 3300009148 Bacteria 1170
476 Ga0105243_10641955 3300009148 Bacteria 1028
477 Ga0105243_11135730 3300009148 Bacteria 791
478 Ga0105241_10213304 3300009174 Bacteria 1619
479 Ga0105241_10272161 3300009174 Bacteria 1443
480 Ga0105241_10355681 3300009174 Bacteria 1273
481 Ga0105241_10549873 3300009174 Bacteria 1036
482 Ga0105241_10620009 3300009174 Bacteria 979
483 Ga0105241_10972906 3300009174 Bacteria 792
484 Ga0105241_11639194 3300009174 Bacteria 623
485 Ga0105242_10141472 3300009176 Bacteria 2088
486 Ga0105242_10354305 3300009176 Bacteria 1356
487 Ga0105242_10554843 3300009176 Bacteria 1102
488 Ga0105242_11002670 3300009176 Bacteria 843
489 Ga0105242_11378800 3300009176 Bacteria 731
490 Ga0105242_11423383 3300009176 Bacteria 721
491 Ga0105248_10092142 3300009177 Bacteria 3413
492 Ga0105248_10193609 3300009177 Bacteria 2291
493 Ga0105248_10390100 3300009177 Bacteria 1568
494 Ga0105248_10519530 3300009177 Bacteria 1342
495 Ga0105248_12062465 3300009177 Bacteria 648
496 Ga0105237_10011455 3300009545 Bacteria 9381
497 Ga0105237_10011853 3300009545 Bacteria 9220
498 Ga0105237_10086201 3300009545 Bacteria 3130
499 Ga0105237_10097293 3300009545 Bacteria 2933
500 Ga0105237_10114301 3300009545 Bacteria 2692
501 Ga0105237_10169772 3300009545 Bacteria 2181
502 Ga0105237_10219415 3300009545 Bacteria 1902
503 Ga0105237_10238903 3300009545 Bacteria 1818
504 Ga0105237_10241105 3300009545 Bacteria 1809
505 Ga0105237_10444817 3300009545 Bacteria 1302
506 Ga0105237_10536873 3300009545 Bacteria 1176
507 Ga0105237_10584995 3300009545 Bacteria 1123
508 Ga0105237_10615541 3300009545 Bacteria 1093
509 Ga0105237_10616179 3300009545 Bacteria 1092
510 Ga0105237_11437595 3300009545 Bacteria 696
511 Ga0105238_10019915 3300009551 Bacteria 6829
512 Ga0105238_10040344 3300009551 Bacteria 4730
513 Ga0105238_10158575 3300009551 Bacteria 2238
514 Ga0105238_10367611 3300009551 Bacteria 1428
515 Ga0105238_10544241 3300009551 Bacteria 1165
516 Ga0105238_10623145 3300009551 Bacteria 1088
517 Ga0105238_10939183 3300009551 Bacteria 884
518 Ga0105238_11053867 3300009551 Bacteria 835
519 Ga0105238_11109942 3300009551 Bacteria 814
520 Ga0105238_11537075 3300009551 Bacteria 695
521 Ga0105249_10112279 3300009553 Bacteria 2578
522 Ga0105249_10343517 3300009553 Bacteria 1510
523 Ga0105249_10365524 3300009553 Bacteria 1465
524 Ga0105249_10484987 3300009553 Bacteria 1279
525 Ga0105249_10558578 3300009553 Bacteria 1196
526 Ga0105249_10768229 3300009553 Bacteria 1026
527 Ga0105249_10797505 3300009553 Bacteria 1008
528 Ga0099796_10039287 3300010159 Bacteria 1592
529 Ga0099796_10177506 3300010159 Bacteria 853
530 Ga0105239_10014622 3300010375 Bacteria 8707
531 Ga0105239_10060173 3300010375 Bacteria 4168
532 Ga0105239_10101440 3300010375 Bacteria 3184
533 Ga0105239_10146596 3300010375 Bacteria 2633
534 Ga0105239_10305254 3300010375 Bacteria 1793
535 Ga0105239_10344857 3300010375 Bacteria 1681
536 Ga0105239_10347818 3300010375 Bacteria 1674
537 Ga0105239_10658603 3300010375 Bacteria 1196
538 Ga0105239_10750366 3300010375 Bacteria 1117
539 Ga0105239_10877438 3300010375 Bacteria 1029
540 Ga0105239_11012255 3300010375 Bacteria 955
541 Ga0105239_11863527 3300010375 Bacteria 697
542 Ga0105239_12030481 3300010375 Bacteria 668
543 Ga0105246_10109343 3300011119 Bacteria 2028
544 Ga0105246_10125732 3300011119 Bacteria 1907
545 Ga0105246_10341683 3300011119 Bacteria 1224
546 Ga0105246_10495821 3300011119 Bacteria 1036
547 Ga0157322_1015048 3300012490 Bacteria 684
548 Ga0157370_10072120 3300013104 Bacteria 3259
549 Ga0157370_10215461 3300013104 Bacteria 1779
550 Ga0157369_10009427 3300013105 Bacteria 11159
551 Ga0157369_10082239 3300013105 Bacteria 3445
552 Ga0157369_10359852 3300013105 Bacteria 1511
553 Ga0157369_10831237 3300013105 Bacteria 948
554 Ga0157369_11708722 3300013105 Bacteria 639
555 Ga0157374_10302149 3300013296 Bacteria 1583
556 Ga0157374_10361112 3300013296 Bacteria 1444
557 Ga0157374_10514659 3300013296 Bacteria 1202
558 Ga0157374_10685682 3300013296 Bacteria 1037
559 Ga0157374_10698253 3300013296 Bacteria 1027
560 Ga0157374_11073353 3300013296 Bacteria 825
561 Ga0157374_11814055 3300013296 Bacteria 635
562 Ga0157378_10093914 3300013297 Bacteria 2731
563 Ga0157378_10101987 3300013297 Bacteria 2621
564 Ga0157378_10351095 3300013297 Bacteria 1441
565 Ga0157378_10391855 3300013297 Bacteria 1366
566 Ga0157378_10558750 3300013297 Bacteria 1151
567 Ga0157378_10749351 3300013297 Bacteria 999
568 Ga0157378_10913054 3300013297 Bacteria 909
569 Ga0157378_11256875 3300013297 Bacteria 781
570 Ga0163162_10178728 3300013306 Bacteria 2248
571 Ga0163162_10366238 3300013306 Bacteria 1574
572 Ga0163162_10581263 3300013306 Bacteria 1247
573 Ga0163162_10691844 3300013306 Bacteria 1142
574 Ga0163162_10717647 3300013306 Bacteria 1120
575 Ga0163162_10826408 3300013306 Bacteria 1043
576 Ga0163162_11020970 3300013306 Bacteria 935
577 Ga0163162_11622451 3300013306 Bacteria 738
578 Ga0157372_10045709 3300013307 Bacteria 4858
579 Ga0157372_10175850 3300013307 Bacteria 2477
580 Ga0157372_10565752 3300013307 Bacteria 1325
581 Ga0157372_11873765 3300013307 Bacteria 689
582 Ga0157375_10106252 3300013308 Bacteria 2899
583 Ga0157375_10162243 3300013308 Bacteria 2378
584 Ga0157375_10276890 3300013308 Bacteria 1840
585 Ga0157375_10449721 3300013308 Bacteria 1454
586 Ga0157375_10657845 3300013308 Bacteria 1204
587 Ga0157375_11243852 3300013308 Bacteria 874
588 Ga0163163_10024503 3300014325 Bacteria 5743
589 Ga0163163_10029342 3300014325 Bacteria 5290
590 Ga0163163_10424285 3300014325 Bacteria 1389
591 Ga0163163_10679881 3300014325 Bacteria 1093
592 Ga0163163_11101661 3300014325 Bacteria 857
593 Ga0163163_11748227 3300014325 Bacteria 682
594 Ga0157380_10224193 3300014326 Bacteria 1684
595 Ga0157380_10265137 3300014326 Bacteria 1562
596 Ga0157380_10324581 3300014326 Bacteria 1429
597 Ga0157380_10451055 3300014326 Bacteria 1235
598 Ga0157380_10580993 3300014326 Bacteria 1105
599 Ga0157380_10621076 3300014326 Bacteria 1073
600 Ga0157380_11296949 3300014326 Bacteria 775
601 Ga0182008_10384751 3300014497 Bacteria 751
602 Ga0157377_10056720 3300014745 Bacteria 2225
603 Ga0157377_10592327 3300014745 Bacteria 790
604 Ga0157379_10313136 3300014968 Bacteria 1432
605 Ga0157379_10317066 3300014968 Bacteria 1423
606 Ga0157379_11182255 3300014968 Bacteria 735
607 Ga0157376_10016269 3300014969 Bacteria 5641
608 Ga0157376_10106056 3300014969 Bacteria 2465
609 Ga0157376_10431434 3300014969 Bacteria 1281
610 Ga0157376_10778395 3300014969 Bacteria 968
611 Ga0157376_10970759 3300014969 Bacteria 871
612 Ga0157376_11054484 3300014969 Bacteria 837
613 Ga0157376_11148358 3300014969 Bacteria 804
614 Ga0182005_1189930 3300015265 Bacteria 613
615 Ga0163161_10048495 3300017792 Bacteria 3067
616 Ga0163161_10102197 3300017792 Bacteria 2135
617 Ga0163161_10405149 3300017792 Bacteria 1094
618 Ga0163161_10487267 3300017792 Bacteria 1002
619 Ga0163161_10593028 3300017792 Bacteria 913
620 Ga0184599_100945 3300019188 Bacteria 876
621 Ga0197907_10228093 3300020069 Bacteria 511
622 Ga0197907_10342790 3300020069 Bacteria 602
623 Ga0197907_10419893 3300020069 Bacteria 1157
624 Ga0206356_10110208 3300020070 Bacteria 704
625 Ga0206356_11432654 3300020070 Bacteria 837
626 Ga0206355_1173982 3300020076 Bacteria 842
627 Ga0206355_1416067 3300020076 Bacteria 582
628 Ga0206350_11290848 3300020080 Bacteria 675
629 Ga0206350_11293925 3300020080 Bacteria 516
630 Ga0206350_11433473 3300020080 Bacteria 569
631 Ga0206350_11626606 3300020080 Bacteria 522
632 Ga0206354_11361333 3300020081 Bacteria 847
633 Ga0206353_10413424 3300020082 Bacteria 703
634 Ga0206353_11952916 3300020082 Bacteria 780
635 Ga0154015_1079109 3300020610 Bacteria 844
636 Ga0154015_1436508 3300020610 Bacteria 775
637 Ga0214544_1000002 3300021320 Bacteria 753857
638 Ga0214542_1000001 3300021321 Bacteria 1018696
639 Ga0214545_1000001 3300021324 Bacteria 1092817
640 Ga0214543_1000001 3300021327 Bacteria 776921
641 Ga0213872_10201321 3300021361 Bacteria 853
642 Ga0213874_10050529 3300021377 Bacteria 1274
643 Ga0213874_10397644 3300021377 Bacteria 536
644 Ga0213876_10132243 3300021384 Bacteria 1326
645 Ga0213876_10296497 3300021384 Bacteria 859
646 Ga0213875_10074750 3300021388 Bacteria 1581
647 Ga0213871_10001152 3300021441 Bacteria 4225
648 Ga0213871_10209370 3300021441 Bacteria 610
649 Ga0224712_10044519 3300022467 Bacteria 1693
650 Ga0224712_10231132 3300022467 Bacteria 849
651 Ga0224712_10463194 3300022467 Bacteria 610
652 Ga0228598_1043871 3300024227 Bacteria 884
653 Ga0209563_107702 3300025230 Bacteria 1749
654 Ga0207425_1006689 3300025245 Bacteria 3126
655 Ga0209677_102003 3300025253 Bacteria 8103
656 Ga0209677_105594 3300025253 Bacteria 3237
657 Ga0209148_1000937 3300025254 Bacteria 19219
658 Ga0209148_1010941 3300025254 Bacteria 1701
659 Ga0209233_1001535 3300025261 Bacteria 9050
660 Ga0209233_1006855 3300025261 Bacteria 3644
661 Ga0209233_1009396 3300025261 Bacteria 2977
662 Ga0209233_1054330 3300025261 Bacteria 800
663 Ga0209455_1003495 3300025272 Bacteria 5532
664 Ga0209455_1003839 3300025272 Bacteria 5137
665 Ga0209455_1005796 3300025272 Bacteria 3753
666 Ga0209564_1003386 3300025295 Bacteria 10994
667 Ga0209758_1000024 3300025297 Bacteria 591966
668 Ga0209758_1000068 3300025297 Bacteria 286488
669 Ga0209758_1000868 3300025297 Bacteria 41599
670 Ga0209758_1001914 3300025297 Bacteria 22658
671 Ga0209758_1011456 3300025297 Bacteria 5135
672 Ga0209758_1022253 3300025297 Bacteria 2916
673 Ga0209758_1044070 3300025297 Bacteria 1636
674 Ga0209758_1080453 3300025297 Bacteria 987
675 Ga0209758_1132451 3300025297 Bacteria 657
676 Ga0209256_1004276 3300025299 Bacteria 9114
677 Ga0207426_1000439 3300025302 Bacteria 67107
678 Ga0207426_1000588 3300025302 Bacteria 48329
679 Ga0207426_1031729 3300025302 Bacteria 1721
680 Ga0207426_1053615 3300025302 Bacteria 1190
681 Ga0209257_1000416 3300025304 Bacteria 82474
682 Ga0207697_10013313 3300025315 Bacteria 3432
683 Ga0207656_10088718 3300025321 Bacteria 1401
684 Ga0207656_10260902 3300025321 Bacteria 851
685 Ga0207682_10048527 3300025893 Bacteria 1750
686 Ga0207692_10001654 3300025898 Bacteria 8430
687 Ga0207692_10016870 3300025898 Bacteria 3245
688 Ga0207692_10020606 3300025898 Bacteria 3002
689 Ga0207692_10165486 3300025898 Bacteria 1278
690 Ga0207642_10147160 3300025899 Bacteria 1249
691 Ga0207642_10187169 3300025899 Bacteria 1133
692 Ga0207710_10051918 3300025900 Bacteria 1842
693 Ga0207710_10235485 3300025900 Bacteria 912
694 Ga0207710_10394541 3300025900 Bacteria 710
695 Ga0207710_10426103 3300025900 Bacteria 683
696 Ga0207710_10731267 3300025900 Bacteria 520
697 Ga0207688_10150019 3300025901 Bacteria 1376
698 Ga0207688_10158316 3300025901 Bacteria 1341
699 Ga0207688_10189663 3300025901 Bacteria 1229
700 Ga0207688_10203964 3300025901 Bacteria 1186
701 Ga0207688_10352174 3300025901 Bacteria 907
702 Ga0207688_10503753 3300025901 Bacteria 758
703 Ga0207680_10107680 3300025903 Bacteria 1802
704 Ga0207680_10262811 3300025903 Bacteria 1195
705 Ga0207680_10401503 3300025903 Bacteria 969
706 Ga0207680_10417301 3300025903 Bacteria 950
707 Ga0207647_10215757 3300025904 Bacteria 1107
708 Ga0207647_10273744 3300025904 Bacteria 965
709 Ga0207647_10618347 3300025904 Bacteria 596
710 Ga0207647_10626169 3300025904 Bacteria 592
711 Ga0207685_10035338 3300025905 Bacteria 1823
712 Ga0207685_10156619 3300025905 Bacteria 1036
713 Ga0207699_10002873 3300025906 Bacteria 8166
714 Ga0207699_10048826 3300025906 Bacteria 2488
715 Ga0207699_10059739 3300025906 Bacteria 2286
716 Ga0207699_11224738 3300025906 Bacteria 556
717 Ga0207645_10113976 3300025907 Bacteria 1752
718 Ga0207645_10724960 3300025907 Bacteria 676
719 Ga0207643_10228830 3300025908 Bacteria 1140
720 Ga0207643_10275313 3300025908 Bacteria 1042
721 Ga0207705_10013315 3300025909 Bacteria 5935
722 Ga0207705_10116331 3300025909 Bacteria 1980
723 Ga0207684_10426665 3300025910 Bacteria 1139
724 Ga0207684_11365789 3300025910 Bacteria 581
725 Ga0207654_10099641 3300025911 Bacteria 1788
726 Ga0207654_10173538 3300025911 Bacteria 1402
727 Ga0207654_10307919 3300025911 Bacteria 1079
728 Ga0207654_10896951 3300025911 Bacteria 643
729 Ga0207707_10000826 3300025912 Bacteria 30384
730 Ga0207707_10007843 3300025912 Bacteria 9281
731 Ga0207707_10027522 3300025912 Bacteria 4971
732 Ga0207707_10127237 3300025912 Bacteria 2228
733 Ga0207707_10184358 3300025912 Bacteria 1821
734 Ga0207707_10242608 3300025912 Bacteria 1566
735 Ga0207695_10000008 3300025913 Bacteria 1058268
736 Ga0207695_10265024 3300025913 Bacteria 1615
737 Ga0207695_10452512 3300025913 Bacteria 1167
738 Ga0207695_10486791 3300025913 Bacteria 1116
739 Ga0207695_10686740 3300025913 Bacteria 904
740 Ga0207695_10820937 3300025913 Bacteria 810
741 Ga0207695_11052129 3300025913 Bacteria 694
742 Ga0207671_10002506 3300025914 Bacteria 19597
743 Ga0207671_10040502 3300025914 Bacteria 3449
744 Ga0207671_10094186 3300025914 Bacteria 2260
745 Ga0207671_10109709 3300025914 Bacteria 2098
746 Ga0207671_10155463 3300025914 Bacteria 1769
747 Ga0207671_10227952 3300025914 Bacteria 1461
748 Ga0207671_10303328 3300025914 Bacteria 1262
749 Ga0207671_10463011 3300025914 Bacteria 1010
750 Ga0207671_10468832 3300025914 Bacteria 1003
751 Ga0207671_10542907 3300025914 Bacteria 927
752 Ga0207671_10596668 3300025914 Bacteria 880
753 Ga0207671_11445674 3300025914 Bacteria 532
754 Ga0207693_10007358 3300025915 Bacteria 9057
755 Ga0207693_10017927 3300025915 Bacteria 5644
756 Ga0207693_10095120 3300025915 Bacteria 2335
757 Ga0207663_10000319 3300025916 Bacteria 20997
758 Ga0207663_10040286 3300025916 Bacteria 2838
759 Ga0207663_10092947 3300025916 Bacteria 2006
760 Ga0207663_10117794 3300025916 Bacteria 1813
761 Ga0207663_10139970 3300025916 Bacteria 1684
762 Ga0207663_10274621 3300025916 Bacteria 1250
763 Ga0207663_10403616 3300025916 Bacteria 1046
764 Ga0207663_11252023 3300025916 Bacteria 598
765 Ga0207663_11261774 3300025916 Bacteria 595
766 Ga0207660_10020422 3300025917 Bacteria 4444
767 Ga0207660_10025033 3300025917 Bacteria 4048
768 Ga0207660_10049281 3300025917 Bacteria 2985
769 Ga0207660_10054290 3300025917 Bacteria 2859
770 Ga0207660_10557600 3300025917 Bacteria 932
771 Ga0207660_10688290 3300025917 Bacteria 834
772 Ga0207662_10035786 3300025918 Bacteria 2901
773 Ga0207657_10067780 3300025919 Bacteria 3033
774 Ga0207657_10171584 3300025919 Bacteria 1757
775 Ga0207657_10327604 3300025919 Bacteria 1210
776 Ga0207657_10741180 3300025919 Bacteria 761
777 Ga0207657_10955243 3300025919 Bacteria 659
778 Ga0207657_11447877 3300025919 Bacteria 515
779 Ga0207649_10141860 3300025920 Bacteria 1645
780 Ga0207649_10162873 3300025920 Bacteria 1547
781 Ga0207649_10202542 3300025920 Bacteria 1403
782 Ga0207649_10204179 3300025920 Bacteria 1398
783 Ga0207652_10005120 3300025921 Bacteria 10636
784 Ga0207652_10010590 3300025921 Bacteria 7422
785 Ga0207652_10108119 3300025921 Bacteria 2464
786 Ga0207652_10134281 3300025921 Bacteria 2209
787 Ga0207652_10402413 3300025921 Bacteria 1235
788 Ga0207652_10461074 3300025921 Bacteria 1145
789 Ga0207646_10131589 3300025922 Bacteria 2252
790 Ga0207681_10145678 3300025923 Bacteria 1769
791 Ga0207681_10252641 3300025923 Bacteria 1377
792 Ga0207681_10531394 3300025923 Bacteria 966
793 Ga0207681_10677081 3300025923 Bacteria 856
794 Ga0207694_10041481 3300025924 Bacteria 3547
795 Ga0207694_10168238 3300025924 Bacteria 1773
796 Ga0207694_10499756 3300025924 Bacteria 1018
797 Ga0207694_11008127 3300025924 Bacteria 705
798 Ga0207694_11414310 3300025924 Bacteria 588
799 Ga0207650_10382246 3300025925 Bacteria 1163
800 Ga0207650_10597304 3300025925 Bacteria 928
801 Ga0207659_10186349 3300025926 Bacteria 1648
802 Ga0207659_10294987 3300025926 Bacteria 1330
803 Ga0207659_10765274 3300025926 Bacteria 829
804 Ga0207659_10849723 3300025926 Bacteria 784
805 Ga0207687_10020131 3300025927 Bacteria 4425
806 Ga0207687_10091903 3300025927 Bacteria 2215
807 Ga0207687_10230466 3300025927 Bacteria 1463
808 Ga0207687_10239517 3300025927 Bacteria 1437
809 Ga0207687_10840991 3300025927 Bacteria 784
810 Ga0207700_10062435 3300025928 Bacteria 2830
811 Ga0207700_10085245 3300025928 Bacteria 2479
812 Ga0207700_10193602 3300025928 Bacteria 1710
813 Ga0207700_10224263 3300025928 Bacteria 1595
814 Ga0207700_10266542 3300025928 Bacteria 1468
815 Ga0207700_10656911 3300025928 Bacteria 935
816 Ga0207700_10709864 3300025928 Bacteria 898
817 Ga0207664_10030772 3300025929 Bacteria 4102
818 Ga0207664_10056442 3300025929 Bacteria 3119
819 Ga0207664_10061287 3300025929 Bacteria 3001
820 Ga0207664_10098419 3300025929 Bacteria 2412
821 Ga0207664_10373614 3300025929 Bacteria 1265
822 Ga0207644_10080535 3300025931 Bacteria 2405
823 Ga0207644_10105628 3300025931 Bacteria 2122
824 Ga0207644_10509857 3300025931 Bacteria 993
825 Ga0207644_11251588 3300025931 Bacteria 624
826 Ga0207690_10066263 3300025932 Bacteria 2473
827 Ga0207690_10295201 3300025932 Bacteria 1266
828 Ga0207690_10362385 3300025932 Bacteria 1149
829 Ga0207706_10154348 3300025933 Bacteria 2020
830 Ga0207706_10170648 3300025933 Bacteria 1911
831 Ga0207706_10248345 3300025933 Bacteria 1555
832 Ga0207706_10397870 3300025933 Bacteria 1194
833 Ga0207706_10511672 3300025933 Bacteria 1036
834 Ga0207706_10952814 3300025933 Bacteria 723
835 Ga0207686_10028779 3300025934 Bacteria 3269
836 Ga0207686_10553004 3300025934 Bacteria 900
837 Ga0207709_10540714 3300025935 Bacteria 915
838 Ga0207709_10578105 3300025935 Bacteria 887
839 Ga0207709_10727430 3300025935 Bacteria 796
840 Ga0207709_11668003 3300025935 Bacteria 530
841 Ga0207670_10412135 3300025936 Bacteria 1082
842 Ga0207670_10953341 3300025936 Bacteria 720
843 Ga0207669_10003771 3300025937 Bacteria 6587
844 Ga0207669_10141448 3300025937 Bacteria 1671
845 Ga0207704_10101101 3300025938 Bacteria 1922
846 Ga0207704_10484866 3300025938 Bacteria 993
847 Ga0207704_11137547 3300025938 Bacteria 664
848 Ga0207665_10017908 3300025939 Bacteria 4656
849 Ga0207665_10024487 3300025939 Bacteria 3980
850 Ga0207665_10126280 3300025939 Bacteria 1811
851 Ga0207665_10156826 3300025939 Bacteria 1634
852 Ga0207665_10210819 3300025939 Bacteria 1419
853 Ga0207665_10713276 3300025939 Bacteria 789
854 Ga0207665_10963198 3300025939 Bacteria 678
855 Ga0207665_11520286 3300025939 Bacteria 532
856 Ga0207691_10229003 3300025940 Bacteria 1610
857 Ga0207691_10256183 3300025940 Bacteria 1509
858 Ga0207691_10263244 3300025940 Bacteria 1486
859 Ga0207691_10335120 3300025940 Bacteria 1296
860 Ga0207691_10475901 3300025940 Bacteria 1062
861 Ga0207711_10087354 3300025941 Bacteria 2736
862 Ga0207711_10144955 3300025941 Bacteria 2139
863 Ga0207711_10173011 3300025941 Bacteria 1960
864 Ga0207711_10253065 3300025941 Bacteria 1618
865 Ga0207711_10381457 3300025941 Bacteria 1308
866 Ga0207711_10571961 3300025941 Bacteria 1054
867 Ga0207711_10872318 3300025941 Bacteria 837
868 Ga0207711_10945904 3300025941 Bacteria 800
869 Ga0207689_10181040 3300025942 Bacteria 1738
870 Ga0207689_10229251 3300025942 Bacteria 1535
871 Ga0207689_10239433 3300025942 Bacteria 1500
872 Ga0207689_10345056 3300025942 Bacteria 1237
873 Ga0207689_10426828 3300025942 Bacteria 1106
874 Ga0207661_10012708 3300025944 Bacteria 6131
875 Ga0207661_10016612 3300025944 Bacteria 5432
876 Ga0207661_10077987 3300025944 Bacteria 2726
877 Ga0207661_10514214 3300025944 Bacteria 1095
878 Ga0207661_11270711 3300025944 Bacteria 677
879 Ga0207679_10190441 3300025945 Bacteria 1705
880 Ga0207679_10316900 3300025945 Bacteria 1349
881 Ga0207667_10006896 3300025949 Bacteria 13722
882 Ga0207667_10107367 3300025949 Bacteria 2880
883 Ga0207667_10135958 3300025949 Bacteria 2531
884 Ga0207667_10465350 3300025949 Bacteria 1284
885 Ga0207667_10510429 3300025949 Bacteria 1218
886 Ga0207667_10889946 3300025949 Bacteria 883
887 Ga0207651_10199837 3300025960 Bacteria 1601
888 Ga0207651_10824544 3300025960 Bacteria 823
889 Ga0207651_11052489 3300025960 Bacteria 728
890 Ga0207651_11072559 3300025960 Bacteria 721
891 Ga0207712_10346127 3300025961 Bacteria 1234
892 Ga0207712_10352835 3300025961 Bacteria 1223
893 Ga0207712_10441736 3300025961 Bacteria 1102
894 Ga0207712_10879690 3300025961 Bacteria 791
895 Ga0207668_10132136 3300025972 Bacteria 1907
896 Ga0207668_10205749 3300025972 Bacteria 1570
897 Ga0207668_10297084 3300025972 Bacteria 1331
898 Ga0207668_10528425 3300025972 Bacteria 1019
899 Ga0207668_10671721 3300025972 Bacteria 908
900 Ga0207668_10697039 3300025972 Bacteria 892
901 Ga0207668_10955354 3300025972 Bacteria 764
902 Ga0207640_10160439 3300025981 Bacteria 1663
903 Ga0207640_10199400 3300025981 Bacteria 1516
904 Ga0207640_10672463 3300025981 Bacteria 884
905 Ga0207640_11192320 3300025981 Bacteria 677
906 Ga0207640_12146876 3300025981 Bacteria 507
907 Ga0207658_10058005 3300025986 Bacteria 2879
908 Ga0207658_10282048 3300025986 Bacteria 1424
909 Ga0207658_10558511 3300025986 Bacteria 1025
910 Ga0207658_10591261 3300025986 Bacteria 996
911 Ga0207658_11514696 3300025986 Bacteria 613
912 Ga0207677_10031707 3300026023 Bacteria 3387
913 Ga0207677_10035214 3300026023 Bacteria 3249
914 Ga0207677_10475144 3300026023 Bacteria 1076
915 Ga0207677_11275074 3300026023 Bacteria 674
916 Ga0207703_10290205 3300026035 Bacteria 1488
917 Ga0207703_10384161 3300026035 Bacteria 1299
918 Ga0207703_10384886 3300026035 Bacteria 1298
919 Ga0207703_10517160 3300026035 Bacteria 1122
920 Ga0207703_10558189 3300026035 Bacteria 1080
921 Ga0207703_10699444 3300026035 Bacteria 964
922 Ga0207703_10779765 3300026035 Bacteria 912
923 Ga0207703_10921958 3300026035 Bacteria 837
924 Ga0207639_10035654 3300026041 Bacteria 3682
925 Ga0207639_10089910 3300026041 Bacteria 2455
926 Ga0207639_10240102 3300026041 Bacteria 1575
927 Ga0207639_10973768 3300026041 Bacteria 794
928 Ga0207639_10998263 3300026041 Bacteria 784
929 Ga0207639_11168733 3300026041 Bacteria 722
930 Ga0207639_11476144 3300026041 Bacteria 638
931 Ga0207678_10036770 3300026067 Bacteria 4263
932 Ga0207678_10123193 3300026067 Bacteria 2212
933 Ga0207678_10235707 3300026067 Bacteria 1567
934 Ga0207678_10242405 3300026067 Bacteria 1544
935 Ga0207678_10279066 3300026067 Bacteria 1434
936 Ga0207678_10753343 3300026067 Bacteria 859
937 Ga0207678_10903568 3300026067 Bacteria 781
938 Ga0207678_10980797 3300026067 Bacteria 748
939 Ga0207708_10902697 3300026075 Bacteria 765
940 Ga0207702_10003278 3300026078 Bacteria 14933
941 Ga0207702_10346714 3300026078 Bacteria 1420
942 Ga0207702_10358010 3300026078 Bacteria 1398
943 Ga0207702_10680515 3300026078 Bacteria 1013
944 Ga0207702_11183450 3300026078 Bacteria 759
945 Ga0207702_11248750 3300026078 Bacteria 737
946 Ga0207641_10050159 3300026088 Bacteria 3530
947 Ga0207641_10262064 3300026088 Bacteria 1619
948 Ga0207641_10428092 3300026088 Bacteria 1275
949 Ga0207641_11662758 3300026088 Bacteria 640
950 Ga0207648_10069649 3300026089 Bacteria 3065
951 Ga0207648_10334504 3300026089 Bacteria 1363
952 Ga0207648_10710431 3300026089 Bacteria 932
953 Ga0207648_10916785 3300026089 Bacteria 819
954 Ga0207676_10168213 3300026095 Bacteria 1907
955 Ga0207676_10303983 3300026095 Bacteria 1457
956 Ga0207676_10682204 3300026095 Bacteria 994
957 Ga0207676_11132694 3300026095 Bacteria 774
958 Ga0207676_11291518 3300026095 Bacteria 724
959 Ga0207674_10020869 3300026116 Bacteria 7069
960 Ga0207674_10048135 3300026116 Bacteria 4365
961 Ga0207674_10138094 3300026116 Bacteria 2398
962 Ga0207674_10343099 3300026116 Bacteria 1444
963 Ga0207675_100096518 3300026118 Bacteria 2783
964 Ga0207675_100278873 3300026118 Bacteria 1624
965 Ga0207675_100395688 3300026118 Bacteria 1361
966 Ga0207675_100936008 3300026118 Bacteria 883
967 Ga0207683_10049400 3300026121 Bacteria 3683
968 Ga0207683_10119465 3300026121 Bacteria 2365
969 Ga0207683_10465752 3300026121 Bacteria 1166
970 Ga0207683_10629720 3300026121 Bacteria 993
971 Ga0207683_10641731 3300026121 Bacteria 983
972 Ga0207683_10748605 3300026121 Bacteria 907
973 Ga0207683_11508006 3300026121 Bacteria 621
974 Ga0207698_10094109 3300026142 Bacteria 2462
975 Ga0207698_10211648 3300026142 Bacteria 1745
976 Ga0207698_10327332 3300026142 Bacteria 1438
977 Ga0207698_10631835 3300026142 Bacteria 1059
978 Ga0207698_10814746 3300026142 Bacteria 937
979 Ga0207698_11082457 3300026142 Bacteria 814
980 Ga0209389_1000100 3300027296 Bacteria 79023
981 Ga0209389_1000181 3300027296 Bacteria 49013
982 Ga0209589_1000001 3300027357 Bacteria 794224
983 Ga0209589_1000092 3300027357 Bacteria 89530
984 Ga0209489_100001 3300027361 Bacteria 794224
985 Ga0209489_100006 3300027361 Bacteria 475698
986 Ga0209489_103729 3300027361 Bacteria 29160
987 Ga0209700_100001 3300027363 Bacteria 794224
988 Ga0209700_100005 3300027363 Bacteria 573969
989 Ga0209179_1047999 3300027512 Bacteria 911
990 Ga0209588_1000484 3300027671 Bacteria 10221
991 Ga0209813_10017923 3300027866 Bacteria 1950
992 Ga0209813_10051610 3300027866 Bacteria 1287
993 Ga0209813_10268314 3300027866 Bacteria 654
994 Ga0268266_10005138 3300028379 Bacteria 12330
995 Ga0268266_10008212 3300028379 Bacteria 9306
996 Ga0268266_10015621 3300028379 Bacteria 6506
997 Ga0268266_10073814 3300028379 Bacteria 2961
998 Ga0268266_10109916 3300028379 Bacteria 2441
999 Ga0268266_10233874 3300028379 Bacteria 1693
1000 Ga0268266_10235310 3300028379 Bacteria 1688
1001 Ga0268266_10524081 3300028379 Bacteria 1133
1002 Ga0268266_10556684 3300028379 Bacteria 1099
1003 Ga0268266_11167988 3300028379 Bacteria 744
1004 Ga0268266_11257212 3300028379 Bacteria 715
1005 Ga0268266_11457876 3300028379 Bacteria 660
1006 Ga0268265_10055455 3300028380 Bacteria 3011
1007 Ga0268265_10101908 3300028380 Bacteria 2320
1008 Ga0268265_10350086 3300028380 Bacteria 1348
1009 Ga0268265_10614647 3300028380 Bacteria 1040
1010 Ga0268265_10722155 3300028380 Bacteria 964
1011 Ga0268265_11019044 3300028380 Bacteria 818
1012 Ga0268264_10000065 3300028381 Bacteria 298403
1013 Ga0268264_10214093 3300028381 Bacteria 1770
1014 Ga0268264_10265107 3300028381 Bacteria 1602
1015 Ga0268264_10288007 3300028381 Bacteria 1541
1016 Ga0268264_10866859 3300028381 Bacteria 905
1017 Ga0268264_11296331 3300028381 Bacteria 738
1018 Ga0268264_11883137 3300028381 Bacteria 608
1019 Ga0265319_1094678 3300028563 Bacteria 941
1020 Ga0265318_10070211 3300028577 Bacteria 1299
1021 Ga0265323_10025339 3300028653 Bacteria 2246
1022 Ga0265336_10000093 3300028666 Bacteria 68442
1023 Ga0307517_10000008 3300028786 Bacteria 243202
1024 Ga0307517_10321310 3300028786 Bacteria 856
1025 Ga0307515_10087661 3300028794 Bacteria 3946
1026 Ga0307515_10375291 3300028794 Bacteria 1057
1027 Ga0307515_10698827 3300028794 Bacteria 630
1028 Ga0265338_10000078 3300028800 Bacteria 177516
1029 Ga0265338_10877624 3300028800 Bacteria 612
1030 Ga0307511_10078029 3300030521 Bacteria 2352
1031 Ga0307511_10198460 3300030521 Bacteria 1047
1032 Ga0265330_10039705 3300031235 Bacteria 2091
1033 Ga0265332_10030775 3300031238 Bacteria 2343
1034 Ga0265332_10163272 3300031238 Bacteria 930
1035 Ga0265328_10049994 3300031239 Bacteria 1535
1036 Ga0265325_10017991 3300031241 Bacteria 3923
1037 Ga0265325_10026729 3300031241 Bacteria 3124
1038 Ga0265340_10001286 3300031247 Bacteria 14397
1039 Ga0265340_10004003 3300031247 Bacteria 8284
1040 Ga0265339_10033591 3300031249 Bacteria 2887
1041 Ga0265339_10580716 3300031249 Bacteria 514
1042 Ga0265331_10049850 3300031250 Bacteria 2010
1043 Ga0265316_10056419 3300031344 Bacteria 3068
1044 Ga0265316_10144331 3300031344 Bacteria 1786
1045 Ga0307513_10716312 3300031456 Bacteria 706
1046 Ga0307509_10409464 3300031507 Bacteria 1060
1047 Ga0307509_10424779 3300031507 Bacteria 1029
1048 Ga0307509_10506575 3300031507 Bacteria 891
1049 Ga0307408_100686805 3300031548 Bacteria 919
1050 Ga0307408_100819365 3300031548 Bacteria 846
1051 Ga0307508_10000235 3300031616 Bacteria 67350
1052 Ga0307508_10183601 3300031616 Bacteria 1694
1053 Ga0307508_10579519 3300031616 Bacteria 722
1054 Ga0307514_10248899 3300031649 Bacteria 1055
1055 Ga0265314_10023327 3300031711 Bacteria 4719
1056 Ga0265314_10037345 3300031711 Bacteria 3520
1057 Ga0265314_10040511 3300031711 Bacteria 3343
1058 Ga0265342_10000178 3300031712 Bacteria 70648
1059 Ga0265342_10005077 3300031712 Bacteria 10147
1060 Ga0265342_10236495 3300031712 Bacteria 979
1061 Ga0265342_10287020 3300031712 Bacteria 870
1062 Ga0307516_10004958 3300031730 Bacteria 16170
1063 Ga0307516_10006838 3300031730 Bacteria 13294
1064 Ga0307516_10036390 3300031730 Bacteria 4926
1065 Ga0307516_10194973 3300031730 Bacteria 1749
1066 Ga0307516_10195687 3300031730 Bacteria 1744
1067 Ga0307516_10297050 3300031730 Bacteria 1292
1068 Ga0307516_10568637 3300031730 Bacteria 787
1069 Ga0307405_11005939 3300031731 Bacteria 711
1070 Ga0316044_118058 3300031810 Bacteria 752
1071 Ga0316045_127981 3300031815 Bacteria 501
1072 Ga0307413_10457948 3300031824 Bacteria 1014
1073 Ga0307518_10255667 3300031838 Bacteria 1109
1074 Ga0307410_10468545 3300031852 Bacteria 1031
1075 Ga0307410_10886051 3300031852 Bacteria 764
1076 Ga0307410_11112938 3300031852 Bacteria 685
1077 Ga0307406_10291801 3300031901 Bacteria 1249
1078 Ga0307406_10324762 3300031901 Bacteria 1192
1079 Ga0307406_10498567 3300031901 Bacteria 987
1080 Ga0307407_10226245 3300031903 Bacteria 1268
1081 Ga0307407_11215626 3300031903 Bacteria 589
1082 Ga0307412_10214350 3300031911 Bacteria 1472
1083 Ga0307412_10506579 3300031911 Bacteria 1006
1084 Ga0307412_10797163 3300031911 Bacteria 820
1085 Ga0307412_11810814 3300031911 Bacteria 562
1086 Ga0307409_101006289 3300031995 Bacteria 852
1087 Ga0307416_100775190 3300032002 Bacteria 1053
1088 Ga0307416_100793144 3300032002 Bacteria 1042
1089 Ga0307416_101176819 3300032002 Bacteria 872
1090 Ga0307416_101801308 3300032002 Bacteria 716
1091 Ga0307414_10868195 3300032004 Bacteria 826
1092 Ga0307414_11053743 3300032004 Bacteria 750
1093 Ga0307411_10011395 3300032005 Bacteria 4798
1094 Ga0307411_10189310 3300032005 Bacteria 1570
1095 Ga0307415_100100438 3300032126 Bacteria 2120
1096 Ga0307415_100180137 3300032126 Bacteria 1657
1097 Ga0307415_102561598 3300032126 Bacteria 503
1098 Ga0307507_10344829 3300033179 Bacteria 880
1099 Ga0307510_10059492 3300033180 Bacteria 3944
1100 Ga0307510_10253288 3300033180 Bacteria 1247
1101 Ga0307510_10298770 3300033180 Bacteria 1073
1102 Ga0307510_10580586 3300033180 Bacteria 570
1103 Ga0315911_1000002 3300033442 Bacteria 926833
1104 Ga0373926_0038090 3300035083 Bacteria 1712
1105 Ga0373926_0080313 3300035083 Bacteria 1206
1106 Ga0373929_0034492 3300035085 Bacteria 1098
1107 Ga0373934_0133445 3300035086 Bacteria 1013
1108 Ga0373934_0171858 3300035086 Bacteria 890
1109 Ga0373934_0178994 3300035086 Bacteria 871
1110 Ga0373934_0278776 3300035086 Bacteria 692
1111 Ga0373923_0028091 3300035111 Bacteria 2248
1112 Ga0373923_0049119 3300035111 Bacteria 1764
1113 Ga0373923_0162282 3300035111 Bacteria 1020
1114 Ga0373923_0357565 3300035111 Bacteria 698
1115 Ga0373936_0013742 3300035113 Bacteria 3090
1116 Ga0373936_0033214 3300035113 Bacteria 2044
1117 Ga0373936_0139058 3300035113 Bacteria 1048
1118 Ga0373945_0019653 3300035116 Bacteria 2308
1119 Ga0373945_0311046 3300035116 Bacteria 676
1120 Ga0373953_0005948 3300035117 Bacteria 3994
1121 Ga0373953_0104409 3300035117 Bacteria 1194
1122 Ga0373954_0003534 3300035118 Bacteria 6642
1123 Ga0373954_0012386 3300035118 Bacteria 3791
1124 Ga0373954_0038094 3300035118 Bacteria 2235
1125 Ga0373956_0011432 3300035119 Bacteria 3658
1126 Ga0373956_0103546 3300035119 Bacteria 1322
1127 Ga0373957_0006104 3300035120 Bacteria 3777
1128 Ga0373957_0084124 3300035120 Bacteria 1258
1129 Ga0373960_0062946 3300035121 Bacteria 1130
1130 Ga0373943_0003155 3300035170 Bacteria 7485
1131 Ga0373943_0318484 3300035170 Bacteria 886
1132 Ga0373943_0614826 3300035170 Bacteria 641
1133 Ga0373946_0014986 3300035171 Bacteria 2932
1134 Ga0373946_0044731 3300035171 Bacteria 1829
1135 Ga0373955_0002262 3300035172 Bacteria 8363
1136 Ga0373955_0031453 3300035172 Bacteria 2780
1137 Ga0373955_0066698 3300035172 Bacteria 2001
1138 Ga0373955_0249288 3300035172 Bacteria 1064
1139 Ga0373955_0560561 3300035172 Bacteria 699
1140 Ga0373924_0029616 3300035410 Bacteria 2189
1141 Ga0373924_0035616 3300035410 Bacteria 2019
1142 Ga0373931_0151662 3300035691 Bacteria 1351
1143 Ga0373931_0235978 3300035691 Bacteria 1107
1144 Ga0373935_0002637 3300035692 Bacteria 10305
1145 Ga0373935_0084290 3300035692 Bacteria 2070
1146 Ga0373935_0096459 3300035692 Bacteria 1943
1147 Ga0373935_0300845 3300035692 Bacteria 1134
1148 Ga0373935_0587496 3300035692 Bacteria 814
1149 Ga0373927_0000488 3300035695 Bacteria 30514
1150 Ga0373927_0082240 3300035695 Bacteria 2087
1151 Ga0373927_0127626 3300035695 Bacteria 1661
1152 Ga0373927_0128209 3300035695 Bacteria 1657
1153 Ga0373927_0301067 3300035695 Bacteria 1055
1154 Ga0373927_0311440 3300035695 Bacteria 1036
1155 Ga0373933_0020294 3300035724 Bacteria 3766
1156 Ga0373933_0038446 3300035724 Bacteria 2811
1157 Ga0373933_0628659 3300035724 Bacteria 705
1158 Ga0373947_0000909 3300035725 Bacteria 17934
1159 Ga0373947_0049931 3300035725 Bacteria 2514
1160 Ga0373947_0206996 3300035725 Bacteria 1285
1161 Ga0373947_0291094 3300035725 Bacteria 1087
1162 Ga0373947_0626378 3300035725 Bacteria 733
1163 Ga0373947_0852563 3300035725 Bacteria 622
1164 Ga0310104_08219 3300036242 Bacteria 871
1165 Ga0373937_0073915 3300036401 Bacteria 3145
1166 Ga0373937_0095241 3300036401 Bacteria 2760
1167 Ga0373937_0118634 3300036401 Bacteria 2464
1168 Ga0373937_0267944 3300036401 Bacteria 1612
1169 Ga0373937_1024516 3300036401 Bacteria 774
1170 Ga0310112_017016 3300036458 Bacteria 1031
1171 Ga0310109_027304 3300036534 Bacteria 762
1172 Ga0373925_0009396 3300037068 Bacteria 7118
1173 Ga0373925_0065398 3300037068 Bacteria 2739
1174 Ga0373925_0147893 3300037068 Bacteria 1842
1175 Ga0373925_0512360 3300037068 Bacteria 985
1176 Ga0373925_0707453 3300037068 Bacteria 830
1177 Ga0373925_0911008 3300037068 Bacteria 724
1178 Ga0373925_1329884 3300037068 Bacteria 589
1179 Ga0395899_0314164 3300037312 Bacteria 1057
1180 Ga0395899_0759053 3300037312 Bacteria 603
1181 Ga0395900_0001158 3300037418 Bacteria 33053
1182 Ga0395900_0112313 3300037418 Bacteria 2798
1183 Ga0395900_0147653 3300037418 Bacteria 2404
1184 Ga0395900_0350819 3300037418 Bacteria 1449
1185 Ga0395900_0371284 3300037418 Bacteria 1400
1186 Ga0395900_0372240 3300037418 Bacteria 1398
1187 Ga0395900_1765893 3300037418 Bacteria 529
1188 Ga0395898_0003218 3300037466 Bacteria 18368
1189 Ga0395898_0169025 3300037466 Bacteria 2090
1190 Ga0395898_0174554 3300037466 Bacteria 2054
1191 Ga0395898_0238433 3300037466 Bacteria 1735
1192 Ga0395898_0894500 3300037466 Bacteria 826
1193 Ga0395905_0001590 3300037471 Bacteria 27055
1194 Ga0395905_0066544 3300037471 Bacteria 3374
1195 Ga0395905_0339672 3300037471 Bacteria 1393
1196 Ga0395905_0481773 3300037471 Bacteria 1140
1197 Ga0395905_0706293 3300037471 Bacteria 911
1198 Ga0436364_0094814 3300037853 Bacteria 1340
1199 Ga0436364_0762417 3300037853 Bacteria 2962
1200 Ga0436364_1175670 3300037853 Bacteria 1771
1201 Ga0436364_1498081 3300037853 Bacteria 2338
1202 Ga0395901_0029555 3300038443 Bacteria 5643
1203 Ga0395901_0177629 3300038443 Bacteria 2233
1204 Ga0395901_0202105 3300038443 Bacteria 2083
1205 Ga0395901_0233704 3300038443 Bacteria 1919
1206 Ga0395901_0716470 3300038443 Bacteria 997
1207 Ga0395901_0893316 3300038443 Bacteria 871
1208 Ga0436365_0250762 3300039437 Bacteria 38553
1209 Ga0436365_0578389 3300039437 Bacteria 1739
1210 Ga0436365_0644892 3300039437 Bacteria 631
1211 Ga0436365_0997368 3300039437 Bacteria 1575
1212 Ga0436365_1462626 3300039437 Bacteria 4057
1213 Ga0436365_1563546 3300039437 Bacteria 1281
1214 Ga0436365_1757899 3300039437 Bacteria 2111
1215 Ga0436365_1761752 3300039437 Bacteria 764
1216 Ga0436360_0194286 3300039438 Bacteria 851
1217 Ga0436360_0199833 3300039438 Bacteria 983
1218 Ga0436360_0623484 3300039438 Bacteria 2343
1219 Ga0436360_0815106 3300039438 Bacteria 1781
1220 Ga0436361_0163903 3300039447 Bacteria 1877
1221 Ga0436361_0698273 3300039447 Bacteria 964
1222 Ga0436361_0703675 3300039447 Bacteria 664
1223 Ga0436361_0793959 3300039447 Bacteria 815
1224 Ga0436363_0203958 3300039450 Bacteria 4307
1225 Ga0436363_0309471 3300039450 Bacteria 1043
1226 Ga0436363_0823102 3300039450 Bacteria 759
1227 Ga0436363_1038792 3300039450 Bacteria 2516
1228 Ga0436363_1041594 3300039450 Bacteria 818
1229 Ga0436363_1056798 3300039450 Bacteria 2370
1230 Ga0436362_0186797 3300039453 Bacteria 1036
1231 Ga0436362_0750865 3300039453 Bacteria 873
1232 Ga0436362_0825905 3300039453 Bacteria 7268
1233 Ga0439465_0013695 3300041413 Bacteria 2526
1234 Ga0439465_0021902 3300041413 Bacteria 2006
1235 Ga0439465_0223595 3300041413 Bacteria 691
1236 Ga0439465_0424825 3300041413 Bacteria 508
1237 Ga0451791_0643076 3300041451 Bacteria 857
1238 Ga0451793_0311658 3300041452 Bacteria 1873
1239 Ga0451797_1297372 3300041453 Bacteria 866
1240 Ga0451800_0439194 3300041459 Bacteria 1247
1241 Ga0451802_1471182 3300041460 Bacteria 606
1242 Ga0451807_2194086 3300041486 Bacteria 890
1243 Ga0451833_0105914 3300041491 Bacteria 782
1244 Ga0451833_1146639 3300041491 Bacteria 668
1245 Ga0451839_0270489 3300041496 Bacteria 558
1246 Ga0451849_1219311 3300041505 Bacteria 856
1247 Ga0451843_0571380 3300041509 Bacteria 721
1248 Ga0451843_1169842 3300041509 Bacteria 550
1249 Ga0451855_0077832 3300041511 Bacteria 1231
1250 Ga0451853_0069924 3300041512 Bacteria 931
1251 Ga0451853_0909562 3300041512 Bacteria 842
1252 Ga0439445_0162464 3300042004 Bacteria 653
1253 Ga0439458_0127617 3300042157 Bacteria 673
1254 Ga0439459_0097816 3300042438 Bacteria 714
1255 Ga0466969_0061483 3300044656 Bacteria 1824
1256 Ga0466972_0000776 3300044658 Bacteria 15182
1257 Ga0466965_0160106 3300044683 Bacteria 1180
1258 Ga0466966_0007017 3300044684 Bacteria 7459
1259 Ga0466966_0122588 3300044684 Bacteria 1596
1260 Ga0466966_0163465 3300044684 Bacteria 1355
1261 Ga0466961_0000008 3300044693 Bacteria 142607
1262 Ga0466961_0219091 3300044693 Bacteria 1173
1263 Ga0466961_0596716 3300044693 Bacteria 664
1264 Ga0466963_0048066 3300044694 Bacteria 2817
1265 Ga0466963_0154257 3300044694 Bacteria 1596
1266 Ga0466964_0078711 3300044706 Bacteria 1410
1267 Ga0466964_0110349 3300044706 Bacteria 1226
1268 Ga0466964_0240547 3300044706 Bacteria 888
1269 Ga0466971_0466254 3300044719 Bacteria 620
1270 Ga0466968_0049009 3300044735 Bacteria 1799
1271 Ga0466968_0139348 3300044735 Bacteria 1109
1272 Ga0466968_0166483 3300044735 Bacteria 1019
1273 Ga0466968_0326380 3300044735 Bacteria 742
1274 Ga0466968_0345378 3300044735 Bacteria 722
1275 Ga0466970_0271872 3300044765 Bacteria 952
1276 Ga0466970_0317534 3300044765 Bacteria 880
1277 Ga0466957_0062441 3300044842 Bacteria 2288
1278 Ga0466957_0172369 3300044842 Bacteria 1410
1279 Ga0466957_0513259 3300044842 Bacteria 832
1280 Ga0466957_1193114 3300044842 Bacteria 550
1281 Ga0466960_0002447 3300044901 Bacteria 6994
1282 Ga0466960_0297546 3300044901 Bacteria 908
1283 Ga0466959_0011253 3300045049 Bacteria 6420
1284 Ga0466959_0297717 3300045049 Bacteria 1105
1285 Ga0466959_0392463 3300045049 Bacteria 944
1286 Ga0466959_0829164 3300045049 Bacteria 618
1287 Ga0466958_0562264 3300045836 Bacteria 741
1288 Ga0466967_0067937 3300045976 Bacteria 3180
1289 Ga0466967_0177972 3300045976 Bacteria 2004
1290 Ga0466967_0467378 3300045976 Bacteria 1234
1291 Ga0466967_1065042 3300045976 Bacteria 805
1292 Ga0466967_2018091 3300045976 Bacteria 573
1293 Ga0495592_0038963 3300046454 Bacteria 3572
1294 Ga0495592_0053038 3300046454 Bacteria 3008
1295 Ga0495592_0257576 3300046454 Bacteria 1150
1296 Ga0495592_0337858 3300046454 Bacteria 969
1297 Ga0495592_0834180 3300046454 Bacteria 546
1298 Ga0495603_0006651 3300046455 Bacteria 6935
1299 Ga0495603_0116972 3300046455 Bacteria 1554
1300 Ga0495603_0145256 3300046455 Bacteria 1379
1301 Ga0495603_0149467 3300046455 Bacteria 1357
1302 Ga0495603_0260148 3300046455 Bacteria 999
1303 Ga0495603_0367879 3300046455 Bacteria 825
1304 Ga0495603_0692173 3300046455 Bacteria 583
1305 Ga0495590_0082798 3300046457 Bacteria 1131
1306 Ga0495590_0132993 3300046457 Bacteria 895
1307 Ga0495591_162340 3300046458 Bacteria 535
1308 Ga0495629_0000483 3300046459 Bacteria 33389
1309 Ga0495629_0016229 3300046459 Bacteria 5346
1310 Ga0495629_0019113 3300046459 Bacteria 4899
1311 Ga0495629_0213332 3300046459 Bacteria 1333
1312 Ga0495638_0009179 3300046460 Bacteria 6955
1313 Ga0495638_0065389 3300046460 Bacteria 2238
1314 Ga0495638_0380078 3300046460 Bacteria 738
1315 Ga0495641_0008137 3300046461 Bacteria 6438
1316 Ga0495651_0018721 3300046462 Bacteria 5364
1317 Ga0495651_0054859 3300046462 Bacteria 3063
1318 Ga0495651_0298032 3300046462 Bacteria 1082
1319 Ga0495651_0318564 3300046462 Bacteria 1037
1320 Ga0495653_0114200 3300046463 Bacteria 1935
1321 Ga0495653_0667448 3300046463 Bacteria 634
1322 Ga0495650_0076375 3300046471 Bacteria 1302
1323 Ga0495650_0114511 3300046471 Bacteria 998
1324 Ga0495650_0269314 3300046471 Bacteria 575
1325 Ga0495580_0000574 3300046472 Bacteria 30931
1326 Ga0495580_0171458 3300046472 Bacteria 1500
1327 Ga0495580_0259534 3300046472 Bacteria 1188
1328 Ga0495582_0000221 3300046473 Bacteria 31591
1329 Ga0495582_0309376 3300046473 Bacteria 909
1330 Ga0495582_0658994 3300046473 Bacteria 606
1331 Ga0495605_0077043 3300046474 Bacteria 1565
1332 Ga0495639_0000308 3300046475 Bacteria 23799
1333 Ga0495639_0043015 3300046475 Bacteria 2039
1334 Ga0495662_0034926 3300046476 Bacteria 2426
1335 Ga0495662_0115997 3300046476 Bacteria 1313
1336 Ga0495662_0144867 3300046476 Bacteria 1170
1337 Ga0495664_0005425 3300046477 Bacteria 7005
1338 Ga0495664_0011444 3300046477 Bacteria 5004
1339 Ga0495664_0045198 3300046477 Bacteria 2611
1340 Ga0495664_0539676 3300046477 Bacteria 695
1341 Ga0495584_0116247 3300046491 Bacteria 1354
1342 Ga0495584_0190681 3300046491 Bacteria 1042
1343 Ga0495584_0208296 3300046491 Bacteria 994
1344 Ga0495584_0231892 3300046491 Bacteria 938
1345 Ga0495584_0468990 3300046491 Bacteria 641
1346 Ga0495585_0146144 3300046492 Bacteria 1235
1347 Ga0495585_0269229 3300046492 Bacteria 845
1348 Ga0495594_0000259 3300046499 Bacteria 25796
1349 Ga0495594_0109712 3300046499 Bacteria 1556
1350 Ga0495594_0134788 3300046499 Bacteria 1399
1351 Ga0495594_0272023 3300046499 Bacteria 965
1352 Ga0495594_0399479 3300046499 Bacteria 782
1353 Ga0495596_0107920 3300046500 Bacteria 1081
1354 Ga0495596_0159755 3300046500 Bacteria 876
1355 Ga0495607_0142270 3300046501 Bacteria 1236
1356 Ga0495607_0201079 3300046501 Bacteria 986
1357 Ga0495606_0005915 3300046507 Bacteria 11497
1358 Ga0495606_0094628 3300046507 Bacteria 1830
1359 Ga0495606_0124952 3300046507 Bacteria 1535
1360 Ga0495608_0026385 3300046511 Bacteria 3961
1361 Ga0495608_0184364 3300046511 Bacteria 1319
1362 Ga0495610_0121933 3300046512 Bacteria 1141
1363 Ga0495610_0135555 3300046512 Bacteria 1065
1364 Ga0495616_0015452 3300046513 Bacteria 4247
1365 Ga0495616_0211869 3300046513 Bacteria 847
1366 Ga0495618_0013174 3300046514 Bacteria 5031
1367 Ga0495618_0097465 3300046514 Bacteria 1881
1368 Ga0495618_0144266 3300046514 Bacteria 1522
1369 Ga0495620_0117941 3300046515 Bacteria 1048
1370 Ga0495620_0254652 3300046515 Bacteria 669
1371 Ga0495628_0002686 3300046516 Bacteria 15907
1372 Ga0495628_0026154 3300046516 Bacteria 4764
1373 Ga0495628_0029783 3300046516 Bacteria 4424
1374 Ga0495628_0105040 3300046516 Bacteria 2176
1375 Ga0495628_0235186 3300046516 Bacteria 1372
1376 Ga0495628_0487381 3300046516 Bacteria 892
1377 Ga0495630_0003908 3300046517 Bacteria 10417
1378 Ga0495630_0012540 3300046517 Bacteria 6157
1379 Ga0495630_0035491 3300046517 Bacteria 3726
1380 Ga0495630_0074128 3300046517 Bacteria 2563
1381 Ga0495631_0051621 3300046518 Bacteria 1797
1382 Ga0495631_0117460 3300046518 Bacteria 1144
1383 Ga0495631_0311187 3300046518 Bacteria 670
1384 Ga0495632_0140326 3300046519 Bacteria 1121
1385 Ga0495632_0171789 3300046519 Bacteria 995
1386 Ga0495632_0189363 3300046519 Bacteria 940
1387 Ga0495632_0205057 3300046519 Bacteria 896
1388 Ga0495637_0139212 3300046520 Bacteria 922
1389 Ga0495643_0028435 3300046522 Bacteria 3134
1390 Ga0495644_0059595 3300046523 Bacteria 1435
1391 Ga0495644_0162069 3300046523 Bacteria 858
1392 Ga0495644_0377247 3300046523 Bacteria 560
1393 Ga0495666_0110430 3300046526 Bacteria 1292
1394 Ga0495666_0446030 3300046526 Bacteria 580
1395 Ga0495642_0084707 3300046528 Bacteria 1338
1396 Ga0495642_0379181 3300046528 Bacteria 623
1397 Ga0495652_0031217 3300046529 Bacteria 4667
1398 Ga0495652_0046561 3300046529 Bacteria 3722
1399 Ga0495652_0087545 3300046529 Bacteria 2555
1400 Ga0495652_0098745 3300046529 Bacteria 2372
1401 Ga0495652_0171311 3300046529 Bacteria 1675
1402 Ga0495654_0146728 3300046530 Bacteria 1047
1403 Ga0495665_0000153 3300046531 Bacteria 34092
1404 Ga0495665_0042179 3300046531 Bacteria 2429
1405 Ga0495665_0622161 3300046531 Bacteria 539
1406 Ga0495640_0000198 3300046533 Bacteria 40193
1407 Ga0495640_0005502 3300046533 Bacteria 10075
1408 Ga0495640_0011366 3300046533 Bacteria 6852
1409 Ga0495640_0033100 3300046533 Bacteria 3675
1410 Ga0495640_0064426 3300046533 Bacteria 2478
1411 Ga0495640_0191222 3300046533 Bacteria 1301
1412 Ga0495640_0586938 3300046533 Bacteria 674
1413 Ga0495587_0031348 3300046536 Bacteria 3219
1414 Ga0495587_0101225 3300046536 Bacteria 1660
1415 Ga0495587_0273991 3300046536 Bacteria 946
1416 Ga0495598_0158860 3300046537 Bacteria 794
1417 Ga0495597_0045951 3300046542 Bacteria 1936
1418 Ga0495645_0015763 3300046543 Bacteria 5380
1419 Ga0495645_0089260 3300046543 Bacteria 2204
1420 Ga0495645_0099228 3300046543 Bacteria 2072
1421 Ga0495645_0207742 3300046543 Bacteria 1324
1422 Ga0495645_0219440 3300046543 Bacteria 1280
1423 Ga0495645_0349825 3300046543 Bacteria 952
1424 Ga0495622_0004435 3300046557 Bacteria 6515
1425 Ga0495622_0010265 3300046557 Bacteria 4330
1426 Ga0495633_0143286 3300046558 Bacteria 1104
1427 Ga0495667_0005606 3300046559 Bacteria 8483
1428 Ga0495667_0006893 3300046559 Bacteria 7715
1429 Ga0495667_0076227 3300046559 Bacteria 2181
1430 Ga0495667_0670245 3300046559 Bacteria 644
1431 Ga0495656_0504373 3300046615 Bacteria 642
1432 Ga0495656_0730687 3300046615 Bacteria 533
1433 Ga0495668_0127991 3300046616 Bacteria 1390
1434 Ga0495668_0128635 3300046616 Bacteria 1386
1435 Ga0495668_0130752 3300046616 Bacteria 1374
1436 Ga0495668_0165501 3300046616 Bacteria 1211
1437 Ga0495634_0001034 3300046642 Bacteria 26091
1438 Ga0495634_0039812 3300046642 Bacteria 3199
1439 Ga0495634_0052733 3300046642 Bacteria 2726
1440 Ga0495634_0072920 3300046642 Bacteria 2258
1441 Ga0495634_0327325 3300046642 Bacteria 921
1442 Ga0495611_0094488 3300046648 Bacteria 1383
1443 Ga0495625_0174643 3300046660 Bacteria 1432
1444 Ga0495625_0240923 3300046660 Bacteria 1177
1445 Ga0495625_0274672 3300046660 Bacteria 1086
1446 Ga0495625_0286465 3300046660 Bacteria 1058
1447 Ga0495625_0287273 3300046660 Bacteria 1056
1448 Ga0495625_0566395 3300046660 Bacteria 686
1449 Ga0495635_0009534 3300046663 Bacteria 6786
1450 Ga0495635_0010426 3300046663 Bacteria 6500
1451 Ga0495635_0014273 3300046663 Bacteria 5559
1452 Ga0495635_0305961 3300046663 Bacteria 1065
1453 Ga0495635_0786525 3300046663 Bacteria 614
1454 Ga0495659_0166963 3300046664 Bacteria 891
1455 Ga0495659_0260622 3300046664 Bacteria 724
1456 Ga0495661_0142631 3300046665 Bacteria 1302
1457 Ga0495661_0319228 3300046665 Bacteria 772
1458 Ga0495588_0046544 3300046674 Bacteria 2225
1459 Ga0495588_0215297 3300046674 Bacteria 1014
1460 Ga0495657_0000620 3300046675 Bacteria 32206
1461 Ga0495657_0052501 3300046675 Bacteria 2732
1462 Ga0495657_0856959 3300046675 Bacteria 518
1463 Ga0495599_0005293 3300046678 Bacteria 7696
1464 Ga0495599_0008410 3300046678 Bacteria 6272
1465 Ga0495599_0114601 3300046678 Bacteria 1677
1466 Ga0495599_0148024 3300046678 Bacteria 1455
1467 Ga0495599_0154512 3300046678 Bacteria 1420
1468 Ga0495623_0013424 3300046679 Bacteria 5310
1469 Ga0495623_0022615 3300046679 Bacteria 4059
1470 Ga0495623_0065121 3300046679 Bacteria 2279
1471 Ga0495646_0020195 3300046680 Bacteria 4213
1472 Ga0495646_0087815 3300046680 Bacteria 1802
1473 Ga0495647_0001232 3300046681 Bacteria 7895
1474 Ga0495647_0157890 3300046681 Bacteria 976
1475 Ga0495647_0276232 3300046681 Bacteria 753
1476 Ga0495658_0000722 3300046683 Bacteria 17856
1477 Ga0495658_0134158 3300046683 Bacteria 1510
1478 Ga0495658_0320783 3300046683 Bacteria 982
1479 Ga0495658_0527753 3300046683 Bacteria 756
1480 Ga0495669_0017294 3300046684 Bacteria 3093
1481 Ga0495669_0648425 3300046684 Bacteria 513
1482 Ga0495613_0000393 3300046689 Bacteria 37458
1483 Ga0495613_0037313 3300046689 Bacteria 3603
1484 Ga0495624_0000182 3300046690 Bacteria 46968
1485 Ga0495624_0020251 3300046690 Bacteria 4430
1486 Ga0495624_0044131 3300046690 Bacteria 2843
1487 Ga0495670_0394824 3300046691 Bacteria 747
1488 Ga0495649_0099525 3300046694 Bacteria 1546
1489 Ga0495649_0108545 3300046694 Bacteria 1472
1490 Ga0495589_0154098 3300046794 Bacteria 1096
1491 Ga0495589_0244146 3300046794 Bacteria 840
1492 Ga0495589_0360639 3300046794 Bacteria 669
1493 Ga0495600_0005897 3300046809 Bacteria 7411
1494 Ga0495600_0011574 3300046809 Bacteria 5502
1495 Ga0495600_0023578 3300046809 Bacteria 3959
1496 Ga0495660_0107236 3300046810 Bacteria 1430
1497 Ga0495660_0155504 3300046810 Bacteria 1126
1498 Ga0495581_0000502 3300047315 Bacteria 20006
1499 Ga0495581_0108359 3300047315 Bacteria 1614
1500 Ga0495604_0016861 3300047317 Bacteria 5840
1501 Ga0495604_0024741 3300047317 Bacteria 4790
1502 Ga0495604_0064951 3300047317 Bacteria 2779
1503 Ga0495604_0189144 3300047317 Bacteria 1436
1504 Ga0495636_0277449 3300047318 Bacteria 780
1505 Ga0495674_0001836 3300047319 Bacteria 20935
1506 Ga0495674_0030667 3300047319 Bacteria 4887
1507 Ga0495674_0061746 3300047319 Bacteria 3265
1508 Ga0495674_0157112 3300047319 Bacteria 1904
1509 Ga0495674_0255746 3300047319 Bacteria 1440
1510 Ga0495674_0875798 3300047319 Bacteria 694
1511 Ga0495674_1102094 3300047319 Bacteria 604
1512 Ga0495672_0006932 3300047320 Bacteria 8627
1513 Ga0495676_0014383 3300047321 Bacteria 7082
1514 Ga0495676_0022847 3300047321 Bacteria 5435
1515 Ga0495676_0138341 3300047321 Bacteria 1748
1516 Ga0495676_1109051 3300047321 Bacteria 503
1517 Ga0495680_0007659 3300047322 Bacteria 9863
1518 Ga0495680_0018705 3300047322 Bacteria 5871
1519 Ga0495680_0021273 3300047322 Bacteria 5432
1520 Ga0495683_0039001 3300047323 Bacteria 2402
1521 Ga0495687_041647 3300047443 Bacteria 2013
1522 Ga0495687_087513 3300047443 Bacteria 1202
1523 Ga0495675_0004343 3300047444 Bacteria 8576
1524 Ga0495675_0040007 3300047444 Bacteria 2986
1525 Ga0495675_0060637 3300047444 Bacteria 2397
1526 Ga0495675_0386080 3300047444 Bacteria 818
1527 Ga0495677_0068092 3300047445 Bacteria 1325
1528 Ga0495677_0258596 3300047445 Bacteria 681
1529 Ga0495679_071326 3300047446 Bacteria 1000
1530 Ga0495685_058341 3300047447 Bacteria 1303
1531 Ga0495673_0042108 3300047469 Bacteria 2052
1532 Ga0495673_0131458 3300047469 Bacteria 983
1533 Ga0495673_0134481 3300047469 Bacteria 969
1534 Ga0495673_0161037 3300047469 Bacteria 861
1535 Ga0495684_0015597 3300047471 Bacteria 5848
1536 Ga0495684_0039729 3300047471 Bacteria 3607
1537 Ga0495684_0087376 3300047471 Bacteria 2363
1538 Ga0495684_0090819 3300047471 Bacteria 2313
1539 Ga0495684_0150219 3300047471 Bacteria 1742
1540 Ga0495686_0070106 3300047472 Bacteria 2160
1541 Ga0495593_0000477 3300047673 Bacteria 22563
1542 Ga0495593_0056490 3300047673 Bacteria 2063
1543 Ga0495593_0112143 3300047673 Bacteria 1392
1544 Ga0495602_0002073 3300048088 Bacteria 20164
1545 Ga0495602_0024308 3300048088 Bacteria 5879
1546 Ga0495602_0041881 3300048088 Bacteria 4177
1547 Ga0495614_0207083 3300048089 Bacteria 889
1548 Ga0495615_0045953 3300048090 Bacteria 1108
1549 Ga0496100_0008365 3300048903 Bacteria 5767
1550 Ga0496100_0061893 3300048903 Bacteria 2468
1551 Ga0496100_0100807 3300048903 Bacteria 1990
1552 Ga0496100_0150084 3300048903 Bacteria 1661
1553 Ga0496100_0157735 3300048903 Bacteria 1624
1554 Ga0496100_0362996 3300048903 Bacteria 1096
1555 Ga0496100_0819805 3300048903 Bacteria 729
1556 Ga0496100_1001556 3300048903 Bacteria 657
1557 Ga0496100_1254388 3300048903 Bacteria 585
1558 Ga0496101_0026636 3300048904 Bacteria 4020
1559 Ga0496101_0172586 3300048904 Bacteria 1662
1560 Ga0496101_0302345 3300048904 Bacteria 1253
1561 Ga0496101_0323443 3300048904 Bacteria 1210
1562 Ga0496101_0426860 3300048904 Bacteria 1045
1563 Ga0496101_0584317 3300048904 Bacteria 883
1564 Ga0496101_0698252 3300048904 Bacteria 801
1565 Ga0496102_0003479 3300048905 Bacteria 13351
1566 Ga0496102_0096520 3300048905 Bacteria 2740
1567 Ga0496102_0180575 3300048905 Bacteria 1988
1568 Ga0496102_0434438 3300048905 Bacteria 1232
1569 Ga0496102_0474286 3300048905 Bacteria 1172
1570 Ga0496102_1130068 3300048905 Bacteria 703
1571 Ga0496103_0020520 3300048906 Bacteria 3969
1572 Ga0496103_0020540 3300048906 Bacteria 3968
1573 Ga0496103_0128906 3300048906 Bacteria 1615
1574 Ga0496103_0234879 3300048906 Bacteria 1180
1575 Ga0496103_0260337 3300048906 Bacteria 1116
1576 Ga0496103_0455378 3300048906 Bacteria 820
1577 Ga0496104_0019192 3300048907 Bacteria 6251
1578 Ga0496104_0036469 3300048907 Bacteria 4598
1579 Ga0496104_0078820 3300048907 Bacteria 3139
1580 Ga0496104_0083241 3300048907 Bacteria 3051
1581 Ga0496104_0117708 3300048907 Bacteria 2550
1582 Ga0496104_0320266 3300048907 Bacteria 1463
1583 Ga0496104_0499362 3300048907 Bacteria 1128
1584 Ga0496104_0718462 3300048907 Bacteria 907
1585 Ga0496105_0001231 3300048908 Bacteria 17852
1586 Ga0496105_0007183 3300048908 Bacteria 8595
1587 Ga0496105_0073844 3300048908 Bacteria 2817
1588 Ga0496105_0092661 3300048908 Bacteria 2495
1589 Ga0496105_0152634 3300048908 Bacteria 1898
1590 Ga0496105_0346402 3300048908 Bacteria 1187
1591 Ga0496105_0422794 3300048908 Bacteria 1055
1592 Ga0496106_0011700 3300048909 Bacteria 6481
1593 Ga0496106_0018329 3300048909 Bacteria 5173
1594 Ga0496106_0022369 3300048909 Bacteria 4695
1595 Ga0496106_0031265 3300048909 Bacteria 3966
1596 Ga0496106_0156079 3300048909 Bacteria 1802
1597 Ga0496106_0748858 3300048909 Bacteria 777
1598 Ga0496106_0777173 3300048909 Bacteria 760
1599 Ga0496107_0002191 3300048910 Bacteria 12555
1600 Ga0496107_0007020 3300048910 Bacteria 7759
1601 Ga0496107_0068466 3300048910 Bacteria 2576
1602 Ga0496107_0124603 3300048910 Bacteria 1900
1603 Ga0496107_0319665 3300048910 Bacteria 1155
1604 Ga0496107_0382310 3300048910 Bacteria 1047
1605 Ga0496107_0579526 3300048910 Bacteria 830
1606 Ga0496107_0629554 3300048910 Bacteria 792
1607 Ga0496108_0000708 3300048911 Bacteria 25879
1608 Ga0496108_0014588 3300048911 Bacteria 6414
1609 Ga0496108_0024541 3300048911 Bacteria 4965
1610 Ga0496108_0094672 3300048911 Bacteria 2542
1611 Ga0496108_0201038 3300048911 Bacteria 1729
1612 Ga0496108_0378594 3300048911 Bacteria 1236
1613 Ga0496108_0408221 3300048911 Bacteria 1186
1614 Ga0496108_0544542 3300048911 Bacteria 1013
1615 Ga0496108_0906833 3300048911 Bacteria 756
1616 Ga0496109_0000492 3300048912 Bacteria 33814
1617 Ga0496109_0009095 3300048912 Bacteria 8459
1618 Ga0496109_0046731 3300048912 Bacteria 3933
1619 Ga0496109_0184444 3300048912 Bacteria 1961
1620 Ga0496109_1155349 3300048912 Bacteria 711
1621 Ga0496110_0002285 3300048913 Bacteria 14319
1622 Ga0496110_0023366 3300048913 Bacteria 5256
1623 Ga0496110_0044051 3300048913 Bacteria 3896
1624 Ga0496110_0087812 3300048913 Bacteria 2777
1625 Ga0496110_0168702 3300048913 Bacteria 1985
1626 Ga0496110_0192169 3300048913 Bacteria 1854
1627 Ga0496110_0217934 3300048913 Bacteria 1735
1628 Ga0496110_1131360 3300048913 Bacteria 691
1629 Ga0496111_0032721 3300048914 Bacteria 3708
1630 Ga0496111_0141807 3300048914 Bacteria 1780
1631 Ga0496111_0296591 3300048914 Bacteria 1198
1632 Ga0496111_0386938 3300048914 Bacteria 1034
1633 Ga0496111_0843001 3300048914 Bacteria 662
1634 Ga0496112_0000004 3300048915 Bacteria 553294
1635 Ga0496112_0000640 3300048915 Bacteria 24288
1636 Ga0496112_0010712 3300048915 Bacteria 8335
1637 Ga0496112_0016874 3300048915 Bacteria 6851
1638 Ga0496112_0058605 3300048915 Bacteria 3792
1639 Ga0496112_0072955 3300048915 Bacteria 3393
1640 Ga0496112_0180389 3300048915 Bacteria 2075
1641 Ga0496112_0430089 3300048915 Bacteria 1258
1642 Ga0496112_0654094 3300048915 Bacteria 980
1643 Ga0496112_0672759 3300048915 Bacteria 964
1644 Ga0496113_0008109 3300048916 Bacteria 6820
1645 Ga0496113_0023344 3300048916 Bacteria 4386
1646 Ga0496113_0092430 3300048916 Bacteria 2333
1647 Ga0496113_0109242 3300048916 Bacteria 2150
1648 Ga0496113_0159072 3300048916 Bacteria 1785
1649 Ga0496113_0263020 3300048916 Bacteria 1378
1650 Ga0496113_0827869 3300048916 Bacteria 734
1651 Ga0496114_0028242 3300048917 Bacteria 4602
1652 Ga0496114_0153791 3300048917 Bacteria 1996
1653 Ga0496114_0179458 3300048917 Bacteria 1849
1654 Ga0496114_0305799 3300048917 Bacteria 1404
1655 Ga0496114_0308824 3300048917 Bacteria 1397
1656 Ga0496114_0345600 3300048917 Bacteria 1316
1657 Ga0496114_0528446 3300048917 Bacteria 1043
1658 Ga0496114_0882396 3300048917 Bacteria 775
1659 Ga0496115_0000645 3300048918 Bacteria 26227
1660 Ga0496115_0046924 3300048918 Bacteria 3454
1661 Ga0496115_0085931 3300048918 Bacteria 2566
1662 Ga0496115_0108749 3300048918 Bacteria 2276
1663 Ga0496115_0117739 3300048918 Bacteria 2185
1664 Ga0496115_0119226 3300048918 Bacteria 2170
1665 Ga0496115_0185631 3300048918 Bacteria 1718
1666 Ga0496115_0250461 3300048918 Bacteria 1458
1667 Ga0496115_0260890 3300048918 Bacteria 1425
1668 Ga0496115_0296029 3300048918 Bacteria 1326
1669 Ga0496115_0371995 3300048918 Bacteria 1163
1670 Ga0496115_0459371 3300048918 Bacteria 1027
1671 Ga0496115_0708361 3300048918 Bacteria 791
1672 Ga0496115_0711480 3300048918 Bacteria 789
1673 Ga0496115_1085845 3300048918 Bacteria 607
1674 Ga0496115_1106243 3300048918 Bacteria 600
1675 Ga0496116_0092850 3300048919 Bacteria 1829
1676 Ga0496116_0106297 3300048919 Bacteria 1662
1677 Ga0496116_0154030 3300048919 Bacteria 1272
1678 Ga0496117_0020967 3300048920 Bacteria 5311
1679 Ga0496117_0058927 3300048920 Bacteria 2656
1680 Ga0496117_0096822 3300048920 Bacteria 1882
1681 Ga0496117_0259996 3300048920 Bacteria 942
1682 Ga0496118_0011127 3300048921 Bacteria 8819
1683 Ga0496118_0052561 3300048921 Bacteria 3106
1684 Ga0496118_0066993 3300048921 Bacteria 2618
1685 Ga0496118_0192460 3300048921 Bacteria 1218
1686 Ga0496118_0222158 3300048921 Bacteria 1098
1687 Ga0496118_0557026 3300048921 Bacteria 558
1688 Ga0496119_0007084 3300048922 Bacteria 10196
1689 Ga0496119_0097576 3300048922 Bacteria 1656
1690 Ga0496120_0128092 3300048923 Bacteria 1304
1691 Ga0496121_0001081 3300048924 Bacteria 48118
1692 Ga0496121_0022281 3300048924 Bacteria 6159
1693 Ga0496121_0051335 3300048924 Bacteria 3474
1694 Ga0496121_0061578 3300048924 Bacteria 3078
1695 Ga0496121_0112008 3300048924 Bacteria 2079
1696 Ga0496121_0117288 3300048924 Bacteria 2017
1697 Ga0496121_0139564 3300048924 Bacteria 1800
1698 Ga0496121_0168695 3300048924 Bacteria 1592
1699 Ga0496121_0217486 3300048924 Bacteria 1348
1700 Ga0496121_0229743 3300048924 Bacteria 1300
1701 Ga0496121_0269731 3300048924 Bacteria 1170
1702 Ga0496121_0335129 3300048924 Bacteria 1013
1703 Ga0496122_0118787 3300048925 Bacteria 1712
1704 Ga0496123_0263328 3300048926 Bacteria 843
1705 Ga0496124_0000722 3300048927 Bacteria 54175
1706 Ga0496124_0093901 3300048927 Bacteria 2441
1707 Ga0496124_0162362 3300048927 Bacteria 1740
1708 Ga0496124_0175385 3300048927 Bacteria 1655
1709 Ga0496124_0382745 3300048927 Bacteria 983
1710 Ga0496124_0494425 3300048927 Bacteria 822
1711 Ga0496125_0042922 3300048928 Bacteria 3845
1712 Ga0496125_0052306 3300048928 Bacteria 3359
1713 Ga0496125_0060574 3300048928 Bacteria 3041
1714 Ga0496125_0081858 3300048928 Bacteria 2464
1715 Ga0496125_0124612 3300048928 Bacteria 1829
1716 Ga0496125_0201464 3300048928 Bacteria 1302
1717 Ga0496125_0266230 3300048928 Bacteria 1071
1718 Ga0496125_0305022 3300048928 Bacteria 973
1719 Ga0496125_0634901 3300048928 Bacteria 577
1720 Ga0496126_0005379 3300048929 Bacteria 14623
1721 Ga0496126_0010006 3300048929 Bacteria 10007
1722 Ga0496126_0026794 3300048929 Bacteria 5519
1723 Ga0496126_0032722 3300048929 Bacteria 4896
1724 Ga0496126_0037510 3300048929 Bacteria 4521
1725 Ga0496126_0176941 3300048929 Bacteria 1814
1726 Ga0496126_0214589 3300048929 Bacteria 1619
1727 Ga0496126_0219268 3300048929 Bacteria 1599
1728 Ga0496126_0337357 3300048929 Bacteria 1235
1729 Ga0496126_0521098 3300048929 Bacteria 947
1730 Ga0496126_0564664 3300048929 Bacteria 901
1731 Ga0496126_1159210 3300048929 Bacteria 571
1732 Ga0496126_1355678 3300048929 Bacteria 515
1733 Ga0496126_1394606 3300048929 Bacteria 506
1734 Ga0495678_037470 3300049459 Bacteria 1970
1735 Ga0495682_0064092 3300049460 Bacteria 1325
1736 Ga0495682_0162019 3300049460 Bacteria 796
1737 Ga0501031_0099715 3300049568 Bacteria 1895
1738 Ga0501032_0056095 3300049569 Bacteria 2649
1739 Ga0501034_0360309 3300049571 Bacteria 1381
1740 Ga0501036_0171713 3300049572 Bacteria 1827
1741 Ga0501037_0330138 3300049573 Bacteria 1055
1742 Ga0501038_0088196 3300049574 Bacteria 2604
1743 Ga0501038_0689826 3300049574 Bacteria 766
1744 Ga0501039_0407540 3300049575 Bacteria 1068
1745 Ga0501039_0549861 3300049575 Bacteria 906
1746 Ga0501041_0262404 3300049577 Bacteria 1086
1747 Ga0501046_0097706 3300049580 Bacteria 2255
1748 Ga0501046_0831400 3300049580 Bacteria 646
1749 Ga0501047_0038959 3300049581 Bacteria 4597
1750 Ga0501047_0215246 3300049581 Bacteria 1778
1751 Ga0501048_0335976 3300049582 Bacteria 1077
1752 Ga0501048_0986972 3300049582 Bacteria 606
1753 Ga0501067_0089788 3300049583 Bacteria 1705
1754 Ga0501070_0024877 3300049586 Bacteria 5021
1755 Ga0501071_0679266 3300049587 Bacteria 793
1756 Ga0501073_0041960 3300049589 Bacteria 3231
1757 Ga0501074_0025357 3300049590 Bacteria 4306
1758 Ga0501075_0336857 3300049591 Bacteria 1150
1759 Ga0501076_0440377 3300049592 Bacteria 1073
1760 Ga0501076_0519053 3300049592 Bacteria 982
1761 Ga0501079_0159663 3300049741 Bacteria 1758
1762 Ga0501079_0646575 3300049741 Bacteria 833
1763 Ga0501080_0221453 3300049742 Bacteria 1731
1764 Ga0501083_0706867 3300049744 Bacteria 656
1765 Ga0501035_0198407 3300049822 Bacteria 1722
1766 Ga0501035_0358222 3300049822 Bacteria 1219
1767 Ga0501044_0020178 3300049823 Bacteria 7113
1768 Ga0501044_0226791 3300049823 Bacteria 1817
1769 Ga0501044_0678595 3300049823 Bacteria 917
1770 Ga0501045_0318270 3300049824 Bacteria 1158
1771 nmdc:mga03683_137390_c1 3300050489 Bacteria 1097
1772 nmdc:mga03683_236336_c1 3300050489 Bacteria 846
1773 nmdc:mga03683_308050_c1 3300050489 Bacteria 744
1774 nmdc:mga03n38_3259_c1 3300050490 Bacteria 5184
1775 nmdc:mga03n38_384600_c1 3300050490 Bacteria 770
1776 nmdc:mga03n38_474311_c1 3300050490 Bacteria 699
1777 nmdc:mga03n38_571219_c1 3300050490 Bacteria 641
1778 nmdc:mga03n38_798982_c1 3300050490 Bacteria 549
1779 nmdc:mga03n38_84980_c1 3300050490 Bacteria 1495
1780 nmdc:mga00v17_244105_c1 3300050491 Bacteria 1165
1781 nmdc:mga00v17_387304_c1 3300050491 Bacteria 909
1782 nmdc:mga00v17_420230_c1 3300050491 Bacteria 868
1783 nmdc:mga00v17_455771_c1 3300050491 Bacteria 830
1784 nmdc:mga00v17_93774_c1 3300050491 Bacteria 1888
1785 nmdc:mga0yw44_141505_c2 3300050492 Bacteria 1245
1786 nmdc:mga0yw44_18988_c1 3300050492 Bacteria 3781
1787 nmdc:mga0yw44_210843_c1 3300050492 Bacteria 1285
1788 nmdc:mga0yw44_235958_c1 3300050492 Bacteria 1215
1789 nmdc:mga0yw44_292189_c1 3300050492 Bacteria 1091
1790 nmdc:mga0yw44_54072_c1 3300050492 Bacteria 2439
1791 nmdc:mga0yw44_54857_c1 3300050492 Bacteria 2424
1792 nmdc:mga0yw44_662796_c1 3300050492 Bacteria 709
1793 nmdc:mga0yw44_88703_c1 3300050492 Bacteria 1950
1794 nmdc:mga0yw44_95036_c1 3300050492 Bacteria 1890
1795 nmdc:mga0k408_11613_c2 3300050493 Bacteria 2725
1796 nmdc:mga0k408_164036_c1 3300050493 Bacteria 1324
1797 nmdc:mga0k408_56271_c1 3300050493 Bacteria 2282
1798 nmdc:mga06z11_176497_c1 3300050494 Bacteria 1230
1799 nmdc:mga06z11_231852_c1 3300050494 Bacteria 1082
1800 nmdc:mga06z11_4478_c1 3300050494 Bacteria 5500
1801 nmdc:mga06z11_672159_c1 3300050494 Bacteria 631
1802 nmdc:mga06z11_8583_c1 3300050494 Bacteria 4271
1803 nmdc:mga04h51_3442_c1 3300050495 Bacteria 3846
1804 nmdc:mga04h51_56253_c1 3300050495 Bacteria 1335
1805 nmdc:mga04h51_74321_c1 3300050495 Bacteria 1194
1806 nmdc:mga07m45_161426_c2 3300050496 Bacteria 1007
1807 nmdc:mga07m45_40551_c1 3300050496 Bacteria 2605
1808 nmdc:mga07m45_454117_c1 3300050496 Bacteria 743
1809 nmdc:mga07m45_51949_c1 3300050496 Bacteria 2313
1810 nmdc:mga07m45_674089_c1 3300050496 Bacteria 595
1811 nmdc:mga07m45_781655_c1 3300050496 Bacteria 548
1812 nmdc:mga07m45_8933_c1 3300050496 Bacteria 5174
1813 nmdc:mga05p37_105215_c1 3300050507 Bacteria 3472
1814 nmdc:mga09592_375042_c1 3300050508 Bacteria 1230
1815 nmdc:mga0qj67_1129184_c1 3300050509 Bacteria 611
1816 nmdc:mga08y16_166913_c1 3300050511 Bacteria 2287
1817 nmdc:mga0n895_12267_c1 3300050512 Bacteria 7680
1818 nmdc:mga0n895_262097_c1 3300050512 Bacteria 1754
1819 nmdc:mga0n895_550532_c1 3300050512 Bacteria 1159
1820 nmdc:mga0n895_569356_c1 3300050512 Bacteria 1137
1821 nmdc:mga0rr50_317070_c1 3300050513 Bacteria 1306
1822 nmdc:mga08x19_146481_c1 3300050514 Bacteria 1597
1823 nmdc:mga08x19_230208_c1 3300050514 Bacteria 1275
1824 nmdc:mga0a205_409724_c1 3300050515 Bacteria 1218
1825 nmdc:mga0a205_714779_c1 3300050515 Bacteria 851
1826 nmdc:mga0sz30_315696_c1 3300050516 Bacteria 697
1827 nmdc:mga0sz30_429617_c1 3300050516 Bacteria 592
1828 nmdc:mga0sz30_6162_c1 3300050516 Bacteria 4441
1829 nmdc:mga0sz30_78073_c1 3300050516 Bacteria 1431
1830 nmdc:mga0sz30_97619_c1 3300050516 Bacteria 1282
1831 Ga0495601_0440591 3300053077 Bacteria 843
1832 Ga0495612_0009214 3300053078 Bacteria 4004
1833 Ga0495612_0042381 3300053078 Bacteria 1858
1834 Ga0495612_0042871 3300053078 Bacteria 1848
1835 Ga0495612_0140186 3300053078 Bacteria 1048
1836 Ga0495612_0267881 3300053078 Bacteria 762
1837 Ga0500610_0105271 3300053079 Bacteria 1455
1838 Ga0500610_0198147 3300053079 Bacteria 970
1839 Ga0500635_0009607 3300053080 Bacteria 2690
1840 Ga0500635_0046188 3300053080 Bacteria 1477
1841 Ga0495655_0003779 3300053083 Bacteria 2531
1842 Ga0495595_0002229 3300053084 Bacteria 7540
1843 Ga0495595_0013856 3300053084 Bacteria 3412
1844 Ga0495595_0071764 3300053084 Bacteria 1637
1845 Ga0495595_0493592 3300053084 Bacteria 624
1846 Ga0495619_0014396 3300053085 Bacteria 4994
1847 Ga0495619_0015092 3300053085 Bacteria 4882
1848 Ga0495619_0038480 3300053085 Bacteria 3121
1849 Ga0495619_0107482 3300053085 Bacteria 1903
1850 Ga0495619_0658110 3300053085 Bacteria 714
1851 Ga0500578_0190634 3300053086 Bacteria 1259
1852 Ga0500643_000007 3300053087 Bacteria 462836
1853 Ga0500643_072921 3300053087 Bacteria 951
1854 Ga0500644_0085588 3300053088 Bacteria 1169
1855 Ga0500644_0270329 3300053088 Bacteria 721
1856 Ga0500646_0124108 3300053090 Bacteria 833
1857 Ga0500647_0065471 3300053091 Bacteria 1748
1858 Ga0500647_0070606 3300053091 Bacteria 1679
1859 Ga0500583_0043438 3300053092 Bacteria 2053
1860 Ga0500583_0063054 3300053092 Bacteria 1754
1861 Ga0500651_0142873 3300053093 Bacteria 1441
1862 Ga0500651_0230077 3300053093 Bacteria 1084
1863 Ga0500566_0000049 3300053094 Bacteria 57920
1864 Ga0500566_0000483 3300053094 Bacteria 22212
1865 Ga0500566_0012879 3300053094 Bacteria 4925
1866 Ga0500566_0066164 3300053094 Bacteria 2037
1867 Ga0500566_0100260 3300053094 Bacteria 1589
1868 Ga0500566_0117492 3300053094 Bacteria 1438
1869 Ga0500640_001761 3300053095 Bacteria 6785
1870 Ga0500641_0061668 3300053096 Bacteria 1562
1871 Ga0500641_0081856 3300053096 Bacteria 1371
1872 Ga0500650_0137842 3300053098 Bacteria 1132
1873 Ga0500554_000760 3300053102 Bacteria 6464
1874 Ga0500555_003826 3300053103 Bacteria 4283
1875 Ga0500556_0092523 3300053104 Bacteria 1156
1876 Ga0500557_000013 3300053105 Bacteria 108649
1877 Ga0500562_005257 3300053108 Bacteria 3254
1878 Ga0500572_000123 3300053111 Bacteria 26083
1879 Ga0500572_000675 3300053111 Bacteria 11219
1880 Ga0500572_084716 3300053111 Bacteria 997
1881 Ga0500582_180497 3300053114 Bacteria 719
1882 Ga0500582_207850 3300053114 Bacteria 654
1883 Ga0500591_067553 3300053115 Bacteria 1629
1884 Ga0500594_0322779 3300053118 Bacteria 519
1885 Ga0500595_000418 3300053119 Bacteria 26871
1886 Ga0500595_011086 3300053119 Bacteria 3547
1887 Ga0500595_014275 3300053119 Bacteria 3018
1888 Ga0500608_180640 3300053122 Bacteria 894
1889 Ga0500614_025216 3300053123 Bacteria 1411
1890 Ga0500614_203342 3300053123 Bacteria 611
1891 Ga0500642_0000031 3300053130 Bacteria 114671
1892 Ga0500642_0096124 3300053130 Bacteria 1373
1893 Ga0500655_004332 3300053133 Bacteria 2560
1894 Ga0500658_0400732 3300053134 Bacteria 628
1895 Ga0500559_0007266 3300053136 Bacteria 4920
1896 Ga0500559_0016567 3300053136 Bacteria 3113
1897 Ga0500559_0068209 3300053136 Bacteria 1597
1898 Ga0500564_197584 3300053138 Bacteria 828
1899 Ga0500564_229781 3300053138 Bacteria 746
1900 Ga0500568_0012178 3300053139 Bacteria 3962
1901 Ga0500568_0065332 3300053139 Bacteria 1401
1902 Ga0500573_0031137 3300053140 Bacteria 3078
1903 Ga0500577_0172188 3300053142 Bacteria 926
1904 Ga0500585_063656 3300053144 Bacteria 1329
1905 Ga0500589_033685 3300053147 Bacteria 2390
1906 Ga0500590_092698 3300053148 Bacteria 1464
1907 Ga0500590_250152 3300053148 Bacteria 705
1908 Ga0500603_000749 3300053150 Bacteria 7884
1909 Ga0500603_001143 3300053150 Bacteria 6208
1910 Ga0500603_019262 3300053150 Bacteria 1654
1911 Ga0500603_161102 3300053150 Bacteria 700
1912 Ga0500604_0040079 3300053151 Bacteria 1411
1913 Ga0500604_0165161 3300053151 Bacteria 755
1914 Ga0500616_0153001 3300053153 Bacteria 1066
1915 Ga0500622_0014965 3300053156 Bacteria 4159
1916 Ga0500627_0492336 3300053158 Bacteria 511
1917 Ga0500630_000330 3300053159 Bacteria 19750
1918 Ga0500634_0151865 3300053161 Bacteria 1081
1919 Ga0500638_002404 3300053162 Bacteria 6505
1920 Ga0500638_103683 3300053162 Bacteria 1323
1921 Ga0500638_141897 3300053162 Bacteria 1078
1922 Ga0500638_215228 3300053162 Bacteria 801
1923 Ga0500638_223166 3300053162 Bacteria 780
1924 Ga0500639_000020 3300053163 Bacteria 102959
1925 Ga0500639_119053 3300053163 Bacteria 1271
1926 Ga0500639_206300 3300053163 Bacteria 838
1927 Ga0500639_308014 3300053163 Bacteria 590
1928 Ga0500636_0000014 3300053177 Bacteria 124740
1929 Ga0500636_0095118 3300053177 Bacteria 1701
1930 Ga0500636_0313354 3300053177 Bacteria 766
1931 Ga0500636_0357414 3300053177 Bacteria 694
1932 Ga0500636_0507792 3300053177 Bacteria 531
1933 Ga0500637_0000845 3300053178 Bacteria 12246
1934 Ga0500637_0008751 3300053178 Bacteria 5122
1935 Ga0500637_0122044 3300053178 Bacteria 1511
1936 Ga0500637_0281170 3300053178 Bacteria 916
1937 Ga0500611_047166 3300053727 Bacteria 972
1938 Ga0500657_233073 3300053728 Bacteria 569
1939 Ga0500625_117738 3300053729 Bacteria 1075
1940 Ga0500645_006615 3300053730 Bacteria 4111
1941 Ga0500645_079916 3300053730 Bacteria 933
1942 Ga0500645_158782 3300053730 Bacteria 620
1943 Ga0500609_001006 3300053731 Bacteria 4223
1944 Ga0500609_031781 3300053731 Bacteria 725
1945 Ga0500596_002310 3300053735 Bacteria 3774
1946 Ga0500596_002565 3300053735 Bacteria 3569
1947 Ga0500599_002436 3300053736 Bacteria 2231
1948 Ga0500601_000055 3300053737 Bacteria 23778
1949 Ga0500601_007664 3300053737 Bacteria 1198
1950 Ga0501084_0442530 3300054114 Bacteria 1099
1951 Ga0500661_000430 3300055283 Bacteria 7764
1952 Ga0500661_018265 3300055283 Bacteria 1250
1953 Ga0587093_045538 3300059478 Bacteria 678
1954 Ga0587066_137740 3300059490 Bacteria 593
1955 Ga0587070_143891 3300059491 Bacteria 591
1956 Ga0587073_0046936 3300059492 Bacteria 964
1957 Ga0587077_074900 3300059493 Bacteria 764
1958 Ga0587077_164488 3300059493 Bacteria 590
1959 Ga0587080_064596 3300059503 Bacteria 720
1960 Ga0587080_068574 3300059503 Bacteria 705
1961 Ga0587080_103365 3300059503 Bacteria 613
1962 Ga0587082_049012 3300059504 Bacteria 800
1963 Ga0587082_099454 3300059504 Bacteria 632
1964 Ga0587082_126078 3300059504 Bacteria 583
1965 Ga0587083_0164123 3300059505 Bacteria 610
1966 Ga0587083_0184315 3300059505 Bacteria 586
1967 Ga0587083_0226495 3300059505 Bacteria 546
1968 Ga0587085_121185 3300059506 Bacteria 574
1969 Ga0587085_147272 3300059506 Bacteria 540
1970 Ga0587086_080257 3300059507 Bacteria 574
1971 Ga0587088_080480 3300059508 Bacteria 696
1972 Ga0587088_088508 3300059508 Bacteria 674
1973 Ga0587089_066392 3300059509 Bacteria 605
1974 Ga0587090_101734 3300059510 Bacteria 602
1975 Ga0587090_127761 3300059510 Bacteria 557
1976 Ga0587091_065305 3300059511 Bacteria 783
1977 Ga0587091_148430 3300059511 Bacteria 593
1978 Ga0587092_082559 3300059512 Bacteria 637
1979 Ga0587092_097642 3300059512 Bacteria 601
1980 Ga0587094_085601 3300059513 Bacteria 589
1981 Ga0587106_100441 3300059605 Bacteria 590
1982 Ga0587106_148005 3300059605 Bacteria 520
1983 Ga0587125_054427 3300059607 Bacteria 572
1984 Ga0587125_061272 3300059607 Bacteria 551
1985 Ga0587131_011653 3300059609 Bacteria 640
1986 Ga0587099_048823 3300059622 Bacteria 560
1987 Ga0587101_066470 3300059623 Bacteria 655
1988 Ga0587109_121352 3300059624 Bacteria 621
1989 Ga0587109_179350 3300059624 Bacteria 540
1990 Ga0587109_203353 3300059624 Bacteria 517
1991 Ga0587113_030364 3300059625 Bacteria 610
1992 Ga0587122_035346 3300059628 Bacteria 603
1993 Ga0587128_042698 3300059630 Bacteria 799
1994 Ga0587130_044308 3300059631 Bacteria 545
1995 Ga0587062_078972 3300059639 Bacteria 608
1996 Ga0587067_099515 3300059640 Bacteria 671
1997 Ga0587067_177744 3300059640 Bacteria 552
1998 Ga0587068_038059 3300059641 Bacteria 861
1999 Ga0587068_058083 3300059641 Bacteria 739
2000 Ga0587068_068230 3300059641 Bacteria 697
2001 Ga0587069_109260 3300059642 Bacteria 574
2002 Ga0587072_120464 3300059643 Bacteria 608
2003 Ga0587072_164300 3300059643 Bacteria 544
2004 Ga0587075_090131 3300059644 Bacteria 598
2005 Ga0587076_109374 3300059645 Bacteria 627
2006 Ga0587076_151816 3300059645 Bacteria 563
2007 Ga0587078_035769 3300059646 Bacteria 685
2008 Ga0587102_056540 3300059649 Bacteria 539
2009 Ga0587110_047406 3300059654 Bacteria 567
2010 Ga0587114_051284 3300059655 Bacteria 699
2011 Ga0587114_099347 3300059655 Bacteria 565
2012 Ga0587116_17292 3300059656 Bacteria 532
2013 Ga0587120_023306 3300059659 Bacteria 600
2014 Ga0587124_033301 3300059660 Bacteria 578
2015 Ga0587060_027369 3300060243 Bacteria 568
2016 Ga0587071_034650 3300060344 Bacteria 988
2017 Ga0587071_094213 3300060344 Bacteria 684
2018 Ga0587071_114561 3300060344 Bacteria 638
2019 Ga0587071_150757 3300060344 Bacteria 578
2020 Ga0587111_0154757 3300060346 Bacteria 619
2021 Ga0466962_0053200 3300061719 Bacteria 1935
2022 Ga0466962_0134266 3300061719 Bacteria 1197
2023 Ga0466962_0157948 3300061719 Bacteria 1102

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005548 Ga0070665_100790059 Ga0070665_1007900592 130
2 3300041413 Ga0439465_0021902 Ga0439465_0021902_179_610 130
3 3300046471 Ga0495650_0269314 Ga0495650_0269314_72_500 130
4 3300050494 nmdc:mga06z11_4478_c1 nmdc:mga06z11_4478_c1_2550_2981 130
5 3300050496 nmdc:mga07m45_8933_c1 nmdc:mga07m45_8933_c1_2446_2877 130
6 3300050516 nmdc:mga0sz30_315696_c1 nmdc:mga0sz30_315696_c1_122_553 130
7 3300053139 Ga0500568_0065332 Ga0500568_0065332_133_561 130
8 3300005439 Ga0070711_100746439 Ga0070711_1007464392 131
9 3300005549 Ga0070704_100951090 Ga0070704_1009510902 131
10 3300009098 Ga0105245_10934213 Ga0105245_109342131 131
11 3300031241 Ga0265325_10026729 Ga0265325_100267294 131
12 3300031247 Ga0265340_10004003 Ga0265340_100040031 131
13 3300031344 Ga0265316_10144331 Ga0265316_101443312 131
14 3300031711 Ga0265314_10040511 Ga0265314_100405114 131
15 3300031712 Ga0265342_10000178 Ga0265342_1000017810 131
16 3300046507 Ga0495606_0005915 Ga0495606_0005915_8333_8797 131
17 3300048915 Ga0496112_0000004 Ga0496112_0000004_421752_422216 131
18 3300049568 Ga0501031_0099715 Ga0501031_0099715_1149_1553 131
19 3300049569 Ga0501032_0056095 Ga0501032_0056095_2201_2605 131
20 3300049571 Ga0501034_0360309 Ga0501034_0360309_395_799 131
21 3300049573 Ga0501037_0330138 Ga0501037_0330138_70_474 131
22 3300049574 Ga0501038_0088196 Ga0501038_0088196_162_566 131
23 3300049580 Ga0501046_0831400 Ga0501046_0831400_53_457 131
24 3300049581 Ga0501047_0215246 Ga0501047_0215246_1128_1532 131
25 3300049822 Ga0501035_0198407 Ga0501035_0198407_1307_1711 131
26 3300049823 Ga0501044_0226791 Ga0501044_0226791_1344_1748 131
27 3300049823 Ga0501044_0678595 Ga0501044_0678595_252_656 131
28 3300005340 Ga0070689_100636686 Ga0070689_1006366862 132
29 3300005353 Ga0070669_100848037 Ga0070669_1008480372 132
30 3300005840 Ga0068870_10867191 Ga0068870_108671912 132
31 3300025916 Ga0207663_10117794 Ga0207663_101177942 132
32 3300025919 Ga0207657_10955243 Ga0207657_109552431 132
33 3300031249 Ga0265339_10580716 Ga0265339_105807161 132
34 3300048907 Ga0496104_0036469 Ga0496104_0036469_2181_2582 132
35 3300048909 Ga0496106_0018329 Ga0496106_0018329_3625_4026 132
36 3300048910 Ga0496107_0002191 Ga0496107_0002191_4918_5319 132
37 3300048911 Ga0496108_0000708 Ga0496108_0000708_8279_8680 132
38 3300048912 Ga0496109_0000492 Ga0496109_0000492_8145_8546 132
39 3300048913 Ga0496110_0002285 Ga0496110_0002285_5031_5432 132
40 3300048915 Ga0496112_0000640 Ga0496112_0000640_15586_15987 132
41 3300048916 Ga0496113_0159072 Ga0496113_0159072_1112_1513 132
42 3300048917 Ga0496114_0305799 Ga0496114_0305799_356_757 132
43 3300048918 Ga0496115_0371995 Ga0496115_0371995_440_841 132
44 3300035170 Ga0373943_0614826 Ga0373943_0614826_163_567 133
45 3300020076 Ga0206355_1173982 Ga0206355_11739822 134
46 3300020080 Ga0206350_11433473 Ga0206350_114334731 134
47 3300025981 Ga0207640_12146876 Ga0207640_121468761 134
48 iso_pu_bacteria 8019619141 8019628655 134
49 3300038443 Ga0395901_0716470 Ga0395901_0716470_341_751 135
50 3300059645 Ga0587076_151816 Ga0587076_151816_54_461 135
51 3300049822 Ga0501035_0358222 Ga0501035_0358222_554_967 136
52 iso_pu_bacteria 2922361189 2922365831 136
53 3300053138 Ga0500564_197584 Ga0500564_197584_398_814 138
54 iso_pu_bacteria 2524023228 2524534054 138
55 iso_pu_bacteria 2849076700 2849078881 138
56 3300026041 Ga0207639_11168733 Ga0207639_111687331 139
57 iso_pu_bacteria 2513237104 2513722148 139
58 iso_pu_bacteria 2879110137 2879115940 139
59 3300053118 Ga0500594_0322779 Ga0500594_0322779_11_436 140
60 iso_pu_bacteria 2508501128 2509151429 140
61 iso_pu_bacteria 2513237096 2513657000 140
62 iso_pu_bacteria 2513237101 2513696779 140
63 iso_pu_bacteria 2513237137 2513855440 140
64 iso_pu_bacteria 2513237145 2513918740 140
65 iso_pu_bacteria 2517572143 2517891989 140
66 iso_pu_bacteria 2524023205 2524443065 140
67 iso_pu_bacteria 2524023210 2524470216 140
68 iso_pu_bacteria 2667528175 2671121973 140
69 iso_pu_bacteria 2721755755 2723846628 140
70 iso_pu_bacteria 2728368998 2728753074 140
71 iso_pu_bacteria 2744054633 2745074740 140
72 iso_pu_bacteria 2791355197 2793068944 140
73 iso_pu_bacteria 2791355199 2793076609 140
74 iso_pu_bacteria 2874604998 2874605657 140
75 iso_pu_bacteria 2876808645 2876814697 140
76 iso_pu_bacteria 2885374607 2885375260 140
77 iso_pu_bacteria 2889033259 2889041190 140
78 iso_pu_bacteria 2903748898 2903750199 140
79 iso_pu_bacteria 2904690495 2904694952 140
80 iso_pu_bacteria 2904699407 2904704060 140
81 iso_pu_bacteria 2906610324 2906617110 140
82 iso_pu_bacteria 2906626472 2906632029 140
83 iso_pu_bacteria 2906635258 2906643215 140
84 iso_pu_bacteria 2906660503 2906662377 140
85 iso_pu_bacteria 2908739725 2908742255 140
86 iso_pu_bacteria 2908756301 2908759908 140
87 iso_pu_bacteria 2922386360 2922391379 140
88 iso_pu_bacteria 2922425934 2922430736 140
89 iso_pu_bacteria 2935630451 2935636435 140
90 iso_pu_bacteria 2941507105 2941509855 140
91 iso_pu_bacteria 2941515067 2941520901 140
92 iso_pu_bacteria 2941523033 2941525254 140
93 iso_pu_bacteria 3005474847 3005480642 140
94 iso_pu_bacteria 8006926726 8006931751 140
95 iso_pu_bacteria 8006933436 8006940130 140
96 iso_pu_bacteria 8006964411 8006969742 140
97 iso_pu_bacteria 8006973647 8006979913 140
98 iso_pu_bacteria 8006984368 8006987807 140
99 iso_pu_bacteria 8006994254 8007000803 140
100 iso_pu_bacteria 8016583857 8016593367 140
101 iso_pu_bacteria 8019555841 8019556102 140
102 iso_pu_bacteria 8019565922 8019569205 140
103 iso_pu_bacteria 8056681323 8056689304 140
104 iso_pu_bacteria 8056689827 8056692171 140
105 iso_pu_bacteria 2507262055 2507508148 141
106 iso_pu_bacteria 2508501009 2508542213 141
107 iso_pu_bacteria 2508501042 2508692027 141
108 iso_pu_bacteria 2513237092 2513622278 141
109 iso_pu_bacteria 2513237094 2513640428 141
110 iso_pu_bacteria 2513237095 2513645350 141
111 iso_pu_bacteria 2513237102 2513703061 141
112 iso_pu_bacteria 2513237139 2513873221 141
113 iso_pu_bacteria 2513237161 2514015794 141
114 iso_pu_bacteria 2515154112 2515627348 141
115 iso_pu_bacteria 2528768022 2528848812 141
116 iso_pu_bacteria 2617270735 2617346105 141
117 iso_pu_bacteria 2617270741 2617375340 141
118 iso_pu_bacteria 2791355196 2793060510 141
119 iso_pu_bacteria 2802429603 2805914789 141
120 iso_pu_bacteria 2816332527 2818239588 141
121 iso_pu_bacteria 2824617872 2824618438 141
122 iso_pu_bacteria 2824626560 2824627347 141
123 iso_pu_bacteria 2824635225 2824639688 141
124 iso_pu_bacteria 2824644064 2824646668 141
125 iso_pu_bacteria 2824661429 2824665613 141
126 iso_pu_bacteria 2824671348 2824676417 141
127 iso_pu_bacteria 2824679649 2824687141 141
128 iso_pu_bacteria 2824687955 2824692822 141
129 iso_pu_bacteria 2824696289 2824700303 141
130 iso_pu_bacteria 2824704595 2824713475 141
131 iso_pu_bacteria 2824714736 2824716966 141
132 iso_pu_bacteria 2824723954 2824727266 141
133 iso_pu_bacteria 2824732956 2824738197 141
134 iso_pu_bacteria 2824746037 2824752699 141
135 iso_pu_bacteria 2824753945 2824756579 141
136 iso_pu_bacteria 2824763712 2824766073 141
137 iso_pu_bacteria 2824773399 2824774519 141
138 iso_pu_bacteria 2838122688 2838123270 141
139 iso_pu_bacteria 2841941048 2841946562 141
140 iso_pu_bacteria 2841949485 2841954209 141
141 iso_pu_bacteria 2841966195 2841969583 141
142 iso_pu_bacteria 2841974524 2841974532 141
143 iso_pu_bacteria 2841983080 2841983905 141
144 iso_pu_bacteria 2847939898 2847947012 141
145 iso_pu_bacteria 2874590934 2874598485 141
146 iso_pu_bacteria 2874612657 2874619294 141
147 iso_pu_bacteria 2874620515 2874626485 141
148 iso_pu_bacteria 2874645413 2874652461 141
149 iso_pu_bacteria 2876771140 2876778036 141
150 iso_pu_bacteria 2876818435 2876826094 141
151 iso_pu_bacteria 2879074833 2879081830 141
152 iso_pu_bacteria 2879099564 2879108465 141
153 iso_pu_bacteria 2879127579 2879134952 141
154 iso_pu_bacteria 2879142872 2879149637 141
155 iso_pu_bacteria 2881364244 2881368392 141
156 iso_pu_bacteria 2881665667 2881672458 141
157 iso_pu_bacteria 2885366525 2885370457 141
158 iso_pu_bacteria 2885409591 2885413694 141
159 iso_pu_bacteria 2888378607 2888384570 141
160 iso_pu_bacteria 2888388044 2888393345 141
161 iso_pu_bacteria 2904666416 2904671826 141
162 iso_pu_bacteria 2904711408 2904715196 141
163 iso_pu_bacteria 2908775508 2908780606 141
164 iso_pu_bacteria 2922368715 2922375016 141
165 iso_pu_bacteria 2922393267 2922394494 141
166 iso_pu_bacteria 2929615660 2929622043 141
167 iso_pu_bacteria 2929624759 2929629650 141
168 iso_pu_bacteria 2932784394 2932793825 141
169 iso_pu_bacteria 2932809354 2932812894 141
170 iso_pu_bacteria 2932818245 2932819015 141
171 iso_pu_bacteria 2932828146 2932830580 141
172 iso_pu_bacteria 2933577622 2933583682 141
173 iso_pu_bacteria 2935608549 2935609367 141
174 iso_pu_bacteria 2935616580 2935616875 141
175 iso_pu_bacteria 2935638405 2935641795 141
176 iso_pu_bacteria 2935648319 2935650837 141
177 iso_pu_bacteria 2935656913 2935659018 141
178 iso_pu_bacteria 2935665750 2935671663 141
179 iso_pu_bacteria 2935675223 2935683440 141
180 iso_pu_bacteria 2935684952 2935685720 141
181 iso_pu_bacteria 2935694250 2935698027 141
182 iso_pu_bacteria 2935703347 2935705567 141
183 iso_pu_bacteria 2935713505 2935714272 141
184 iso_pu_bacteria 2935722832 2935724891 141
185 iso_pu_bacteria 2935732158 2935732750 141
186 iso_pu_bacteria 2935741537 2935742129 141
187 iso_pu_bacteria 2935750917 2935751685 141
188 iso_pu_bacteria 2935760218 2935768173 141
189 iso_pu_bacteria 2935769743 2935769792 141
190 iso_pu_bacteria 2935777560 2935778988 141
191 iso_pu_bacteria 2935785616 2935785966 141
192 iso_pu_bacteria 2935793552 2935794106 141
193 iso_pu_bacteria 2935801545 2935802546 141
194 iso_pu_bacteria 2935810662 2935813624 141
195 iso_pu_bacteria 2935819856 2935822527 141
196 iso_pu_bacteria 2935827899 2935829962 141
197 iso_pu_bacteria 2935837841 2935837878 141
198 iso_pu_bacteria 2935847175 2935848110 141
199 iso_pu_bacteria 2935855204 2935855499 141
200 iso_pu_bacteria 2935864058 2935867256 141
201 iso_pu_bacteria 2935873716 2935875924 141
202 iso_pu_bacteria 2935908558 2935908667 141
203 iso_pu_bacteria 2935916978 2935917812 141
204 iso_pu_bacteria 2935926038 2935926759 141
205 iso_pu_bacteria 2935934488 2935935209 141
206 iso_pu_bacteria 2935942939 2935943659 141
207 iso_pu_bacteria 2935951376 2935952097 141
208 iso_pu_bacteria 2935959822 2935960898 141
209 iso_pu_bacteria 2935967501 2935968222 141
210 iso_pu_bacteria 2935975950 2935978843 141
211 iso_pu_bacteria 2935992306 2935996593 141
212 iso_pu_bacteria 2936002035 2936003867 141
213 iso_pu_bacteria 2936011229 2936013433 141
214 iso_pu_bacteria 2936019824 2936022440 141
215 iso_pu_bacteria 2936028420 2936030886 141
216 iso_pu_bacteria 2936037263 2936042797 141
217 iso_pu_bacteria 2936046547 2936048699 141
218 iso_pu_bacteria 2936055302 2936058913 141
219 iso_pu_bacteria 2940556831 2940557512 141
220 iso_pu_bacteria 2941538514 2941539456 141
221 iso_pu_bacteria 3005483717 3005484750 141
222 iso_pu_bacteria 3005506211 3005507495 141
223 iso_pu_bacteria 3005587118 3005587602 141
224 iso_pu_bacteria 3005594810 3005599720 141
225 iso_pu_bacteria 3005710791 3005715363 141
226 iso_pu_bacteria 3005718088 3005722737 141
227 iso_pu_bacteria 8016511872 8016521706 141
228 iso_pu_bacteria 8016522445 8016529146 141
229 iso_pu_bacteria 8016530956 8016534352 141
230 iso_pu_bacteria 8016548790 8016554561 141
231 iso_pu_bacteria 8016557553 8016562931 141
232 iso_pu_bacteria 8016566248 8016572693 141
233 iso_pu_bacteria 8016575299 8016576854 141
234 iso_pu_bacteria 8016595262 8016600703 141
235 iso_pu_bacteria 8016603502 8016610028 141
236 iso_pu_bacteria 8016613128 8016614909 141
237 iso_pu_bacteria 8016622563 8016626077 141
238 iso_pu_bacteria 8016630954 8016639855 141
239 iso_pu_bacteria 8017057580 8017063941 141
240 iso_pu_bacteria 8019530166 8019534119 141
241 iso_pu_bacteria 8019538911 8019545349 141
242 iso_pu_bacteria 8019576017 8019583295 141
243 iso_pu_bacteria 8019586578 8019591104 141
244 iso_pu_bacteria 8019597564 8019600238 141
245 iso_pu_bacteria 8019608314 8019618304 141
246 iso_pu_bacteria 8019638758 8019645754 141
247 iso_pu_bacteria 8019648815 8019659032 141
248 iso_pu_bacteria 8019659431 8019661858 141
249 iso_pu_bacteria 8019668869 8019671384 141
250 iso_pu_bacteria 8055742211 8055745792 141
251 iso_pu_bacteria 8056967851 8056968485 141
252 3300005327 Ga0070658_10026123 Ga0070658_100261233 142
253 3300005329 Ga0070683_100033154 Ga0070683_1000331543 142
254 3300005336 Ga0070680_100012506 Ga0070680_1000125066 142
255 3300005337 Ga0070682_100935830 Ga0070682_1009358301 142
256 3300005339 Ga0070660_100031842 Ga0070660_1000318422 142
257 3300005344 Ga0070661_100073259 Ga0070661_1000732593 142
258 3300005366 Ga0070659_100089592 Ga0070659_1000895922 142
259 3300005435 Ga0070714_100258835 Ga0070714_1002588351 142
260 3300005436 Ga0070713_100050580 Ga0070713_1000505803 142
261 3300005458 Ga0070681_10419909 Ga0070681_104199091 142
262 3300005530 Ga0070679_100002694 Ga0070679_10000269416 142
263 3300005535 Ga0070684_100000621 Ga0070684_10000062112 142
264 3300005539 Ga0068853_100160683 Ga0068853_1001606832 142
265 3300005547 Ga0070693_100582955 Ga0070693_1005829552 142
266 3300005563 Ga0068855_100147281 Ga0068855_1001472812 142
267 3300005577 Ga0068857_100043499 Ga0068857_1000434993 142
268 3300005578 Ga0068854_100034085 Ga0068854_1000340852 142
269 3300005616 Ga0068852_100302407 Ga0068852_1003024072 142
270 3300005834 Ga0068851_10153668 Ga0068851_101536682 142
271 3300006173 Ga0070716_100577656 Ga0070716_1005776562 142
272 3300009093 Ga0105240_10108339 Ga0105240_101083393 142
273 3300009174 Ga0105241_10620009 Ga0105241_106200092 142
274 3300009545 Ga0105237_10011853 Ga0105237_1001185310 142
275 3300009551 Ga0105238_10019915 Ga0105238_100199156 142
276 3300010375 Ga0105239_10060173 Ga0105239_100601733 142
277 3300013105 Ga0157369_10009427 Ga0157369_100094273 142
278 3300025321 Ga0207656_10088718 Ga0207656_100887181 142
279 3300025904 Ga0207647_10618347 Ga0207647_106183471 142
280 3300025909 Ga0207705_10013315 Ga0207705_100133155 142
281 3300025912 Ga0207707_10027522 Ga0207707_100275225 142
282 3300025913 Ga0207695_10486791 Ga0207695_104867912 142
283 3300025914 Ga0207671_10542907 Ga0207671_105429072 142
284 3300025917 Ga0207660_10020422 Ga0207660_100204221 142
285 3300025919 Ga0207657_10067780 Ga0207657_100677803 142
286 3300025921 Ga0207652_10005120 Ga0207652_100051204 142
287 3300025924 Ga0207694_10041481 Ga0207694_100414812 142
288 3300025929 Ga0207664_10098419 Ga0207664_100984192 142
289 3300025939 Ga0207665_10210819 Ga0207665_102108192 142
290 3300025944 Ga0207661_10012708 Ga0207661_100127081 142
291 3300025949 Ga0207667_10107367 Ga0207667_101073673 142
292 3300026041 Ga0207639_10035654 Ga0207639_100356543 142
293 3300026116 Ga0207674_10020869 Ga0207674_100208693 142
294 3300026142 Ga0207698_10327332 Ga0207698_103273322 142
295 3300035111 Ga0373923_0049119 Ga0373923_0049119_167_598 142
296 3300035113 Ga0373936_0013742 Ga0373936_0013742_1775_2206 142
297 3300035116 Ga0373945_0019653 Ga0373945_0019653_634_1065 142
298 3300035121 Ga0373960_0062946 Ga0373960_0062946_441_872 142
299 3300035170 Ga0373943_0003155 Ga0373943_0003155_2686_3117 142
300 3300035171 Ga0373946_0014986 Ga0373946_0014986_319_750 142
301 3300035172 Ga0373955_0031453 Ga0373955_0031453_2263_2694 142
302 3300035692 Ga0373935_0002637 Ga0373935_0002637_6224_6655 142
303 3300035695 Ga0373927_0000488 Ga0373927_0000488_8014_8445 142
304 3300035725 Ga0373947_0000909 Ga0373947_0000909_7641_8072 142
305 3300036401 Ga0373937_0073915 Ga0373937_0073915_2173_2604 142
306 3300037068 Ga0373925_0009396 Ga0373925_0009396_2048_2479 142
307 3300039450 Ga0436363_1056798 Ga0436363_1056798_317_751 142
308 3300041496 Ga0451839_0270489 Ga0451839_0270489_79_510 142
309 3300044693 Ga0466961_0596716 Ga0466961_0596716_137_577 142
310 3300044719 Ga0466971_0466254 Ga0466971_0466254_57_497 142
311 3300044842 Ga0466957_1193114 Ga0466957_1193114_44_484 142
312 3300046455 Ga0495603_0006651 Ga0495603_0006651_4876_5307 142
313 3300046459 Ga0495629_0000483 Ga0495629_0000483_9649_10080 142
314 3300046461 Ga0495641_0008137 Ga0495641_0008137_5562_5993 142
315 3300046463 Ga0495653_0667448 Ga0495653_0667448_101_532 142
316 3300046472 Ga0495580_0000574 Ga0495580_0000574_6722_7153 142
317 3300046473 Ga0495582_0000221 Ga0495582_0000221_23126_23557 142
318 3300046475 Ga0495639_0000308 Ga0495639_0000308_15603_16034 142
319 3300046476 Ga0495662_0034926 Ga0495662_0034926_160_591 142
320 3300046477 Ga0495664_0011444 Ga0495664_0011444_4323_4754 142
321 3300046499 Ga0495594_0000259 Ga0495594_0000259_14503_14934 142
322 3300046516 Ga0495628_0105040 Ga0495628_0105040_560_991 142
323 3300046517 Ga0495630_0003908 Ga0495630_0003908_1898_2329 142
324 3300046529 Ga0495652_0031217 Ga0495652_0031217_1913_2344 142
325 3300046531 Ga0495665_0000153 Ga0495665_0000153_23253_23684 142
326 3300046533 Ga0495640_0000198 Ga0495640_0000198_17827_18258 142
327 3300046543 Ga0495645_0089260 Ga0495645_0089260_445_885 142
328 3300046557 Ga0495622_0004435 Ga0495622_0004435_5901_6332 142
329 3300046559 Ga0495667_0006893 Ga0495667_0006893_5847_6278 142
330 3300046642 Ga0495634_0001034 Ga0495634_0001034_23229_23660 142
331 3300046663 Ga0495635_0014273 Ga0495635_0014273_3661_4092 142
332 3300046674 Ga0495588_0046544 Ga0495588_0046544_1271_1702 142
333 3300046678 Ga0495599_0148024 Ga0495599_0148024_25_465 142
334 3300046678 Ga0495599_0154512 Ga0495599_0154512_837_1268 142
335 3300046681 Ga0495647_0001232 Ga0495647_0001232_3492_3923 142
336 3300046683 Ga0495658_0000722 Ga0495658_0000722_12199_12630 142
337 3300046689 Ga0495613_0000393 Ga0495613_0000393_14139_14570 142
338 3300046690 Ga0495624_0000182 Ga0495624_0000182_23207_23638 142
339 3300047315 Ga0495581_0000502 Ga0495581_0000502_5264_5695 142
340 3300047319 Ga0495674_0001836 Ga0495674_0001836_15746_16177 142
341 3300047321 Ga0495676_0022847 Ga0495676_0022847_3329_3760 142
342 3300047444 Ga0495675_0386080 Ga0495675_0386080_28_459 142
343 3300047471 Ga0495684_0087376 Ga0495684_0087376_443_874 142
344 3300047673 Ga0495593_0000477 Ga0495593_0000477_10537_10968 142
345 3300048918 Ga0496115_0250461 Ga0496115_0250461_311_742 142
346 3300048929 Ga0496126_0564664 Ga0496126_0564664_38_469 142
347 3300048929 Ga0496126_1394606 Ga0496126_1394606_50_481 142
348 3300059511 Ga0587091_065305 Ga0587091_065305_86_526 142
349 3300059630 Ga0587128_042698 Ga0587128_042698_253_693 142
350 3300061719 Ga0466962_0134266 Ga0466962_0134266_662_1102 142
351 iso_pu_bacteria 2824600985 2824607292 142
352 iso_pu_bacteria 2824609381 2824610637 142
353 iso_pu_bacteria 2824653114 2824654238 142
354 iso_pu_bacteria 2888419890 2888425004 142
355 3300009093 Ga0105240_12575919 Ga0105240_125759191 143
356 3300013308 Ga0157375_11243852 Ga0157375_112438521 143
357 3300021377 Ga0213874_10050529 Ga0213874_100505292 143
358 3300021384 Ga0213876_10296497 Ga0213876_102964972 143
359 3300026118 Ga0207675_100936008 Ga0207675_1009360082 143
360 3300027671 Ga0209588_1000484 Ga0209588_10004847 143
361 3300028379 Ga0268266_11457876 Ga0268266_114578761 143
362 3300031249 Ga0265339_10033591 Ga0265339_100335913 143
363 3300031711 Ga0265314_10037345 Ga0265314_100373452 143
364 3300031712 Ga0265342_10005077 Ga0265342_100050774 143
365 3300039437 Ga0436365_1757899 Ga0436365_1757899_489_932 143
366 3300039438 Ga0436360_0199833 Ga0436360_0199833_79_522 143
367 3300039438 Ga0436360_0623484 Ga0436360_0623484_236_679 143
368 3300039450 Ga0436363_0203958 Ga0436363_0203958_390_833 143
369 3300039450 Ga0436363_0309471 Ga0436363_0309471_365_808 143
370 3300048929 Ga0496126_0032722 Ga0496126_0032722_3558_3995 143
371 3300053177 Ga0500636_0507792 Ga0500636_0507792_60_494 143
372 iso_pu_bacteria 2513237098 2513677263 143
373 iso_pu_bacteria 2876761206 2876770385 143
374 iso_pu_bacteria 2885383462 2885391262 143
375 iso_pu_bacteria 2903768456 2903776904 143
376 3300002073 JGI24745J21846_1028407 JGI24745J21846_10284071 144
377 3300002076 JGI24749J21850_1075797 JGI24749J21850_10757971 144
378 3300002244 JGI24742J22300_10059793 JGI24742J22300_100597931 144
379 3300003203 JGI25406J46586_10011488 JGI25406J46586_100114884 144
380 3300003203 JGI25406J46586_10016664 JGI25406J46586_100166643 144
381 3300003215 JGI25153J46596_10008505 JGI25153J46596_100085053 144
382 3300003659 JGI25404J52841_10045597 JGI25404J52841_100455971 144
383 3300003659 JGI25404J52841_10056933 JGI25404J52841_100569331 144
384 3300003659 JGI25404J52841_10095922 JGI25404J52841_100959221 144
385 3300004799 Ga0058863_11742447 Ga0058863_117424471 144
386 3300004800 Ga0058861_11838611 Ga0058861_118386111 144
387 3300004801 Ga0058860_11966111 Ga0058860_119661111 144
388 3300004801 Ga0058860_12114306 Ga0058860_121143061 144
389 3300004801 Ga0058860_12129102 Ga0058860_121291021 144
390 3300004803 Ga0058862_12886227 Ga0058862_128862272 144
391 3300005293 Ga0065715_10366381 Ga0065715_103663812 144
392 3300005327 Ga0070658_10225256 Ga0070658_102252562 144
393 3300005327 Ga0070658_10283047 Ga0070658_102830471 144
394 3300005327 Ga0070658_10363423 Ga0070658_103634231 144
395 3300005328 Ga0070676_10115789 Ga0070676_101157892 144
396 3300005328 Ga0070676_10662692 Ga0070676_106626921 144
397 3300005328 Ga0070676_11226654 Ga0070676_112266541 144
398 3300005329 Ga0070683_100090421 Ga0070683_1000904214 144
399 3300005329 Ga0070683_100179689 Ga0070683_1001796892 144
400 3300005330 Ga0070690_100083437 Ga0070690_1000834372 144
401 3300005331 Ga0070670_100196746 Ga0070670_1001967462 144
402 3300005331 Ga0070670_100296160 Ga0070670_1002961601 144
403 3300005333 Ga0070677_10385846 Ga0070677_103858461 144
404 3300005334 Ga0068869_100064053 Ga0068869_1000640532 144
405 3300005334 Ga0068869_100104355 Ga0068869_1001043552 144
406 3300005334 Ga0068869_100434467 Ga0068869_1004344671 144
407 3300005334 Ga0068869_100496759 Ga0068869_1004967592 144
408 3300005335 Ga0070666_10314810 Ga0070666_103148102 144
409 3300005335 Ga0070666_10463918 Ga0070666_104639182 144
410 3300005336 Ga0070680_100021861 Ga0070680_1000218613 144
411 3300005336 Ga0070680_100057435 Ga0070680_1000574352 144
412 3300005336 Ga0070680_100311639 Ga0070680_1003116392 144
413 3300005336 Ga0070680_100751443 Ga0070680_1007514432 144
414 3300005337 Ga0070682_100006487 Ga0070682_1000064875 144
415 3300005337 Ga0070682_100582578 Ga0070682_1005825781 144
416 3300005338 Ga0068868_100038515 Ga0068868_1000385152 144
417 3300005338 Ga0068868_100238636 Ga0068868_1002386362 144
418 3300005338 Ga0068868_100352418 Ga0068868_1003524182 144
419 3300005338 Ga0068868_101070782 Ga0068868_1010707821 144
420 3300005339 Ga0070660_100708023 Ga0070660_1007080232 144
421 3300005340 Ga0070689_100949864 Ga0070689_1009498641 144
422 3300005341 Ga0070691_10182990 Ga0070691_101829902 144
423 3300005341 Ga0070691_10452199 Ga0070691_104521991 144
424 3300005344 Ga0070661_100242088 Ga0070661_1002420881 144
425 3300005344 Ga0070661_100283896 Ga0070661_1002838962 144
426 3300005347 Ga0070668_100077863 Ga0070668_1000778632 144
427 3300005347 Ga0070668_100144165 Ga0070668_1001441652 144
428 3300005347 Ga0070668_100301700 Ga0070668_1003017002 144
429 3300005347 Ga0070668_100331293 Ga0070668_1003312932 144
430 3300005347 Ga0070668_100375678 Ga0070668_1003756781 144
431 3300005347 Ga0070668_100800166 Ga0070668_1008001662 144
432 3300005347 Ga0070668_100840852 Ga0070668_1008408521 144
433 3300005347 Ga0070668_100965311 Ga0070668_1009653111 144
434 3300005353 Ga0070669_100284212 Ga0070669_1002842121 144
435 3300005353 Ga0070669_101016002 Ga0070669_1010160021 144
436 3300005353 Ga0070669_101865949 Ga0070669_1018659491 144
437 3300005354 Ga0070675_100185365 Ga0070675_1001853652 144
438 3300005354 Ga0070675_100451855 Ga0070675_1004518551 144
439 3300005354 Ga0070675_100547088 Ga0070675_1005470882 144
440 3300005354 Ga0070675_100918645 Ga0070675_1009186451 144
441 3300005355 Ga0070671_100292085 Ga0070671_1002920851 144
442 3300005355 Ga0070671_100415573 Ga0070671_1004155732 144
443 3300005355 Ga0070671_100896181 Ga0070671_1008961811 144
444 3300005356 Ga0070674_100073507 Ga0070674_1000735071 144
445 3300005356 Ga0070674_100151114 Ga0070674_1001511141 144
446 3300005356 Ga0070674_100381587 Ga0070674_1003815872 144
447 3300005356 Ga0070674_100575965 Ga0070674_1005759651 144
448 3300005364 Ga0070673_100318710 Ga0070673_1003187102 144
449 3300005364 Ga0070673_101832151 Ga0070673_1018321511 144
450 3300005365 Ga0070688_100080916 Ga0070688_1000809161 144
451 3300005365 Ga0070688_100638521 Ga0070688_1006385211 144
452 3300005366 Ga0070659_100162618 Ga0070659_1001626182 144
453 3300005366 Ga0070659_100314242 Ga0070659_1003142421 144
454 3300005367 Ga0070667_100159197 Ga0070667_1001591972 144
455 3300005367 Ga0070667_100326851 Ga0070667_1003268512 144
456 3300005367 Ga0070667_100697140 Ga0070667_1006971401 144
457 3300005434 Ga0070709_10018677 Ga0070709_100186773 144
458 3300005434 Ga0070709_10022697 Ga0070709_100226972 144
459 3300005434 Ga0070709_10070933 Ga0070709_100709332 144
460 3300005435 Ga0070714_100040114 Ga0070714_1000401143 144
461 3300005435 Ga0070714_100040203 Ga0070714_1000402032 144
462 3300005435 Ga0070714_100076117 Ga0070714_1000761171 144
463 3300005435 Ga0070714_100158355 Ga0070714_1001583551 144
464 3300005435 Ga0070714_100185602 Ga0070714_1001856022 144
465 3300005435 Ga0070714_100350226 Ga0070714_1003502262 144
466 3300005436 Ga0070713_100010724 Ga0070713_1000107243 144
467 3300005436 Ga0070713_100030898 Ga0070713_1000308983 144
468 3300005436 Ga0070713_100422772 Ga0070713_1004227722 144
469 3300005436 Ga0070713_100500403 Ga0070713_1005004031 144
470 3300005436 Ga0070713_101062571 Ga0070713_1010625711 144
471 3300005436 Ga0070713_101339509 Ga0070713_1013395091 144
472 3300005437 Ga0070710_10000725 Ga0070710_1000072510 144
473 3300005437 Ga0070710_10003810 Ga0070710_100038106 144
474 3300005437 Ga0070710_10006126 Ga0070710_100061267 144
475 3300005437 Ga0070710_10068175 Ga0070710_100681752 144
476 3300005438 Ga0070701_10224185 Ga0070701_102241852 144
477 3300005438 Ga0070701_10243543 Ga0070701_102435431 144
478 3300005439 Ga0070711_100011590 Ga0070711_1000115903 144
479 3300005439 Ga0070711_100207959 Ga0070711_1002079592 144
480 3300005439 Ga0070711_100227652 Ga0070711_1002276521 144
481 3300005439 Ga0070711_100540088 Ga0070711_1005400882 144
482 3300005439 Ga0070711_101217559 Ga0070711_1012175592 144
483 3300005441 Ga0070700_100189928 Ga0070700_1001899282 144
484 3300005441 Ga0070700_100249862 Ga0070700_1002498621 144
485 3300005444 Ga0070694_100196413 Ga0070694_1001964132 144
486 3300005455 Ga0070663_100008002 Ga0070663_1000080022 144
487 3300005455 Ga0070663_100046554 Ga0070663_1000465543 144
488 3300005455 Ga0070663_100050416 Ga0070663_1000504162 144
489 3300005455 Ga0070663_100110392 Ga0070663_1001103921 144
490 3300005455 Ga0070663_100250630 Ga0070663_1002506302 144
491 3300005455 Ga0070663_100292355 Ga0070663_1002923552 144
492 3300005455 Ga0070663_100319210 Ga0070663_1003192102 144
493 3300005456 Ga0070678_100021665 Ga0070678_1000216653 144
494 3300005456 Ga0070678_100196527 Ga0070678_1001965271 144
495 3300005456 Ga0070678_100352029 Ga0070678_1003520292 144
496 3300005456 Ga0070678_100509962 Ga0070678_1005099622 144
497 3300005456 Ga0070678_100550164 Ga0070678_1005501641 144
498 3300005456 Ga0070678_101178734 Ga0070678_1011787342 144
499 3300005457 Ga0070662_100220056 Ga0070662_1002200562 144
500 3300005457 Ga0070662_101649461 Ga0070662_1016494611 144
501 3300005458 Ga0070681_10054112 Ga0070681_100541123 144
502 3300005458 Ga0070681_10082833 Ga0070681_100828333 144
503 3300005458 Ga0070681_10318071 Ga0070681_103180712 144
504 3300005458 Ga0070681_10886401 Ga0070681_108864011 144
505 3300005459 Ga0068867_100210459 Ga0068867_1002104592 144
506 3300005459 Ga0068867_100435605 Ga0068867_1004356052 144
507 3300005459 Ga0068867_101445523 Ga0068867_1014455231 144
508 3300005466 Ga0070685_10416786 Ga0070685_104167861 144
509 3300005466 Ga0070685_10971966 Ga0070685_109719661 144
510 3300005467 Ga0070706_100182280 Ga0070706_1001822802 144
511 3300005468 Ga0070707_100172001 Ga0070707_1001720012 144
512 3300005471 Ga0070698_100068577 Ga0070698_1000685772 144
513 3300005518 Ga0070699_100384256 Ga0070699_1003842562 144
514 3300005530 Ga0070679_100003367 Ga0070679_1000033676 144
515 3300005530 Ga0070679_100037652 Ga0070679_1000376524 144
516 3300005530 Ga0070679_100044161 Ga0070679_1000441615 144
517 3300005530 Ga0070679_100079804 Ga0070679_1000798043 144
518 3300005530 Ga0070679_100259634 Ga0070679_1002596342 144
519 3300005530 Ga0070679_100393123 Ga0070679_1003931232 144
520 3300005530 Ga0070679_100395699 Ga0070679_1003956991 144
521 3300005535 Ga0070684_100025802 Ga0070684_1000258024 144
522 3300005535 Ga0070684_100224803 Ga0070684_1002248032 144
523 3300005535 Ga0070684_100398622 Ga0070684_1003986221 144
524 3300005535 Ga0070684_100667030 Ga0070684_1006670302 144
525 3300005535 Ga0070684_101450648 Ga0070684_1014506481 144
526 3300005535 Ga0070684_101459194 Ga0070684_1014591941 144
527 3300005536 Ga0070697_100604655 Ga0070697_1006046552 144
528 3300005536 Ga0070697_100946412 Ga0070697_1009464121 144
529 3300005536 Ga0070697_100999211 Ga0070697_1009992111 144
530 3300005539 Ga0068853_100123009 Ga0068853_1001230093 144
531 3300005539 Ga0068853_101075122 Ga0068853_1010751221 144
532 3300005539 Ga0068853_102030517 Ga0068853_1020305171 144
533 3300005543 Ga0070672_100098775 Ga0070672_1000987752 144
534 3300005543 Ga0070672_100189663 Ga0070672_1001896632 144
535 3300005543 Ga0070672_100472896 Ga0070672_1004728961 144
536 3300005543 Ga0070672_100911007 Ga0070672_1009110072 144
537 3300005544 Ga0070686_100364357 Ga0070686_1003643572 144
538 3300005544 Ga0070686_100818745 Ga0070686_1008187452 144
539 3300005546 Ga0070696_100252699 Ga0070696_1002526991 144
540 3300005547 Ga0070693_100401216 Ga0070693_1004012162 144
541 3300005548 Ga0070665_100054703 Ga0070665_1000547033 144
542 3300005548 Ga0070665_100100540 Ga0070665_1001005403 144
543 3300005548 Ga0070665_100130873 Ga0070665_1001308732 144
544 3300005548 Ga0070665_100283940 Ga0070665_1002839402 144
545 3300005548 Ga0070665_100743911 Ga0070665_1007439112 144
546 3300005548 Ga0070665_100957142 Ga0070665_1009571422 144
547 3300005549 Ga0070704_100188055 Ga0070704_1001880552 144
548 3300005563 Ga0068855_100103169 Ga0068855_1001031693 144
549 3300005563 Ga0068855_100122647 Ga0068855_1001226473 144
550 3300005563 Ga0068855_100326887 Ga0068855_1003268872 144
551 3300005563 Ga0068855_101694620 Ga0068855_1016946201 144
552 3300005564 Ga0070664_100293540 Ga0070664_1002935402 144
553 3300005564 Ga0070664_100405212 Ga0070664_1004052122 144
554 3300005564 Ga0070664_101165437 Ga0070664_1011654372 144
555 3300005564 Ga0070664_101482887 Ga0070664_1014828871 144
556 3300005577 Ga0068857_100261709 Ga0068857_1002617092 144
557 3300005577 Ga0068857_100274618 Ga0068857_1002746182 144
558 3300005578 Ga0068854_100219702 Ga0068854_1002197022 144
559 3300005578 Ga0068854_100262734 Ga0068854_1002627342 144
560 3300005578 Ga0068854_100850635 Ga0068854_1008506351 144
561 3300005614 Ga0068856_100000201 Ga0068856_10000020153 144
562 3300005614 Ga0068856_100555071 Ga0068856_1005550712 144
563 3300005614 Ga0068856_100625091 Ga0068856_1006250912 144
564 3300005614 Ga0068856_100715027 Ga0068856_1007150271 144
565 3300005614 Ga0068856_100759672 Ga0068856_1007596722 144
566 3300005614 Ga0068856_101308636 Ga0068856_1013086362 144
567 3300005615 Ga0070702_100079418 Ga0070702_1000794181 144
568 3300005615 Ga0070702_100272169 Ga0070702_1002721692 144
569 3300005616 Ga0068852_100742036 Ga0068852_1007420362 144
570 3300005616 Ga0068852_100829663 Ga0068852_1008296632 144
571 3300005616 Ga0068852_101164194 Ga0068852_1011641941 144
572 3300005616 Ga0068852_101488739 Ga0068852_1014887391 144
573 3300005617 Ga0068859_100045251 Ga0068859_1000452512 144
574 3300005617 Ga0068859_100116420 Ga0068859_1001164202 144
575 3300005617 Ga0068859_100325593 Ga0068859_1003255932 144
576 3300005617 Ga0068859_100372061 Ga0068859_1003720612 144
577 3300005617 Ga0068859_100641261 Ga0068859_1006412612 144
578 3300005618 Ga0068864_100062298 Ga0068864_1000622982 144
579 3300005618 Ga0068864_100110512 Ga0068864_1001105123 144
580 3300005618 Ga0068864_100167663 Ga0068864_1001676633 144
581 3300005618 Ga0068864_100194200 Ga0068864_1001942001 144
582 3300005618 Ga0068864_100544648 Ga0068864_1005446481 144
583 3300005618 Ga0068864_100597428 Ga0068864_1005974282 144
584 3300005618 Ga0068864_101241333 Ga0068864_1012413332 144
585 3300005718 Ga0068866_10092168 Ga0068866_100921682 144
586 3300005718 Ga0068866_10340513 Ga0068866_103405132 144
587 3300005719 Ga0068861_100189930 Ga0068861_1001899302 144
588 3300005719 Ga0068861_100212459 Ga0068861_1002124592 144
589 3300005719 Ga0068861_100580845 Ga0068861_1005808451 144
590 3300005834 Ga0068851_10510849 Ga0068851_105108492 144
591 3300005834 Ga0068851_10581373 Ga0068851_105813732 144
592 3300005840 Ga0068870_10079790 Ga0068870_100797902 144
593 3300005840 Ga0068870_10080681 Ga0068870_100806812 144
594 3300005841 Ga0068863_100443923 Ga0068863_1004439232 144
595 3300005841 Ga0068863_100448929 Ga0068863_1004489292 144
596 3300005841 Ga0068863_100450100 Ga0068863_1004501002 144
597 3300005841 Ga0068863_101561969 Ga0068863_1015619691 144
598 3300005842 Ga0068858_100155075 Ga0068858_1001550752 144
599 3300005842 Ga0068858_100200946 Ga0068858_1002009462 144
600 3300005842 Ga0068858_100325967 Ga0068858_1003259672 144
601 3300005842 Ga0068858_102001293 Ga0068858_1020012931 144
602 3300005843 Ga0068860_100000289 Ga0068860_10000028958 144
603 3300005843 Ga0068860_100222875 Ga0068860_1002228752 144
604 3300005843 Ga0068860_100596626 Ga0068860_1005966261 144
605 3300005843 Ga0068860_100807480 Ga0068860_1008074802 144
606 3300005843 Ga0068860_101613271 Ga0068860_1016132711 144
607 3300005843 Ga0068860_102659985 Ga0068860_1026599851 144
608 3300005844 Ga0068862_100068226 Ga0068862_1000682263 144
609 3300005844 Ga0068862_100148045 Ga0068862_1001480452 144
610 3300005844 Ga0068862_100826161 Ga0068862_1008261612 144
611 3300005844 Ga0068862_101356472 Ga0068862_1013564721 144
612 3300005844 Ga0068862_102654913 Ga0068862_1026549131 144
613 3300005937 Ga0081455_10012314 Ga0081455_100123143 144
614 3300005937 Ga0081455_10019799 Ga0081455_100197996 144
615 3300005937 Ga0081455_10020159 Ga0081455_100201595 144
616 3300005937 Ga0081455_10026512 Ga0081455_100265123 144
617 3300005937 Ga0081455_10228020 Ga0081455_102280201 144
618 3300005937 Ga0081455_10318556 Ga0081455_103185562 144
619 3300005981 Ga0081538_10073885 Ga0081538_100738851 144
620 3300005981 Ga0081538_10200242 Ga0081538_102002422 144
621 3300005983 Ga0081540_1002792 Ga0081540_100279211 144
622 3300005983 Ga0081540_1004157 Ga0081540_10041578 144
623 3300005983 Ga0081540_1004365 Ga0081540_10043655 144
624 3300005983 Ga0081540_1004412 Ga0081540_10044129 144
625 3300005983 Ga0081540_1011178 Ga0081540_10111785 144
626 3300005983 Ga0081540_1020291 Ga0081540_10202912 144
627 3300005983 Ga0081540_1021342 Ga0081540_10213422 144
628 3300005983 Ga0081540_1027604 Ga0081540_10276042 144
629 3300005983 Ga0081540_1047429 Ga0081540_10474292 144
630 3300005983 Ga0081540_1182984 Ga0081540_11829841 144
631 3300005983 Ga0081540_1329606 Ga0081540_13296061 144
632 3300005985 Ga0081539_10000148 Ga0081539_1000014853 144
633 3300005985 Ga0081539_10035694 Ga0081539_100356942 144
634 3300005985 Ga0081539_10039795 Ga0081539_100397952 144
635 3300005985 Ga0081539_10294315 Ga0081539_102943151 144
636 3300006028 Ga0070717_10029353 Ga0070717_100293533 144
637 3300006028 Ga0070717_10299725 Ga0070717_102997252 144
638 3300006028 Ga0070717_10542485 Ga0070717_105424851 144
639 3300006038 Ga0075365_10055792 Ga0075365_100557922 144
640 3300006038 Ga0075365_10079199 Ga0075365_100791993 144
641 3300006038 Ga0075365_10190605 Ga0075365_101906052 144
642 3300006038 Ga0075365_10223168 Ga0075365_102231682 144
643 3300006038 Ga0075365_10300150 Ga0075365_103001502 144
644 3300006038 Ga0075365_10672456 Ga0075365_106724561 144
645 3300006038 Ga0075365_10764004 Ga0075365_107640041 144
646 3300006042 Ga0075368_10060534 Ga0075368_100605341 144
647 3300006042 Ga0075368_10095443 Ga0075368_100954432 144
648 3300006042 Ga0075368_10164519 Ga0075368_101645192 144
649 3300006042 Ga0075368_10436626 Ga0075368_104366261 144
650 3300006048 Ga0075363_100001658 Ga0075363_1000016584 144
651 3300006048 Ga0075363_100091755 Ga0075363_1000917552 144
652 3300006051 Ga0075364_10278796 Ga0075364_102787961 144
653 3300006051 Ga0075364_10341441 Ga0075364_103414412 144
654 3300006051 Ga0075364_10369721 Ga0075364_103697211 144
655 3300006163 Ga0070715_10010336 Ga0070715_100103362 144
656 3300006163 Ga0070715_10076947 Ga0070715_100769471 144
657 3300006173 Ga0070716_100002224 Ga0070716_1000022242 144
658 3300006173 Ga0070716_100030041 Ga0070716_1000300413 144
659 3300006173 Ga0070716_100143794 Ga0070716_1001437942 144
660 3300006173 Ga0070716_100220639 Ga0070716_1002206391 144
661 3300006173 Ga0070716_100435461 Ga0070716_1004354611 144
662 3300006173 Ga0070716_100523351 Ga0070716_1005233512 144
663 3300006175 Ga0070712_100004628 Ga0070712_1000046283 144
664 3300006175 Ga0070712_100014309 Ga0070712_1000143093 144
665 3300006175 Ga0070712_100086834 Ga0070712_1000868343 144
666 3300006175 Ga0070712_100565823 Ga0070712_1005658232 144
667 3300006177 Ga0075362_10110127 Ga0075362_101101272 144
668 3300006178 Ga0075367_10140376 Ga0075367_101403762 144
669 3300006178 Ga0075367_10157514 Ga0075367_101575142 144
670 3300006178 Ga0075367_10172009 Ga0075367_101720092 144
671 3300006178 Ga0075367_10187755 Ga0075367_101877551 144
672 3300006186 Ga0075369_10323508 Ga0075369_103235081 144
673 3300006186 Ga0075369_10388069 Ga0075369_103880691 144
674 3300006195 Ga0075366_10151310 Ga0075366_101513102 144
675 3300006195 Ga0075366_10392801 Ga0075366_103928011 144
676 3300006195 Ga0075366_10747867 Ga0075366_107478671 144
677 3300006237 Ga0097621_100134641 Ga0097621_1001346412 144
678 3300006237 Ga0097621_100300980 Ga0097621_1003009801 144
679 3300006237 Ga0097621_100407749 Ga0097621_1004077491 144
680 3300006237 Ga0097621_100524074 Ga0097621_1005240742 144
681 3300006237 Ga0097621_101003470 Ga0097621_1010034701 144
682 3300006237 Ga0097621_101293430 Ga0097621_1012934301 144
683 3300006237 Ga0097621_101678804 Ga0097621_1016788041 144
684 3300006353 Ga0075370_10045719 Ga0075370_100457193 144
685 3300006353 Ga0075370_10177681 Ga0075370_101776811 144
686 3300006353 Ga0075370_10377231 Ga0075370_103772311 144
687 3300006353 Ga0075370_10645121 Ga0075370_106451211 144
688 3300006353 Ga0075370_11023539 Ga0075370_110235391 144
689 3300006358 Ga0068871_100126964 Ga0068871_1001269642 144
690 3300006358 Ga0068871_100163833 Ga0068871_1001638332 144
691 3300006358 Ga0068871_100238761 Ga0068871_1002387612 144
692 3300006358 Ga0068871_100530958 Ga0068871_1005309582 144
693 3300006358 Ga0068871_100586524 Ga0068871_1005865241 144
694 3300006358 Ga0068871_101230935 Ga0068871_1012309351 144
695 3300006358 Ga0068871_101555752 Ga0068871_1015557521 144
696 3300006844 Ga0075428_100138656 Ga0075428_1001386562 144
697 3300006844 Ga0075428_100310635 Ga0075428_1003106352 144
698 3300006871 Ga0075434_100016398 Ga0075434_1000163983 144
699 3300006871 Ga0075434_100746125 Ga0075434_1007461252 144
700 3300006881 Ga0068865_100049382 Ga0068865_1000493823 144
701 3300006881 Ga0068865_100147740 Ga0068865_1001477402 144
702 3300006881 Ga0068865_100677655 Ga0068865_1006776552 144
703 3300006914 Ga0075436_100263610 Ga0075436_1002636102 144
704 3300006914 Ga0075436_101071749 Ga0075436_1010717491 144
705 3300006931 Ga0097620_100045247 Ga0097620_1000452472 144
706 3300006931 Ga0097620_100116421 Ga0097620_1001164212 144
707 3300006931 Ga0097620_100325590 Ga0097620_1003255902 144
708 3300006931 Ga0097620_100372083 Ga0097620_1003720832 144
709 3300006931 Ga0097620_100641253 Ga0097620_1006412532 144
710 3300006941 Ga0099825_1022051 Ga0099825_10220514 144
711 3300006942 Ga0099824_1006466 Ga0099824_100646612 144
712 3300006943 Ga0099822_1008625 Ga0099822_100862510 144
713 3300007076 Ga0075435_100354531 Ga0075435_1003545311 144
714 3300007076 Ga0075435_101075977 Ga0075435_1010759772 144
715 3300007788 Ga0099795_10050414 Ga0099795_100504142 144
716 3300007788 Ga0099795_10097600 Ga0099795_100976002 144
717 3300009093 Ga0105240_10056701 Ga0105240_100567012 144
718 3300009093 Ga0105240_10071943 Ga0105240_100719434 144
719 3300009093 Ga0105240_10433839 Ga0105240_104338391 144
720 3300009093 Ga0105240_10611102 Ga0105240_106111022 144
721 3300009093 Ga0105240_10997916 Ga0105240_109979161 144
722 3300009093 Ga0105240_11193506 Ga0105240_111935062 144
723 3300009093 Ga0105240_11533319 Ga0105240_115333192 144
724 3300009094 Ga0111539_10166745 Ga0111539_101667452 144
725 3300009094 Ga0111539_10923273 Ga0111539_109232732 144
726 3300009094 Ga0111539_11493297 Ga0111539_114932971 144
727 3300009094 Ga0111539_13050948 Ga0111539_130509481 144
728 3300009098 Ga0105245_10136956 Ga0105245_101369561 144
729 3300009098 Ga0105245_10137179 Ga0105245_101371792 144
730 3300009098 Ga0105245_10359854 Ga0105245_103598542 144
731 3300009098 Ga0105245_10384631 Ga0105245_103846312 144
732 3300009098 Ga0105245_12081003 Ga0105245_120810031 144
733 3300009101 Ga0105247_10050303 Ga0105247_100503033 144
734 3300009101 Ga0105247_10111201 Ga0105247_101112012 144
735 3300009101 Ga0105247_10173716 Ga0105247_101737162 144
736 3300009101 Ga0105247_10326703 Ga0105247_103267032 144
737 3300009101 Ga0105247_10626035 Ga0105247_106260352 144
738 3300009101 Ga0105247_11489960 Ga0105247_114899601 144
739 3300009147 Ga0114129_10094982 Ga0114129_100949822 144
740 3300009147 Ga0114129_11046888 Ga0114129_110468881 144
741 3300009148 Ga0105243_10348898 Ga0105243_103488981 144
742 3300009148 Ga0105243_10425063 Ga0105243_104250632 144
743 3300009148 Ga0105243_10426587 Ga0105243_104265872 144
744 3300009148 Ga0105243_10482934 Ga0105243_104829342 144
745 3300009148 Ga0105243_11135730 Ga0105243_111357301 144
746 3300009174 Ga0105241_10213304 Ga0105241_102133042 144
747 3300009174 Ga0105241_10272161 Ga0105241_102721612 144
748 3300009174 Ga0105241_10549873 Ga0105241_105498731 144
749 3300009174 Ga0105241_10972906 Ga0105241_109729061 144
750 3300009174 Ga0105241_11639194 Ga0105241_116391941 144
751 3300009176 Ga0105242_10141472 Ga0105242_101414722 144
752 3300009176 Ga0105242_10354305 Ga0105242_103543052 144
753 3300009176 Ga0105242_10554843 Ga0105242_105548432 144
754 3300009176 Ga0105242_11002670 Ga0105242_110026701 144
755 3300009176 Ga0105242_11378800 Ga0105242_113788001 144
756 3300009176 Ga0105242_11423383 Ga0105242_114233831 144
757 3300009177 Ga0105248_10092142 Ga0105248_100921423 144
758 3300009177 Ga0105248_10390100 Ga0105248_103901002 144
759 3300009177 Ga0105248_10519530 Ga0105248_105195302 144
760 3300009177 Ga0105248_12062465 Ga0105248_120624651 144
761 3300009545 Ga0105237_10086201 Ga0105237_100862013 144
762 3300009545 Ga0105237_10097293 Ga0105237_100972932 144
763 3300009545 Ga0105237_10114301 Ga0105237_101143012 144
764 3300009545 Ga0105237_10169772 Ga0105237_101697722 144
765 3300009545 Ga0105237_10219415 Ga0105237_102194152 144
766 3300009545 Ga0105237_10241105 Ga0105237_102411052 144
767 3300009545 Ga0105237_10444817 Ga0105237_104448172 144
768 3300009545 Ga0105237_10536873 Ga0105237_105368731 144
769 3300009545 Ga0105237_10615541 Ga0105237_106155411 144
770 3300009545 Ga0105237_10616179 Ga0105237_106161792 144
771 3300009545 Ga0105237_11437595 Ga0105237_114375951 144
772 3300009551 Ga0105238_10040344 Ga0105238_100403442 144
773 3300009551 Ga0105238_10158575 Ga0105238_101585752 144
774 3300009551 Ga0105238_10367611 Ga0105238_103676111 144
775 3300009551 Ga0105238_10544241 Ga0105238_105442411 144
776 3300009551 Ga0105238_10939183 Ga0105238_109391832 144
777 3300009551 Ga0105238_11053867 Ga0105238_110538671 144
778 3300009551 Ga0105238_11109942 Ga0105238_111099422 144
779 3300009551 Ga0105238_11537075 Ga0105238_115370752 144
780 3300009553 Ga0105249_10112279 Ga0105249_101122792 144
781 3300009553 Ga0105249_10343517 Ga0105249_103435172 144
782 3300009553 Ga0105249_10365524 Ga0105249_103655241 144
783 3300009553 Ga0105249_10484987 Ga0105249_104849872 144
784 3300009553 Ga0105249_10558578 Ga0105249_105585781 144
785 3300009553 Ga0105249_10797505 Ga0105249_107975052 144
786 3300010159 Ga0099796_10039287 Ga0099796_100392872 144
787 3300010159 Ga0099796_10177506 Ga0099796_101775061 144
788 3300010375 Ga0105239_10014622 Ga0105239_100146223 144
789 3300010375 Ga0105239_10146596 Ga0105239_101465962 144
790 3300010375 Ga0105239_10305254 Ga0105239_103052542 144
791 3300010375 Ga0105239_10344857 Ga0105239_103448572 144
792 3300010375 Ga0105239_10347818 Ga0105239_103478182 144
793 3300010375 Ga0105239_10750366 Ga0105239_107503661 144
794 3300010375 Ga0105239_10877438 Ga0105239_108774382 144
795 3300010375 Ga0105239_11012255 Ga0105239_110122552 144
796 3300010375 Ga0105239_11863527 Ga0105239_118635271 144
797 3300010375 Ga0105239_12030481 Ga0105239_120304811 144
798 3300011119 Ga0105246_10109343 Ga0105246_101093432 144
799 3300011119 Ga0105246_10341683 Ga0105246_103416832 144
800 3300011119 Ga0105246_10495821 Ga0105246_104958212 144
801 3300012490 Ga0157322_1015048 Ga0157322_10150481 144
802 3300013104 Ga0157370_10072120 Ga0157370_100721203 144
803 3300013104 Ga0157370_10215461 Ga0157370_102154612 144
804 3300013105 Ga0157369_10082239 Ga0157369_100822392 144
805 3300013105 Ga0157369_10359852 Ga0157369_103598521 144
806 3300013105 Ga0157369_10831237 Ga0157369_108312371 144
807 3300013105 Ga0157369_11708722 Ga0157369_117087221 144
808 3300013296 Ga0157374_10302149 Ga0157374_103021492 144
809 3300013296 Ga0157374_10361112 Ga0157374_103611121 144
810 3300013296 Ga0157374_10514659 Ga0157374_105146592 144
811 3300013296 Ga0157374_10685682 Ga0157374_106856821 144
812 3300013296 Ga0157374_10698253 Ga0157374_106982531 144
813 3300013296 Ga0157374_11073353 Ga0157374_110733531 144
814 3300013296 Ga0157374_11814055 Ga0157374_118140551 144
815 3300013297 Ga0157378_10093914 Ga0157378_100939142 144
816 3300013297 Ga0157378_10101987 Ga0157378_101019872 144
817 3300013297 Ga0157378_10351095 Ga0157378_103510952 144
818 3300013297 Ga0157378_10391855 Ga0157378_103918552 144
819 3300013297 Ga0157378_10558750 Ga0157378_105587502 144
820 3300013297 Ga0157378_10913054 Ga0157378_109130541 144
821 3300013297 Ga0157378_11256875 Ga0157378_112568752 144
822 3300013306 Ga0163162_10178728 Ga0163162_101787282 144
823 3300013306 Ga0163162_10366238 Ga0163162_103662382 144
824 3300013306 Ga0163162_10581263 Ga0163162_105812632 144
825 3300013306 Ga0163162_10691844 Ga0163162_106918442 144
826 3300013306 Ga0163162_10717647 Ga0163162_107176471 144
827 3300013306 Ga0163162_10826408 Ga0163162_108264082 144
828 3300013306 Ga0163162_11020970 Ga0163162_110209701 144
829 3300013306 Ga0163162_11622451 Ga0163162_116224512 144
830 3300013307 Ga0157372_10045709 Ga0157372_100457094 144
831 3300013307 Ga0157372_10175850 Ga0157372_101758505 144
832 3300013307 Ga0157372_10565752 Ga0157372_105657522 144
833 3300013307 Ga0157372_11873765 Ga0157372_118737652 144
834 3300013308 Ga0157375_10106252 Ga0157375_101062522 144
835 3300013308 Ga0157375_10162243 Ga0157375_101622432 144
836 3300013308 Ga0157375_10449721 Ga0157375_104497212 144
837 3300014325 Ga0163163_10024503 Ga0163163_100245034 144
838 3300014325 Ga0163163_10029342 Ga0163163_100293422 144
839 3300014325 Ga0163163_10424285 Ga0163163_104242852 144
840 3300014325 Ga0163163_11101661 Ga0163163_111016612 144
841 3300014325 Ga0163163_11748227 Ga0163163_117482271 144
842 3300014326 Ga0157380_10224193 Ga0157380_102241932 144
843 3300014326 Ga0157380_10265137 Ga0157380_102651372 144
844 3300014326 Ga0157380_10324581 Ga0157380_103245812 144
845 3300014326 Ga0157380_10451055 Ga0157380_104510551 144
846 3300014326 Ga0157380_10580993 Ga0157380_105809932 144
847 3300014326 Ga0157380_10621076 Ga0157380_106210761 144
848 3300014326 Ga0157380_11296949 Ga0157380_112969491 144
849 3300014745 Ga0157377_10056720 Ga0157377_100567203 144
850 3300014745 Ga0157377_10592327 Ga0157377_105923271 144
851 3300014968 Ga0157379_10313136 Ga0157379_103131362 144
852 3300014968 Ga0157379_10317066 Ga0157379_103170662 144
853 3300014969 Ga0157376_10016269 Ga0157376_100162692 144
854 3300014969 Ga0157376_10106056 Ga0157376_101060562 144
855 3300014969 Ga0157376_10431434 Ga0157376_104314342 144
856 3300014969 Ga0157376_10778395 Ga0157376_107783951 144
857 3300014969 Ga0157376_10970759 Ga0157376_109707592 144
858 3300014969 Ga0157376_11054484 Ga0157376_110544841 144
859 3300015265 Ga0182005_1189930 Ga0182005_11899301 144
860 3300017792 Ga0163161_10048495 Ga0163161_100484953 144
861 3300017792 Ga0163161_10102197 Ga0163161_101021972 144
862 3300017792 Ga0163161_10405149 Ga0163161_104051492 144
863 3300017792 Ga0163161_10593028 Ga0163161_105930282 144
864 3300019188 Ga0184599_100945 Ga0184599_1009451 144
865 3300020069 Ga0197907_10228093 Ga0197907_102280931 144
866 3300020069 Ga0197907_10342790 Ga0197907_103427901 144
867 3300020069 Ga0197907_10419893 Ga0197907_104198933 144
868 3300020070 Ga0206356_10110208 Ga0206356_101102081 144
869 3300020070 Ga0206356_11432654 Ga0206356_114326541 144
870 3300020076 Ga0206355_1416067 Ga0206355_14160671 144
871 3300020080 Ga0206350_11290848 Ga0206350_112908481 144
872 3300020080 Ga0206350_11293925 Ga0206350_112939251 144
873 3300020080 Ga0206350_11626606 Ga0206350_116266061 144
874 3300020081 Ga0206354_11361333 Ga0206354_113613332 144
875 3300020082 Ga0206353_10413424 Ga0206353_104134241 144
876 3300020082 Ga0206353_11952916 Ga0206353_119529161 144
877 3300020610 Ga0154015_1079109 Ga0154015_10791092 144
878 3300020610 Ga0154015_1436508 Ga0154015_14365082 144
879 3300021361 Ga0213872_10201321 Ga0213872_102013212 144
880 3300021377 Ga0213874_10397644 Ga0213874_103976441 144
881 3300021384 Ga0213876_10132243 Ga0213876_101322432 144
882 3300021388 Ga0213875_10074750 Ga0213875_100747502 144
883 3300021441 Ga0213871_10001152 Ga0213871_100011522 144
884 3300021441 Ga0213871_10209370 Ga0213871_102093701 144
885 3300022467 Ga0224712_10044519 Ga0224712_100445192 144
886 3300022467 Ga0224712_10231132 Ga0224712_102311322 144
887 3300022467 Ga0224712_10463194 Ga0224712_104631941 144
888 3300024227 Ga0228598_1043871 Ga0228598_10438712 144
889 3300025253 Ga0209677_102003 Ga0209677_1020036 144
890 3300025254 Ga0209148_1010941 Ga0209148_10109412 144
891 3300025261 Ga0209233_1001535 Ga0209233_10015359 144
892 3300025261 Ga0209233_1054330 Ga0209233_10543302 144
893 3300025272 Ga0209455_1003495 Ga0209455_10034954 144
894 3300025272 Ga0209455_1003839 Ga0209455_10038396 144
895 3300025297 Ga0209758_1011456 Ga0209758_10114562 144
896 3300025297 Ga0209758_1044070 Ga0209758_10440702 144
897 3300025321 Ga0207656_10260902 Ga0207656_102609022 144
898 3300025893 Ga0207682_10048527 Ga0207682_100485272 144
899 3300025898 Ga0207692_10001654 Ga0207692_100016547 144
900 3300025898 Ga0207692_10016870 Ga0207692_100168702 144
901 3300025898 Ga0207692_10020606 Ga0207692_100206062 144
902 3300025898 Ga0207692_10165486 Ga0207692_101654862 144
903 3300025899 Ga0207642_10147160 Ga0207642_101471601 144
904 3300025899 Ga0207642_10187169 Ga0207642_101871692 144
905 3300025900 Ga0207710_10051918 Ga0207710_100519182 144
906 3300025900 Ga0207710_10235485 Ga0207710_102354852 144
907 3300025900 Ga0207710_10394541 Ga0207710_103945412 144
908 3300025900 Ga0207710_10426103 Ga0207710_104261031 144
909 3300025901 Ga0207688_10150019 Ga0207688_101500191 144
910 3300025901 Ga0207688_10158316 Ga0207688_101583162 144
911 3300025901 Ga0207688_10189663 Ga0207688_101896631 144
912 3300025901 Ga0207688_10203964 Ga0207688_102039642 144
913 3300025901 Ga0207688_10352174 Ga0207688_103521742 144
914 3300025901 Ga0207688_10503753 Ga0207688_105037532 144
915 3300025903 Ga0207680_10262811 Ga0207680_102628112 144
916 3300025903 Ga0207680_10401503 Ga0207680_104015032 144
917 3300025903 Ga0207680_10417301 Ga0207680_104173011 144
918 3300025904 Ga0207647_10626169 Ga0207647_106261691 144
919 3300025905 Ga0207685_10035338 Ga0207685_100353381 144
920 3300025905 Ga0207685_10156619 Ga0207685_101566192 144
921 3300025906 Ga0207699_10002873 Ga0207699_100028737 144
922 3300025906 Ga0207699_10048826 Ga0207699_100488262 144
923 3300025906 Ga0207699_10059739 Ga0207699_100597392 144
924 3300025906 Ga0207699_11224738 Ga0207699_112247381 144
925 3300025907 Ga0207645_10113976 Ga0207645_101139762 144
926 3300025907 Ga0207645_10724960 Ga0207645_107249601 144
927 3300025908 Ga0207643_10228830 Ga0207643_102288302 144
928 3300025908 Ga0207643_10275313 Ga0207643_102753132 144
929 3300025909 Ga0207705_10116331 Ga0207705_101163312 144
930 3300025910 Ga0207684_10426665 Ga0207684_104266652 144
931 3300025910 Ga0207684_11365789 Ga0207684_113657891 144
932 3300025911 Ga0207654_10099641 Ga0207654_100996412 144
933 3300025911 Ga0207654_10896951 Ga0207654_108969511 144
934 3300025912 Ga0207707_10000826 Ga0207707_100008267 144
935 3300025912 Ga0207707_10007843 Ga0207707_100078439 144
936 3300025912 Ga0207707_10127237 Ga0207707_101272372 144
937 3300025912 Ga0207707_10184358 Ga0207707_101843582 144
938 3300025912 Ga0207707_10242608 Ga0207707_102426081 144
939 3300025913 Ga0207695_10265024 Ga0207695_102650242 144
940 3300025913 Ga0207695_10452512 Ga0207695_104525121 144
941 3300025913 Ga0207695_11052129 Ga0207695_110521291 144
942 3300025914 Ga0207671_10040502 Ga0207671_100405022 144
943 3300025914 Ga0207671_10109709 Ga0207671_101097092 144
944 3300025914 Ga0207671_10155463 Ga0207671_101554631 144
945 3300025914 Ga0207671_10303328 Ga0207671_103033282 144
946 3300025914 Ga0207671_10463011 Ga0207671_104630111 144
947 3300025914 Ga0207671_10596668 Ga0207671_105966682 144
948 3300025914 Ga0207671_11445674 Ga0207671_114456741 144
949 3300025915 Ga0207693_10007358 Ga0207693_100073588 144
950 3300025915 Ga0207693_10017927 Ga0207693_100179272 144
951 3300025915 Ga0207693_10095120 Ga0207693_100951202 144
952 3300025916 Ga0207663_10000319 Ga0207663_100003193 144
953 3300025916 Ga0207663_10040286 Ga0207663_100402862 144
954 3300025916 Ga0207663_10092947 Ga0207663_100929471 144
955 3300025916 Ga0207663_10139970 Ga0207663_101399701 144
956 3300025916 Ga0207663_10274621 Ga0207663_102746212 144
957 3300025916 Ga0207663_11252023 Ga0207663_112520231 144
958 3300025916 Ga0207663_11261774 Ga0207663_112617741 144
959 3300025917 Ga0207660_10025033 Ga0207660_100250333 144
960 3300025917 Ga0207660_10049281 Ga0207660_100492812 144
961 3300025917 Ga0207660_10054290 Ga0207660_100542901 144
962 3300025917 Ga0207660_10557600 Ga0207660_105576001 144
963 3300025917 Ga0207660_10688290 Ga0207660_106882901 144
964 3300025918 Ga0207662_10035786 Ga0207662_100357863 144
965 3300025919 Ga0207657_10171584 Ga0207657_101715842 144
966 3300025919 Ga0207657_11447877 Ga0207657_114478771 144
967 3300025920 Ga0207649_10141860 Ga0207649_101418602 144
968 3300025920 Ga0207649_10202542 Ga0207649_102025422 144
969 3300025920 Ga0207649_10204179 Ga0207649_102041791 144
970 3300025921 Ga0207652_10010590 Ga0207652_100105905 144
971 3300025921 Ga0207652_10108119 Ga0207652_101081193 144
972 3300025921 Ga0207652_10134281 Ga0207652_101342812 144
973 3300025921 Ga0207652_10402413 Ga0207652_104024132 144
974 3300025921 Ga0207652_10461074 Ga0207652_104610742 144
975 3300025922 Ga0207646_10131589 Ga0207646_101315892 144
976 3300025923 Ga0207681_10145678 Ga0207681_101456782 144
977 3300025923 Ga0207681_10252641 Ga0207681_102526411 144
978 3300025923 Ga0207681_10531394 Ga0207681_105313941 144
979 3300025923 Ga0207681_10677081 Ga0207681_106770811 144
980 3300025924 Ga0207694_10168238 Ga0207694_101682382 144
981 3300025924 Ga0207694_11008127 Ga0207694_110081271 144
982 3300025924 Ga0207694_11414310 Ga0207694_114143101 144
983 3300025925 Ga0207650_10382246 Ga0207650_103822461 144
984 3300025925 Ga0207650_10597304 Ga0207650_105973042 144
985 3300025926 Ga0207659_10186349 Ga0207659_101863492 144
986 3300025926 Ga0207659_10294987 Ga0207659_102949872 144
987 3300025926 Ga0207659_10765274 Ga0207659_107652741 144
988 3300025926 Ga0207659_10849723 Ga0207659_108497232 144
989 3300025927 Ga0207687_10020131 Ga0207687_100201313 144
990 3300025927 Ga0207687_10091903 Ga0207687_100919032 144
991 3300025927 Ga0207687_10230466 Ga0207687_102304662 144
992 3300025927 Ga0207687_10239517 Ga0207687_102395172 144
993 3300025927 Ga0207687_10840991 Ga0207687_108409911 144
994 3300025928 Ga0207700_10062435 Ga0207700_100624353 144
995 3300025928 Ga0207700_10085245 Ga0207700_100852451 144
996 3300025928 Ga0207700_10193602 Ga0207700_101936021 144
997 3300025928 Ga0207700_10224263 Ga0207700_102242631 144
998 3300025928 Ga0207700_10266542 Ga0207700_102665422 144
999 3300025928 Ga0207700_10656911 Ga0207700_106569111 144
1000 3300025928 Ga0207700_10709864 Ga0207700_107098641 144
1001 3300025929 Ga0207664_10030772 Ga0207664_100307724 144
1002 3300025929 Ga0207664_10056442 Ga0207664_100564422 144
1003 3300025929 Ga0207664_10061287 Ga0207664_100612871 144
1004 3300025929 Ga0207664_10373614 Ga0207664_103736142 144
1005 3300025931 Ga0207644_10105628 Ga0207644_101056282 144
1006 3300025931 Ga0207644_10509857 Ga0207644_105098571 144
1007 3300025931 Ga0207644_11251588 Ga0207644_112515881 144
1008 3300025932 Ga0207690_10066263 Ga0207690_100662632 144
1009 3300025932 Ga0207690_10362385 Ga0207690_103623852 144
1010 3300025933 Ga0207706_10170648 Ga0207706_101706482 144
1011 3300025933 Ga0207706_10248345 Ga0207706_102483452 144
1012 3300025933 Ga0207706_10397870 Ga0207706_103978702 144
1013 3300025933 Ga0207706_10952814 Ga0207706_109528142 144
1014 3300025934 Ga0207686_10028779 Ga0207686_100287793 144
1015 3300025934 Ga0207686_10553004 Ga0207686_105530042 144
1016 3300025935 Ga0207709_10540714 Ga0207709_105407142 144
1017 3300025935 Ga0207709_10578105 Ga0207709_105781052 144
1018 3300025935 Ga0207709_10727430 Ga0207709_107274301 144
1019 3300025935 Ga0207709_11668003 Ga0207709_116680031 144
1020 3300025936 Ga0207670_10412135 Ga0207670_104121352 144
1021 3300025936 Ga0207670_10953341 Ga0207670_109533411 144
1022 3300025937 Ga0207669_10003771 Ga0207669_100037717 144
1023 3300025937 Ga0207669_10141448 Ga0207669_101414481 144
1024 3300025938 Ga0207704_10101101 Ga0207704_101011012 144
1025 3300025938 Ga0207704_10484866 Ga0207704_104848662 144
1026 3300025938 Ga0207704_11137547 Ga0207704_111375471 144
1027 3300025939 Ga0207665_10017908 Ga0207665_100179081 144
1028 3300025939 Ga0207665_10024487 Ga0207665_100244873 144
1029 3300025939 Ga0207665_10126280 Ga0207665_101262802 144
1030 3300025939 Ga0207665_10713276 Ga0207665_107132761 144
1031 3300025939 Ga0207665_10963198 Ga0207665_109631981 144
1032 3300025939 Ga0207665_11520286 Ga0207665_115202861 144
1033 3300025940 Ga0207691_10229003 Ga0207691_102290031 144
1034 3300025940 Ga0207691_10256183 Ga0207691_102561832 144
1035 3300025940 Ga0207691_10263244 Ga0207691_102632442 144
1036 3300025940 Ga0207691_10335120 Ga0207691_103351201 144
1037 3300025940 Ga0207691_10475901 Ga0207691_104759011 144
1038 3300025941 Ga0207711_10144955 Ga0207711_101449552 144
1039 3300025941 Ga0207711_10173011 Ga0207711_101730112 144
1040 3300025941 Ga0207711_10381457 Ga0207711_103814572 144
1041 3300025941 Ga0207711_10571961 Ga0207711_105719612 144
1042 3300025941 Ga0207711_10872318 Ga0207711_108723182 144
1043 3300025941 Ga0207711_10945904 Ga0207711_109459042 144
1044 3300025942 Ga0207689_10229251 Ga0207689_102292512 144
1045 3300025942 Ga0207689_10239433 Ga0207689_102394332 144
1046 3300025942 Ga0207689_10345056 Ga0207689_103450562 144
1047 3300025942 Ga0207689_10426828 Ga0207689_104268282 144
1048 3300025944 Ga0207661_10016612 Ga0207661_100166121 144
1049 3300025944 Ga0207661_10077987 Ga0207661_100779871 144
1050 3300025944 Ga0207661_10514214 Ga0207661_105142142 144
1051 3300025944 Ga0207661_11270711 Ga0207661_112707111 144
1052 3300025945 Ga0207679_10190441 Ga0207679_101904412 144
1053 3300025945 Ga0207679_10316900 Ga0207679_103169002 144
1054 3300025949 Ga0207667_10006896 Ga0207667_100068962 144
1055 3300025949 Ga0207667_10135958 Ga0207667_101359581 144
1056 3300025949 Ga0207667_10465350 Ga0207667_104653502 144
1057 3300025949 Ga0207667_10889946 Ga0207667_108899461 144
1058 3300025960 Ga0207651_10199837 Ga0207651_101998371 144
1059 3300025960 Ga0207651_10824544 Ga0207651_108245442 144
1060 3300025960 Ga0207651_11052489 Ga0207651_110524891 144
1061 3300025960 Ga0207651_11072559 Ga0207651_110725591 144
1062 3300025961 Ga0207712_10346127 Ga0207712_103461272 144
1063 3300025961 Ga0207712_10441736 Ga0207712_104417362 144
1064 3300025961 Ga0207712_10879690 Ga0207712_108796901 144
1065 3300025972 Ga0207668_10132136 Ga0207668_101321362 144
1066 3300025972 Ga0207668_10205749 Ga0207668_102057492 144
1067 3300025972 Ga0207668_10297084 Ga0207668_102970842 144
1068 3300025972 Ga0207668_10528425 Ga0207668_105284252 144
1069 3300025972 Ga0207668_10671721 Ga0207668_106717212 144
1070 3300025972 Ga0207668_10697039 Ga0207668_106970392 144
1071 3300025972 Ga0207668_10955354 Ga0207668_109553541 144
1072 3300025981 Ga0207640_10160439 Ga0207640_101604392 144
1073 3300025981 Ga0207640_10672463 Ga0207640_106724631 144
1074 3300025981 Ga0207640_11192320 Ga0207640_111923201 144
1075 3300025986 Ga0207658_10058005 Ga0207658_100580052 144
1076 3300025986 Ga0207658_10558511 Ga0207658_105585112 144
1077 3300025986 Ga0207658_10591261 Ga0207658_105912611 144
1078 3300025986 Ga0207658_11514696 Ga0207658_115146961 144
1079 3300026023 Ga0207677_10031707 Ga0207677_100317073 144
1080 3300026023 Ga0207677_10035214 Ga0207677_100352143 144
1081 3300026023 Ga0207677_10475144 Ga0207677_104751442 144
1082 3300026023 Ga0207677_11275074 Ga0207677_112750741 144
1083 3300026035 Ga0207703_10290205 Ga0207703_102902052 144
1084 3300026035 Ga0207703_10384161 Ga0207703_103841612 144
1085 3300026035 Ga0207703_10384886 Ga0207703_103848862 144
1086 3300026035 Ga0207703_10517160 Ga0207703_105171602 144
1087 3300026035 Ga0207703_10558189 Ga0207703_105581892 144
1088 3300026035 Ga0207703_10699444 Ga0207703_106994441 144
1089 3300026035 Ga0207703_10779765 Ga0207703_107797651 144
1090 3300026035 Ga0207703_10921958 Ga0207703_109219581 144
1091 3300026041 Ga0207639_10240102 Ga0207639_102401022 144
1092 3300026041 Ga0207639_10973768 Ga0207639_109737681 144
1093 3300026041 Ga0207639_10998263 Ga0207639_109982632 144
1094 3300026041 Ga0207639_11476144 Ga0207639_114761441 144
1095 3300026067 Ga0207678_10036770 Ga0207678_100367703 144
1096 3300026067 Ga0207678_10235707 Ga0207678_102357072 144
1097 3300026067 Ga0207678_10242405 Ga0207678_102424052 144
1098 3300026067 Ga0207678_10279066 Ga0207678_102790662 144
1099 3300026067 Ga0207678_10903568 Ga0207678_109035682 144
1100 3300026067 Ga0207678_10980797 Ga0207678_109807971 144
1101 3300026075 Ga0207708_10902697 Ga0207708_109026972 144
1102 3300026078 Ga0207702_10003278 Ga0207702_100032789 144
1103 3300026078 Ga0207702_10346714 Ga0207702_103467142 144
1104 3300026078 Ga0207702_10358010 Ga0207702_103580102 144
1105 3300026078 Ga0207702_10680515 Ga0207702_106805151 144
1106 3300026078 Ga0207702_11183450 Ga0207702_111834501 144
1107 3300026088 Ga0207641_10050159 Ga0207641_100501593 144
1108 3300026088 Ga0207641_10262064 Ga0207641_102620642 144
1109 3300026088 Ga0207641_10428092 Ga0207641_104280922 144
1110 3300026088 Ga0207641_11662758 Ga0207641_116627581 144
1111 3300026089 Ga0207648_10069649 Ga0207648_100696492 144
1112 3300026089 Ga0207648_10334504 Ga0207648_103345042 144
1113 3300026089 Ga0207648_10710431 Ga0207648_107104311 144
1114 3300026089 Ga0207648_10916785 Ga0207648_109167851 144
1115 3300026095 Ga0207676_10168213 Ga0207676_101682132 144
1116 3300026095 Ga0207676_10303983 Ga0207676_103039831 144
1117 3300026095 Ga0207676_10682204 Ga0207676_106822042 144
1118 3300026095 Ga0207676_11291518 Ga0207676_112915182 144
1119 3300026116 Ga0207674_10048135 Ga0207674_100481353 144
1120 3300026116 Ga0207674_10138094 Ga0207674_101380942 144
1121 3300026118 Ga0207675_100096518 Ga0207675_1000965182 144
1122 3300026118 Ga0207675_100278873 Ga0207675_1002788732 144
1123 3300026118 Ga0207675_100395688 Ga0207675_1003956882 144
1124 3300026121 Ga0207683_10049400 Ga0207683_100494002 144
1125 3300026121 Ga0207683_10119465 Ga0207683_101194652 144
1126 3300026121 Ga0207683_10465752 Ga0207683_104657522 144
1127 3300026121 Ga0207683_10629720 Ga0207683_106297202 144
1128 3300026121 Ga0207683_10641731 Ga0207683_106417312 144
1129 3300026121 Ga0207683_11508006 Ga0207683_115080061 144
1130 3300026142 Ga0207698_10211648 Ga0207698_102116481 144
1131 3300026142 Ga0207698_10814746 Ga0207698_108147462 144
1132 3300026142 Ga0207698_11082457 Ga0207698_110824572 144
1133 3300027357 Ga0209589_1000001 Ga0209589_1000001343 144
1134 3300027361 Ga0209489_100001 Ga0209489_100001343 144
1135 3300027363 Ga0209700_100001 Ga0209700_100001343 144
1136 3300027512 Ga0209179_1047999 Ga0209179_10479992 144
1137 3300027866 Ga0209813_10051610 Ga0209813_100516102 144
1138 3300027866 Ga0209813_10268314 Ga0209813_102683141 144
1139 3300028379 Ga0268266_10005138 Ga0268266_100051387 144
1140 3300028379 Ga0268266_10008212 Ga0268266_100082123 144
1141 3300028379 Ga0268266_10015621 Ga0268266_100156219 144
1142 3300028379 Ga0268266_10073814 Ga0268266_100738142 144
1143 3300028379 Ga0268266_10233874 Ga0268266_102338742 144
1144 3300028379 Ga0268266_10235310 Ga0268266_102353102 144
1145 3300028379 Ga0268266_10524081 Ga0268266_105240812 144
1146 3300028379 Ga0268266_11167988 Ga0268266_111679881 144
1147 3300028379 Ga0268266_11257212 Ga0268266_112572122 144
1148 3300028380 Ga0268265_10055455 Ga0268265_100554553 144
1149 3300028380 Ga0268265_10101908 Ga0268265_101019082 144
1150 3300028380 Ga0268265_10350086 Ga0268265_103500862 144
1151 3300028380 Ga0268265_10722155 Ga0268265_107221551 144
1152 3300028380 Ga0268265_11019044 Ga0268265_110190441 144
1153 3300028381 Ga0268264_10000065 Ga0268264_10000065106 144
1154 3300028381 Ga0268264_10214093 Ga0268264_102140932 144
1155 3300028381 Ga0268264_10265107 Ga0268264_102651072 144
1156 3300028381 Ga0268264_10288007 Ga0268264_102880072 144
1157 3300028381 Ga0268264_10866859 Ga0268264_108668592 144
1158 3300028381 Ga0268264_11296331 Ga0268264_112963311 144
1159 3300028381 Ga0268264_11883137 Ga0268264_118831371 144
1160 3300028563 Ga0265319_1094678 Ga0265319_10946782 144
1161 3300028577 Ga0265318_10070211 Ga0265318_100702111 144
1162 3300028653 Ga0265323_10025339 Ga0265323_100253392 144
1163 3300028666 Ga0265336_10000093 Ga0265336_1000009314 144
1164 3300028786 Ga0307517_10000008 Ga0307517_10000008237 144
1165 3300028786 Ga0307517_10321310 Ga0307517_103213101 144
1166 3300028794 Ga0307515_10087661 Ga0307515_100876612 144
1167 3300028794 Ga0307515_10375291 Ga0307515_103752912 144
1168 3300028794 Ga0307515_10698827 Ga0307515_106988271 144
1169 3300028800 Ga0265338_10000078 Ga0265338_10000078146 144
1170 3300028800 Ga0265338_10877624 Ga0265338_108776241 144
1171 3300030521 Ga0307511_10078029 Ga0307511_100780292 144
1172 3300030521 Ga0307511_10198460 Ga0307511_101984602 144
1173 3300031235 Ga0265330_10039705 Ga0265330_100397052 144
1174 3300031238 Ga0265332_10030775 Ga0265332_100307752 144
1175 3300031238 Ga0265332_10163272 Ga0265332_101632722 144
1176 3300031239 Ga0265328_10049994 Ga0265328_100499942 144
1177 3300031241 Ga0265325_10017991 Ga0265325_100179912 144
1178 3300031247 Ga0265340_10001286 Ga0265340_1000128610 144
1179 3300031250 Ga0265331_10049850 Ga0265331_100498502 144
1180 3300031344 Ga0265316_10056419 Ga0265316_100564192 144
1181 3300031456 Ga0307513_10716312 Ga0307513_107163121 144
1182 3300031507 Ga0307509_10409464 Ga0307509_104094642 144
1183 3300031507 Ga0307509_10424779 Ga0307509_104247791 144
1184 3300031507 Ga0307509_10506575 Ga0307509_105065751 144
1185 3300031548 Ga0307408_100686805 Ga0307408_1006868052 144
1186 3300031548 Ga0307408_100819365 Ga0307408_1008193652 144
1187 3300031616 Ga0307508_10000235 Ga0307508_1000023550 144
1188 3300031616 Ga0307508_10183601 Ga0307508_101836013 144
1189 3300031616 Ga0307508_10579519 Ga0307508_105795192 144
1190 3300031649 Ga0307514_10248899 Ga0307514_102488992 144
1191 3300031711 Ga0265314_10023327 Ga0265314_100233273 144
1192 3300031712 Ga0265342_10236495 Ga0265342_102364952 144
1193 3300031712 Ga0265342_10287020 Ga0265342_102870202 144
1194 3300031730 Ga0307516_10004958 Ga0307516_100049589 144
1195 3300031730 Ga0307516_10006838 Ga0307516_100068381 144
1196 3300031730 Ga0307516_10036390 Ga0307516_100363903 144
1197 3300031730 Ga0307516_10194973 Ga0307516_101949732 144
1198 3300031730 Ga0307516_10195687 Ga0307516_101956872 144
1199 3300031730 Ga0307516_10297050 Ga0307516_102970502 144
1200 3300031730 Ga0307516_10568637 Ga0307516_105686372 144
1201 3300031731 Ga0307405_11005939 Ga0307405_110059391 144
1202 3300031810 Ga0316044_118058 Ga0316044_1180582 144
1203 3300031815 Ga0316045_127981 Ga0316045_1279811 144
1204 3300031824 Ga0307413_10457948 Ga0307413_104579482 144
1205 3300031852 Ga0307410_10468545 Ga0307410_104685452 144
1206 3300031852 Ga0307410_10886051 Ga0307410_108860511 144
1207 3300031852 Ga0307410_11112938 Ga0307410_111129382 144
1208 3300031901 Ga0307406_10291801 Ga0307406_102918012 144
1209 3300031901 Ga0307406_10324762 Ga0307406_103247622 144
1210 3300031901 Ga0307406_10498567 Ga0307406_104985672 144
1211 3300031903 Ga0307407_10226245 Ga0307407_102262452 144
1212 3300031903 Ga0307407_11215626 Ga0307407_112156261 144
1213 3300031911 Ga0307412_10214350 Ga0307412_102143501 144
1214 3300031911 Ga0307412_10506579 Ga0307412_105065792 144
1215 3300031911 Ga0307412_10797163 Ga0307412_107971631 144
1216 3300031911 Ga0307412_11810814 Ga0307412_118108141 144
1217 3300032002 Ga0307416_100775190 Ga0307416_1007751901 144
1218 3300032002 Ga0307416_100793144 Ga0307416_1007931442 144
1219 3300032002 Ga0307416_101176819 Ga0307416_1011768191 144
1220 3300032002 Ga0307416_101801308 Ga0307416_1018013082 144
1221 3300032004 Ga0307414_10868195 Ga0307414_108681952 144
1222 3300032004 Ga0307414_11053743 Ga0307414_110537432 144
1223 3300032005 Ga0307411_10011395 Ga0307411_100113953 144
1224 3300032005 Ga0307411_10189310 Ga0307411_101893102 144
1225 3300032126 Ga0307415_100100438 Ga0307415_1001004381 144
1226 3300032126 Ga0307415_100180137 Ga0307415_1001801372 144
1227 3300032126 Ga0307415_102561598 Ga0307415_1025615981 144
1228 3300033179 Ga0307507_10344829 Ga0307507_103448292 144
1229 3300033180 Ga0307510_10059492 Ga0307510_100594923 144
1230 3300033180 Ga0307510_10253288 Ga0307510_102532881 144
1231 3300033180 Ga0307510_10580586 Ga0307510_105805861 144
1232 3300033442 Ga0315911_1000002 Ga0315911_1000002824 144
1233 3300035083 Ga0373926_0038090 Ga0373926_0038090_1257_1694 144
1234 3300035083 Ga0373926_0080313 Ga0373926_0080313_181_627 144
1235 3300035085 Ga0373929_0034492 Ga0373929_0034492_237_719 144
1236 3300035086 Ga0373934_0133445 Ga0373934_0133445_490_930 144
1237 3300035086 Ga0373934_0171858 Ga0373934_0171858_25_465 144
1238 3300035086 Ga0373934_0178994 Ga0373934_0178994_324_761 144
1239 3300035086 Ga0373934_0278776 Ga0373934_0278776_233_670 144
1240 3300035111 Ga0373923_0028091 Ga0373923_0028091_895_1341 144
1241 3300035111 Ga0373923_0162282 Ga0373923_0162282_551_988 144
1242 3300035111 Ga0373923_0357565 Ga0373923_0357565_113_553 144
1243 3300035113 Ga0373936_0033214 Ga0373936_0033214_137_574 144
1244 3300035113 Ga0373936_0139058 Ga0373936_0139058_451_888 144
1245 3300035116 Ga0373945_0311046 Ga0373945_0311046_11_457 144
1246 3300035117 Ga0373953_0005948 Ga0373953_0005948_700_1137 144
1247 3300035117 Ga0373953_0104409 Ga0373953_0104409_180_626 144
1248 3300035118 Ga0373954_0003534 Ga0373954_0003534_5206_5652 144
1249 3300035118 Ga0373954_0012386 Ga0373954_0012386_1891_2328 144
1250 3300035118 Ga0373954_0038094 Ga0373954_0038094_1464_1904 144
1251 3300035119 Ga0373956_0011432 Ga0373956_0011432_2597_3037 144
1252 3300035119 Ga0373956_0103546 Ga0373956_0103546_866_1312 144
1253 3300035120 Ga0373957_0006104 Ga0373957_0006104_2525_2962 144
1254 3300035120 Ga0373957_0084124 Ga0373957_0084124_231_671 144
1255 3300035170 Ga0373943_0318484 Ga0373943_0318484_435_872 144
1256 3300035171 Ga0373946_0044731 Ga0373946_0044731_43_489 144
1257 3300035172 Ga0373955_0002262 Ga0373955_0002262_5033_5473 144
1258 3300035172 Ga0373955_0066698 Ga0373955_0066698_1064_1510 144
1259 3300035172 Ga0373955_0249288 Ga0373955_0249288_204_644 144
1260 3300035410 Ga0373924_0029616 Ga0373924_0029616_503_949 144
1261 3300035410 Ga0373924_0035616 Ga0373924_0035616_231_671 144
1262 3300035691 Ga0373931_0151662 Ga0373931_0151662_651_1088 144
1263 3300035691 Ga0373931_0235978 Ga0373931_0235978_435_872 144
1264 3300035692 Ga0373935_0084290 Ga0373935_0084290_520_960 144
1265 3300035692 Ga0373935_0096459 Ga0373935_0096459_94_531 144
1266 3300035692 Ga0373935_0300845 Ga0373935_0300845_585_1022 144
1267 3300035692 Ga0373935_0587496 Ga0373935_0587496_274_714 144
1268 3300035695 Ga0373927_0082240 Ga0373927_0082240_1387_1824 144
1269 3300035695 Ga0373927_0127626 Ga0373927_0127626_368_805 144
1270 3300035695 Ga0373927_0128209 Ga0373927_0128209_1159_1596 144
1271 3300035695 Ga0373927_0301067 Ga0373927_0301067_408_845 144
1272 3300035695 Ga0373927_0311440 Ga0373927_0311440_216_653 144
1273 3300035724 Ga0373933_0020294 Ga0373933_0020294_130_567 144
1274 3300035724 Ga0373933_0038446 Ga0373933_0038446_980_1426 144
1275 3300035724 Ga0373933_0628659 Ga0373933_0628659_220_657 144
1276 3300035725 Ga0373947_0049931 Ga0373947_0049931_1036_1473 144
1277 3300035725 Ga0373947_0206996 Ga0373947_0206996_137_583 144
1278 3300035725 Ga0373947_0291094 Ga0373947_0291094_251_688 144
1279 3300035725 Ga0373947_0626378 Ga0373947_0626378_101_583 144
1280 3300035725 Ga0373947_0852563 Ga0373947_0852563_33_470 144
1281 3300036242 Ga0310104_08219 Ga0310104_08219_18_455 144
1282 3300036401 Ga0373937_0095241 Ga0373937_0095241_2171_2617 144
1283 3300036401 Ga0373937_0118634 Ga0373937_0118634_1463_1900 144
1284 3300036401 Ga0373937_0267944 Ga0373937_0267944_1152_1592 144
1285 3300036401 Ga0373937_1024516 Ga0373937_1024516_241_678 144
1286 3300036458 Ga0310112_017016 Ga0310112_017016_21_458 144
1287 3300036534 Ga0310109_027304 Ga0310109_027304_154_591 144
1288 3300037068 Ga0373925_0065398 Ga0373925_0065398_279_716 144
1289 3300037068 Ga0373925_0147893 Ga0373925_0147893_1347_1784 144
1290 3300037068 Ga0373925_0707453 Ga0373925_0707453_185_631 144
1291 3300037068 Ga0373925_0911008 Ga0373925_0911008_221_658 144
1292 3300037068 Ga0373925_1329884 Ga0373925_1329884_91_528 144
1293 3300037312 Ga0395899_0314164 Ga0395899_0314164_70_507 144
1294 3300037418 Ga0395900_0001158 Ga0395900_0001158_28638_29072 144
1295 3300037418 Ga0395900_0112313 Ga0395900_0112313_480_929 144
1296 3300037418 Ga0395900_0147653 Ga0395900_0147653_1097_1543 144
1297 3300037418 Ga0395900_0350819 Ga0395900_0350819_840_1277 144
1298 3300037466 Ga0395898_0003218 Ga0395898_0003218_3982_4416 144
1299 3300037466 Ga0395898_0169025 Ga0395898_0169025_1564_2001 144
1300 3300037466 Ga0395898_0174554 Ga0395898_0174554_988_1425 144
1301 3300037466 Ga0395898_0238433 Ga0395898_0238433_593_1039 144
1302 3300037471 Ga0395905_0339672 Ga0395905_0339672_742_1179 144
1303 3300037471 Ga0395905_0481773 Ga0395905_0481773_43_480 144
1304 3300037853 Ga0436364_0094814 Ga0436364_0094814_816_1262 144
1305 3300037853 Ga0436364_0762417 Ga0436364_0762417_342_788 144
1306 3300037853 Ga0436364_1175670 Ga0436364_1175670_389_835 144
1307 3300037853 Ga0436364_1498081 Ga0436364_1498081_553_999 144
1308 3300038443 Ga0395901_0029555 Ga0395901_0029555_4476_4922 144
1309 3300038443 Ga0395901_0202105 Ga0395901_0202105_1086_1535 144
1310 3300038443 Ga0395901_0233704 Ga0395901_0233704_234_668 144
1311 3300039437 Ga0436365_0250762 Ga0436365_0250762_3758_4204 144
1312 3300039437 Ga0436365_0578389 Ga0436365_0578389_1090_1536 144
1313 3300039437 Ga0436365_0644892 Ga0436365_0644892_85_531 144
1314 3300039437 Ga0436365_0997368 Ga0436365_0997368_423_869 144
1315 3300039437 Ga0436365_1462626 Ga0436365_1462626_1061_1507 144
1316 3300039437 Ga0436365_1563546 Ga0436365_1563546_652_1098 144
1317 3300039437 Ga0436365_1761752 Ga0436365_1761752_219_665 144
1318 3300039438 Ga0436360_0194286 Ga0436360_0194286_292_738 144
1319 3300039438 Ga0436360_0815106 Ga0436360_0815106_1245_1688 144
1320 3300039447 Ga0436361_0163903 Ga0436361_0163903_805_1251 144
1321 3300039447 Ga0436361_0698273 Ga0436361_0698273_73_516 144
1322 3300039447 Ga0436361_0703675 Ga0436361_0703675_64_510 144
1323 3300039447 Ga0436361_0793959 Ga0436361_0793959_34_477 144
1324 3300039450 Ga0436363_0823102 Ga0436363_0823102_280_726 144
1325 3300039450 Ga0436363_1038792 Ga0436363_1038792_1931_2377 144
1326 3300039450 Ga0436363_1041594 Ga0436363_1041594_198_644 144
1327 3300039453 Ga0436362_0186797 Ga0436362_0186797_242_688 144
1328 3300039453 Ga0436362_0750865 Ga0436362_0750865_89_532 144
1329 3300039453 Ga0436362_0825905 Ga0436362_0825905_2678_3124 144
1330 3300041413 Ga0439465_0013695 Ga0439465_0013695_1332_1769 144
1331 3300041413 Ga0439465_0223595 Ga0439465_0223595_58_495 144
1332 3300041451 Ga0451791_0643076 Ga0451791_0643076_114_551 144
1333 3300041453 Ga0451797_1297372 Ga0451797_1297372_45_482 144
1334 3300041460 Ga0451802_1471182 Ga0451802_1471182_18_452 144
1335 3300041486 Ga0451807_2194086 Ga0451807_2194086_179_616 144
1336 3300041491 Ga0451833_1146639 Ga0451833_1146639_114_551 144
1337 3300041505 Ga0451849_1219311 Ga0451849_1219311_82_516 144
1338 3300041509 Ga0451843_0571380 Ga0451843_0571380_143_580 144
1339 3300041509 Ga0451843_1169842 Ga0451843_1169842_27_461 144
1340 3300041512 Ga0451853_0909562 Ga0451853_0909562_128_565 144
1341 3300042004 Ga0439445_0162464 Ga0439445_0162464_189_626 144
1342 3300042157 Ga0439458_0127617 Ga0439458_0127617_109_546 144
1343 3300042438 Ga0439459_0097816 Ga0439459_0097816_214_651 144
1344 3300044684 Ga0466966_0122588 Ga0466966_0122588_668_1105 144
1345 3300044684 Ga0466966_0163465 Ga0466966_0163465_689_1126 144
1346 3300044694 Ga0466963_0154257 Ga0466963_0154257_509_955 144
1347 3300044706 Ga0466964_0110349 Ga0466964_0110349_505_951 144
1348 3300044735 Ga0466968_0049009 Ga0466968_0049009_1098_1541 144
1349 3300044735 Ga0466968_0139348 Ga0466968_0139348_439_885 144
1350 3300044735 Ga0466968_0326380 Ga0466968_0326380_297_731 144
1351 3300044842 Ga0466957_0172369 Ga0466957_0172369_758_1204 144
1352 3300045049 Ga0466959_0392463 Ga0466959_0392463_466_912 144
1353 3300045049 Ga0466959_0829164 Ga0466959_0829164_44_481 144
1354 3300045836 Ga0466958_0562264 Ga0466958_0562264_99_545 144
1355 3300045976 Ga0466967_0177972 Ga0466967_0177972_20_466 144
1356 3300045976 Ga0466967_0467378 Ga0466967_0467378_239_685 144
1357 3300045976 Ga0466967_2018091 Ga0466967_2018091_109_558 144
1358 3300046454 Ga0495592_0038963 Ga0495592_0038963_2648_3085 144
1359 3300046454 Ga0495592_0053038 Ga0495592_0053038_74_514 144
1360 3300046454 Ga0495592_0337858 Ga0495592_0337858_199_645 144
1361 3300046454 Ga0495592_0834180 Ga0495592_0834180_71_508 144
1362 3300046455 Ga0495603_0116972 Ga0495603_0116972_67_504 144
1363 3300046455 Ga0495603_0145256 Ga0495603_0145256_257_694 144
1364 3300046455 Ga0495603_0149467 Ga0495603_0149467_750_1187 144
1365 3300046455 Ga0495603_0367879 Ga0495603_0367879_259_696 144
1366 3300046455 Ga0495603_0692173 Ga0495603_0692173_136_573 144
1367 3300046457 Ga0495590_0082798 Ga0495590_0082798_20_457 144
1368 3300046458 Ga0495591_162340 Ga0495591_162340_39_476 144
1369 3300046459 Ga0495629_0019113 Ga0495629_0019113_1488_1928 144
1370 3300046459 Ga0495629_0213332 Ga0495629_0213332_172_609 144
1371 3300046460 Ga0495638_0065389 Ga0495638_0065389_408_845 144
1372 3300046460 Ga0495638_0380078 Ga0495638_0380078_256_693 144
1373 3300046462 Ga0495651_0018721 Ga0495651_0018721_677_1117 144
1374 3300046462 Ga0495651_0054859 Ga0495651_0054859_1364_1801 144
1375 3300046462 Ga0495651_0318564 Ga0495651_0318564_137_574 144
1376 3300046471 Ga0495650_0114511 Ga0495650_0114511_364_801 144
1377 3300046472 Ga0495580_0171458 Ga0495580_0171458_480_926 144
1378 3300046472 Ga0495580_0259534 Ga0495580_0259534_322_759 144
1379 3300046473 Ga0495582_0309376 Ga0495582_0309376_390_827 144
1380 3300046473 Ga0495582_0658994 Ga0495582_0658994_60_497 144
1381 3300046474 Ga0495605_0077043 Ga0495605_0077043_915_1352 144
1382 3300046475 Ga0495639_0043015 Ga0495639_0043015_1148_1594 144
1383 3300046476 Ga0495662_0115997 Ga0495662_0115997_279_725 144
1384 3300046476 Ga0495662_0144867 Ga0495662_0144867_24_464 144
1385 3300046477 Ga0495664_0005425 Ga0495664_0005425_6081_6527 144
1386 3300046477 Ga0495664_0045198 Ga0495664_0045198_2036_2482 144
1387 3300046491 Ga0495584_0116247 Ga0495584_0116247_148_585 144
1388 3300046491 Ga0495584_0208296 Ga0495584_0208296_109_546 144
1389 3300046491 Ga0495584_0231892 Ga0495584_0231892_350_787 144
1390 3300046491 Ga0495584_0468990 Ga0495584_0468990_169_606 144
1391 3300046492 Ga0495585_0146144 Ga0495585_0146144_45_482 144
1392 3300046499 Ga0495594_0109712 Ga0495594_0109712_718_1155 144
1393 3300046499 Ga0495594_0134788 Ga0495594_0134788_407_844 144
1394 3300046499 Ga0495594_0272023 Ga0495594_0272023_483_920 144
1395 3300046499 Ga0495594_0399479 Ga0495594_0399479_249_686 144
1396 3300046500 Ga0495596_0107920 Ga0495596_0107920_201_638 144
1397 3300046500 Ga0495596_0159755 Ga0495596_0159755_105_587 144
1398 3300046501 Ga0495607_0142270 Ga0495607_0142270_621_1058 144
1399 3300046511 Ga0495608_0184364 Ga0495608_0184364_511_948 144
1400 3300046513 Ga0495616_0211869 Ga0495616_0211869_376_813 144
1401 3300046514 Ga0495618_0013174 Ga0495618_0013174_1993_2430 144
1402 3300046514 Ga0495618_0144266 Ga0495618_0144266_1066_1512 144
1403 3300046515 Ga0495620_0254652 Ga0495620_0254652_75_512 144
1404 3300046516 Ga0495628_0002686 Ga0495628_0002686_11169_11606 144
1405 3300046516 Ga0495628_0029783 Ga0495628_0029783_723_1163 144
1406 3300046516 Ga0495628_0235186 Ga0495628_0235186_523_969 144
1407 3300046516 Ga0495628_0487381 Ga0495628_0487381_190_627 144
1408 3300046517 Ga0495630_0012540 Ga0495630_0012540_5105_5551 144
1409 3300046517 Ga0495630_0074128 Ga0495630_0074128_46_486 144
1410 3300046518 Ga0495631_0051621 Ga0495631_0051621_1023_1460 144
1411 3300046518 Ga0495631_0117460 Ga0495631_0117460_31_522 144
1412 3300046518 Ga0495631_0311187 Ga0495631_0311187_133_570 144
1413 3300046519 Ga0495632_0140326 Ga0495632_0140326_625_1062 144
1414 3300046519 Ga0495632_0171789 Ga0495632_0171789_430_867 144
1415 3300046519 Ga0495632_0189363 Ga0495632_0189363_339_830 144
1416 3300046519 Ga0495632_0205057 Ga0495632_0205057_72_509 144
1417 3300046520 Ga0495637_0139212 Ga0495637_0139212_392_829 144
1418 3300046523 Ga0495644_0059595 Ga0495644_0059595_312_749 144
1419 3300046523 Ga0495644_0162069 Ga0495644_0162069_321_758 144
1420 3300046523 Ga0495644_0377247 Ga0495644_0377247_83_520 144
1421 3300046526 Ga0495666_0110430 Ga0495666_0110430_446_892 144
1422 3300046526 Ga0495666_0446030 Ga0495666_0446030_10_447 144
1423 3300046528 Ga0495642_0379181 Ga0495642_0379181_101_538 144
1424 3300046529 Ga0495652_0046561 Ga0495652_0046561_2634_3074 144
1425 3300046529 Ga0495652_0087545 Ga0495652_0087545_1102_1548 144
1426 3300046529 Ga0495652_0098745 Ga0495652_0098745_696_1133 144
1427 3300046531 Ga0495665_0042179 Ga0495665_0042179_1370_1816 144
1428 3300046531 Ga0495665_0622161 Ga0495665_0622161_91_528 144
1429 3300046533 Ga0495640_0005502 Ga0495640_0005502_9151_9588 144
1430 3300046533 Ga0495640_0011366 Ga0495640_0011366_4100_4540 144
1431 3300046533 Ga0495640_0064426 Ga0495640_0064426_958_1404 144
1432 3300046533 Ga0495640_0191222 Ga0495640_0191222_815_1252 144
1433 3300046533 Ga0495640_0586938 Ga0495640_0586938_145_582 144
1434 3300046536 Ga0495587_0031348 Ga0495587_0031348_1346_1786 144
1435 3300046536 Ga0495587_0101225 Ga0495587_0101225_759_1196 144
1436 3300046537 Ga0495598_0158860 Ga0495598_0158860_298_735 144
1437 3300046543 Ga0495645_0099228 Ga0495645_0099228_356_796 144
1438 3300046543 Ga0495645_0207742 Ga0495645_0207742_868_1314 144
1439 3300046543 Ga0495645_0219440 Ga0495645_0219440_69_506 144
1440 3300046543 Ga0495645_0349825 Ga0495645_0349825_436_873 144
1441 3300046558 Ga0495633_0143286 Ga0495633_0143286_298_735 144
1442 3300046559 Ga0495667_0076227 Ga0495667_0076227_1512_1952 144
1443 3300046559 Ga0495667_0670245 Ga0495667_0670245_18_455 144
1444 3300046615 Ga0495656_0504373 Ga0495656_0504373_96_533 144
1445 3300046615 Ga0495656_0730687 Ga0495656_0730687_45_482 144
1446 3300046616 Ga0495668_0128635 Ga0495668_0128635_648_1085 144
1447 3300046616 Ga0495668_0130752 Ga0495668_0130752_884_1321 144
1448 3300046616 Ga0495668_0165501 Ga0495668_0165501_63_500 144
1449 3300046642 Ga0495634_0039812 Ga0495634_0039812_2474_2920 144
1450 3300046642 Ga0495634_0072920 Ga0495634_0072920_822_1262 144
1451 3300046642 Ga0495634_0327325 Ga0495634_0327325_378_815 144
1452 3300046648 Ga0495611_0094488 Ga0495611_0094488_914_1351 144
1453 3300046660 Ga0495625_0274672 Ga0495625_0274672_561_998 144
1454 3300046660 Ga0495625_0286465 Ga0495625_0286465_369_806 144
1455 3300046660 Ga0495625_0287273 Ga0495625_0287273_553_990 144
1456 3300046660 Ga0495625_0566395 Ga0495625_0566395_219_656 144
1457 3300046663 Ga0495635_0009534 Ga0495635_0009534_5344_5784 144
1458 3300046663 Ga0495635_0010426 Ga0495635_0010426_693_1130 144
1459 3300046663 Ga0495635_0305961 Ga0495635_0305961_507_953 144
1460 3300046663 Ga0495635_0786525 Ga0495635_0786525_151_588 144
1461 3300046664 Ga0495659_0166963 Ga0495659_0166963_443_880 144
1462 3300046664 Ga0495659_0260622 Ga0495659_0260622_107_544 144
1463 3300046665 Ga0495661_0142631 Ga0495661_0142631_333_770 144
1464 3300046665 Ga0495661_0319228 Ga0495661_0319228_291_728 144
1465 3300046675 Ga0495657_0052501 Ga0495657_0052501_1273_1713 144
1466 3300046675 Ga0495657_0856959 Ga0495657_0856959_40_480 144
1467 3300046678 Ga0495599_0005293 Ga0495599_0005293_1619_2056 144
1468 3300046678 Ga0495599_0114601 Ga0495599_0114601_722_1162 144
1469 3300046679 Ga0495623_0022615 Ga0495623_0022615_1142_1582 144
1470 3300046679 Ga0495623_0065121 Ga0495623_0065121_451_888 144
1471 3300046680 Ga0495646_0020195 Ga0495646_0020195_2634_3074 144
1472 3300046680 Ga0495646_0087815 Ga0495646_0087815_1235_1681 144
1473 3300046681 Ga0495647_0157890 Ga0495647_0157890_369_806 144
1474 3300046681 Ga0495647_0276232 Ga0495647_0276232_85_567 144
1475 3300046683 Ga0495658_0320783 Ga0495658_0320783_178_660 144
1476 3300046683 Ga0495658_0527753 Ga0495658_0527753_165_602 144
1477 3300046684 Ga0495669_0017294 Ga0495669_0017294_1673_2110 144
1478 3300046684 Ga0495669_0648425 Ga0495669_0648425_42_479 144
1479 3300046690 Ga0495624_0044131 Ga0495624_0044131_895_1341 144
1480 3300046691 Ga0495670_0394824 Ga0495670_0394824_138_620 144
1481 3300046694 Ga0495649_0099525 Ga0495649_0099525_407_844 144
1482 3300046794 Ga0495589_0154098 Ga0495589_0154098_541_978 144
1483 3300046794 Ga0495589_0244146 Ga0495589_0244146_184_666 144
1484 3300046794 Ga0495589_0360639 Ga0495589_0360639_26_463 144
1485 3300046809 Ga0495600_0005897 Ga0495600_0005897_1619_2056 144
1486 3300046809 Ga0495600_0011574 Ga0495600_0011574_263_703 144
1487 3300046810 Ga0495660_0155504 Ga0495660_0155504_572_1009 144
1488 3300047317 Ga0495604_0016861 Ga0495604_0016861_3512_3949 144
1489 3300047317 Ga0495604_0064951 Ga0495604_0064951_586_1026 144
1490 3300047317 Ga0495604_0189144 Ga0495604_0189144_373_813 144
1491 3300047318 Ga0495636_0277449 Ga0495636_0277449_17_454 144
1492 3300047319 Ga0495674_0030667 Ga0495674_0030667_1641_2087 144
1493 3300047319 Ga0495674_0061746 Ga0495674_0061746_488_925 144
1494 3300047319 Ga0495674_0157112 Ga0495674_0157112_357_797 144
1495 3300047319 Ga0495674_0255746 Ga0495674_0255746_803_1240 144
1496 3300047319 Ga0495674_0875798 Ga0495674_0875798_121_558 144
1497 3300047319 Ga0495674_1102094 Ga0495674_1102094_111_548 144
1498 3300047320 Ga0495672_0006932 Ga0495672_0006932_771_1208 144
1499 3300047321 Ga0495676_0138341 Ga0495676_0138341_171_608 144
1500 3300047321 Ga0495676_1109051 Ga0495676_1109051_20_457 144
1501 3300047322 Ga0495680_0018705 Ga0495680_0018705_1406_1846 144
1502 3300047322 Ga0495680_0021273 Ga0495680_0021273_4915_5352 144
1503 3300047444 Ga0495675_0040007 Ga0495675_0040007_1094_1534 144
1504 3300047444 Ga0495675_0060637 Ga0495675_0060637_197_634 144
1505 3300047445 Ga0495677_0068092 Ga0495677_0068092_675_1112 144
1506 3300047445 Ga0495677_0258596 Ga0495677_0258596_90_527 144
1507 3300047446 Ga0495679_071326 Ga0495679_071326_228_665 144
1508 3300047447 Ga0495685_058341 Ga0495685_058341_20_457 144
1509 3300047469 Ga0495673_0134481 Ga0495673_0134481_394_831 144
1510 3300047471 Ga0495684_0015597 Ga0495684_0015597_3256_3693 144
1511 3300047471 Ga0495684_0090819 Ga0495684_0090819_1857_2297 144
1512 3300047471 Ga0495684_0150219 Ga0495684_0150219_812_1258 144
1513 3300047472 Ga0495686_0070106 Ga0495686_0070106_288_725 144
1514 3300047673 Ga0495593_0112143 Ga0495593_0112143_324_770 144
1515 3300048088 Ga0495602_0024308 Ga0495602_0024308_1191_1631 144
1516 3300048088 Ga0495602_0041881 Ga0495602_0041881_2156_2593 144
1517 3300048089 Ga0495614_0207083 Ga0495614_0207083_116_562 144
1518 3300048090 Ga0495615_0045953 Ga0495615_0045953_576_1013 144
1519 3300048903 Ga0496100_0008365 Ga0496100_0008365_2310_2747 144
1520 3300048903 Ga0496100_0061893 Ga0496100_0061893_984_1421 144
1521 3300048903 Ga0496100_0100807 Ga0496100_0100807_960_1406 144
1522 3300048903 Ga0496100_0157735 Ga0496100_0157735_443_880 144
1523 3300048903 Ga0496100_0819805 Ga0496100_0819805_196_633 144
1524 3300048903 Ga0496100_1254388 Ga0496100_1254388_16_453 144
1525 3300048904 Ga0496101_0026636 Ga0496101_0026636_220_657 144
1526 3300048904 Ga0496101_0302345 Ga0496101_0302345_413_850 144
1527 3300048904 Ga0496101_0323443 Ga0496101_0323443_407_844 144
1528 3300048904 Ga0496101_0426860 Ga0496101_0426860_377_814 144
1529 3300048904 Ga0496101_0584317 Ga0496101_0584317_308_745 144
1530 3300048904 Ga0496101_0698252 Ga0496101_0698252_286_723 144
1531 3300048905 Ga0496102_0003479 Ga0496102_0003479_4248_4685 144
1532 3300048905 Ga0496102_0180575 Ga0496102_0180575_452_892 144
1533 3300048905 Ga0496102_0434438 Ga0496102_0434438_436_873 144
1534 3300048905 Ga0496102_1130068 Ga0496102_1130068_21_458 144
1535 3300048906 Ga0496103_0020540 Ga0496103_0020540_1557_1994 144
1536 3300048906 Ga0496103_0128906 Ga0496103_0128906_1138_1575 144
1537 3300048906 Ga0496103_0234879 Ga0496103_0234879_221_658 144
1538 3300048906 Ga0496103_0260337 Ga0496103_0260337_504_941 144
1539 3300048907 Ga0496104_0083241 Ga0496104_0083241_2307_2744 144
1540 3300048907 Ga0496104_0117708 Ga0496104_0117708_1351_1791 144
1541 3300048907 Ga0496104_0320266 Ga0496104_0320266_987_1424 144
1542 3300048907 Ga0496104_0499362 Ga0496104_0499362_74_511 144
1543 3300048907 Ga0496104_0718462 Ga0496104_0718462_408_854 144
1544 3300048908 Ga0496105_0007183 Ga0496105_0007183_4376_4813 144
1545 3300048908 Ga0496105_0073844 Ga0496105_0073844_341_781 144
1546 3300048908 Ga0496105_0092661 Ga0496105_0092661_584_1021 144
1547 3300048908 Ga0496105_0422794 Ga0496105_0422794_344_781 144
1548 3300048909 Ga0496106_0011700 Ga0496106_0011700_4647_5084 144
1549 3300048909 Ga0496106_0022369 Ga0496106_0022369_1065_1502 144
1550 3300048909 Ga0496106_0031265 Ga0496106_0031265_2541_2978 144
1551 3300048909 Ga0496106_0156079 Ga0496106_0156079_936_1373 144
1552 3300048909 Ga0496106_0748858 Ga0496106_0748858_204_641 144
1553 3300048910 Ga0496107_0007020 Ga0496107_0007020_3362_3799 144
1554 3300048910 Ga0496107_0068466 Ga0496107_0068466_1481_1918 144
1555 3300048910 Ga0496107_0124603 Ga0496107_0124603_275_715 144
1556 3300048910 Ga0496107_0319665 Ga0496107_0319665_14_451 144
1557 3300048910 Ga0496107_0382310 Ga0496107_0382310_517_954 144
1558 3300048910 Ga0496107_0579526 Ga0496107_0579526_333_770 144
1559 3300048910 Ga0496107_0629554 Ga0496107_0629554_153_593 144
1560 3300048911 Ga0496108_0014588 Ga0496108_0014588_1614_2051 144
1561 3300048911 Ga0496108_0094672 Ga0496108_0094672_329_766 144
1562 3300048911 Ga0496108_0201038 Ga0496108_0201038_21_461 144
1563 3300048911 Ga0496108_0378594 Ga0496108_0378594_432_869 144
1564 3300048911 Ga0496108_0408221 Ga0496108_0408221_86_523 144
1565 3300048911 Ga0496108_0544542 Ga0496108_0544542_143_580 144
1566 3300048912 Ga0496109_0009095 Ga0496109_0009095_3669_4106 144
1567 3300048912 Ga0496109_0046731 Ga0496109_0046731_197_634 144
1568 3300048912 Ga0496109_0184444 Ga0496109_0184444_1248_1685 144
1569 3300048913 Ga0496110_0023366 Ga0496110_0023366_2359_2799 144
1570 3300048913 Ga0496110_0044051 Ga0496110_0044051_2595_3032 144
1571 3300048913 Ga0496110_0087812 Ga0496110_0087812_94_531 144
1572 3300048913 Ga0496110_0192169 Ga0496110_0192169_372_809 144
1573 3300048913 Ga0496110_0217934 Ga0496110_0217934_396_833 144
1574 3300048913 Ga0496110_1131360 Ga0496110_1131360_154_591 144
1575 3300048914 Ga0496111_0032721 Ga0496111_0032721_775_1212 144
1576 3300048914 Ga0496111_0296591 Ga0496111_0296591_703_1140 144
1577 3300048914 Ga0496111_0386938 Ga0496111_0386938_237_674 144
1578 3300048914 Ga0496111_0843001 Ga0496111_0843001_47_493 144
1579 3300048915 Ga0496112_0010712 Ga0496112_0010712_605_1045 144
1580 3300048915 Ga0496112_0016874 Ga0496112_0016874_4840_5280 144
1581 3300048915 Ga0496112_0072955 Ga0496112_0072955_687_1124 144
1582 3300048915 Ga0496112_0180389 Ga0496112_0180389_977_1414 144
1583 3300048915 Ga0496112_0654094 Ga0496112_0654094_179_616 144
1584 3300048915 Ga0496112_0672759 Ga0496112_0672759_396_842 144
1585 3300048916 Ga0496113_0023344 Ga0496113_0023344_3714_4151 144
1586 3300048916 Ga0496113_0092430 Ga0496113_0092430_416_853 144
1587 3300048916 Ga0496113_0263020 Ga0496113_0263020_884_1321 144
1588 3300048917 Ga0496114_0028242 Ga0496114_0028242_3910_4347 144
1589 3300048917 Ga0496114_0153791 Ga0496114_0153791_1064_1501 144
1590 3300048917 Ga0496114_0179458 Ga0496114_0179458_764_1201 144
1591 3300048917 Ga0496114_0308824 Ga0496114_0308824_127_564 144
1592 3300048917 Ga0496114_0345600 Ga0496114_0345600_295_735 144
1593 3300048917 Ga0496114_0528446 Ga0496114_0528446_82_519 144
1594 3300048917 Ga0496114_0882396 Ga0496114_0882396_293_730 144
1595 3300048918 Ga0496115_0000645 Ga0496115_0000645_23078_23515 144
1596 3300048918 Ga0496115_0046924 Ga0496115_0046924_2017_2454 144
1597 3300048918 Ga0496115_0085931 Ga0496115_0085931_1434_1871 144
1598 3300048918 Ga0496115_0108749 Ga0496115_0108749_1081_1518 144
1599 3300048918 Ga0496115_0117739 Ga0496115_0117739_896_1333 144
1600 3300048918 Ga0496115_0119226 Ga0496115_0119226_1636_2076 144
1601 3300048918 Ga0496115_0185631 Ga0496115_0185631_900_1337 144
1602 3300048918 Ga0496115_0260890 Ga0496115_0260890_943_1380 144
1603 3300048918 Ga0496115_0708361 Ga0496115_0708361_257_694 144
1604 3300048918 Ga0496115_0711480 Ga0496115_0711480_131_568 144
1605 3300048918 Ga0496115_1085845 Ga0496115_1085845_59_505 144
1606 3300048919 Ga0496116_0106297 Ga0496116_0106297_842_1279 144
1607 3300048919 Ga0496116_0154030 Ga0496116_0154030_786_1232 144
1608 3300048920 Ga0496117_0058927 Ga0496117_0058927_1360_1797 144
1609 3300048920 Ga0496117_0096822 Ga0496117_0096822_1263_1709 144
1610 3300048920 Ga0496117_0259996 Ga0496117_0259996_395_832 144
1611 3300048921 Ga0496118_0011127 Ga0496118_0011127_7025_7462 144
1612 3300048921 Ga0496118_0052561 Ga0496118_0052561_2112_2558 144
1613 3300048921 Ga0496118_0222158 Ga0496118_0222158_414_851 144
1614 3300048922 Ga0496119_0097576 Ga0496119_0097576_1045_1482 144
1615 3300048923 Ga0496120_0128092 Ga0496120_0128092_817_1254 144
1616 3300048924 Ga0496121_0001081 Ga0496121_0001081_1431_1868 144
1617 3300048924 Ga0496121_0022281 Ga0496121_0022281_4162_4608 144
1618 3300048924 Ga0496121_0051335 Ga0496121_0051335_2749_3186 144
1619 3300048924 Ga0496121_0061578 Ga0496121_0061578_1982_2419 144
1620 3300048924 Ga0496121_0117288 Ga0496121_0117288_748_1185 144
1621 3300048924 Ga0496121_0139564 Ga0496121_0139564_396_842 144
1622 3300048924 Ga0496121_0217486 Ga0496121_0217486_159_596 144
1623 3300048924 Ga0496121_0229743 Ga0496121_0229743_808_1245 144
1624 3300048924 Ga0496121_0335129 Ga0496121_0335129_551_988 144
1625 3300048927 Ga0496124_0000722 Ga0496124_0000722_52365_52802 144
1626 3300048927 Ga0496124_0093901 Ga0496124_0093901_265_711 144
1627 3300048927 Ga0496124_0162362 Ga0496124_0162362_1097_1534 144
1628 3300048927 Ga0496124_0175385 Ga0496124_0175385_614_1051 144
1629 3300048927 Ga0496124_0494425 Ga0496124_0494425_220_657 144
1630 3300048928 Ga0496125_0042922 Ga0496125_0042922_2223_2660 144
1631 3300048928 Ga0496125_0060574 Ga0496125_0060574_903_1349 144
1632 3300048928 Ga0496125_0081858 Ga0496125_0081858_1123_1569 144
1633 3300048928 Ga0496125_0124612 Ga0496125_0124612_1197_1634 144
1634 3300048928 Ga0496125_0266230 Ga0496125_0266230_456_893 144
1635 3300048928 Ga0496125_0634901 Ga0496125_0634901_84_521 144
1636 3300048929 Ga0496126_0005379 Ga0496126_0005379_13239_13676 144
1637 3300048929 Ga0496126_0010006 Ga0496126_0010006_4207_4644 144
1638 3300048929 Ga0496126_0037510 Ga0496126_0037510_3963_4400 144
1639 3300048929 Ga0496126_0176941 Ga0496126_0176941_762_1199 144
1640 3300048929 Ga0496126_0214589 Ga0496126_0214589_163_609 144
1641 3300048929 Ga0496126_0219268 Ga0496126_0219268_837_1274 144
1642 3300048929 Ga0496126_0337357 Ga0496126_0337357_176_613 144
1643 3300048929 Ga0496126_0521098 Ga0496126_0521098_126_572 144
1644 3300048929 Ga0496126_1159210 Ga0496126_1159210_20_457 144
1645 3300049459 Ga0495678_037470 Ga0495678_037470_582_1019 144
1646 3300049460 Ga0495682_0162019 Ga0495682_0162019_52_489 144
1647 3300049572 Ga0501036_0171713 Ga0501036_0171713_717_1154 144
1648 3300049574 Ga0501038_0689826 Ga0501038_0689826_259_696 144
1649 3300049575 Ga0501039_0407540 Ga0501039_0407540_175_612 144
1650 3300049575 Ga0501039_0549861 Ga0501039_0549861_288_725 144
1651 3300049577 Ga0501041_0262404 Ga0501041_0262404_556_993 144
1652 3300049580 Ga0501046_0097706 Ga0501046_0097706_222_668 144
1653 3300049581 Ga0501047_0038959 Ga0501047_0038959_3144_3590 144
1654 3300049582 Ga0501048_0335976 Ga0501048_0335976_576_1013 144
1655 3300049582 Ga0501048_0986972 Ga0501048_0986972_20_466 144
1656 3300049583 Ga0501067_0089788 Ga0501067_0089788_992_1429 144
1657 3300049586 Ga0501070_0024877 Ga0501070_0024877_3211_3657 144
1658 3300049587 Ga0501071_0679266 Ga0501071_0679266_307_744 144
1659 3300049589 Ga0501073_0041960 Ga0501073_0041960_61_507 144
1660 3300049590 Ga0501074_0025357 Ga0501074_0025357_791_1237 144
1661 3300049591 Ga0501075_0336857 Ga0501075_0336857_392_829 144
1662 3300049592 Ga0501076_0440377 Ga0501076_0440377_479_916 144
1663 3300049592 Ga0501076_0519053 Ga0501076_0519053_235_672 144
1664 3300049741 Ga0501079_0159663 Ga0501079_0159663_322_759 144
1665 3300049741 Ga0501079_0646575 Ga0501079_0646575_373_810 144
1666 3300049742 Ga0501080_0221453 Ga0501080_0221453_938_1384 144
1667 3300049744 Ga0501083_0706867 Ga0501083_0706867_53_490 144
1668 3300049823 Ga0501044_0020178 Ga0501044_0020178_1384_1830 144
1669 3300049824 Ga0501045_0318270 Ga0501045_0318270_150_587 144
1670 3300050489 nmdc:mga03683_137390_c1 nmdc:mga03683_137390_c1_220_657 144
1671 3300050489 nmdc:mga03683_236336_c1 nmdc:mga03683_236336_c1_45_482 144
1672 3300050490 nmdc:mga03n38_3259_c1 nmdc:mga03n38_3259_c1_4263_4700 144
1673 3300050490 nmdc:mga03n38_474311_c1 nmdc:mga03n38_474311_c1_193_630 144
1674 3300050490 nmdc:mga03n38_571219_c1 nmdc:mga03n38_571219_c1_176_613 144
1675 3300050490 nmdc:mga03n38_798982_c1 nmdc:mga03n38_798982_c1_102_539 144
1676 3300050490 nmdc:mga03n38_84980_c1 nmdc:mga03n38_84980_c1_826_1263 144
1677 3300050491 nmdc:mga00v17_244105_c1 nmdc:mga00v17_244105_c1_513_950 144
1678 3300050491 nmdc:mga00v17_387304_c1 nmdc:mga00v17_387304_c1_205_642 144
1679 3300050491 nmdc:mga00v17_455771_c1 nmdc:mga00v17_455771_c1_27_464 144
1680 3300050492 nmdc:mga0yw44_141505_c2 nmdc:mga0yw44_141505_c2_326_763 144
1681 3300050492 nmdc:mga0yw44_210843_c1 nmdc:mga0yw44_210843_c1_477_914 144
1682 3300050492 nmdc:mga0yw44_235958_c1 nmdc:mga0yw44_235958_c1_114_551 144
1683 3300050492 nmdc:mga0yw44_54857_c1 nmdc:mga0yw44_54857_c1_1106_1543 144
1684 3300050492 nmdc:mga0yw44_662796_c1 nmdc:mga0yw44_662796_c1_65_502 144
1685 3300050492 nmdc:mga0yw44_95036_c1 nmdc:mga0yw44_95036_c1_296_730 144
1686 3300050493 nmdc:mga0k408_164036_c1 nmdc:mga0k408_164036_c1_374_811 144
1687 3300050493 nmdc:mga0k408_56271_c1 nmdc:mga0k408_56271_c1_1752_2189 144
1688 3300050494 nmdc:mga06z11_672159_c1 nmdc:mga06z11_672159_c1_111_548 144
1689 3300050494 nmdc:mga06z11_8583_c1 nmdc:mga06z11_8583_c1_334_771 144
1690 3300050495 nmdc:mga04h51_56253_c1 nmdc:mga04h51_56253_c1_853_1290 144
1691 3300050495 nmdc:mga04h51_74321_c1 nmdc:mga04h51_74321_c1_707_1144 144
1692 3300050496 nmdc:mga07m45_40551_c1 nmdc:mga07m45_40551_c1_322_759 144
1693 3300050496 nmdc:mga07m45_454117_c1 nmdc:mga07m45_454117_c1_288_725 144
1694 3300050496 nmdc:mga07m45_781655_c1 nmdc:mga07m45_781655_c1_37_474 144
1695 3300050507 nmdc:mga05p37_105215_c1 nmdc:mga05p37_105215_c1_2885_3322 144
1696 3300050508 nmdc:mga09592_375042_c1 nmdc:mga09592_375042_c1_20_457 144
1697 3300050509 nmdc:mga0qj67_1129184_c1 nmdc:mga0qj67_1129184_c1_115_552 144
1698 3300050511 nmdc:mga08y16_166913_c1 nmdc:mga08y16_166913_c1_135_572 144
1699 3300050512 nmdc:mga0n895_12267_c1 nmdc:mga0n895_12267_c1_2391_2837 144
1700 3300050512 nmdc:mga0n895_262097_c1 nmdc:mga0n895_262097_c1_662_1144 144
1701 3300050512 nmdc:mga0n895_550532_c1 nmdc:mga0n895_550532_c1_506_988 144
1702 3300050512 nmdc:mga0n895_569356_c1 nmdc:mga0n895_569356_c1_31_468 144
1703 3300050513 nmdc:mga0rr50_317070_c1 nmdc:mga0rr50_317070_c1_618_1100 144
1704 3300050514 nmdc:mga08x19_146481_c1 nmdc:mga08x19_146481_c1_48_485 144
1705 3300050514 nmdc:mga08x19_230208_c1 nmdc:mga08x19_230208_c1_732_1178 144
1706 3300050515 nmdc:mga0a205_409724_c1 nmdc:mga0a205_409724_c1_487_924 144
1707 3300050515 nmdc:mga0a205_714779_c1 nmdc:mga0a205_714779_c1_54_491 144
1708 3300050516 nmdc:mga0sz30_429617_c1 nmdc:mga0sz30_429617_c1_26_460 144
1709 3300050516 nmdc:mga0sz30_97619_c1 nmdc:mga0sz30_97619_c1_24_461 144
1710 3300053077 Ga0495601_0440591 Ga0495601_0440591_203_649 144
1711 3300053078 Ga0495612_0009214 Ga0495612_0009214_1214_1660 144
1712 3300053078 Ga0495612_0042381 Ga0495612_0042381_831_1268 144
1713 3300053078 Ga0495612_0042871 Ga0495612_0042871_348_785 144
1714 3300053078 Ga0495612_0140186 Ga0495612_0140186_500_940 144
1715 3300053078 Ga0495612_0267881 Ga0495612_0267881_157_603 144
1716 3300053079 Ga0500610_0198147 Ga0500610_0198147_293_730 144
1717 3300053080 Ga0500635_0009607 Ga0500635_0009607_1479_1916 144
1718 3300053080 Ga0500635_0046188 Ga0500635_0046188_408_845 144
1719 3300053084 Ga0495595_0002229 Ga0495595_0002229_2644_3081 144
1720 3300053084 Ga0495595_0013856 Ga0495595_0013856_454_891 144
1721 3300053084 Ga0495595_0071764 Ga0495595_0071764_618_1058 144
1722 3300053084 Ga0495595_0493592 Ga0495595_0493592_114_560 144
1723 3300053085 Ga0495619_0014396 Ga0495619_0014396_2666_3103 144
1724 3300053085 Ga0495619_0038480 Ga0495619_0038480_445_882 144
1725 3300053085 Ga0495619_0107482 Ga0495619_0107482_1210_1647 144
1726 3300053085 Ga0495619_0658110 Ga0495619_0658110_44_490 144
1727 3300053087 Ga0500643_072921 Ga0500643_072921_396_833 144
1728 3300053088 Ga0500644_0085588 Ga0500644_0085588_720_1157 144
1729 3300053088 Ga0500644_0270329 Ga0500644_0270329_44_481 144
1730 3300053090 Ga0500646_0124108 Ga0500646_0124108_227_664 144
1731 3300053091 Ga0500647_0065471 Ga0500647_0065471_946_1383 144
1732 3300053092 Ga0500583_0063054 Ga0500583_0063054_893_1330 144
1733 3300053093 Ga0500651_0230077 Ga0500651_0230077_276_713 144
1734 3300053094 Ga0500566_0000049 Ga0500566_0000049_57087_57524 144
1735 3300053094 Ga0500566_0012879 Ga0500566_0012879_1034_1471 144
1736 3300053094 Ga0500566_0066164 Ga0500566_0066164_1212_1649 144
1737 3300053094 Ga0500566_0100260 Ga0500566_0100260_979_1416 144
1738 3300053094 Ga0500566_0117492 Ga0500566_0117492_335_772 144
1739 3300053095 Ga0500640_001761 Ga0500640_001761_5983_6420 144
1740 3300053096 Ga0500641_0061668 Ga0500641_0061668_842_1279 144
1741 3300053096 Ga0500641_0081856 Ga0500641_0081856_61_498 144
1742 3300053102 Ga0500554_000760 Ga0500554_000760_21_458 144
1743 3300053111 Ga0500572_000123 Ga0500572_000123_20679_21125 144
1744 3300053111 Ga0500572_000675 Ga0500572_000675_10415_10852 144
1745 3300053114 Ga0500582_207850 Ga0500582_207850_75_512 144
1746 3300053115 Ga0500591_067553 Ga0500591_067553_847_1284 144
1747 3300053119 Ga0500595_000418 Ga0500595_000418_4354_4791 144
1748 3300053119 Ga0500595_014275 Ga0500595_014275_1249_1686 144
1749 3300053122 Ga0500608_180640 Ga0500608_180640_174_611 144
1750 3300053123 Ga0500614_025216 Ga0500614_025216_363_800 144
1751 3300053123 Ga0500614_203342 Ga0500614_203342_96_533 144
1752 3300053136 Ga0500559_0007266 Ga0500559_0007266_1566_2012 144
1753 3300053136 Ga0500559_0068209 Ga0500559_0068209_808_1245 144
1754 3300053138 Ga0500564_229781 Ga0500564_229781_170_607 144
1755 3300053140 Ga0500573_0031137 Ga0500573_0031137_491_928 144
1756 3300053142 Ga0500577_0172188 Ga0500577_0172188_248_685 144
1757 3300053144 Ga0500585_063656 Ga0500585_063656_80_517 144
1758 3300053147 Ga0500589_033685 Ga0500589_033685_405_842 144
1759 3300053148 Ga0500590_092698 Ga0500590_092698_675_1112 144
1760 3300053148 Ga0500590_250152 Ga0500590_250152_22_459 144
1761 3300053150 Ga0500603_000749 Ga0500603_000749_7082_7519 144
1762 3300053150 Ga0500603_001143 Ga0500603_001143_2481_2918 144
1763 3300053150 Ga0500603_019262 Ga0500603_019262_95_532 144
1764 3300053150 Ga0500603_161102 Ga0500603_161102_129_566 144
1765 3300053151 Ga0500604_0040079 Ga0500604_0040079_182_619 144
1766 3300053151 Ga0500604_0165161 Ga0500604_0165161_258_695 144
1767 3300053158 Ga0500627_0492336 Ga0500627_0492336_64_501 144
1768 3300053159 Ga0500630_000330 Ga0500630_000330_340_777 144
1769 3300053161 Ga0500634_0151865 Ga0500634_0151865_561_998 144
1770 3300053162 Ga0500638_002404 Ga0500638_002404_2694_3131 144
1771 3300053162 Ga0500638_141897 Ga0500638_141897_292_729 144
1772 3300053162 Ga0500638_215228 Ga0500638_215228_173_610 144
1773 3300053163 Ga0500639_000020 Ga0500639_000020_69699_70136 144
1774 3300053163 Ga0500639_119053 Ga0500639_119053_695_1141 144
1775 3300053163 Ga0500639_206300 Ga0500639_206300_38_475 144
1776 3300053177 Ga0500636_0095118 Ga0500636_0095118_634_1071 144
1777 3300053177 Ga0500636_0313354 Ga0500636_0313354_18_464 144
1778 3300053177 Ga0500636_0357414 Ga0500636_0357414_180_617 144
1779 3300053178 Ga0500637_0000845 Ga0500637_0000845_9123_9560 144
1780 3300053178 Ga0500637_0008751 Ga0500637_0008751_3207_3644 144
1781 3300053178 Ga0500637_0122044 Ga0500637_0122044_251_688 144
1782 3300053178 Ga0500637_0281170 Ga0500637_0281170_333_770 144
1783 3300053727 Ga0500611_047166 Ga0500611_047166_201_638 144
1784 3300053728 Ga0500657_233073 Ga0500657_233073_49_486 144
1785 3300053730 Ga0500645_006615 Ga0500645_006615_3552_3989 144
1786 3300053730 Ga0500645_079916 Ga0500645_079916_446_883 144
1787 3300053731 Ga0500609_031781 Ga0500609_031781_61_498 144
1788 3300053735 Ga0500596_002310 Ga0500596_002310_2184_2630 144
1789 3300053735 Ga0500596_002565 Ga0500596_002565_2671_3108 144
1790 3300053737 Ga0500601_007664 Ga0500601_007664_420_857 144
1791 3300054114 Ga0501084_0442530 Ga0501084_0442530_126_563 144
1792 3300055283 Ga0500661_000430 Ga0500661_000430_3478_3915 144
1793 3300059478 Ga0587093_045538 Ga0587093_045538_128_574 144
1794 3300059490 Ga0587066_137740 Ga0587066_137740_109_555 144
1795 3300059491 Ga0587070_143891 Ga0587070_143891_88_534 144
1796 3300059492 Ga0587073_0046936 Ga0587073_0046936_321_767 144
1797 3300059493 Ga0587077_074900 Ga0587077_074900_306_743 144
1798 3300059493 Ga0587077_164488 Ga0587077_164488_86_532 144
1799 3300059503 Ga0587080_064596 Ga0587080_064596_140_586 144
1800 3300059503 Ga0587080_068574 Ga0587080_068574_148_594 144
1801 3300059503 Ga0587080_103365 Ga0587080_103365_110_556 144
1802 3300059504 Ga0587082_049012 Ga0587082_049012_80_514 144
1803 3300059504 Ga0587082_099454 Ga0587082_099454_149_595 144
1804 3300059504 Ga0587082_126078 Ga0587082_126078_121_567 144
1805 3300059505 Ga0587083_0164123 Ga0587083_0164123_107_553 144
1806 3300059505 Ga0587083_0184315 Ga0587083_0184315_102_548 144
1807 3300059505 Ga0587083_0226495 Ga0587083_0226495_25_471 144
1808 3300059506 Ga0587085_121185 Ga0587085_121185_106_552 144
1809 3300059506 Ga0587085_147272 Ga0587085_147272_36_482 144
1810 3300059507 Ga0587086_080257 Ga0587086_080257_108_554 144
1811 3300059508 Ga0587088_080480 Ga0587088_080480_132_578 144
1812 3300059508 Ga0587088_088508 Ga0587088_088508_137_583 144
1813 3300059509 Ga0587089_066392 Ga0587089_066392_124_570 144
1814 3300059510 Ga0587090_101734 Ga0587090_101734_110_556 144
1815 3300059510 Ga0587090_127761 Ga0587090_127761_91_537 144
1816 3300059511 Ga0587091_148430 Ga0587091_148430_123_569 144
1817 3300059512 Ga0587092_082559 Ga0587092_082559_135_581 144
1818 3300059512 Ga0587092_097642 Ga0587092_097642_51_497 144
1819 3300059513 Ga0587094_085601 Ga0587094_085601_123_569 144
1820 3300059605 Ga0587106_100441 Ga0587106_100441_124_570 144
1821 3300059605 Ga0587106_148005 Ga0587106_148005_58_504 144
1822 3300059607 Ga0587125_054427 Ga0587125_054427_87_533 144
1823 3300059607 Ga0587125_061272 Ga0587125_061272_85_531 144
1824 3300059609 Ga0587131_011653 Ga0587131_011653_174_620 144
1825 3300059622 Ga0587099_048823 Ga0587099_048823_21_467 144
1826 3300059623 Ga0587101_066470 Ga0587101_066470_124_570 144
1827 3300059624 Ga0587109_121352 Ga0587109_121352_66_512 144
1828 3300059624 Ga0587109_179350 Ga0587109_179350_19_456 144
1829 3300059624 Ga0587109_203353 Ga0587109_203353_58_504 144
1830 3300059625 Ga0587113_030364 Ga0587113_030364_37_483 144
1831 3300059628 Ga0587122_035346 Ga0587122_035346_137_583 144
1832 3300059631 Ga0587130_044308 Ga0587130_044308_86_532 144
1833 3300059639 Ga0587062_078972 Ga0587062_078972_124_570 144
1834 3300059640 Ga0587067_099515 Ga0587067_099515_105_551 144
1835 3300059640 Ga0587067_177744 Ga0587067_177744_21_467 144
1836 3300059641 Ga0587068_038059 Ga0587068_038059_110_556 144
1837 3300059641 Ga0587068_058083 Ga0587068_058083_182_628 144
1838 3300059642 Ga0587069_109260 Ga0587069_109260_109_546 144
1839 3300059643 Ga0587072_120464 Ga0587072_120464_63_509 144
1840 3300059643 Ga0587072_164300 Ga0587072_164300_22_465 144
1841 3300059644 Ga0587075_090131 Ga0587075_090131_42_488 144
1842 3300059645 Ga0587076_109374 Ga0587076_109374_138_584 144
1843 3300059646 Ga0587078_035769 Ga0587078_035769_119_565 144
1844 3300059649 Ga0587102_056540 Ga0587102_056540_82_519 144
1845 3300059654 Ga0587110_047406 Ga0587110_047406_30_476 144
1846 3300059655 Ga0587114_051284 Ga0587114_051284_124_570 144
1847 3300059655 Ga0587114_099347 Ga0587114_099347_58_504 144
1848 3300059656 Ga0587116_17292 Ga0587116_17292_66_512 144
1849 3300059659 Ga0587120_023306 Ga0587120_023306_138_575 144
1850 3300059660 Ga0587124_033301 Ga0587124_033301_71_517 144
1851 3300060243 Ga0587060_027369 Ga0587060_027369_102_548 144
1852 3300060344 Ga0587071_034650 Ga0587071_034650_408_854 144
1853 3300060344 Ga0587071_094213 Ga0587071_094213_158_592 144
1854 3300060344 Ga0587071_114561 Ga0587071_114561_113_559 144
1855 3300060344 Ga0587071_150757 Ga0587071_150757_109_555 144
1856 3300060346 Ga0587111_0154757 Ga0587111_0154757_95_541 144
1857 3300061719 Ga0466962_0157948 Ga0466962_0157948_94_540 144
1858 2010549000 RicEn_FSXC13370_b1 RicEn_252960 145
1859 3300001989 JGI24739J22299_10030467 JGI24739J22299_100304672 145
1860 3300001989 JGI24739J22299_10046355 JGI24739J22299_100463552 145
1861 3300001991 JGI24743J22301_10146283 JGI24743J22301_101462831 145
1862 3300003215 JGI25153J46596_10010083 JGI25153J46596_100100834 145
1863 3300003215 JGI25153J46596_10014699 JGI25153J46596_100146993 145
1864 3300003215 JGI25153J46596_10038357 JGI25153J46596_100383571 145
1865 3300003215 JGI25153J46596_10139394 JGI25153J46596_101393941 145
1866 3300003354 JGI25160J50197_1013715 JGI25160J50197_10137152 145
1867 3300003752 Ga0055539_1020392 Ga0055539_10203921 145
1868 3300003763 Ga0055529_1023165 Ga0055529_10231651 145
1869 3300003771 Ga0055526_1022250 Ga0055526_10222502 145
1870 3300003771 Ga0055526_1044691 Ga0055526_10446912 145
1871 3300003794 Ga0055531_10001869 Ga0055531_100018692 145
1872 3300005262 Ga0065165_1000611 Ga0065165_100061112 145
1873 3300005262 Ga0065165_1000654 Ga0065165_100065453 145
1874 3300005262 Ga0065165_1010849 Ga0065165_10108492 145
1875 3300005262 Ga0065165_1014739 Ga0065165_10147393 145
1876 3300005327 Ga0070658_10092442 Ga0070658_100924423 145
1877 3300005334 Ga0068869_100752073 Ga0068869_1007520731 145
1878 3300005335 Ga0070666_10303843 Ga0070666_103038432 145
1879 3300005338 Ga0068868_100054227 Ga0068868_1000542272 145
1880 3300005344 Ga0070661_100925575 Ga0070661_1009255751 145
1881 3300005344 Ga0070661_101136794 Ga0070661_1011367941 145
1882 3300005345 Ga0070692_10257788 Ga0070692_102577881 145
1883 3300005347 Ga0070668_100273071 Ga0070668_1002730712 145
1884 3300005355 Ga0070671_100204966 Ga0070671_1002049661 145
1885 3300005366 Ga0070659_100152735 Ga0070659_1001527352 145
1886 3300005439 Ga0070711_101481997 Ga0070711_1014819971 145
1887 3300005455 Ga0070663_100085912 Ga0070663_1000859121 145
1888 3300005455 Ga0070663_100124599 Ga0070663_1001245992 145
1889 3300005457 Ga0070662_100075473 Ga0070662_1000754732 145
1890 3300005457 Ga0070662_100293943 Ga0070662_1002939432 145
1891 3300005459 Ga0068867_100629616 Ga0068867_1006296161 145
1892 3300005539 Ga0068853_100104507 Ga0068853_1001045072 145
1893 3300005543 Ga0070672_100508232 Ga0070672_1005082321 145
1894 3300005548 Ga0070665_100085554 Ga0070665_1000855543 145
1895 3300005548 Ga0070665_100379633 Ga0070665_1003796332 145
1896 3300005548 Ga0070665_100878323 Ga0070665_1008783232 145
1897 3300005563 Ga0068855_100134366 Ga0068855_1001343662 145
1898 3300005564 Ga0070664_100894092 Ga0070664_1008940922 145
1899 3300005578 Ga0068854_101793262 Ga0068854_1017932621 145
1900 3300005614 Ga0068856_100035420 Ga0068856_1000354203 145
1901 3300005614 Ga0068856_100563438 Ga0068856_1005634382 145
1902 3300005614 Ga0068856_100730298 Ga0068856_1007302982 145
1903 3300005616 Ga0068852_100039116 Ga0068852_1000391162 145
1904 3300005616 Ga0068852_101053874 Ga0068852_1010538742 145
1905 3300005617 Ga0068859_101121064 Ga0068859_1011210642 145
1906 3300005718 Ga0068866_10981205 Ga0068866_109812051 145
1907 3300005841 Ga0068863_100498598 Ga0068863_1004985982 145
1908 3300005842 Ga0068858_100576219 Ga0068858_1005762192 145
1909 3300005844 Ga0068862_100777127 Ga0068862_1007771272 145
1910 3300005983 Ga0081540_1010468 Ga0081540_10104683 145
1911 3300005983 Ga0081540_1138186 Ga0081540_11381862 145
1912 3300006038 Ga0075365_10057415 Ga0075365_100574152 145
1913 3300006038 Ga0075365_10252505 Ga0075365_102525052 145
1914 3300006038 Ga0075365_10322125 Ga0075365_103221252 145
1915 3300006038 Ga0075365_10537433 Ga0075365_105374331 145
1916 3300006042 Ga0075368_10009440 Ga0075368_100094403 145
1917 3300006048 Ga0075363_100018361 Ga0075363_1000183613 145
1918 3300006051 Ga0075364_10183293 Ga0075364_101832932 145
1919 3300006177 Ga0075362_10152013 Ga0075362_101520132 145
1920 3300006177 Ga0075362_10240965 Ga0075362_102409652 145
1921 3300006178 Ga0075367_10012122 Ga0075367_100121223 145
1922 3300006186 Ga0075369_10000436 Ga0075369_1000043615 145
1923 3300006186 Ga0075369_10053430 Ga0075369_100534302 145
1924 3300006186 Ga0075369_10145064 Ga0075369_101450641 145
1925 3300006186 Ga0075369_10295003 Ga0075369_102950031 145
1926 3300006195 Ga0075366_10134039 Ga0075366_101340392 145
1927 3300006353 Ga0075370_10014796 Ga0075370_100147962 145
1928 3300006353 Ga0075370_10276393 Ga0075370_102763932 145
1929 3300006931 Ga0097620_101121146 Ga0097620_1011211462 145
1930 3300006942 Ga0099824_1021711 Ga0099824_10217112 145
1931 3300006944 Ga0099823_1036144 Ga0099823_10361443 145
1932 3300009093 Ga0105240_10005244 Ga0105240_1000524412 145
1933 3300009093 Ga0105240_12114414 Ga0105240_121144141 145
1934 3300009101 Ga0105247_10084071 Ga0105247_100840712 145
1935 3300009148 Ga0105243_10641955 Ga0105243_106419551 145
1936 3300009174 Ga0105241_10355681 Ga0105241_103556812 145
1937 3300009177 Ga0105248_10193609 Ga0105248_101936093 145
1938 3300009545 Ga0105237_10011455 Ga0105237_100114555 145
1939 3300009545 Ga0105237_10238903 Ga0105237_102389032 145
1940 3300009545 Ga0105237_10584995 Ga0105237_105849952 145
1941 3300009551 Ga0105238_10623145 Ga0105238_106231452 145
1942 3300009553 Ga0105249_10768229 Ga0105249_107682291 145
1943 3300010375 Ga0105239_10101440 Ga0105239_101014403 145
1944 3300010375 Ga0105239_10658603 Ga0105239_106586032 145
1945 3300011119 Ga0105246_10125732 Ga0105246_101257322 145
1946 3300013297 Ga0157378_10749351 Ga0157378_107493512 145
1947 3300013308 Ga0157375_10276890 Ga0157375_102768902 145
1948 3300013308 Ga0157375_10657845 Ga0157375_106578452 145
1949 3300014325 Ga0163163_10679881 Ga0163163_106798812 145
1950 3300014497 Ga0182008_10384751 Ga0182008_103847511 145
1951 3300014968 Ga0157379_11182255 Ga0157379_111822551 145
1952 3300014969 Ga0157376_11148358 Ga0157376_111483581 145
1953 3300017792 Ga0163161_10487267 Ga0163161_104872672 145
1954 3300021320 Ga0214544_1000002 Ga0214544_100000216 145
1955 3300021321 Ga0214542_1000001 Ga0214542_1000001366 145
1956 3300021324 Ga0214545_1000001 Ga0214545_1000001432 145
1957 3300021327 Ga0214543_1000001 Ga0214543_1000001764 145
1958 3300025230 Ga0209563_107702 Ga0209563_1077022 145
1959 3300025245 Ga0207425_1006689 Ga0207425_10066892 145
1960 3300025253 Ga0209677_105594 Ga0209677_1055943 145
1961 3300025254 Ga0209148_1000937 Ga0209148_100093713 145
1962 3300025261 Ga0209233_1006855 Ga0209233_10068553 145
1963 3300025261 Ga0209233_1009396 Ga0209233_10093962 145
1964 3300025272 Ga0209455_1005796 Ga0209455_10057963 145
1965 3300025295 Ga0209564_1003386 Ga0209564_100338613 145
1966 3300025297 Ga0209758_1000024 Ga0209758_1000024167 145
1967 3300025297 Ga0209758_1000068 Ga0209758_1000068208 145
1968 3300025297 Ga0209758_1000868 Ga0209758_100086826 145
1969 3300025297 Ga0209758_1001914 Ga0209758_100191412 145
1970 3300025297 Ga0209758_1022253 Ga0209758_10222533 145
1971 3300025297 Ga0209758_1080453 Ga0209758_10804532 145
1972 3300025297 Ga0209758_1132451 Ga0209758_11324511 145
1973 3300025299 Ga0209256_1004276 Ga0209256_10042764 145
1974 3300025302 Ga0207426_1000439 Ga0207426_100043942 145
1975 3300025302 Ga0207426_1000588 Ga0207426_10005882 145
1976 3300025302 Ga0207426_1031729 Ga0207426_10317292 145
1977 3300025302 Ga0207426_1053615 Ga0207426_10536152 145
1978 3300025304 Ga0209257_1000416 Ga0209257_100041653 145
1979 3300025315 Ga0207697_10013313 Ga0207697_100133133 145
1980 3300025900 Ga0207710_10731267 Ga0207710_107312671 145
1981 3300025903 Ga0207680_10107680 Ga0207680_101076802 145
1982 3300025904 Ga0207647_10215757 Ga0207647_102157572 145
1983 3300025904 Ga0207647_10273744 Ga0207647_102737442 145
1984 3300025911 Ga0207654_10173538 Ga0207654_101735382 145
1985 3300025911 Ga0207654_10307919 Ga0207654_103079192 145
1986 3300025913 Ga0207695_10000008 Ga0207695_10000008264 145
1987 3300025913 Ga0207695_10686740 Ga0207695_106867401 145
1988 3300025913 Ga0207695_10820937 Ga0207695_108209372 145
1989 3300025914 Ga0207671_10002506 Ga0207671_100025062 145
1990 3300025914 Ga0207671_10094186 Ga0207671_100941863 145
1991 3300025914 Ga0207671_10227952 Ga0207671_102279521 145
1992 3300025914 Ga0207671_10468832 Ga0207671_104688322 145
1993 3300025916 Ga0207663_10403616 Ga0207663_104036162 145
1994 3300025919 Ga0207657_10327604 Ga0207657_103276042 145
1995 3300025919 Ga0207657_10741180 Ga0207657_107411801 145
1996 3300025920 Ga0207649_10162873 Ga0207649_101628732 145
1997 3300025924 Ga0207694_10499756 Ga0207694_104997562 145
1998 3300025931 Ga0207644_10080535 Ga0207644_100805353 145
1999 3300025932 Ga0207690_10295201 Ga0207690_102952012 145
2000 3300025933 Ga0207706_10154348 Ga0207706_101543482 145
2001 3300025933 Ga0207706_10511672 Ga0207706_105116722 145
2002 3300025939 Ga0207665_10156826 Ga0207665_101568262 145
2003 3300025941 Ga0207711_10087354 Ga0207711_100873543 145
2004 3300025941 Ga0207711_10253065 Ga0207711_102530652 145
2005 3300025942 Ga0207689_10181040 Ga0207689_101810402 145
2006 3300025949 Ga0207667_10510429 Ga0207667_105104291 145
2007 3300025961 Ga0207712_10352835 Ga0207712_103528352 145
2008 3300025981 Ga0207640_10199400 Ga0207640_101994002 145
2009 3300025986 Ga0207658_10282048 Ga0207658_102820482 145
2010 3300026041 Ga0207639_10089910 Ga0207639_100899102 145
2011 3300026067 Ga0207678_10123193 Ga0207678_101231931 145
2012 3300026067 Ga0207678_10753343 Ga0207678_107533432 145
2013 3300026078 Ga0207702_11248750 Ga0207702_112487501 145
2014 3300026095 Ga0207676_11132694 Ga0207676_111326941 145
2015 3300026116 Ga0207674_10343099 Ga0207674_103430992 145
2016 3300026121 Ga0207683_10748605 Ga0207683_107486051 145
2017 3300026142 Ga0207698_10094109 Ga0207698_100941093 145
2018 3300026142 Ga0207698_10631835 Ga0207698_106318351 145
2019 3300027296 Ga0209389_1000100 Ga0209389_100010059 145
2020 3300027296 Ga0209389_1000181 Ga0209389_100018115 145
2021 3300027357 Ga0209589_1000092 Ga0209589_100009270 145
2022 3300027361 Ga0209489_100006 Ga0209489_100006527 145
2023 3300027361 Ga0209489_103729 Ga0209489_1037295 145
2024 3300027363 Ga0209700_100005 Ga0209700_100005397 145
2025 3300027866 Ga0209813_10017923 Ga0209813_100179231 145
2026 3300028379 Ga0268266_10109916 Ga0268266_101099163 145
2027 3300028379 Ga0268266_10556684 Ga0268266_105566842 145
2028 3300028380 Ga0268265_10614647 Ga0268265_106146472 145
2029 3300031838 Ga0307518_10255667 Ga0307518_102556672 145
2030 3300031995 Ga0307409_101006289 Ga0307409_1010062891 145
2031 3300033180 Ga0307510_10298770 Ga0307510_102987701 145
2032 3300035172 Ga0373955_0560561 Ga0373955_0560561_46_483 145
2033 3300037068 Ga0373925_0512360 Ga0373925_0512360_227_664 145
2034 3300037312 Ga0395899_0759053 Ga0395899_0759053_79_516 145
2035 3300037418 Ga0395900_0371284 Ga0395900_0371284_423_860 145
2036 3300037418 Ga0395900_0372240 Ga0395900_0372240_559_996 145
2037 3300037418 Ga0395900_1765893 Ga0395900_1765893_16_453 145
2038 3300037466 Ga0395898_0894500 Ga0395898_0894500_61_498 145
2039 3300037471 Ga0395905_0001590 Ga0395905_0001590_6254_6691 145
2040 3300037471 Ga0395905_0066544 Ga0395905_0066544_497_934 145
2041 3300037471 Ga0395905_0706293 Ga0395905_0706293_370_807 145
2042 3300038443 Ga0395901_0177629 Ga0395901_0177629_913_1350 145
2043 3300038443 Ga0395901_0893316 Ga0395901_0893316_333_770 145
2044 3300041413 Ga0439465_0424825 Ga0439465_0424825_28_465 145
2045 3300041452 Ga0451793_0311658 Ga0451793_0311658_998_1474 145
2046 3300041459 Ga0451800_0439194 Ga0451800_0439194_268_705 145
2047 3300041491 Ga0451833_0105914 Ga0451833_0105914_109_546 145
2048 3300041511 Ga0451855_0077832 Ga0451855_0077832_451_888 145
2049 3300041512 Ga0451853_0069924 Ga0451853_0069924_159_596 145
2050 3300044656 Ga0466969_0061483 Ga0466969_0061483_1274_1711 145
2051 3300044658 Ga0466972_0000776 Ga0466972_0000776_3574_4011 145
2052 3300044683 Ga0466965_0160106 Ga0466965_0160106_407_844 145
2053 3300044684 Ga0466966_0007017 Ga0466966_0007017_4820_5257 145
2054 3300044693 Ga0466961_0000008 Ga0466961_0000008_100003_100440 145
2055 3300044693 Ga0466961_0219091 Ga0466961_0219091_699_1136 145
2056 3300044694 Ga0466963_0048066 Ga0466963_0048066_1894_2343 145
2057 3300044706 Ga0466964_0078711 Ga0466964_0078711_749_1186 145
2058 3300044706 Ga0466964_0240547 Ga0466964_0240547_178_615 145
2059 3300044735 Ga0466968_0166483 Ga0466968_0166483_253_690 145
2060 3300044735 Ga0466968_0345378 Ga0466968_0345378_189_626 145
2061 3300044765 Ga0466970_0271872 Ga0466970_0271872_328_765 145
2062 3300044765 Ga0466970_0317534 Ga0466970_0317534_426_863 145
2063 3300044842 Ga0466957_0062441 Ga0466957_0062441_316_765 145
2064 3300044842 Ga0466957_0513259 Ga0466957_0513259_29_466 145
2065 3300044901 Ga0466960_0002447 Ga0466960_0002447_4491_4928 145
2066 3300044901 Ga0466960_0297546 Ga0466960_0297546_291_728 145
2067 3300045049 Ga0466959_0011253 Ga0466959_0011253_2732_3169 145
2068 3300045049 Ga0466959_0297717 Ga0466959_0297717_516_953 145
2069 3300045976 Ga0466967_0067937 Ga0466967_0067937_754_1203 145
2070 3300045976 Ga0466967_1065042 Ga0466967_1065042_236_673 145
2071 3300046454 Ga0495592_0257576 Ga0495592_0257576_371_808 145
2072 3300046455 Ga0495603_0260148 Ga0495603_0260148_549_986 145
2073 3300046457 Ga0495590_0132993 Ga0495590_0132993_106_543 145
2074 3300046459 Ga0495629_0016229 Ga0495629_0016229_4419_4856 145
2075 3300046460 Ga0495638_0009179 Ga0495638_0009179_3969_4406 145
2076 3300046462 Ga0495651_0298032 Ga0495651_0298032_299_736 145
2077 3300046463 Ga0495653_0114200 Ga0495653_0114200_551_988 145
2078 3300046471 Ga0495650_0076375 Ga0495650_0076375_448_912 145
2079 3300046477 Ga0495664_0539676 Ga0495664_0539676_93_530 145
2080 3300046491 Ga0495584_0190681 Ga0495584_0190681_397_834 145
2081 3300046492 Ga0495585_0269229 Ga0495585_0269229_291_728 145
2082 3300046501 Ga0495607_0201079 Ga0495607_0201079_33_470 145
2083 3300046507 Ga0495606_0094628 Ga0495606_0094628_586_1023 145
2084 3300046507 Ga0495606_0124952 Ga0495606_0124952_348_824 145
2085 3300046511 Ga0495608_0026385 Ga0495608_0026385_1855_2292 145
2086 3300046512 Ga0495610_0121933 Ga0495610_0121933_32_469 145
2087 3300046512 Ga0495610_0135555 Ga0495610_0135555_491_928 145
2088 3300046513 Ga0495616_0015452 Ga0495616_0015452_3614_4051 145
2089 3300046514 Ga0495618_0097465 Ga0495618_0097465_701_1138 145
2090 3300046515 Ga0495620_0117941 Ga0495620_0117941_119_556 145
2091 3300046516 Ga0495628_0026154 Ga0495628_0026154_1773_2210 145
2092 3300046517 Ga0495630_0035491 Ga0495630_0035491_1424_1861 145
2093 3300046522 Ga0495643_0028435 Ga0495643_0028435_505_942 145
2094 3300046528 Ga0495642_0084707 Ga0495642_0084707_594_1031 145
2095 3300046529 Ga0495652_0171311 Ga0495652_0171311_922_1359 145
2096 3300046530 Ga0495654_0146728 Ga0495654_0146728_485_922 145
2097 3300046533 Ga0495640_0033100 Ga0495640_0033100_752_1189 145
2098 3300046536 Ga0495587_0273991 Ga0495587_0273991_211_648 145
2099 3300046542 Ga0495597_0045951 Ga0495597_0045951_425_862 145
2100 3300046543 Ga0495645_0015763 Ga0495645_0015763_2293_2730 145
2101 3300046557 Ga0495622_0010265 Ga0495622_0010265_2590_3027 145
2102 3300046559 Ga0495667_0005606 Ga0495667_0005606_2649_3086 145
2103 3300046616 Ga0495668_0127991 Ga0495668_0127991_523_960 145
2104 3300046642 Ga0495634_0052733 Ga0495634_0052733_41_478 145
2105 3300046660 Ga0495625_0174643 Ga0495625_0174643_921_1358 145
2106 3300046660 Ga0495625_0240923 Ga0495625_0240923_698_1135 145
2107 3300046674 Ga0495588_0215297 Ga0495588_0215297_563_1000 145
2108 3300046675 Ga0495657_0000620 Ga0495657_0000620_31211_31648 145
2109 3300046678 Ga0495599_0008410 Ga0495599_0008410_5235_5672 145
2110 3300046679 Ga0495623_0013424 Ga0495623_0013424_1786_2223 145
2111 3300046683 Ga0495658_0134158 Ga0495658_0134158_402_839 145
2112 3300046689 Ga0495613_0037313 Ga0495613_0037313_2492_2929 145
2113 3300046690 Ga0495624_0020251 Ga0495624_0020251_2751_3188 145
2114 3300046694 Ga0495649_0108545 Ga0495649_0108545_891_1328 145
2115 3300046809 Ga0495600_0023578 Ga0495600_0023578_299_736 145
2116 3300046810 Ga0495660_0107236 Ga0495660_0107236_572_1009 145
2117 3300047315 Ga0495581_0108359 Ga0495581_0108359_696_1133 145
2118 3300047317 Ga0495604_0024741 Ga0495604_0024741_3863_4300 145
2119 3300047321 Ga0495676_0014383 Ga0495676_0014383_4529_4966 145
2120 3300047322 Ga0495680_0007659 Ga0495680_0007659_5730_6167 145
2121 3300047323 Ga0495683_0039001 Ga0495683_0039001_982_1419 145
2122 3300047443 Ga0495687_041647 Ga0495687_041647_927_1364 145
2123 3300047443 Ga0495687_087513 Ga0495687_087513_348_785 145
2124 3300047444 Ga0495675_0004343 Ga0495675_0004343_947_1384 145
2125 3300047469 Ga0495673_0042108 Ga0495673_0042108_123_560 145
2126 3300047469 Ga0495673_0131458 Ga0495673_0131458_300_737 145
2127 3300047469 Ga0495673_0161037 Ga0495673_0161037_140_577 145
2128 3300047471 Ga0495684_0039729 Ga0495684_0039729_2554_2991 145
2129 3300047673 Ga0495593_0056490 Ga0495593_0056490_603_1040 145
2130 3300048088 Ga0495602_0002073 Ga0495602_0002073_19364_19801 145
2131 3300048903 Ga0496100_0150084 Ga0496100_0150084_50_487 145
2132 3300048903 Ga0496100_0362996 Ga0496100_0362996_198_635 145
2133 3300048903 Ga0496100_1001556 Ga0496100_1001556_197_634 145
2134 3300048904 Ga0496101_0172586 Ga0496101_0172586_406_843 145
2135 3300048905 Ga0496102_0096520 Ga0496102_0096520_811_1248 145
2136 3300048905 Ga0496102_0474286 Ga0496102_0474286_229_666 145
2137 3300048906 Ga0496103_0020520 Ga0496103_0020520_659_1096 145
2138 3300048906 Ga0496103_0455378 Ga0496103_0455378_205_642 145
2139 3300048907 Ga0496104_0019192 Ga0496104_0019192_3979_4416 145
2140 3300048907 Ga0496104_0078820 Ga0496104_0078820_1871_2308 145
2141 3300048908 Ga0496105_0001231 Ga0496105_0001231_13928_14365 145
2142 3300048908 Ga0496105_0152634 Ga0496105_0152634_419_856 145
2143 3300048908 Ga0496105_0346402 Ga0496105_0346402_493_930 145
2144 3300048909 Ga0496106_0777173 Ga0496106_0777173_307_744 145
2145 3300048911 Ga0496108_0024541 Ga0496108_0024541_3647_4084 145
2146 3300048911 Ga0496108_0906833 Ga0496108_0906833_85_561 145
2147 3300048912 Ga0496109_1155349 Ga0496109_1155349_16_453 145
2148 3300048913 Ga0496110_0168702 Ga0496110_0168702_183_620 145
2149 3300048914 Ga0496111_0141807 Ga0496111_0141807_317_754 145
2150 3300048915 Ga0496112_0058605 Ga0496112_0058605_3308_3745 145
2151 3300048915 Ga0496112_0430089 Ga0496112_0430089_405_842 145
2152 3300048916 Ga0496113_0008109 Ga0496113_0008109_2693_3130 145
2153 3300048916 Ga0496113_0109242 Ga0496113_0109242_319_756 145
2154 3300048916 Ga0496113_0827869 Ga0496113_0827869_274_711 145
2155 3300048918 Ga0496115_0296029 Ga0496115_0296029_310_747 145
2156 3300048918 Ga0496115_0459371 Ga0496115_0459371_239_718 145
2157 3300048918 Ga0496115_1106243 Ga0496115_1106243_13_450 145
2158 3300048919 Ga0496116_0092850 Ga0496116_0092850_952_1389 145
2159 3300048920 Ga0496117_0020967 Ga0496117_0020967_2295_2732 145
2160 3300048921 Ga0496118_0066993 Ga0496118_0066993_59_496 145
2161 3300048921 Ga0496118_0192460 Ga0496118_0192460_250_687 145
2162 3300048921 Ga0496118_0557026 Ga0496118_0557026_68_505 145
2163 3300048922 Ga0496119_0007084 Ga0496119_0007084_623_1060 145
2164 3300048924 Ga0496121_0112008 Ga0496121_0112008_187_624 145
2165 3300048924 Ga0496121_0168695 Ga0496121_0168695_47_484 145
2166 3300048924 Ga0496121_0269731 Ga0496121_0269731_474_911 145
2167 3300048925 Ga0496122_0118787 Ga0496122_0118787_26_463 145
2168 3300048926 Ga0496123_0263328 Ga0496123_0263328_13_450 145
2169 3300048927 Ga0496124_0382745 Ga0496124_0382745_170_607 145
2170 3300048928 Ga0496125_0052306 Ga0496125_0052306_2516_2953 145
2171 3300048928 Ga0496125_0201464 Ga0496125_0201464_591_1028 145
2172 3300048928 Ga0496125_0305022 Ga0496125_0305022_131_580 145
2173 3300048929 Ga0496126_0026794 Ga0496126_0026794_1517_1954 145
2174 3300048929 Ga0496126_1355678 Ga0496126_1355678_52_489 145
2175 3300049460 Ga0495682_0064092 Ga0495682_0064092_431_868 145
2176 3300050489 nmdc:mga03683_308050_c1 nmdc:mga03683_308050_c1_123_572 145
2177 3300050490 nmdc:mga03n38_384600_c1 nmdc:mga03n38_384600_c1_198_635 145
2178 3300050491 nmdc:mga00v17_420230_c1 nmdc:mga00v17_420230_c1_204_680 145
2179 3300050491 nmdc:mga00v17_93774_c1 nmdc:mga00v17_93774_c1_40_489 145
2180 3300050492 nmdc:mga0yw44_18988_c1 nmdc:mga0yw44_18988_c1_250_687 145
2181 3300050492 nmdc:mga0yw44_292189_c1 nmdc:mga0yw44_292189_c1_566_1015 145
2182 3300050492 nmdc:mga0yw44_54072_c1 nmdc:mga0yw44_54072_c1_1500_1937 145
2183 3300050492 nmdc:mga0yw44_88703_c1 nmdc:mga0yw44_88703_c1_157_594 145
2184 3300050493 nmdc:mga0k408_11613_c2 nmdc:mga0k408_11613_c2_496_933 145
2185 3300050494 nmdc:mga06z11_176497_c1 nmdc:mga06z11_176497_c1_122_559 145
2186 3300050494 nmdc:mga06z11_231852_c1 nmdc:mga06z11_231852_c1_185_622 145
2187 3300050495 nmdc:mga04h51_3442_c1 nmdc:mga04h51_3442_c1_369_806 145
2188 3300050496 nmdc:mga07m45_161426_c2 nmdc:mga07m45_161426_c2_305_754 145
2189 3300050496 nmdc:mga07m45_51949_c1 nmdc:mga07m45_51949_c1_525_962 145
2190 3300050496 nmdc:mga07m45_674089_c1 nmdc:mga07m45_674089_c1_75_512 145
2191 3300050516 nmdc:mga0sz30_6162_c1 nmdc:mga0sz30_6162_c1_1788_2225 145
2192 3300050516 nmdc:mga0sz30_78073_c1 nmdc:mga0sz30_78073_c1_767_1216 145
2193 3300053079 Ga0500610_0105271 Ga0500610_0105271_242_679 145
2194 3300053083 Ga0495655_0003779 Ga0495655_0003779_119_556 145
2195 3300053085 Ga0495619_0015092 Ga0495619_0015092_405_842 145
2196 3300053086 Ga0500578_0190634 Ga0500578_0190634_444_905 145
2197 3300053087 Ga0500643_000007 Ga0500643_000007_103009_103446 145
2198 3300053091 Ga0500647_0070606 Ga0500647_0070606_1102_1539 145
2199 3300053092 Ga0500583_0043438 Ga0500583_0043438_954_1391 145
2200 3300053093 Ga0500651_0142873 Ga0500651_0142873_121_558 145
2201 3300053094 Ga0500566_0000483 Ga0500566_0000483_2618_3055 145
2202 3300053098 Ga0500650_0137842 Ga0500650_0137842_462_899 145
2203 3300053103 Ga0500555_003826 Ga0500555_003826_460_897 145
2204 3300053104 Ga0500556_0092523 Ga0500556_0092523_351_788 145
2205 3300053105 Ga0500557_000013 Ga0500557_000013_66576_67013 145
2206 3300053108 Ga0500562_005257 Ga0500562_005257_2069_2506 145
2207 3300053111 Ga0500572_084716 Ga0500572_084716_343_780 145
2208 3300053114 Ga0500582_180497 Ga0500582_180497_54_491 145
2209 3300053119 Ga0500595_011086 Ga0500595_011086_2349_2786 145
2210 3300053130 Ga0500642_0000031 Ga0500642_0000031_76557_76994 145
2211 3300053130 Ga0500642_0096124 Ga0500642_0096124_756_1193 145
2212 3300053133 Ga0500655_004332 Ga0500655_004332_867_1304 145
2213 3300053134 Ga0500658_0400732 Ga0500658_0400732_176_613 145
2214 3300053136 Ga0500559_0016567 Ga0500559_0016567_1439_1876 145
2215 3300053139 Ga0500568_0012178 Ga0500568_0012178_1196_1633 145
2216 3300053153 Ga0500616_0153001 Ga0500616_0153001_539_976 145
2217 3300053156 Ga0500622_0014965 Ga0500622_0014965_415_852 145
2218 3300053162 Ga0500638_103683 Ga0500638_103683_48_485 145
2219 3300053162 Ga0500638_223166 Ga0500638_223166_56_493 145
2220 3300053163 Ga0500639_308014 Ga0500639_308014_71_508 145
2221 3300053177 Ga0500636_0000014 Ga0500636_0000014_35650_36087 145
2222 3300053729 Ga0500625_117738 Ga0500625_117738_402_839 145
2223 3300053730 Ga0500645_158782 Ga0500645_158782_119_556 145
2224 3300053731 Ga0500609_001006 Ga0500609_001006_2472_2909 145
2225 3300053736 Ga0500599_002436 Ga0500599_002436_1002_1439 145
2226 3300053737 Ga0500601_000055 Ga0500601_000055_218_655 145
2227 3300055283 Ga0500661_018265 Ga0500661_018265_803_1240 145
2228 3300059641 Ga0587068_068230 Ga0587068_068230_179_616 145
2229 3300061719 Ga0466962_0053200 Ga0466962_0053200_1437_1886 145
2230 iso_pu_bacteria 2511231028 2511393997 145
2231 iso_pu_bacteria 2517093001 2517102525 145
2232 iso_pu_bacteria 2841957949 2841961074 145
2233 iso_pu_bacteria 2842038055 2842040256 145
2234 iso_pu_bacteria 2842045827 2842046799 145
2235 iso_pu_bacteria 2844315083 2844319502 145
2236 iso_pu_bacteria 2857509624 2857515985 145
2237 iso_pu_bacteria 2874628541 2874635813 145
2238 iso_pu_bacteria 2903727486 2903734438 145
2239 iso_pu_bacteria 2906602504 2906609234 145
2240 iso_pu_bacteria 2906643746 2906646491 145
2241 iso_pu_bacteria 2941531003 2941533287 145

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

27

142

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
2qqz-assembly1.cif.gz_B crystal structure of putative glyoxalase family protein from bacillus anthracis 0.784 5 124
3kol-assembly1.cif.gz_A-2 crystal structure of a glyoxalase/dioxygenase from nostoc punctiforme 0.7721 8 124
2p7k-assembly1.cif.gz_B crystal structure of genomically encoded fosfomycin resistance protein, fosx, from listeria monocytogenes (hexagonal form) 0.7637 5 131
3oaj-assembly1.cif.gz_A crystal structure of putative dioxygenase from bacillus subtilis subsp. subtilis str. 168 0.757 10 124
3oby-assembly2.cif.gz_B crystal structure of archaeoglobus fulgidus pelota reveals inter-domain structural plasticity 0.756 99 127
ID Description Score Start End Superfamily
af_Q10FQ7_7_135_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8281 11 125 3.10.180.10
af_Q55BV8_1020_1547_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8214 97 125 2.130.10.10
3m2oB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8178 77 123 3.30.720.110
3bt3B02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8151 73 124 3.30.720.110
3oajB02 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8142 72 124 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A257J0B0-F1-model_v4 VOC domain-containing protein 0.9104 5 126
AF-A0A523K8V1-F1-model_v4 Glyoxalase 0.9038 4 130
AF-A0A383F359-F1-model_v4 VOC domain-containing protein 0.8997 42 126
AF-A0A0E3BND4-F1-model_v4 VOC domain-containing protein 0.8953 6 131
AF-A0A2E7DHA9-F1-model_v4 Glyoxalase 0.8948 1 127

Feature Viewer

pLDDT pTM Quality
82.03 0.76 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map