F496572

General Info

Members Datasets Scaffolds Average Seq Length
2229 741 2103 99

Family's Representative Sequence

Representative Sequence 3300049743|Ga0501081_1435834|Ga0501081_1435834_84_389
Length 95
Sequence MRTPIGYFLVVSAMLFSIGTIGVLVRRNALIIFMSVELQLNAVNLALVAFSRMHGELNGQVLAFFSLVVAGLAIIVTVFRRRHSASVDDASVLRG

Samples

Sample ID Description Type Environment
1 2523231044 Gordonia rhizosphera NBRC 16068 Isolate Rhizosphere
2 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
3 2551306166 Nocardia tenerifensis NBRC 101015 Isolate Rhizosphere
4 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
5 2565956761 Rhodococcus qingshengii BKS 20-40 Isolate Rhizosphere
6 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
7 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
8 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
9 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
10 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
11 2643221548 Streptomyces sp. Root55 Isolate Unclassified
12 2643221578 Streptomyces sp. Root63 Isolate Unclassified
13 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
14 2643221601 Kitasatospora sp. Root187 Isolate Unclassified
15 2643221631 Kitasatospora sp. Root107 Isolate Unclassified
16 2643221647 Streptomyces sp. Root369 Isolate Unclassified
17 2643221670 Streptomyces sp. Root431 Isolate Unclassified
18 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
19 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
20 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
21 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
22 2643221687 Mycobacterium sp. Root135 Isolate Unclassified
23 2643221692 Nocardia sp. Root136 Isolate Unclassified
24 2643221714 Streptomyces sp. Root264 Isolate Unclassified
25 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
26 2731639228 Motilibacter peucedani DSM 45328 Isolate Rhizosphere
27 2738541264 Mycobacterium sp. OK889 Isolate Unclassified
28 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
29 2738541308 Rhodococcus sp. OK551 Isolate Unclassified
30 2738541356 Mycobacterium sp. OK887 Isolate Unclassified
31 2738543005 Rhodococcus sp. OK519 Isolate Unclassified
32 2744054611 Aldersonia kunmingensis DSM 45001 Isolate Rhizosphere
33 2751185725 Microbispora sp. NRRL B-24597 Isolate Unclassified
34 2751185792 Kitasatospora arboriphila NRRL B-24581 Isolate Unclassified
35 2767802112 Streptomyces avicenniae NRRL B-24776 Isolate Rhizosphere
36 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
37 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
38 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
39 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
40 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
41 2799112218 Motilibacter rhizosphaerae DSM 45622 Isolate Rhizosphere
42 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
43 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
44 2808606448 Streptomyces sp. 193411 Isolate Unclassified
45 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
46 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
47 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
48 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
49 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
50 2842888712 Tsukamurella sp. R-71941 Isolate Unclassified
51 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
52 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
53 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
54 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
55 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
56 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
57 2862574272 Streptomyces sp. AcE210 Isolate Nodule
58 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
59 2867428634 Streptomyces sp. RP5T Isolate Unclassified
60 2867475112 Streptomyces sp. TM32 Isolate Unclassified
61 2868088558 Phytoactinopolyspora endophytica EGI 60009 Isolate Unclassified
62 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
63 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
64 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
65 2902799365 Mycolicibacterium sp. P1-5 Isolate Unclassified
66 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
67 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified
68 2904535858 Rhodococcus erythropolis 2017 Isolate Unclassified
69 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
70 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
71 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
72 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
73 2922554459 Rhodococcus sp. 66b Isolate Unclassified
74 2928142448 Prescottella equi DPS 2018 Isolate Unclassified
75 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
76 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
77 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere
78 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
79 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
80 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
81 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
82 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
83 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
84 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
85 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
86 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
87 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
88 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
89 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
90 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
91 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
92 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
93 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
94 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
95 2974315732 Rhodococcus sp. SORGH_AS 301 Isolate Unclassified
96 2984523437 Rhodococcus sp. SORGH_AS303 Isolate Aerial Root
97 2990044586 Streptomyces sedi JCM 16909 Isolate Unclassified
98 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
99 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified
100 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
101 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
102 3001889506 Janibacter sp. YIM B02568 Isolate Unclassified
103 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
104 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
105 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
106 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
107 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
108 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
109 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
110 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
111 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
112 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
113 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
114 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
115 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
116 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
117 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
118 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
119 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
120 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
121 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
122 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
123 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
124 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
125 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
126 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
127 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
128 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
129 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
130 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
131 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
132 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
133 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
134 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
135 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
136 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
137 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
138 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
139 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
140 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
141 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
142 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
143 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
144 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
145 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
146 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
147 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
148 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
149 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
150 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
151 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
152 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
153 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
154 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
155 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
156 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
157 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
158 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
159 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
160 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
161 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
162 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
163 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
164 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
165 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
166 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
167 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
168 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
169 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
170 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
171 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
172 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
173 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
174 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
175 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
176 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
177 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
178 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
179 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
180 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
181 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
182 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
183 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
184 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
185 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
186 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
187 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
188 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
189 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
190 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
191 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
192 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
193 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
194 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
195 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
196 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
197 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
198 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
199 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
200 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
201 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
202 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
203 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
204 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
205 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
206 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
207 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
208 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
209 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
210 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
211 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
212 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
213 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
214 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
215 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
216 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
217 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
218 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
219 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
220 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
221 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
222 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
223 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
224 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
225 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
226 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
227 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
228 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
229 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
230 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
231 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
232 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
233 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
234 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
235 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
236 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
237 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
238 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
239 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
240 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
241 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
242 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
243 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
244 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
245 3300012476 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.yng.070610 Metagenome Rhizosphere
246 3300012503 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R Metagenome Rhizosphere
247 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
248 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
249 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
250 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
251 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
252 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
253 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
254 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
255 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
256 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
257 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
258 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
259 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
260 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
261 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
262 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
263 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
264 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
265 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
266 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
267 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
268 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
269 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
270 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
271 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
272 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
273 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
274 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
275 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
276 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
277 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
278 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
279 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
280 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
281 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
282 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
283 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
284 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
285 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
286 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
287 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
288 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
289 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
290 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
291 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
292 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
293 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
294 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
295 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
296 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
297 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
298 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
299 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
300 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
301 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
302 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
303 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
304 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
305 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
306 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
307 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
308 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
309 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
310 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
311 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
312 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
313 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
314 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
315 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
316 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
317 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
318 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
319 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
320 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
321 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
322 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
323 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
324 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
325 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
326 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
327 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
328 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
329 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
330 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
331 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
332 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
333 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
334 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
335 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
336 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
337 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
338 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
339 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
340 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
341 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
342 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
343 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
344 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
345 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
346 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
347 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
348 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
349 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
350 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
351 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
352 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
353 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
354 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
355 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
356 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
357 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
358 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
359 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
360 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
361 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
362 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
363 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
364 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
365 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
366 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
367 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
368 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
369 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
370 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
371 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
372 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
373 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
374 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
375 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
376 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
377 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
378 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
379 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
380 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
381 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
382 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
383 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
384 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
385 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
386 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
387 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
388 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
389 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
390 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
391 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
392 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
393 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
394 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
395 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
396 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
397 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
398 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
399 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
400 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
401 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
402 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
403 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
404 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
405 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
406 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
407 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
408 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
409 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
410 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
411 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
412 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
413 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
414 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
415 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
416 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
417 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
418 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
419 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
420 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
421 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
422 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
423 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
424 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
425 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
426 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
427 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
428 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
429 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
430 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
431 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
432 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
433 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
434 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
435 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
436 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
437 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
438 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
439 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
440 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
441 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
442 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
443 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
444 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
445 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
446 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
447 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
448 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
449 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
450 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
451 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
452 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
453 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
454 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
455 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
456 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
457 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
458 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
459 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
460 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
461 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
462 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
463 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
464 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
465 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
466 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
467 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
468 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
469 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
470 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
471 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
472 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
473 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
474 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
475 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
476 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
477 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
478 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
479 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
480 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
481 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
482 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
483 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
484 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
485 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
486 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
487 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
488 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
489 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
490 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
491 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
492 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
493 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
494 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
495 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
496 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
497 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
498 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
499 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
500 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
501 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
502 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
503 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
504 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
505 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
506 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
507 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
508 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
509 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
510 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
511 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
512 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
513 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
514 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
515 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
516 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
517 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
518 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
519 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
520 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
521 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
522 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
523 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
524 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
525 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
526 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
527 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
528 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
529 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
530 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
531 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
532 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
533 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
534 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
535 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
536 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
537 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
538 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
539 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
540 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
541 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
542 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
543 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
544 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
545 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
546 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
547 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
548 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
549 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
550 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
551 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
552 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
553 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
554 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
555 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
556 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
557 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
558 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
559 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
560 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
561 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
562 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
563 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
564 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
565 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
566 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
567 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
568 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
569 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
570 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
571 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
572 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
573 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
574 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
575 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
576 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
577 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
578 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
579 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
580 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
581 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
582 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
583 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
584 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
585 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
586 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
587 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
588 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
589 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
590 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
591 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
592 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
593 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
594 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
595 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
596 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
597 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
598 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
599 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
600 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
601 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
602 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
603 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
604 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
605 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
606 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
607 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
608 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
609 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
610 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
611 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
612 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
613 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
614 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
615 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
616 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
617 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
618 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
619 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
620 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
621 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
622 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
623 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
624 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
625 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
626 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
627 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
628 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
629 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
630 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
631 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
632 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
633 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
634 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
635 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
636 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
637 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
638 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
639 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
640 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
641 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
642 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
643 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
644 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
645 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
646 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
647 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
648 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
649 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
650 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
651 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
652 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
653 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
654 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
655 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
656 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
657 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
658 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
659 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
660 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
661 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
662 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
663 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
664 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
665 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
666 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
667 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
668 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
669 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
670 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
671 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
672 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
673 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
674 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
675 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
676 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
677 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
678 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
679 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
680 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
681 3300053106 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 endosphere Metagenome Endosphere
682 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
683 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
684 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
685 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
686 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
687 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
688 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
689 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
690 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
691 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
692 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
693 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
694 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
695 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
696 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
697 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
698 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
699 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
700 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
701 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
702 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
703 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
704 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
705 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
706 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
707 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
708 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
709 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
710 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
711 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
712 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
713 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
714 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
715 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
716 3300059622 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
717 3300059628 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 160R_AD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
718 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
719 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
720 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
721 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
722 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
723 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
724 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
725 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
726 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
727 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
728 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
729 8033684223 Streptomyces phytophilus PIP175 Isolate Unclassified
730 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified
731 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
732 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
733 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
734 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
735 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
736 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
737 8053945823 Actinomadura terrae OS3-83 Isolate Rhizosphere
738 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
739 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere
740 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere
741 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.27
Metatranscriptomes 1.03
Isolates 5.7

Biome Distribution

Category Percentage (%)
Aerial Root 0.04
Bulb 0
Endosphere 12.25
Nodule 0.27
Rhizoplane 7.27
Rhizosphere 71.02
Stem 0
Stem Tuber 0
Unclassified 9.15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJNas_1001325 3300000546 Bacteria 3615
2 JGI24739J22299_10017756 3300001989 Bacteria 2564
3 JGI24737J22298_10020298 3300001990 Bacteria 2121
4 JGI24743J22301_10007900 3300001991 Bacteria 1856
5 JGI24750J21931_1001262 3300002070 Bacteria 3204
6 JGI24750J21931_1025756 3300002070 Bacteria 844
7 JGI24745J21846_1004116 3300002073 Bacteria 1546
8 JGI24748J21848_1003666 3300002074 Bacteria 1757
9 JGI24738J21930_10004342 3300002075 Bacteria 3487
10 JGI24749J21850_1003699 3300002076 Bacteria 2139
11 JGI24744J21845_10000088 3300002077 Bacteria 11973
12 JGI24744J21845_10002005 3300002077 Bacteria 4117
13 JGI24744J21845_10002298 3300002077 Bacteria 3895
14 JGI24034J26672_10035846 3300002239 Bacteria 821
15 JGI24742J22300_10000958 3300002244 Bacteria 4421
16 JGI24742J22300_10028088 3300002244 Bacteria 976
17 JGI24751J29686_10037569 3300002459 Bacteria 1002
18 JGI25153J46596_10083828 3300003215 Bacteria 787
19 rootH1_10017056 3300003316 Bacteria 1229
20 rootH1_10017056 3300003323 Bacteria 40617
21 rootH2_10032831 3300003320 Bacteria 1759
22 rootL2_10002375 3300003322 Bacteria 2847
23 rootH1_10061150 3300003323 Bacteria 2895
24 JGI25160J50197_1015644 3300003354 Bacteria 2482
25 JGI25160J50197_1022123 3300003354 Bacteria 1871
26 JGI25160J50197_1050490 3300003354 Bacteria 886
27 JGI25160J50197_1096305 3300003354 Bacteria 531
28 Ga0006562J51391_1101924 3300003578 Bacteria 1620
29 Ga0055540_1000003 3300003792 Bacteria 428375
30 Ga0055540_1003721 3300003792 Bacteria 7211
31 Ga0055540_1005958 3300003792 Bacteria 4956
32 Ga0055540_1006423 3300003792 Bacteria 4673
33 Ga0055540_1012991 3300003792 Bacteria 2573
34 Ga0055540_1060386 3300003792 Bacteria 759
35 Ga0070658_10000319 3300005327 Bacteria 41203
36 Ga0070658_10168973 3300005327 Bacteria 1837
37 Ga0070658_11043273 3300005327 Bacteria 711
38 Ga0070676_10005021 3300005328 Bacteria 7011
39 Ga0070683_100255133 3300005329 Bacteria 1668
40 Ga0070683_100544285 3300005329 Bacteria 1110
41 Ga0070683_102219522 3300005329 Bacteria 527
42 Ga0070690_100066359 3300005330 Bacteria 2336
43 Ga0070690_100514413 3300005330 Bacteria 898
44 Ga0070670_100341739 3300005331 Bacteria 1314
45 Ga0070670_101463295 3300005331 Bacteria 627
46 Ga0070677_10131461 3300005333 Bacteria 1143
47 Ga0068869_100078270 3300005334 Bacteria 2462
48 Ga0068869_102158052 3300005334 Bacteria 501
49 Ga0070666_10114765 3300005335 Bacteria 1865
50 Ga0070666_10206198 3300005335 Bacteria 1384
51 Ga0070666_10589613 3300005335 Bacteria 811
52 Ga0070680_100000061 3300005336 Bacteria 56357
53 Ga0070680_100238798 3300005336 Bacteria 1536
54 Ga0070680_101437996 3300005336 Bacteria 597
55 Ga0070682_100071052 3300005337 Bacteria 2227
56 Ga0070682_100286998 3300005337 Bacteria 1202
57 Ga0070682_100841066 3300005337 Bacteria 749
58 Ga0070682_101277581 3300005337 Bacteria 623
59 Ga0070682_101512840 3300005337 Bacteria 577
60 Ga0068868_100001480 3300005338 Bacteria 16204
61 Ga0070660_100110954 3300005339 Bacteria 2182
62 Ga0070660_100361827 3300005339 Bacteria 1196
63 Ga0070689_100020932 3300005340 Bacteria 4862
64 Ga0070689_100706067 3300005340 Bacteria 881
65 Ga0070691_10002982 3300005341 Bacteria 7578
66 Ga0070691_11041401 3300005341 Bacteria 513
67 Ga0070687_100186584 3300005343 Bacteria 1246
68 Ga0070687_100198977 3300005343 Bacteria 1213
69 Ga0070661_100990318 3300005344 Bacteria 697
70 Ga0070692_10095309 3300005345 Bacteria 1624
71 Ga0070692_10401231 3300005345 Bacteria 866
72 Ga0070668_100001192 3300005347 Bacteria 18433
73 Ga0070668_100006438 3300005347 Bacteria 8708
74 Ga0070668_100068621 3300005347 Bacteria 2756
75 Ga0070668_101492986 3300005347 Bacteria 618
76 Ga0070669_100004569 3300005353 Bacteria 9993
77 Ga0070669_100099405 3300005353 Bacteria 2193
78 Ga0070675_101430454 3300005354 Bacteria 637
79 Ga0070671_100047031 3300005355 Bacteria 3589
80 Ga0070674_100000187 3300005356 Bacteria 29321
81 Ga0070674_100025474 3300005356 Bacteria 3851
82 Ga0070674_100300932 3300005356 Bacteria 1279
83 Ga0070674_100495203 3300005356 Bacteria 1017
84 Ga0070673_100102120 3300005364 Bacteria 2364
85 Ga0070688_101080451 3300005365 Bacteria 641
86 Ga0070659_100018793 3300005366 Bacteria 5217
87 Ga0070659_100026599 3300005366 Bacteria 4453
88 Ga0070659_100436784 3300005366 Bacteria 1109
89 Ga0070667_100000056 3300005367 Bacteria 150952
90 Ga0070667_100000854 3300005367 Bacteria 28370
91 Ga0070667_100003985 3300005367 Bacteria 12518
92 Ga0070667_100025316 3300005367 Bacteria 4933
93 Ga0070667_100221674 3300005367 Bacteria 1683
94 Ga0070667_100591567 3300005367 Bacteria 1022
95 Ga0070703_10053183 3300005406 Bacteria 1302
96 Ga0070709_10032314 3300005434 Bacteria 3155
97 Ga0070709_10130230 3300005434 Bacteria 1717
98 Ga0070714_100016403 3300005435 Bacteria 5979
99 Ga0070714_100065097 3300005435 Bacteria 3139
100 Ga0070714_100252503 3300005435 Bacteria 1631
101 Ga0070714_100348335 3300005435 Bacteria 1391
102 Ga0070714_100451848 3300005435 Bacteria 1221
103 Ga0070714_100863902 3300005435 Bacteria 878
104 Ga0070714_101432416 3300005435 Bacteria 675
105 Ga0070714_101507705 3300005435 Bacteria 657
106 Ga0070713_100015655 3300005436 Bacteria 5680
107 Ga0070713_100080518 3300005436 Bacteria 2777
108 Ga0070713_100215794 3300005436 Bacteria 1739
109 Ga0070713_100265185 3300005436 Bacteria 1571
110 Ga0070713_100361968 3300005436 Bacteria 1348
111 Ga0070713_100629163 3300005436 Bacteria 1021
112 Ga0070710_10000277 3300005437 Bacteria 24255
113 Ga0070710_10044347 3300005437 Bacteria 2467
114 Ga0070710_10168660 3300005437 Bacteria 1362
115 Ga0070710_10370702 3300005437 Bacteria 953
116 Ga0070701_10034333 3300005438 Bacteria 2540
117 Ga0070711_100000493 3300005439 Bacteria 20558
118 Ga0070711_100029466 3300005439 Bacteria 3622
119 Ga0070711_100253283 3300005439 Bacteria 1382
120 Ga0070711_100885304 3300005439 Bacteria 761
121 Ga0070705_100200449 3300005440 Bacteria 1368
122 Ga0070705_100263554 3300005440 Bacteria 1217
123 Ga0070700_100289210 3300005441 Bacteria 1191
124 Ga0070694_100008280 3300005444 Bacteria 6359
125 Ga0070694_100118065 3300005444 Bacteria 1899
126 Ga0070708_100297322 3300005445 Bacteria 1520
127 Ga0070663_100042981 3300005455 Bacteria 3178
128 Ga0070663_100362811 3300005455 Bacteria 1176
129 Ga0070663_100429842 3300005455 Bacteria 1085
130 Ga0070663_101210567 3300005455 Bacteria 664
131 Ga0070663_101289937 3300005455 Bacteria 644
132 Ga0070678_100000280 3300005456 Bacteria 23679
133 Ga0070678_100247043 3300005456 Bacteria 1495
134 Ga0070678_100300022 3300005456 Bacteria 1365
135 Ga0070678_100982985 3300005456 Bacteria 775
136 Ga0070678_101874325 3300005456 Bacteria 566
137 Ga0070662_100001491 3300005457 Bacteria 14399
138 Ga0070662_101359820 3300005457 Bacteria 611
139 Ga0070681_10001025 3300005458 Bacteria 23693
140 Ga0070681_10754339 3300005458 Bacteria 890
141 Ga0070681_11539087 3300005458 Bacteria 590
142 Ga0068867_100002048 3300005459 Bacteria 14123
143 Ga0070685_10119192 3300005466 Bacteria 1637
144 Ga0070685_10148015 3300005466 Bacteria 1485
145 Ga0070685_10838994 3300005466 Bacteria 680
146 Ga0070679_100001551 3300005530 Bacteria 20538
147 Ga0070684_100169163 3300005535 Bacteria 1985
148 Ga0070697_100880770 3300005536 Bacteria 794
149 Ga0068853_100001367 3300005539 Bacteria 17604
150 Ga0068853_100084260 3300005539 Bacteria 2785
151 Ga0068853_100142792 3300005539 Bacteria 2150
152 Ga0068853_100570000 3300005539 Bacteria 1074
153 Ga0068853_101643301 3300005539 Bacteria 623
154 Ga0070672_100249143 3300005543 Bacteria 1496
155 Ga0070672_100569437 3300005543 Bacteria 985
156 Ga0070695_100008891 3300005545 Bacteria 5966
157 Ga0070695_100267175 3300005545 Bacteria 1252
158 Ga0070696_100002977 3300005546 Bacteria 11251
159 Ga0070696_100854901 3300005546 Bacteria 752
160 Ga0070693_100021947 3300005547 Bacteria 3389
161 Ga0070693_100098763 3300005547 Bacteria 1775
162 Ga0070693_100531666 3300005547 Bacteria 839
163 Ga0070693_101023388 3300005547 Bacteria 626
164 Ga0070665_100011296 3300005548 Bacteria 9031
165 Ga0070665_100039320 3300005548 Bacteria 4756
166 Ga0070665_100083036 3300005548 Bacteria 3209
167 Ga0070665_100230350 3300005548 Bacteria 1853
168 Ga0070665_100316153 3300005548 Bacteria 1566
169 Ga0070665_100825882 3300005548 Bacteria 940
170 Ga0070665_101327790 3300005548 Bacteria 729
171 Ga0070665_102564412 3300005548 Bacteria 511
172 Ga0070704_100001052 3300005549 Bacteria 14260
173 Ga0070704_100019306 3300005549 Bacteria 4378
174 Ga0070704_100819551 3300005549 Bacteria 833
175 Ga0068855_100244028 3300005563 Bacteria 2006
176 Ga0068855_100417642 3300005563 Bacteria 1468
177 Ga0068855_100590408 3300005563 Bacteria 1199
178 Ga0068855_100596191 3300005563 Bacteria 1192
179 Ga0068855_100745022 3300005563 Bacteria 1045
180 Ga0068855_101397090 3300005563 Bacteria 722
181 Ga0068855_102602693 3300005563 Bacteria 502
182 Ga0070664_101013283 3300005564 Bacteria 781
183 Ga0068857_100597961 3300005577 Bacteria 1043
184 Ga0068854_100000458 3300005578 Bacteria 25182
185 Ga0068854_100020918 3300005578 Bacteria 4433
186 Ga0068854_100252151 3300005578 Bacteria 1410
187 Ga0068856_100203470 3300005614 Bacteria 1994
188 Ga0070702_100000308 3300005615 Bacteria 16864
189 Ga0070702_100148986 3300005615 Bacteria 1499
190 Ga0070702_100956426 3300005615 Bacteria 675
191 Ga0068852_100063059 3300005616 Bacteria 3226
192 Ga0068852_100154194 3300005616 Bacteria 2138
193 Ga0068852_101270523 3300005616 Bacteria 758
194 Ga0068852_101980594 3300005616 Bacteria 605
195 Ga0068859_100000751 3300005617 Bacteria 32654
196 Ga0068859_100039348 3300005617 Bacteria 4743
197 Ga0068859_100206485 3300005617 Bacteria 2050
198 Ga0068864_100132511 3300005618 Bacteria 2241
199 Ga0068864_100468211 3300005618 Bacteria 1208
200 Ga0068864_101863702 3300005618 Bacteria 607
201 Ga0068864_102197808 3300005618 Bacteria 558
202 Ga0068866_10000187 3300005718 Bacteria 29090
203 Ga0068866_10029932 3300005718 Bacteria 2608
204 Ga0068866_10533620 3300005718 Bacteria 782
205 Ga0068866_11223904 3300005718 Bacteria 543
206 Ga0068861_100000195 3300005719 Bacteria 32550
207 Ga0068861_100225745 3300005719 Bacteria 1585
208 Ga0068861_101604859 3300005719 Bacteria 641
209 Ga0068851_10393066 3300005834 Bacteria 815
210 Ga0068870_10747542 3300005840 Bacteria 679
211 Ga0068863_100018953 3300005841 Bacteria 6585
212 Ga0068863_100081670 3300005841 Bacteria 3062
213 Ga0068863_100128462 3300005841 Bacteria 2419
214 Ga0068863_100207411 3300005841 Bacteria 1886
215 Ga0068863_101773287 3300005841 Bacteria 627
216 Ga0068858_100006827 3300005842 Bacteria 11104
217 Ga0068858_100015158 3300005842 Bacteria 7250
218 Ga0068858_100106856 3300005842 Bacteria 2612
219 Ga0068858_100269146 3300005842 Bacteria 1621
220 Ga0068858_100447887 3300005842 Bacteria 1244
221 Ga0068858_100999124 3300005842 Bacteria 820
222 Ga0068858_101387952 3300005842 Bacteria 692
223 Ga0068858_102180194 3300005842 Bacteria 548
224 Ga0068860_100000092 3300005843 Bacteria 150190
225 Ga0068860_100001932 3300005843 Bacteria 21940
226 Ga0068860_100157374 3300005843 Bacteria 2190
227 Ga0068862_100000035 3300005844 Bacteria 174953
228 Ga0068862_100006561 3300005844 Bacteria 9653
229 Ga0068862_100074824 3300005844 Bacteria 2928
230 Ga0068862_101578887 3300005844 Bacteria 663
231 Ga0081455_10024172 3300005937 Bacteria 5635
232 Ga0081455_10031920 3300005937 Bacteria 4755
233 Ga0081455_10034690 3300005937 Bacteria 4517
234 Ga0081455_10091239 3300005937 Bacteria 2468
235 Ga0081455_10192807 3300005937 Bacteria 1533
236 Ga0081455_10273175 3300005937 Bacteria 1225
237 Ga0081538_10136302 3300005981 Bacteria 1142
238 Ga0081540_1047146 3300005983 Bacteria 2169
239 Ga0081539_10045318 3300005985 Bacteria 2530
240 Ga0081539_10050996 3300005985 Bacteria 2336
241 Ga0070717_10212312 3300006028 Bacteria 1699
242 Ga0070717_10384114 3300006028 Bacteria 1259
243 Ga0075365_10004705 3300006038 Bacteria 7278
244 Ga0075365_10019404 3300006038 Bacteria 4196
245 Ga0075365_10024575 3300006038 Bacteria 3802
246 Ga0075365_10082992 3300006038 Bacteria 2174
247 Ga0075365_10197265 3300006038 Bacteria 1410
248 Ga0075365_10292279 3300006038 Bacteria 1146
249 Ga0075365_10470498 3300006038 Bacteria 888
250 Ga0075365_10635542 3300006038 Bacteria 754
251 Ga0075365_10963222 3300006038 Bacteria 601
252 Ga0075365_11198904 3300006038 Bacteria 534
253 Ga0075368_10007123 3300006042 Bacteria 3937
254 Ga0075368_10251780 3300006042 Bacteria 755
255 Ga0075368_10293280 3300006042 Bacteria 701
256 Ga0075368_10480886 3300006042 Bacteria 553
257 Ga0075363_100000383 3300006048 Bacteria 13424
258 Ga0075363_100000613 3300006048 Bacteria 11798
259 Ga0075363_100002816 3300006048 Bacteria 7228
260 Ga0075363_100012126 3300006048 Bacteria 4146
261 Ga0075363_100026851 3300006048 Bacteria 2949
262 Ga0075363_100032534 3300006048 Bacteria 2710
263 Ga0075363_100076456 3300006048 Bacteria 1825
264 Ga0075363_100099522 3300006048 Bacteria 1608
265 Ga0075363_100135422 3300006048 Bacteria 1384
266 Ga0075363_100190303 3300006048 Bacteria 1170
267 Ga0075363_100213308 3300006048 Bacteria 1105
268 Ga0075363_100274408 3300006048 Bacteria 974
269 Ga0075363_100279189 3300006048 Bacteria 966
270 Ga0075363_100292455 3300006048 Bacteria 944
271 Ga0075363_100299583 3300006048 Bacteria 933
272 Ga0075363_100328371 3300006048 Bacteria 891
273 Ga0075363_100472321 3300006048 Bacteria 743
274 Ga0075364_10003028 3300006051 Bacteria 9494
275 Ga0075364_10035907 3300006051 Bacteria 3203
276 Ga0075364_10043671 3300006051 Bacteria 2914
277 Ga0075364_10044294 3300006051 Bacteria 2894
278 Ga0075364_10066923 3300006051 Bacteria 2361
279 Ga0075364_10092827 3300006051 Bacteria 2004
280 Ga0075364_10132230 3300006051 Bacteria 1675
281 Ga0075364_10134790 3300006051 Bacteria 1659
282 Ga0075364_10143695 3300006051 Bacteria 1606
283 Ga0075364_10199940 3300006051 Bacteria 1354
284 Ga0075364_10266749 3300006051 Bacteria 1164
285 Ga0075364_10433398 3300006051 Bacteria 898
286 Ga0075364_10626454 3300006051 Bacteria 735
287 Ga0075364_10628202 3300006051 Bacteria 734
288 Ga0075364_10682480 3300006051 Bacteria 701
289 Ga0075364_10869353 3300006051 Bacteria 614
290 Ga0075364_10946726 3300006051 Bacteria 586
291 Ga0075364_11009446 3300006051 Bacteria 566
292 Ga0070715_10053904 3300006163 Bacteria 1740
293 Ga0070715_10071980 3300006163 Bacteria 1547
294 Ga0070716_100024573 3300006173 Bacteria 3208
295 Ga0070716_100639733 3300006173 Bacteria 805
296 Ga0070712_100001061 3300006175 Bacteria 16610
297 Ga0070712_100005282 3300006175 Bacteria 7992
298 Ga0075362_10015901 3300006177 Bacteria 3070
299 Ga0075362_10072661 3300006177 Bacteria 1574
300 Ga0075362_10083764 3300006177 Bacteria 1472
301 Ga0075362_10126789 3300006177 Bacteria 1211
302 Ga0075362_10289765 3300006177 Bacteria 811
303 Ga0075362_10352118 3300006177 Bacteria 737
304 Ga0075367_10002885 3300006178 Bacteria 8000
305 Ga0075367_10042461 3300006178 Bacteria 2661
306 Ga0075367_10186612 3300006178 Bacteria 1293
307 Ga0075367_10233147 3300006178 Bacteria 1153
308 Ga0075367_10260938 3300006178 Bacteria 1088
309 Ga0075367_10399203 3300006178 Bacteria 869
310 Ga0075367_10546065 3300006178 Bacteria 736
311 Ga0075367_10559833 3300006178 Bacteria 726
312 Ga0075369_10001505 3300006186 Bacteria 7959
313 Ga0075369_10018446 3300006186 Bacteria 2841
314 Ga0075369_10021403 3300006186 Bacteria 2658
315 Ga0075369_10026182 3300006186 Bacteria 2430
316 Ga0075369_10061574 3300006186 Bacteria 1638
317 Ga0075369_10105102 3300006186 Bacteria 1269
318 Ga0075369_10118627 3300006186 Bacteria 1196
319 Ga0075369_10154077 3300006186 Bacteria 1051
320 Ga0075369_10200650 3300006186 Bacteria 920
321 Ga0075369_10271899 3300006186 Bacteria 788
322 Ga0097621_100132479 3300006237 Bacteria 2123
323 Ga0097621_100392623 3300006237 Bacteria 1241
324 Ga0097621_100494859 3300006237 Bacteria 1107
325 Ga0075370_10001408 3300006353 Bacteria 10397
326 Ga0075370_10001448 3300006353 Bacteria 10304
327 Ga0075370_10008954 3300006353 Bacteria 5174
328 Ga0075370_10097924 3300006353 Bacteria 1696
329 Ga0075370_10104498 3300006353 Bacteria 1641
330 Ga0075370_10186332 3300006353 Bacteria 1222
331 Ga0075370_10257482 3300006353 Bacteria 1035
332 Ga0075370_10398205 3300006353 Bacteria 826
333 Ga0075370_10620621 3300006353 Bacteria 655
334 Ga0075370_10648252 3300006353 Bacteria 641
335 Ga0075370_10664947 3300006353 Bacteria 632
336 Ga0068871_100174821 3300006358 Bacteria 1843
337 Ga0075428_100015023 3300006844 Bacteria 8601
338 Ga0075430_100259087 3300006846 Bacteria 1441
339 Ga0075431_101575367 3300006847 Bacteria 615
340 Ga0075433_10984058 3300006852 Bacteria 735
341 Ga0075433_11130050 3300006852 Bacteria 681
342 Ga0075433_11760735 3300006852 Bacteria 533
343 Ga0075429_100558479 3300006880 Bacteria 1003
344 Ga0068865_100001276 3300006881 Bacteria 14662
345 Ga0068865_100032758 3300006881 Bacteria 3475
346 Ga0068865_100630967 3300006881 Bacteria 909
347 Ga0097620_100000751 3300006931 Bacteria 32654
348 Ga0097620_100039348 3300006931 Bacteria 4743
349 Ga0097620_100206491 3300006931 Bacteria 2050
350 Ga0099826_10257458 3300006948 Bacteria 915
351 Ga0075435_100931273 3300007076 Bacteria 758
352 Ga0099794_10681931 3300007265 Bacteria 547
353 Ga0099795_10038450 3300007788 Bacteria 1689
354 Ga0105251_10120384 3300009011 Bacteria 1192
355 Ga0105244_10181460 3300009036 Bacteria 998
356 Ga0105250_10016382 3300009092 Bacteria 3021
357 Ga0105250_10034275 3300009092 Bacteria 2037
358 Ga0105250_10170611 3300009092 Bacteria 911
359 Ga0105240_10619898 3300009093 Bacteria 1189
360 Ga0105240_10956301 3300009093 Bacteria 918
361 Ga0111539_10409140 3300009094 Bacteria 1580
362 Ga0111539_10828184 3300009094 Bacteria 1077
363 Ga0111539_11548544 3300009094 Bacteria 769
364 Ga0105245_10000870 3300009098 Bacteria 27352
365 Ga0105245_10152899 3300009098 Bacteria 2183
366 Ga0105245_10166509 3300009098 Bacteria 2095
367 Ga0105245_10370949 3300009098 Bacteria 1423
368 Ga0105245_10476371 3300009098 Bacteria 1261
369 Ga0105245_10881421 3300009098 Bacteria 936
370 Ga0105245_11742491 3300009098 Bacteria 675
371 Ga0105247_10000062 3300009101 Bacteria 126437
372 Ga0105247_10000637 3300009101 Bacteria 28051
373 Ga0105247_10021071 3300009101 Bacteria 3921
374 Ga0105247_10075913 3300009101 Bacteria 2110
375 Ga0105247_10140167 3300009101 Bacteria 1584
376 Ga0105247_10250979 3300009101 Bacteria 1209
377 Ga0105247_10761866 3300009101 Bacteria 735
378 Ga0114129_10093305 3300009147 Bacteria 4170
379 Ga0114129_10148224 3300009147 Bacteria 3213
380 Ga0114129_10265638 3300009147 Bacteria 2298
381 Ga0105243_10001020 3300009148 Bacteria 25871
382 Ga0105243_10074007 3300009148 Bacteria 2762
383 Ga0105243_10190530 3300009148 Bacteria 1791
384 Ga0105243_10283666 3300009148 Bacteria 1493
385 Ga0105243_10509827 3300009148 Bacteria 1142
386 Ga0105243_11285122 3300009148 Bacteria 748
387 Ga0105243_11528518 3300009148 Bacteria 692
388 Ga0105243_12183366 3300009148 Bacteria 590
389 Ga0105241_10062601 3300009174 Bacteria 2869
390 Ga0105241_10183888 3300009174 Bacteria 1735
391 Ga0105241_10806709 3300009174 Bacteria 865
392 Ga0105241_11212921 3300009174 Bacteria 715
393 Ga0105241_12287648 3300009174 Bacteria 538
394 Ga0105242_10000650 3300009176 Bacteria 27213
395 Ga0105242_10130986 3300009176 Bacteria 2165
396 Ga0105242_11181071 3300009176 Bacteria 783
397 Ga0105242_11542909 3300009176 Bacteria 696
398 Ga0105242_12699092 3300009176 Bacteria 546
399 Ga0105242_12935617 3300009176 Bacteria 527
400 Ga0105248_10000036 3300009177 Bacteria 187421
401 Ga0105248_10003895 3300009177 Bacteria 16497
402 Ga0105248_10014411 3300009177 Bacteria 8702
403 Ga0105248_10047963 3300009177 Bacteria 4790
404 Ga0105248_10115569 3300009177 Bacteria 3026
405 Ga0105248_10151489 3300009177 Bacteria 2616
406 Ga0105248_10785375 3300009177 Bacteria 1075
407 Ga0105248_10838239 3300009177 Bacteria 1038
408 Ga0105248_12344186 3300009177 Bacteria 608
409 Ga0105237_10000467 3300009545 Bacteria 57237
410 Ga0105237_10034141 3300009545 Bacteria 5152
411 Ga0105237_10052349 3300009545 Bacteria 4098
412 Ga0105237_10209041 3300009545 Bacteria 1952
413 Ga0105237_10350429 3300009545 Bacteria 1481
414 Ga0105237_11745850 3300009545 Bacteria 630
415 Ga0105237_11890974 3300009545 Bacteria 605
416 Ga0105238_10088868 3300009551 Bacteria 3076
417 Ga0105238_10131894 3300009551 Bacteria 2477
418 Ga0105238_10152187 3300009551 Bacteria 2288
419 Ga0105238_10325317 3300009551 Bacteria 1524
420 Ga0105238_10956875 3300009551 Bacteria 876
421 Ga0105238_12044567 3300009551 Bacteria 607
422 Ga0105238_12554437 3300009551 Bacteria 547
423 Ga0105238_12633302 3300009551 Bacteria 539
424 Ga0105249_10000046 3300009553 Bacteria 176363
425 Ga0105249_10001186 3300009553 Bacteria 23057
426 Ga0105249_10005021 3300009553 Bacteria 11409
427 Ga0105249_10734696 3300009553 Bacteria 1049
428 Ga0105249_11016856 3300009553 Bacteria 898
429 Ga0105249_11037881 3300009553 Bacteria 889
430 Ga0105249_11389858 3300009553 Bacteria 774
431 Ga0105249_11852390 3300009553 Bacteria 676
432 Ga0099796_10045462 3300010159 Bacteria 1504
433 Ga0105239_10003093 3300010375 Bacteria 20661
434 Ga0105239_10028730 3300010375 Bacteria 6114
435 Ga0105239_10061068 3300010375 Bacteria 4137
436 Ga0105239_10241758 3300010375 Bacteria 2026
437 Ga0105239_10403057 3300010375 Bacteria 1548
438 Ga0105239_10594153 3300010375 Bacteria 1262
439 Ga0105239_10893469 3300010375 Bacteria 1020
440 Ga0105239_11093110 3300010375 Bacteria 918
441 Ga0105239_11896191 3300010375 Bacteria 691
442 Ga0105239_12608396 3300010375 Bacteria 589
443 Ga0105239_12861131 3300010375 Bacteria 563
444 Ga0105239_12978285 3300010375 Bacteria 552
445 Ga0105239_13365063 3300010375 Bacteria 520
446 Ga0105246_10034380 3300011119 Bacteria 3377
447 Ga0105246_10063318 3300011119 Bacteria 2579
448 Ga0105246_10232450 3300011119 Bacteria 1453
449 Ga0105246_11238228 3300011119 Bacteria 689
450 Ga0105246_11800899 3300011119 Bacteria 585
451 Ga0157344_1019660 3300012476 Bacteria 572
452 Ga0157313_1021463 3300012503 Bacteria 663
453 Ga0157342_1079190 3300012507 Bacteria 514
454 Ga0157315_1005519 3300012508 Bacteria 952
455 Ga0157373_10926876 3300013100 Bacteria 647
456 Ga0157371_10124561 3300013102 Bacteria 1833
457 Ga0157371_10309262 3300013102 Bacteria 1145
458 Ga0157370_10300678 3300013104 Bacteria 1481
459 Ga0157370_11343214 3300013104 Bacteria 644
460 Ga0157370_11388264 3300013104 Bacteria 632
461 Ga0157369_10051356 3300013105 Bacteria 4462
462 Ga0157369_10110992 3300013105 Bacteria 2915
463 Ga0157369_10498685 3300013105 Bacteria 1260
464 Ga0157369_10748083 3300013105 Bacteria 1006
465 Ga0157374_10032409 3300013296 Bacteria 4757
466 Ga0157374_11664878 3300013296 Bacteria 663
467 Ga0157374_11809434 3300013296 Bacteria 636
468 Ga0157378_10004457 3300013297 Bacteria 12311
469 Ga0157378_10395003 3300013297 Bacteria 1361
470 Ga0163162_10001609 3300013306 Bacteria 21131
471 Ga0163162_10035606 3300013306 Bacteria 4960
472 Ga0163162_10412955 3300013306 Bacteria 1482
473 Ga0163162_10415926 3300013306 Bacteria 1477
474 Ga0163162_10471848 3300013306 Bacteria 1386
475 Ga0163162_11569914 3300013306 Bacteria 750
476 Ga0163162_12048891 3300013306 Bacteria 656
477 Ga0157372_10004145 3300013307 Bacteria 15520
478 Ga0157372_10219830 3300013307 Bacteria 2202
479 Ga0157372_10298165 3300013307 Bacteria 1875
480 Ga0157372_10323563 3300013307 Bacteria 1795
481 Ga0157372_13131700 3300013307 Bacteria 528
482 Ga0157375_10000419 3300013308 Bacteria 38685
483 Ga0157375_11361671 3300013308 Bacteria 835
484 Ga0157375_11459471 3300013308 Bacteria 807
485 Ga0157375_12957822 3300013308 Bacteria 567
486 Ga0163163_10039390 3300014325 Bacteria 4612
487 Ga0163163_10177849 3300014325 Bacteria 2175
488 Ga0163163_10564851 3300014325 Bacteria 1200
489 Ga0163163_11018401 3300014325 Bacteria 891
490 Ga0163163_11527267 3300014325 Bacteria 729
491 Ga0163163_12221259 3300014325 Bacteria 608
492 Ga0157380_10001844 3300014326 Bacteria 14014
493 Ga0157380_10433095 3300014326 Bacteria 1258
494 Ga0182008_10002958 3300014497 Bacteria 10453
495 Ga0157377_10026136 3300014745 Bacteria 3121
496 Ga0157377_11268421 3300014745 Bacteria 574
497 Ga0157379_10029772 3300014968 Bacteria 4855
498 Ga0157379_10132262 3300014968 Bacteria 2246
499 Ga0157379_10214503 3300014968 Bacteria 1743
500 Ga0157379_10314622 3300014968 Bacteria 1429
501 Ga0157379_11341361 3300014968 Bacteria 692
502 Ga0157376_10037960 3300014969 Bacteria 3917
503 Ga0157376_10057401 3300014969 Bacteria 3256
504 Ga0157376_10107119 3300014969 Bacteria 2453
505 Ga0157376_11853195 3300014969 Bacteria 640
506 Ga0157376_12606991 3300014969 Bacteria 545
507 Ga0182006_1084780 3300015261 Bacteria 1150
508 Ga0182005_1049382 3300015265 Bacteria 1144
509 Ga0183367_1002 3300015688 Bacteria 1101531
510 Ga0163161_10006906 3300017792 Bacteria 7852
511 Ga0163161_10172118 3300017792 Bacteria 1656
512 Ga0163161_10418449 3300017792 Bacteria 1077
513 Ga0163161_10600751 3300017792 Bacteria 907
514 Ga0163161_10636131 3300017792 Bacteria 883
515 Ga0197907_10131781 3300020069 Bacteria 2807
516 Ga0197907_10233448 3300020069 Bacteria 1104
517 Ga0206356_11143445 3300020070 Bacteria 1172
518 Ga0206351_10184192 3300020077 Bacteria 856
519 Ga0206352_10845590 3300020078 Bacteria 584
520 Ga0206350_11195567 3300020080 Bacteria 1100
521 Ga0206354_10960052 3300020081 Bacteria 4048
522 Ga0206353_11128098 3300020082 Bacteria 9314
523 Ga0206353_11287408 3300020082 Bacteria 1112
524 Ga0213872_10306243 3300021361 Bacteria 659
525 Ga0213876_10009953 3300021384 Bacteria 5110
526 Ga0213876_10011067 3300021384 Bacteria 4828
527 Ga0213876_10023670 3300021384 Bacteria 3243
528 Ga0213876_10572096 3300021384 Bacteria 601
529 Ga0213875_10032905 3300021388 Bacteria 2449
530 Ga0213875_10059850 3300021388 Bacteria 1782
531 Ga0213875_10273228 3300021388 Bacteria 798
532 Ga0224712_10000526 3300022467 Bacteria 7751
533 Ga0224712_10002344 3300022467 Bacteria 4653
534 Ga0209025_1037599 3300025294 Bacteria 2144
535 Ga0209758_1007953 3300025297 Bacteria 7028
536 Ga0207426_1004664 3300025302 Bacteria 6590
537 Ga0207426_1006367 3300025302 Bacteria 5152
538 Ga0207426_1038691 3300025302 Bacteria 1500
539 Ga0209051_1000011 3300025303 Bacteria 610828
540 Ga0209051_1000620 3300025303 Bacteria 40785
541 Ga0209051_1000933 3300025303 Bacteria 28862
542 Ga0209051_1001428 3300025303 Bacteria 20451
543 Ga0209051_1033472 3300025303 Bacteria 1943
544 Ga0209051_1039069 3300025303 Bacteria 1719
545 Ga0209051_1095550 3300025303 Bacteria 814
546 Ga0207656_10092487 3300025321 Bacteria 1375
547 Ga0207656_10115433 3300025321 Bacteria 1245
548 Ga0207696_1123242 3300025711 Bacteria 698
549 Ga0207653_10045515 3300025885 Bacteria 1450
550 Ga0207682_10340878 3300025893 Bacteria 705
551 Ga0207692_10001940 3300025898 Bacteria 7881
552 Ga0207692_10136975 3300025898 Bacteria 1389
553 Ga0207692_10302969 3300025898 Bacteria 973
554 Ga0207692_10380415 3300025898 Bacteria 876
555 Ga0207642_10000312 3300025899 Bacteria 14664
556 Ga0207642_10056787 3300025899 Bacteria 1797
557 Ga0207710_10000060 3300025900 Bacteria 168230
558 Ga0207710_10000890 3300025900 Bacteria 15991
559 Ga0207710_10130368 3300025900 Bacteria 1207
560 Ga0207688_10000177 3300025901 Bacteria 28125
561 Ga0207688_10000841 3300025901 Bacteria 15432
562 Ga0207680_10060009 3300025903 Bacteria 2313
563 Ga0207680_10107266 3300025903 Bacteria 1805
564 Ga0207680_10235641 3300025903 Bacteria 1259
565 Ga0207680_10600805 3300025903 Bacteria 787
566 Ga0207647_10014202 3300025904 Bacteria 5496
567 Ga0207647_10028202 3300025904 Bacteria 3649
568 Ga0207685_10001135 3300025905 Bacteria 5314
569 Ga0207685_10010029 3300025905 Bacteria 2778
570 Ga0207699_10126702 3300025906 Bacteria 1659
571 Ga0207699_10282730 3300025906 Bacteria 1153
572 Ga0207645_10042119 3300025907 Bacteria 2922
573 Ga0207643_10540021 3300025908 Bacteria 747
574 Ga0207643_10579470 3300025908 Bacteria 721
575 Ga0207705_10002093 3300025909 Bacteria 15510
576 Ga0207705_10486828 3300025909 Bacteria 957
577 Ga0207654_10071715 3300025911 Bacteria 2060
578 Ga0207654_10288853 3300025911 Bacteria 1111
579 Ga0207707_10000277 3300025912 Bacteria 55264
580 Ga0207707_10167030 3300025912 Bacteria 1923
581 Ga0207707_11302555 3300025912 Bacteria 584
582 Ga0207671_10009964 3300025914 Bacteria 7896
583 Ga0207671_10018152 3300025914 Bacteria 5405
584 Ga0207671_10027045 3300025914 Bacteria 4291
585 Ga0207671_10151176 3300025914 Bacteria 1794
586 Ga0207671_10821232 3300025914 Bacteria 737
587 Ga0207671_11168870 3300025914 Bacteria 603
588 Ga0207693_10000339 3300025915 Bacteria 43073
589 Ga0207693_10000602 3300025915 Bacteria 32212
590 Ga0207693_10217813 3300025915 Bacteria 1500
591 Ga0207663_10000907 3300025916 Bacteria 13535
592 Ga0207663_10122657 3300025916 Bacteria 1782
593 Ga0207663_11001168 3300025916 Bacteria 670
594 Ga0207660_10000115 3300025917 Bacteria 46447
595 Ga0207660_10111634 3300025917 Bacteria 2058
596 Ga0207660_10521538 3300025917 Bacteria 965
597 Ga0207660_10831956 3300025917 Bacteria 753
598 Ga0207660_11033446 3300025917 Bacteria 670
599 Ga0207662_10075302 3300025918 Bacteria 2050
600 Ga0207662_11040064 3300025918 Bacteria 582
601 Ga0207657_10095827 3300025919 Bacteria 2469
602 Ga0207657_10164966 3300025919 Bacteria 1797
603 Ga0207649_11409531 3300025920 Bacteria 551
604 Ga0207649_11674196 3300025920 Bacteria 504
605 Ga0207652_10000333 3300025921 Bacteria 48970
606 Ga0207652_10547270 3300025921 Bacteria 1040
607 Ga0207646_10636104 3300025922 Bacteria 956
608 Ga0207646_10832617 3300025922 Bacteria 821
609 Ga0207681_10000788 3300025923 Bacteria 20865
610 Ga0207681_10086689 3300025923 Bacteria 2225
611 Ga0207694_10048982 3300025924 Bacteria 3270
612 Ga0207694_10183839 3300025924 Bacteria 1696
613 Ga0207694_10632582 3300025924 Bacteria 901
614 Ga0207694_11119059 3300025924 Bacteria 666
615 Ga0207650_10129186 3300025925 Bacteria 1975
616 Ga0207659_10510272 3300025926 Bacteria 1019
617 Ga0207659_10968259 3300025926 Bacteria 732
618 Ga0207659_11137339 3300025926 Bacteria 671
619 Ga0207687_10001983 3300025927 Bacteria 14066
620 Ga0207687_10102936 3300025927 Bacteria 2105
621 Ga0207687_10302244 3300025927 Bacteria 1289
622 Ga0207687_10940733 3300025927 Bacteria 740
623 Ga0207700_10070676 3300025928 Bacteria 2684
624 Ga0207700_10181688 3300025928 Bacteria 1762
625 Ga0207700_10206533 3300025928 Bacteria 1658
626 Ga0207700_10271142 3300025928 Bacteria 1457
627 Ga0207700_10298691 3300025928 Bacteria 1390
628 Ga0207700_10461851 3300025928 Bacteria 1120
629 Ga0207664_10068406 3300025929 Bacteria 2853
630 Ga0207664_10324477 3300025929 Bacteria 1359
631 Ga0207664_10569422 3300025929 Bacteria 1017
632 Ga0207664_10677795 3300025929 Bacteria 927
633 Ga0207664_11686089 3300025929 Bacteria 556
634 Ga0207644_10004647 3300025931 Bacteria 8925
635 Ga0207644_10020065 3300025931 Bacteria 4541
636 Ga0207644_10207081 3300025931 Bacteria 1549
637 Ga0207690_10024212 3300025932 Bacteria 3800
638 Ga0207690_10061631 3300025932 Bacteria 2551
639 Ga0207690_10851592 3300025932 Bacteria 755
640 Ga0207706_10002589 3300025933 Bacteria 17618
641 Ga0207686_10001637 3300025934 Bacteria 12508
642 Ga0207686_10750390 3300025934 Bacteria 779
643 Ga0207686_10789993 3300025934 Bacteria 760
644 Ga0207709_10001393 3300025935 Bacteria 16930
645 Ga0207709_10074674 3300025935 Bacteria 2164
646 Ga0207709_10183433 3300025935 Bacteria 1480
647 Ga0207709_10222341 3300025935 Bacteria 1362
648 Ga0207709_10326906 3300025935 Bacteria 1150
649 Ga0207709_11668838 3300025935 Bacteria 530
650 Ga0207670_10012017 3300025936 Bacteria 5046
651 Ga0207670_10739642 3300025936 Bacteria 816
652 Ga0207670_11054097 3300025936 Bacteria 685
653 Ga0207669_10000205 3300025937 Bacteria 26813
654 Ga0207669_10211685 3300025937 Bacteria 1415
655 Ga0207669_10655942 3300025937 Bacteria 859
656 Ga0207669_10744014 3300025937 Bacteria 809
657 Ga0207669_11018226 3300025937 Bacteria 696
658 Ga0207669_11532880 3300025937 Bacteria 568
659 Ga0207669_11791100 3300025937 Bacteria 525
660 Ga0207704_10000618 3300025938 Bacteria 15725
661 Ga0207704_10209532 3300025938 Bacteria 1433
662 Ga0207704_10361902 3300025938 Bacteria 1133
663 Ga0207704_11617637 3300025938 Bacteria 556
664 Ga0207665_10008088 3300025939 Bacteria 6941
665 Ga0207665_10011512 3300025939 Bacteria 5811
666 Ga0207665_10142777 3300025939 Bacteria 1709
667 Ga0207691_10548394 3300025940 Bacteria 980
668 Ga0207711_10000073 3300025941 Bacteria 107878
669 Ga0207711_10061372 3300025941 Bacteria 3241
670 Ga0207711_10157899 3300025941 Bacteria 2051
671 Ga0207711_10536245 3300025941 Bacteria 1091
672 Ga0207711_10731525 3300025941 Bacteria 922
673 Ga0207711_11955454 3300025941 Bacteria 529
674 Ga0207689_10133901 3300025942 Bacteria 2040
675 Ga0207689_11283094 3300025942 Bacteria 615
676 Ga0207661_10086949 3300025944 Bacteria 2595
677 Ga0207661_10290851 3300025944 Bacteria 1462
678 Ga0207661_10627582 3300025944 Bacteria 987
679 Ga0207661_10735585 3300025944 Bacteria 908
680 Ga0207661_10932794 3300025944 Bacteria 800
681 Ga0207661_11837205 3300025944 Bacteria 551
682 Ga0207679_11528043 3300025945 Bacteria 612
683 Ga0207667_10183276 3300025949 Bacteria 2149
684 Ga0207667_10328404 3300025949 Bacteria 1562
685 Ga0207667_10705552 3300025949 Bacteria 1011
686 Ga0207667_11257202 3300025949 Bacteria 718
687 Ga0207651_10223155 3300025960 Bacteria 1525
688 Ga0207651_10270943 3300025960 Bacteria 1398
689 Ga0207712_10000042 3300025961 Bacteria 176338
690 Ga0207712_10072184 3300025961 Bacteria 2485
691 Ga0207712_10754948 3300025961 Bacteria 852
692 Ga0207712_12019647 3300025961 Bacteria 516
693 Ga0207668_10006306 3300025972 Bacteria 7010
694 Ga0207668_10013064 3300025972 Bacteria 5102
695 Ga0207668_10048285 3300025972 Bacteria 2920
696 Ga0207668_10753972 3300025972 Bacteria 859
697 Ga0207640_10003341 3300025981 Bacteria 8643
698 Ga0207640_10131790 3300025981 Bacteria 1808
699 Ga0207640_10477580 3300025981 Bacteria 1033
700 Ga0207640_10671311 3300025981 Bacteria 885
701 Ga0207658_10000449 3300025986 Bacteria 38511
702 Ga0207658_10000664 3300025986 Bacteria 30027
703 Ga0207658_10003954 3300025986 Bacteria 10411
704 Ga0207658_10004460 3300025986 Bacteria 9728
705 Ga0207658_10069437 3300025986 Bacteria 2662
706 Ga0207658_10451997 3300025986 Bacteria 1137
707 Ga0207658_10852948 3300025986 Bacteria 828
708 Ga0207658_11072789 3300025986 Bacteria 735
709 Ga0207658_11902673 3300025986 Bacteria 542
710 Ga0207677_10016196 3300026023 Bacteria 4407
711 Ga0207677_10257633 3300026023 Bacteria 1420
712 Ga0207703_10002964 3300026035 Bacteria 14391
713 Ga0207703_10059815 3300026035 Bacteria 3113
714 Ga0207703_10063785 3300026035 Bacteria 3022
715 Ga0207703_10065586 3300026035 Bacteria 2984
716 Ga0207703_10151622 3300026035 Bacteria 2022
717 Ga0207703_10414917 3300026035 Bacteria 1252
718 Ga0207703_10731486 3300026035 Bacteria 942
719 Ga0207703_11092095 3300026035 Bacteria 766
720 Ga0207639_10038681 3300026041 Bacteria 3550
721 Ga0207639_10379569 3300026041 Bacteria 1269
722 Ga0207639_10793787 3300026041 Bacteria 882
723 Ga0207639_10973081 3300026041 Bacteria 794
724 Ga0207678_10007047 3300026067 Bacteria 9982
725 Ga0207678_10118193 3300026067 Bacteria 2262
726 Ga0207678_10122695 3300026067 Bacteria 2217
727 Ga0207678_10795511 3300026067 Bacteria 835
728 Ga0207678_10930460 3300026067 Bacteria 769
729 Ga0207678_11078487 3300026067 Bacteria 711
730 Ga0207678_11382732 3300026067 Bacteria 622
731 Ga0207708_10003891 3300026075 Bacteria 10992
732 Ga0207708_10041519 3300026075 Bacteria 3507
733 Ga0207708_10738176 3300026075 Bacteria 844
734 Ga0207702_10903480 3300026078 Bacteria 875
735 Ga0207702_12014144 3300026078 Bacteria 568
736 Ga0207641_10001094 3300026088 Bacteria 27248
737 Ga0207641_10015008 3300026088 Bacteria 6350
738 Ga0207641_10027939 3300026088 Bacteria 4659
739 Ga0207641_10070874 3300026088 Bacteria 2996
740 Ga0207641_10094126 3300026088 Bacteria 2627
741 Ga0207641_10468585 3300026088 Bacteria 1219
742 Ga0207641_11917341 3300026088 Bacteria 594
743 Ga0207648_10000623 3300026089 Bacteria 39688
744 Ga0207648_10047022 3300026089 Bacteria 3783
745 Ga0207648_11638071 3300026089 Bacteria 605
746 Ga0207676_10017255 3300026095 Bacteria 5232
747 Ga0207676_10203343 3300026095 Bacteria 1752
748 Ga0207676_10343914 3300026095 Bacteria 1377
749 Ga0207676_10985563 3300026095 Bacteria 830
750 Ga0207676_11040120 3300026095 Bacteria 808
751 Ga0207676_11369694 3300026095 Bacteria 703
752 Ga0207676_11741940 3300026095 Bacteria 621
753 Ga0207676_11947419 3300026095 Bacteria 586
754 Ga0207674_10296717 3300026116 Bacteria 1565
755 Ga0207674_10500764 3300026116 Bacteria 1174
756 Ga0207675_100001672 3300026118 Bacteria 22194
757 Ga0207675_100533225 3300026118 Bacteria 1171
758 Ga0207675_101185188 3300026118 Bacteria 784
759 Ga0207675_101475440 3300026118 Bacteria 701
760 Ga0207683_10000539 3300026121 Bacteria 35044
761 Ga0207683_10017378 3300026121 Bacteria 6130
762 Ga0207683_10105161 3300026121 Bacteria 2523
763 Ga0207683_10383305 3300026121 Bacteria 1292
764 Ga0207683_10495393 3300026121 Bacteria 1128
765 Ga0207683_10507853 3300026121 Bacteria 1114
766 Ga0207683_10717855 3300026121 Bacteria 927
767 Ga0207698_10047163 3300026142 Bacteria 3261
768 Ga0207698_10102226 3300026142 Bacteria 2379
769 Ga0207698_10678063 3300026142 Bacteria 1024
770 Ga0209371_1029382 3300027312 Bacteria 1215
771 Ga0209179_1045200 3300027512 Bacteria 934
772 Ga0209282_1241770 3300027666 Bacteria 803
773 Ga0209813_10018444 3300027866 Bacteria 1928
774 Ga0209813_10142005 3300027866 Bacteria 853
775 Ga0207428_10336973 3300027907 Bacteria 1111
776 Ga0207428_10532992 3300027907 Bacteria 850
777 Ga0207428_10570865 3300027907 Bacteria 817
778 Ga0268266_10007218 3300028379 Bacteria 10050
779 Ga0268266_10012919 3300028379 Bacteria 7204
780 Ga0268266_10020977 3300028379 Bacteria 5569
781 Ga0268266_10102670 3300028379 Bacteria 2522
782 Ga0268266_10156772 3300028379 Bacteria 2057
783 Ga0268265_10000051 3300028380 Bacteria 174968
784 Ga0268265_10003445 3300028380 Bacteria 11383
785 Ga0268265_10076517 3300028380 Bacteria 2625
786 Ga0268265_10493002 3300028380 Bacteria 1153
787 Ga0268264_10000108 3300028381 Bacteria 208791
788 Ga0268264_10009938 3300028381 Bacteria 7877
789 Ga0268264_10197392 3300028381 Bacteria 1838
790 Ga0268264_10774917 3300028381 Bacteria 957
791 Ga0307517_10004659 3300028786 Bacteria 21023
792 Ga0307517_10036222 3300028786 Bacteria 5556
793 Ga0307517_10265146 3300028786 Bacteria 993
794 Ga0307515_10001177 3300028794 Bacteria 59836
795 Ga0307515_10083676 3300028794 Bacteria 4110
796 Ga0307515_10346614 3300028794 Bacteria 1134
797 Ga0268256_1023853 3300030500 Bacteria 1580
798 Ga0307511_10028203 3300030521 Bacteria 5104
799 Ga0307511_10062540 3300030521 Bacteria 2824
800 Ga0307511_10132506 3300030521 Bacteria 1496
801 Ga0307511_10235476 3300030521 Bacteria 900
802 Ga0307511_10263096 3300030521 Bacteria 815
803 Ga0307511_10276655 3300030521 Bacteria 780
804 Ga0307511_10309783 3300030521 Bacteria 706
805 Ga0307512_10037650 3300030522 Bacteria 4081
806 Ga0307512_10064598 3300030522 Bacteria 2785
807 Ga0307512_10182988 3300030522 Bacteria 1173
808 Ga0314311_1190625 3300030733 Bacteria 661
809 Ga0316180_1107973 3300030736 Bacteria 928
810 Ga0316182_1311333 3300030745 Bacteria 580
811 Ga0265327_10000021 3300031251 Bacteria 417788
812 Ga0265327_10000071 3300031251 Bacteria 215502
813 Ga0265327_10000630 3300031251 Bacteria 57536
814 Ga0265327_10021466 3300031251 Bacteria 3896
815 Ga0307513_10032651 3300031456 Bacteria 5866
816 Ga0307513_10033269 3300031456 Bacteria 5796
817 Ga0307513_10119884 3300031456 Bacteria 2601
818 Ga0307513_10511978 3300031456 Bacteria 916
819 Ga0307509_10169325 3300031507 Bacteria 2066
820 Ga0307509_10206018 3300031507 Bacteria 1797
821 Ga0307509_10338394 3300031507 Bacteria 1233
822 Ga0307509_10441087 3300031507 Bacteria 998
823 Ga0307408_100304208 3300031548 Bacteria 1337
824 Ga0307408_101344318 3300031548 Bacteria 671
825 Ga0307508_10001775 3300031616 Bacteria 23968
826 Ga0307508_10005680 3300031616 Bacteria 11819
827 Ga0307508_10020650 3300031616 Bacteria 5981
828 Ga0307508_10063849 3300031616 Bacteria 3248
829 Ga0307508_10075163 3300031616 Bacteria 2956
830 Ga0307508_10117382 3300031616 Bacteria 2262
831 Ga0307514_10036472 3300031649 Bacteria 3907
832 Ga0307514_10119090 3300031649 Bacteria 1847
833 Ga0307514_10190602 3300031649 Bacteria 1306
834 Ga0316579_10047194 3300031691 Bacteria 2011
835 Ga0316579_10445263 3300031691 Bacteria 627
836 Ga0316576_10069280 3300031727 Bacteria 2600
837 Ga0316576_10557500 3300031727 Bacteria 839
838 Ga0316578_10007838 3300031728 Bacteria 5392
839 Ga0316578_10054210 3300031728 Bacteria 2351
840 Ga0316578_10155229 3300031728 Bacteria 1379
841 Ga0316578_10695755 3300031728 Bacteria 592
842 Ga0307516_10007060 3300031730 Bacteria 12997
843 Ga0307516_10023113 3300031730 Bacteria 6378
844 Ga0307516_10048980 3300031730 Bacteria 4156
845 Ga0307405_10106270 3300031731 Bacteria 1893
846 Ga0307405_10763497 3300031731 Bacteria 807
847 Ga0307405_11497678 3300031731 Bacteria 593
848 Ga0316577_10196594 3300031733 Bacteria 1140
849 Ga0316577_10698771 3300031733 Bacteria 576
850 Ga0307413_10179235 3300031824 Bacteria 1509
851 Ga0307413_10760075 3300031824 Bacteria 811
852 Ga0307413_10963802 3300031824 Bacteria 729
853 Ga0307518_10156737 3300031838 Bacteria 1569
854 Ga0307410_10005427 3300031852 Bacteria 6747
855 Ga0307410_10050900 3300031852 Bacteria 2789
856 Ga0307410_10097846 3300031852 Bacteria 2097
857 Ga0307410_10154260 3300031852 Bacteria 1713
858 Ga0307410_11219754 3300031852 Bacteria 656
859 Ga0307406_10986100 3300031901 Bacteria 722
860 Ga0307406_11413939 3300031901 Bacteria 610
861 Ga0307407_10015605 3300031903 Bacteria 3762
862 Ga0307407_11702345 3300031903 Bacteria 502
863 Ga0307412_10273546 3300031911 Bacteria 1323
864 Ga0307412_11572325 3300031911 Bacteria 600
865 Ga0307409_100037553 3300031995 Bacteria 3572
866 Ga0307409_100205427 3300031995 Bacteria 1766
867 Ga0307409_100326649 3300031995 Bacteria 1438
868 Ga0307409_100387209 3300031995 Bacteria 1331
869 Ga0307409_100641406 3300031995 Bacteria 1055
870 Ga0307409_100815775 3300031995 Bacteria 941
871 Ga0307409_102087345 3300031995 Bacteria 596
872 Ga0307409_102616151 3300031995 Bacteria 533
873 Ga0307416_100056416 3300032002 Bacteria 3170
874 Ga0307416_100107718 3300032002 Bacteria 2446
875 Ga0307416_100436088 3300032002 Bacteria 1359
876 Ga0307416_101380328 3300032002 Bacteria 810
877 Ga0307416_101534811 3300032002 Bacteria 772
878 Ga0307416_103859158 3300032002 Bacteria 502
879 Ga0307411_10140216 3300032005 Bacteria 1782
880 Ga0307411_10196819 3300032005 Bacteria 1544
881 Ga0307411_10561258 3300032005 Bacteria 976
882 Ga0307415_100728871 3300032126 Bacteria 898
883 Ga0307415_100940326 3300032126 Bacteria 799
884 Ga0307415_101508448 3300032126 Bacteria 643
885 Ga0316583_10012794 3300032133 Bacteria 3028
886 Ga0316585_10026058 3300032137 Bacteria 1816
887 Ga0316585_10140083 3300032137 Bacteria 798
888 Ga0316580_10179792 3300032139 Bacteria 650
889 Ga0316580_10284486 3300032139 Bacteria 513
890 Ga0316593_10251358 3300032168 Unclassified 662
891 Ga0307507_10000732 3300033179 Bacteria 72083
892 Ga0307507_10642080 3300033179 Bacteria 540
893 Ga0307510_10035723 3300033180 Bacteria 5543
894 Ga0307510_10088739 3300033180 Bacteria 2949
895 Ga0307510_10284835 3300033180 Bacteria 1121
896 Ga0307510_10416505 3300033180 Bacteria 786
897 Ga0307510_10651932 3300033180 Bacteria 511
898 Ga0316596_1054270 3300033541 Bacteria 1063
899 Ga0373930_0210188 3300034816 Bacteria 509
900 Ga0373938_0069430 3300034957 Bacteria 839
901 Ga0373928_0105733 3300035084 Bacteria 739
902 Ga0373929_0151968 3300035085 Bacteria 621
903 Ga0373940_0078051 3300035088 Bacteria 974
904 Ga0373951_0066451 3300035091 Bacteria 911
905 Ga0373932_0036929 3300035112 Bacteria 1390
906 Ga0373939_0420583 3300035114 Bacteria 557
907 Ga0373960_0036799 3300035121 Bacteria 1396
908 Ga0373942_0032327 3300035207 Bacteria 1389
909 Ga0373942_0078542 3300035207 Bacteria 976
910 Ga0373961_0094945 3300035241 Bacteria 958
911 Ga0373962_0012789 3300035242 Bacteria 2119
912 Ga0373962_0013224 3300035242 Bacteria 2087
913 Ga0316574_0078180 3300035398 Bacteria 2098
914 Ga0316574_0122232 3300035398 Unclassified 1672
915 Ga0373924_0452019 3300035410 Bacteria 576
916 Ga0373931_0011218 3300035691 Bacteria 4325
917 Ga0316582_0204345 3300036647 Bacteria 1348
918 Ga0316582_0430407 3300036647 Bacteria 909
919 Ga0316584_0053682 3300036712 Bacteria 3016
920 Ga0316584_0086906 3300036712 Bacteria 2340
921 Ga0316584_0421280 3300036712 Bacteria 948
922 Ga0395899_0013414 3300037312 Bacteria 6270
923 Ga0395899_0748419 3300037312 Bacteria 609
924 Ga0395900_0075741 3300037418 Bacteria 3459
925 Ga0395900_0427612 3300037418 Bacteria 1284
926 Ga0395898_0006692 3300037466 Bacteria 12285
927 Ga0395898_0017702 3300037466 Bacteria 7272
928 Ga0395905_0069865 3300037471 Bacteria 3290
929 Ga0395905_0528676 3300037471 Bacteria 1080
930 Ga0395905_0686939 3300037471 Bacteria 926
931 Ga0316581_0167237 3300037588 Bacteria 678
932 Ga0436364_0195317 3300037853 Bacteria 14583
933 Ga0436364_0229870 3300037853 Bacteria 2546
934 Ga0436364_1150617 3300037853 Bacteria 1209
935 Ga0436364_1291536 3300037853 Bacteria 16625
936 Ga0395901_0100975 3300038443 Bacteria 3027
937 Ga0395901_0550223 3300038443 Bacteria 1170
938 Ga0436365_0678211 3300039437 Bacteria 16182
939 Ga0436365_0939033 3300039437 Bacteria 60216
940 Ga0436365_0941882 3300039437 Bacteria 1214
941 Ga0436365_1035060 3300039437 Bacteria 5579
942 Ga0436365_1714810 3300039437 Bacteria 1471
943 Ga0436365_1908396 3300039437 Bacteria 15438
944 Ga0436360_0804941 3300039438 Bacteria 1061
945 Ga0436361_0716923 3300039447 Bacteria 2117
946 Ga0436361_1194425 3300039447 Bacteria 888
947 Ga0436363_0444811 3300039450 Bacteria 1813
948 Ga0436363_0754104 3300039450 Bacteria 1265
949 Ga0436363_1331240 3300039450 Bacteria 1950
950 Ga0436363_1709932 3300039450 Bacteria 972
951 Ga0436362_0757592 3300039453 Bacteria 756
952 Ga0436362_1212714 3300039453 Bacteria 721
953 Ga0439439_0009171 3300041406 Bacteria 2348
954 Ga0439439_0047088 3300041406 Bacteria 1126
955 Ga0439461_0013378 3300041410 Bacteria 1548
956 Ga0439461_0014671 3300041410 Bacteria 1493
957 Ga0439461_0024659 3300041410 Bacteria 1217
958 Ga0439466_0003274 3300041411 Bacteria 6307
959 Ga0439466_0008207 3300041411 Bacteria 3937
960 Ga0439466_0013164 3300041411 Bacteria 3031
961 Ga0439466_0035103 3300041411 Bacteria 1697
962 Ga0439465_0011614 3300041413 Bacteria 2764
963 Ga0439465_0013051 3300041413 Bacteria 2595
964 Ga0439465_0034846 3300041413 Bacteria 1612
965 Ga0439465_0131683 3300041413 Bacteria 883
966 Ga0439465_0336671 3300041413 Bacteria 568
967 Ga0451787_711011 3300041441 Bacteria 502
968 Ga0451789_0165262 3300041443 Bacteria 581
969 Ga0451789_0361298 3300041443 Bacteria 696
970 Ga0451789_0982272 3300041443 Bacteria 577
971 Ga0451791_0176299 3300041451 Bacteria 1522
972 Ga0451791_0923786 3300041451 Bacteria 903
973 Ga0451793_0050578 3300041452 Bacteria 966
974 Ga0451793_0165491 3300041452 Bacteria 967
975 Ga0451793_0382258 3300041452 Bacteria 801
976 Ga0451797_0462824 3300041453 Bacteria 600
977 Ga0451797_0777865 3300041453 Bacteria 1023
978 Ga0451798_1003370 3300041458 Bacteria 524
979 Ga0451800_0949963 3300041459 Bacteria 1239
980 Ga0451802_0290968 3300041460 Bacteria 794
981 Ga0451802_1000802 3300041460 Bacteria 687
982 Ga0451806_545077 3300041462 Bacteria 916
983 Ga0451804_0768388 3300041463 Bacteria 516
984 Ga0451807_1186087 3300041486 Bacteria 539
985 Ga0451807_1334898 3300041486 Bacteria 1116
986 Ga0451807_2088134 3300041486 Bacteria 856
987 Ga0451833_0440069 3300041491 Bacteria 1317
988 Ga0451835_0852016 3300041492 Bacteria 1378
989 Ga0451837_0509056 3300041494 Bacteria 2339
990 Ga0451839_0168767 3300041496 Bacteria 744
991 Ga0451841_0295423 3300041498 Bacteria 777
992 Ga0451841_1253551 3300041498 Bacteria 678
993 Ga0451845_0166486 3300041501 Bacteria 1212
994 Ga0451851_1033401 3300041507 Bacteria 972
995 Ga0451843_0901391 3300041509 Bacteria 522
996 Ga0451843_1680136 3300041509 Bacteria 1500
997 Ga0451853_0050097 3300041512 Bacteria 501
998 Ga0451853_0425702 3300041512 Bacteria 546
999 Ga0451853_0450169 3300041512 Bacteria 694
1000 Ga0451853_1037975 3300041512 Bacteria 999
1001 Ga0451853_2284613 3300041512 Bacteria 504
1002 Ga0451853_3283147 3300041512 Bacteria 1546
1003 Ga0451853_3835888 3300041512 Bacteria 2103
1004 Ga0451853_3894526 3300041512 Bacteria 2740
1005 Ga0439431_0007821 3300041997 Bacteria 2390
1006 Ga0439431_0100112 3300041997 Bacteria 796
1007 Ga0439433_0008537 3300041999 Bacteria 2224
1008 Ga0439433_0014215 3300041999 Bacteria 1752
1009 Ga0439442_016793 3300042002 Bacteria 1510
1010 Ga0439442_024566 3300042002 Bacteria 1254
1011 Ga0439445_0001826 3300042004 Bacteria 4689
1012 Ga0439445_0101398 3300042004 Bacteria 816
1013 Ga0439445_0135614 3300042004 Bacteria 712
1014 Ga0439445_0147093 3300042004 Bacteria 685
1015 Ga0439445_0262242 3300042004 Bacteria 517
1016 Ga0439448_0004693 3300042005 Bacteria 3868
1017 Ga0439448_0130866 3300042005 Bacteria 865
1018 Ga0439448_0175236 3300042005 Bacteria 749
1019 Ga0439448_0234069 3300042005 Bacteria 647
1020 Ga0439449_0069372 3300042007 Bacteria 1299
1021 Ga0439450_069576 3300042008 Bacteria 862
1022 Ga0439454_050955 3300042011 Bacteria 699
1023 Ga0439455_0075109 3300042012 Bacteria 912
1024 Ga0439455_0197971 3300042012 Bacteria 581
1025 Ga0439457_000455 3300042014 Bacteria 11799
1026 Ga0439457_000479 3300042014 Bacteria 11535
1027 Ga0439457_044746 3300042014 Bacteria 988
1028 Ga0439462_0024184 3300042015 Bacteria 1594
1029 Ga0439463_161594 3300042016 Bacteria 581
1030 Ga0450890_011941 3300042127 Bacteria 1124
1031 Ga0450894_000142 3300042131 Bacteria 12667
1032 Ga0450895_001889 3300042132 Bacteria 1513
1033 Ga0450898_023027 3300042134 Bacteria 1106
1034 Ga0450898_034090 3300042134 Bacteria 944
1035 Ga0450900_015664 3300042136 Bacteria 1021
1036 Ga0450903_000121 3300042138 Bacteria 16870
1037 Ga0450906_002225 3300042145 Bacteria 4239
1038 Ga0439458_0001134 3300042157 Bacteria 6769
1039 Ga0439458_0025509 3300042157 Bacteria 1387
1040 Ga0450908_070131 3300042184 Bacteria 622
1041 Ga0439434_0010812 3300042435 Bacteria 2693
1042 Ga0439434_0016765 3300042435 Bacteria 2190
1043 Ga0439434_0018207 3300042435 Bacteria 2101
1044 Ga0439435_0023314 3300042436 Bacteria 1624
1045 Ga0439435_0290320 3300042436 Bacteria 558
1046 Ga0439459_0003093 3300042438 Bacteria 2614
1047 Ga0450901_024223 3300042533 Bacteria 658
1048 Ga0451577_0101787 3300042876 Bacteria 2567
1049 Ga0439440_0260273 3300042993 Bacteria 531
1050 Ga0466969_0000470 3300044656 Bacteria 22150
1051 Ga0466969_0005382 3300044656 Bacteria 6810
1052 Ga0466969_0009133 3300044656 Bacteria 5257
1053 Ga0466969_0020850 3300044656 Bacteria 3391
1054 Ga0466969_0034108 3300044656 Bacteria 2579
1055 Ga0466969_0056244 3300044656 Bacteria 1921
1056 Ga0466969_0063027 3300044656 Bacteria 1797
1057 Ga0466969_0106363 3300044656 Bacteria 1316
1058 Ga0466969_0345685 3300044656 Bacteria 673
1059 Ga0466972_0005853 3300044658 Bacteria 6165
1060 Ga0466972_0036904 3300044658 Bacteria 2389
1061 Ga0466972_0038891 3300044658 Bacteria 2323
1062 Ga0466972_0095647 3300044658 Bacteria 1407
1063 Ga0466972_0119432 3300044658 Bacteria 1244
1064 Ga0466972_0120005 3300044658 Bacteria 1240
1065 Ga0466972_0132419 3300044658 Bacteria 1174
1066 Ga0466972_0152676 3300044658 Bacteria 1085
1067 Ga0466972_0246199 3300044658 Bacteria 836
1068 Ga0466972_0341192 3300044658 Bacteria 700
1069 Ga0466965_0005281 3300044683 Bacteria 5810
1070 Ga0466965_0008504 3300044683 Bacteria 4749
1071 Ga0466965_0023201 3300044683 Bacteria 2995
1072 Ga0466965_0023923 3300044683 Bacteria 2952
1073 Ga0466965_0065885 3300044683 Bacteria 1815
1074 Ga0466965_0077985 3300044683 Bacteria 1673
1075 Ga0466965_0112919 3300044683 Bacteria 1397
1076 Ga0466965_0291718 3300044683 Bacteria 883
1077 Ga0466965_0561309 3300044683 Bacteria 645
1078 Ga0466966_0002225 3300044684 Bacteria 12619
1079 Ga0466966_0002809 3300044684 Bacteria 11457
1080 Ga0466966_0002940 3300044684 Bacteria 11227
1081 Ga0466966_0003767 3300044684 Bacteria 10000
1082 Ga0466966_0007557 3300044684 Bacteria 7200
1083 Ga0466966_0010373 3300044684 Bacteria 6185
1084 Ga0466966_0056388 3300044684 Bacteria 2485
1085 Ga0466966_0074389 3300044684 Bacteria 2123
1086 Ga0466966_0092900 3300044684 Bacteria 1871
1087 Ga0466966_0653277 3300044684 Bacteria 633
1088 Ga0466961_0002350 3300044693 Bacteria 11760
1089 Ga0466961_0004001 3300044693 Bacteria 9225
1090 Ga0466961_0006257 3300044693 Bacteria 7559
1091 Ga0466961_0008642 3300044693 Bacteria 6491
1092 Ga0466961_0020414 3300044693 Bacteria 4261
1093 Ga0466961_0032599 3300044693 Bacteria 3348
1094 Ga0466961_0136461 3300044693 Bacteria 1537
1095 Ga0466961_0162770 3300044693 Bacteria 1390
1096 Ga0466961_0259254 3300044693 Bacteria 1066
1097 Ga0466961_0385157 3300044693 Bacteria 851
1098 Ga0466961_0746316 3300044693 Bacteria 585
1099 Ga0466961_0917618 3300044693 Bacteria 521
1100 Ga0466961_0926254 3300044693 Bacteria 518
1101 Ga0466963_0000656 3300044694 Bacteria 16684
1102 Ga0466963_0002324 3300044694 Bacteria 10596
1103 Ga0466963_0062229 3300044694 Bacteria 2497
1104 Ga0466963_0097726 3300044694 Bacteria 2006
1105 Ga0466963_0117681 3300044694 Bacteria 1827
1106 Ga0466963_0215321 3300044694 Bacteria 1345
1107 Ga0466963_0286500 3300044694 Bacteria 1158
1108 Ga0466963_0375967 3300044694 Bacteria 1001
1109 Ga0466963_0821591 3300044694 Bacteria 655
1110 Ga0466964_0065505 3300044706 Bacteria 1522
1111 Ga0466964_0120091 3300044706 Bacteria 1184
1112 Ga0466964_0139210 3300044706 Bacteria 1114
1113 Ga0466964_0658092 3300044706 Bacteria 580
1114 Ga0466971_0000161 3300044719 Bacteria 25159
1115 Ga0466971_0009498 3300044719 Bacteria 4246
1116 Ga0466971_0010470 3300044719 Bacteria 4053
1117 Ga0466971_0037329 3300044719 Bacteria 2177
1118 Ga0466971_0038008 3300044719 Bacteria 2159
1119 Ga0466971_0104911 3300044719 Bacteria 1301
1120 Ga0466971_0194357 3300044719 Bacteria 956
1121 Ga0466971_0204873 3300044719 Bacteria 932
1122 Ga0466971_0245318 3300044719 Bacteria 852
1123 Ga0466968_0003026 3300044735 Bacteria 6208
1124 Ga0466968_0004670 3300044735 Bacteria 5129
1125 Ga0466968_0017639 3300044735 Bacteria 2856
1126 Ga0466968_0078172 3300044735 Bacteria 1450
1127 Ga0466968_0087905 3300044735 Bacteria 1373
1128 Ga0466968_0133985 3300044735 Bacteria 1129
1129 Ga0466968_0204497 3300044735 Bacteria 926
1130 Ga0466970_0002119 3300044765 Bacteria 9580
1131 Ga0466970_0004779 3300044765 Bacteria 6691
1132 Ga0466970_0008021 3300044765 Bacteria 5300
1133 Ga0466970_0010155 3300044765 Bacteria 4771
1134 Ga0466970_0101681 3300044765 Bacteria 1565
1135 Ga0466970_0102256 3300044765 Bacteria 1561
1136 Ga0466970_0293933 3300044765 Bacteria 915
1137 Ga0466970_0629606 3300044765 Bacteria 623
1138 Ga0466970_0897168 3300044765 Bacteria 521
1139 Ga0466957_0001267 3300044842 Bacteria 13152
1140 Ga0466957_0006730 3300044842 Bacteria 6496
1141 Ga0466957_0019108 3300044842 Bacteria 4029
1142 Ga0466957_0023478 3300044842 Bacteria 3646
1143 Ga0466957_0071734 3300044842 Bacteria 2143
1144 Ga0466957_0087858 3300044842 Bacteria 1944
1145 Ga0466957_0144044 3300044842 Bacteria 1537
1146 Ga0466957_0164351 3300044842 Bacteria 1443
1147 Ga0466957_0337919 3300044842 Bacteria 1019
1148 Ga0466957_0458162 3300044842 Bacteria 879
1149 Ga0466957_0653684 3300044842 Bacteria 739
1150 Ga0466957_0721896 3300044842 Bacteria 704
1151 Ga0466960_0000046 3300044901 Bacteria 40430
1152 Ga0466960_0001009 3300044901 Bacteria 10066
1153 Ga0466960_0002661 3300044901 Bacteria 6738
1154 Ga0466960_0004371 3300044901 Bacteria 5519
1155 Ga0466960_0051070 3300044901 Bacteria 1996
1156 Ga0466960_0178961 3300044901 Bacteria 1148
1157 Ga0466960_0585153 3300044901 Bacteria 661
1158 Ga0466959_0001597 3300045049 Bacteria 13978
1159 Ga0466959_0002075 3300045049 Bacteria 12675
1160 Ga0466959_0005630 3300045049 Bacteria 8617
1161 Ga0466959_0019524 3300045049 Bacteria 4984
1162 Ga0466959_0026773 3300045049 Bacteria 4276
1163 Ga0466959_0027848 3300045049 Bacteria 4192
1164 Ga0466959_0045345 3300045049 Bacteria 3238
1165 Ga0466959_0050561 3300045049 Bacteria 3051
1166 Ga0466959_0064953 3300045049 Bacteria 2649
1167 Ga0466959_0116305 3300045049 Bacteria 1904
1168 Ga0466959_0426793 3300045049 Bacteria 899
1169 Ga0466958_0008122 3300045836 Bacteria 5808
1170 Ga0466958_0033877 3300045836 Bacteria 3045
1171 Ga0466958_0210873 3300045836 Bacteria 1237
1172 Ga0466958_0588526 3300045836 Bacteria 723
1173 Ga0466958_0675144 3300045836 Bacteria 673
1174 Ga0466958_0823610 3300045836 Bacteria 605
1175 Ga0466958_0984515 3300045836 Bacteria 550
1176 Ga0466967_0000098 3300045976 Bacteria 31328
1177 Ga0466967_0001175 3300045976 Bacteria 14690
1178 Ga0466967_0004167 3300045976 Bacteria 9677
1179 Ga0466967_0013920 3300045976 Bacteria 6240
1180 Ga0466967_0015885 3300045976 Bacteria 5917
1181 Ga0466967_0039775 3300045976 Bacteria 4045
1182 Ga0466967_0044157 3300045976 Bacteria 3864
1183 Ga0466967_0052656 3300045976 Bacteria 3574
1184 Ga0466967_0090102 3300045976 Bacteria 2786
1185 Ga0466967_0108859 3300045976 Bacteria 2543
1186 Ga0466967_0206462 3300045976 Bacteria 1862
1187 Ga0466967_0213462 3300045976 Bacteria 1831
1188 Ga0466967_0254036 3300045976 Bacteria 1680
1189 Ga0466967_0317645 3300045976 Bacteria 1501
1190 Ga0466967_0808390 3300045976 Bacteria 931
1191 Ga0466967_1448479 3300045976 Bacteria 684
1192 Ga0466967_1667304 3300045976 Bacteria 635
1193 Ga0466967_1936721 3300045976 Bacteria 586
1194 Ga0495617_002450 3300046452 Bacteria 7374
1195 Ga0495627_032876 3300046453 Bacteria 1630
1196 Ga0495592_0005902 3300046454 Bacteria 9091
1197 Ga0495592_0011481 3300046454 Bacteria 6705
1198 Ga0495592_0017511 3300046454 Bacteria 5443
1199 Ga0495592_0043495 3300046454 Bacteria 3360
1200 Ga0495592_0232869 3300046454 Bacteria 1225
1201 Ga0495592_0693649 3300046454 Bacteria 613
1202 Ga0495603_0002752 3300046455 Bacteria 10360
1203 Ga0495603_0005893 3300046455 Bacteria 7323
1204 Ga0495603_0026486 3300046455 Bacteria 3502
1205 Ga0495603_0027817 3300046455 Bacteria 3410
1206 Ga0495603_0057695 3300046455 Bacteria 2296
1207 Ga0495603_0058400 3300046455 Bacteria 2281
1208 Ga0495603_0090468 3300046455 Bacteria 1790
1209 Ga0495603_0324172 3300046455 Bacteria 884
1210 Ga0495590_0167759 3300046457 Bacteria 799
1211 Ga0495629_0007791 3300046459 Bacteria 7882
1212 Ga0495629_0019021 3300046459 Bacteria 4912
1213 Ga0495629_0036510 3300046459 Bacteria 3468
1214 Ga0495629_0038099 3300046459 Bacteria 3388
1215 Ga0495629_0050864 3300046459 Bacteria 2901
1216 Ga0495629_0199262 3300046459 Bacteria 1384
1217 Ga0495629_0625817 3300046459 Bacteria 718
1218 Ga0495629_0879766 3300046459 Bacteria 588
1219 Ga0495638_0006268 3300046460 Bacteria 8682
1220 Ga0495638_0037802 3300046460 Bacteria 3070
1221 Ga0495638_0047159 3300046460 Bacteria 2703
1222 Ga0495638_0069235 3300046460 Bacteria 2163
1223 Ga0495638_0372591 3300046460 Bacteria 748
1224 Ga0495641_0036692 3300046461 Bacteria 2302
1225 Ga0495651_0001691 3300046462 Bacteria 17058
1226 Ga0495651_0002270 3300046462 Bacteria 14836
1227 Ga0495651_0020919 3300046462 Bacteria 5080
1228 Ga0495651_0032656 3300046462 Bacteria 4059
1229 Ga0495653_0009684 3300046463 Bacteria 7879
1230 Ga0495653_0125804 3300046463 Bacteria 1820
1231 Ga0495580_0007503 3300046472 Bacteria 8764
1232 Ga0495580_0093565 3300046472 Bacteria 2091
1233 Ga0495580_0295347 3300046472 Bacteria 1104
1234 Ga0495582_0015462 3300046473 Bacteria 4192
1235 Ga0495582_0020967 3300046473 Bacteria 3579
1236 Ga0495582_0123656 3300046473 Bacteria 1459
1237 Ga0495582_0286903 3300046473 Bacteria 945
1238 Ga0495605_0040643 3300046474 Bacteria 2320
1239 Ga0495605_0136378 3300046474 Bacteria 1103
1240 Ga0495639_0035778 3300046475 Bacteria 2222
1241 Ga0495639_0152229 3300046475 Bacteria 1116
1242 Ga0495662_0003027 3300046476 Bacteria 8480
1243 Ga0495662_0003988 3300046476 Bacteria 7436
1244 Ga0495662_0004401 3300046476 Bacteria 7073
1245 Ga0495662_0030461 3300046476 Bacteria 2604
1246 Ga0495662_0578598 3300046476 Bacteria 549
1247 Ga0495664_0002306 3300046477 Bacteria 10231
1248 Ga0495664_0006527 3300046477 Bacteria 6447
1249 Ga0495664_0168961 3300046477 Bacteria 1327
1250 Ga0495664_0638228 3300046477 Bacteria 631
1251 Ga0495584_0489469 3300046491 Bacteria 626
1252 Ga0495585_0006843 3300046492 Bacteria 7033
1253 Ga0495585_0011896 3300046492 Bacteria 5138
1254 Ga0495585_0056441 3300046492 Bacteria 2169
1255 Ga0495585_0084605 3300046492 Bacteria 1715
1256 Ga0495594_0012495 3300046499 Bacteria 4423
1257 Ga0495594_0019099 3300046499 Bacteria 3640
1258 Ga0495594_0036869 3300046499 Bacteria 2668
1259 Ga0495594_0067391 3300046499 Bacteria 1986
1260 Ga0495594_0105804 3300046499 Bacteria 1584
1261 Ga0495594_0425777 3300046499 Bacteria 755
1262 Ga0495596_0007205 3300046500 Bacteria 5032
1263 Ga0495607_0027724 3300046501 Bacteria 3499
1264 Ga0495607_0116405 3300046501 Bacteria 1410
1265 Ga0495583_0030647 3300046506 Bacteria 2616
1266 Ga0495583_0152135 3300046506 Bacteria 958
1267 Ga0495583_0188811 3300046506 Bacteria 841
1268 Ga0495583_0249917 3300046506 Bacteria 711
1269 Ga0495606_0024751 3300046507 Bacteria 4317
1270 Ga0495606_0040870 3300046507 Bacteria 3113
1271 Ga0495608_0001723 3300046511 Bacteria 15662
1272 Ga0495608_0029184 3300046511 Bacteria 3745
1273 Ga0495608_0273468 3300046511 Bacteria 1050
1274 Ga0495608_0570525 3300046511 Bacteria 681
1275 Ga0495616_0034448 3300046513 Bacteria 2630
1276 Ga0495618_0020219 3300046514 Bacteria 4100
1277 Ga0495618_0029070 3300046514 Bacteria 3446
1278 Ga0495618_0085032 3300046514 Bacteria 2021
1279 Ga0495618_0251534 3300046514 Bacteria 1108
1280 Ga0495620_0175873 3300046515 Bacteria 828
1281 Ga0495620_0197374 3300046515 Bacteria 774
1282 Ga0495628_0001384 3300046516 Bacteria 22247
1283 Ga0495628_0012481 3300046516 Bacteria 7162
1284 Ga0495628_0026361 3300046516 Bacteria 4740
1285 Ga0495628_0050390 3300046516 Bacteria 3293
1286 Ga0495628_0149375 3300046516 Bacteria 1780
1287 Ga0495630_0048762 3300046517 Bacteria 3169
1288 Ga0495630_0265887 3300046517 Bacteria 1310
1289 Ga0495630_0324468 3300046517 Bacteria 1177
1290 Ga0495630_0613214 3300046517 Bacteria 834
1291 Ga0495631_0003549 3300046518 Bacteria 8528
1292 Ga0495631_0472694 3300046518 Bacteria 534
1293 Ga0495632_0028374 3300046519 Bacteria 2921
1294 Ga0495632_0430800 3300046519 Bacteria 574
1295 Ga0495637_0006755 3300046520 Bacteria 5740
1296 Ga0495643_0007275 3300046522 Bacteria 7155
1297 Ga0495643_0085567 3300046522 Bacteria 1634
1298 Ga0495644_0157588 3300046523 Bacteria 870
1299 Ga0495648_0069856 3300046524 Bacteria 2042
1300 Ga0495648_0112305 3300046524 Bacteria 1480
1301 Ga0495648_0204897 3300046524 Bacteria 984
1302 Ga0495648_0413244 3300046524 Bacteria 600
1303 Ga0495666_0000571 3300046526 Bacteria 16465
1304 Ga0495666_0024248 3300046526 Bacteria 2997
1305 Ga0495666_0138843 3300046526 Bacteria 1134
1306 Ga0495666_0481718 3300046526 Bacteria 555
1307 Ga0495642_0082291 3300046528 Bacteria 1357
1308 Ga0495652_0002119 3300046529 Bacteria 20914
1309 Ga0495652_0018989 3300046529 Bacteria 6124
1310 Ga0495652_0024558 3300046529 Bacteria 5334
1311 Ga0495652_0069396 3300046529 Bacteria 2950
1312 Ga0495652_0072250 3300046529 Bacteria 2876
1313 Ga0495654_0007357 3300046530 Bacteria 6159
1314 Ga0495665_0005483 3300046531 Bacteria 6832
1315 Ga0495665_0509134 3300046531 Bacteria 606
1316 Ga0495640_0005626 3300046533 Bacteria 9968
1317 Ga0495640_0013818 3300046533 Bacteria 6132
1318 Ga0495640_0016680 3300046533 Bacteria 5493
1319 Ga0495640_0017644 3300046533 Bacteria 5312
1320 Ga0495640_0142738 3300046533 Bacteria 1543
1321 Ga0495640_0182550 3300046533 Bacteria 1336
1322 Ga0495640_0913821 3300046533 Bacteria 520
1323 Ga0495586_0246189 3300046535 Bacteria 1019
1324 Ga0495587_0079197 3300046536 Bacteria 1905
1325 Ga0495587_0199871 3300046536 Bacteria 1130
1326 Ga0495587_0705976 3300046536 Bacteria 553
1327 Ga0495609_0004676 3300046538 Bacteria 7418
1328 Ga0495597_0031747 3300046542 Bacteria 2400
1329 Ga0495597_0229000 3300046542 Bacteria 736
1330 Ga0495597_0302666 3300046542 Bacteria 620
1331 Ga0495645_0024216 3300046543 Bacteria 4404
1332 Ga0495645_0028167 3300046543 Bacteria 4081
1333 Ga0495645_0045978 3300046543 Bacteria 3183
1334 Ga0495645_0101595 3300046543 Bacteria 2044
1335 Ga0495645_0888778 3300046543 Bacteria 529
1336 Ga0495622_0005380 3300046557 Bacteria 5944
1337 Ga0495622_0015971 3300046557 Bacteria 3491
1338 Ga0495622_0056033 3300046557 Bacteria 1828
1339 Ga0495633_0031583 3300046558 Bacteria 2565
1340 Ga0495667_0033930 3300046559 Bacteria 3413
1341 Ga0495667_0153082 3300046559 Bacteria 1484
1342 Ga0495667_0323018 3300046559 Bacteria 976
1343 Ga0495656_0329388 3300046615 Bacteria 788
1344 Ga0495668_0000123 3300046616 Bacteria 115173
1345 Ga0495668_0036571 3300046616 Bacteria 2751
1346 Ga0495668_0651628 3300046616 Bacteria 582
1347 Ga0495634_0006120 3300046642 Bacteria 9162
1348 Ga0495634_0010265 3300046642 Bacteria 6861
1349 Ga0495634_0050187 3300046642 Bacteria 2803
1350 Ga0495634_0213792 3300046642 Bacteria 1192
1351 Ga0495634_0276759 3300046642 Bacteria 1020
1352 Ga0495634_0382681 3300046642 Bacteria 838
1353 Ga0495611_0057795 3300046648 Bacteria 1758
1354 Ga0495611_0215774 3300046648 Bacteria 893
1355 Ga0495625_0005807 3300046660 Bacteria 11145
1356 Ga0495625_0029488 3300046660 Bacteria 4102
1357 Ga0495625_0238937 3300046660 Bacteria 1183
1358 Ga0495635_0002565 3300046663 Bacteria 12433
1359 Ga0495635_0004355 3300046663 Bacteria 9800
1360 Ga0495635_0066218 3300046663 Bacteria 2477
1361 Ga0495635_0071866 3300046663 Bacteria 2371
1362 Ga0495635_0088357 3300046663 Bacteria 2121
1363 Ga0495635_0341668 3300046663 Bacteria 1000
1364 Ga0495635_0375901 3300046663 Bacteria 946
1365 Ga0495659_0219554 3300046664 Bacteria 785
1366 Ga0495659_0562685 3300046664 Bacteria 504
1367 Ga0495661_0023540 3300046665 Bacteria 3997
1368 Ga0495661_0175298 3300046665 Bacteria 1140
1369 Ga0495588_0003543 3300046674 Bacteria 6816
1370 Ga0495588_0003986 3300046674 Bacteria 6486
1371 Ga0495588_0005355 3300046674 Bacteria 5704
1372 Ga0495588_0010107 3300046674 Bacteria 4377
1373 Ga0495657_0003629 3300046675 Bacteria 12539
1374 Ga0495657_0007083 3300046675 Bacteria 8700
1375 Ga0495657_0008037 3300046675 Bacteria 8088
1376 Ga0495657_0008501 3300046675 Bacteria 7848
1377 Ga0495599_0049987 3300046678 Bacteria 2621
1378 Ga0495599_0064358 3300046678 Bacteria 2290
1379 Ga0495599_0326318 3300046678 Bacteria 923
1380 Ga0495623_0059476 3300046679 Bacteria 2399
1381 Ga0495623_0075257 3300046679 Bacteria 2097
1382 Ga0495623_0135461 3300046679 Bacteria 1470
1383 Ga0495623_0363063 3300046679 Bacteria 786
1384 Ga0495646_0000855 3300046680 Bacteria 17256
1385 Ga0495646_0010343 3300046680 Bacteria 5933
1386 Ga0495646_0051847 3300046680 Bacteria 2481
1387 Ga0495646_0094322 3300046680 Bacteria 1723
1388 Ga0495646_0620530 3300046680 Bacteria 548
1389 Ga0495658_0002176 3300046683 Bacteria 9917
1390 Ga0495658_0112189 3300046683 Bacteria 1640
1391 Ga0495658_0538936 3300046683 Bacteria 747
1392 Ga0495669_0356984 3300046684 Bacteria 707
1393 Ga0495613_0001664 3300046689 Bacteria 16910
1394 Ga0495613_0006878 3300046689 Bacteria 8487
1395 Ga0495613_0007886 3300046689 Bacteria 7917
1396 Ga0495613_0017322 3300046689 Bacteria 5368
1397 Ga0495613_0042788 3300046689 Bacteria 3350
1398 Ga0495613_0056747 3300046689 Bacteria 2875
1399 Ga0495613_0085162 3300046689 Bacteria 2294
1400 Ga0495613_0096472 3300046689 Bacteria 2138
1401 Ga0495613_0539877 3300046689 Bacteria 781
1402 Ga0495624_0075201 3300046690 Bacteria 2098
1403 Ga0495624_0199910 3300046690 Bacteria 1214
1404 Ga0495624_0706154 3300046690 Bacteria 598
1405 Ga0495670_0055508 3300046691 Bacteria 1986
1406 Ga0495670_0058872 3300046691 Bacteria 1928
1407 Ga0495670_0176563 3300046691 Bacteria 1126
1408 Ga0495671_0013941 3300046692 Bacteria 4335
1409 Ga0495671_0030234 3300046692 Bacteria 2775
1410 Ga0495671_0147806 3300046692 Bacteria 1144
1411 Ga0495649_0031220 3300046694 Bacteria 2938
1412 Ga0495649_0171518 3300046694 Bacteria 1135
1413 Ga0495649_0183630 3300046694 Bacteria 1090
1414 Ga0495649_0247873 3300046694 Bacteria 915
1415 Ga0495649_0584368 3300046694 Bacteria 552
1416 Ga0495589_0036165 3300046794 Bacteria 2476
1417 Ga0495589_0042640 3300046794 Bacteria 2261
1418 Ga0495589_0436546 3300046794 Bacteria 600
1419 Ga0495600_0003542 3300046809 Bacteria 9186
1420 Ga0495600_0010402 3300046809 Bacteria 5777
1421 Ga0495600_0017095 3300046809 Bacteria 4611
1422 Ga0495600_0051070 3300046809 Bacteria 2699
1423 Ga0495600_0350712 3300046809 Bacteria 924
1424 Ga0495660_0031126 3300046810 Bacteria 3002
1425 Ga0495660_0038922 3300046810 Bacteria 2642
1426 Ga0495581_0011118 3300047315 Bacteria 5201
1427 Ga0495581_0053853 3300047315 Bacteria 2323
1428 Ga0495581_0081771 3300047315 Bacteria 1870
1429 Ga0495581_0096503 3300047315 Bacteria 1716
1430 Ga0495604_0002351 3300047317 Bacteria 15156
1431 Ga0495604_0004817 3300047317 Bacteria 10702
1432 Ga0495604_0007383 3300047317 Bacteria 8710
1433 Ga0495604_0063067 3300047317 Bacteria 2828
1434 Ga0495604_0285633 3300047317 Bacteria 1113
1435 Ga0495636_0007700 3300047318 Bacteria 4236
1436 Ga0495636_0036875 3300047318 Bacteria 2018
1437 Ga0495636_0037499 3300047318 Bacteria 2002
1438 Ga0495636_0087387 3300047318 Bacteria 1349
1439 Ga0495674_0067245 3300047319 Bacteria 3105
1440 Ga0495674_0070922 3300047319 Bacteria 3010
1441 Ga0495674_0119479 3300047319 Bacteria 2227
1442 Ga0495674_0268767 3300047319 Bacteria 1400
1443 Ga0495674_0283155 3300047319 Bacteria 1358
1444 Ga0495672_0010127 3300047320 Bacteria 6743
1445 Ga0495672_0028030 3300047320 Bacteria 3570
1446 Ga0495676_0001590 3300047321 Bacteria 19706
1447 Ga0495676_0002415 3300047321 Bacteria 16590
1448 Ga0495676_0147379 3300047321 Bacteria 1679
1449 Ga0495676_0290392 3300047321 Bacteria 1105
1450 Ga0495680_0178410 3300047322 Bacteria 1534
1451 Ga0495680_0452211 3300047322 Bacteria 879
1452 Ga0495683_0000766 3300047323 Bacteria 23099
1453 Ga0495683_0021951 3300047323 Bacteria 3286
1454 Ga0495687_001147 3300047443 Bacteria 25643
1455 Ga0495687_003306 3300047443 Bacteria 11824
1456 Ga0495687_039955 3300047443 Bacteria 2071
1457 Ga0495687_140261 3300047443 Bacteria 841
1458 Ga0495675_0011687 3300047444 Bacteria 5512
1459 Ga0495675_0021916 3300047444 Bacteria 4070
1460 Ga0495675_0030965 3300047444 Bacteria 3414
1461 Ga0495675_0059587 3300047444 Bacteria 2420
1462 Ga0495675_0059974 3300047444 Bacteria 2412
1463 Ga0495675_0174278 3300047444 Bacteria 1320
1464 Ga0495675_0390066 3300047444 Bacteria 813
1465 Ga0495679_011002 3300047446 Bacteria 3519
1466 Ga0495685_001275 3300047447 Bacteria 7695
1467 Ga0495685_006034 3300047447 Bacteria 3959
1468 Ga0495685_081645 3300047447 Bacteria 1076
1469 Ga0495685_108302 3300047447 Bacteria 915
1470 Ga0495673_0000456 3300047469 Bacteria 44587
1471 Ga0495681_0003151 3300047470 Bacteria 11550
1472 Ga0495681_0020011 3300047470 Bacteria 3639
1473 Ga0495684_0123494 3300047471 Bacteria 1948
1474 Ga0495684_0157647 3300047471 Bacteria 1695
1475 Ga0495686_0000637 3300047472 Bacteria 48296
1476 Ga0495686_0063634 3300047472 Bacteria 2285
1477 Ga0495686_0232025 3300047472 Bacteria 1044
1478 Ga0495593_0001812 3300047673 Bacteria 12696
1479 Ga0495593_0055656 3300047673 Bacteria 2081
1480 Ga0495593_0346380 3300047673 Bacteria 742
1481 Ga0495602_0055166 3300048088 Bacteria 3501
1482 Ga0495602_0199002 3300048088 Bacteria 1530
1483 Ga0495602_0397105 3300048088 Bacteria 984
1484 Ga0495602_0518465 3300048088 Bacteria 830
1485 Ga0495602_0531111 3300048088 Bacteria 818
1486 Ga0495602_1102216 3300048088 Bacteria 520
1487 Ga0495614_0000229 3300048089 Bacteria 21780
1488 Ga0495614_0009446 3300048089 Bacteria 4311
1489 Ga0495614_0122938 3300048089 Bacteria 1145
1490 Ga0495626_0020580 3300048091 Bacteria 3285
1491 Ga0495626_0066961 3300048091 Bacteria 1623
1492 Ga0495626_0153541 3300048091 Bacteria 969
1493 Ga0496100_0000067 3300048903 Bacteria 58703
1494 Ga0496100_0000461 3300048903 Bacteria 19507
1495 Ga0496100_0004004 3300048903 Bacteria 7749
1496 Ga0496100_0004747 3300048903 Bacteria 7250
1497 Ga0496100_0007759 3300048903 Bacteria 5947
1498 Ga0496100_0096240 3300048903 Bacteria 2031
1499 Ga0496100_0148167 3300048903 Bacteria 1671
1500 Ga0496100_0249001 3300048903 Bacteria 1314
1501 Ga0496100_0295276 3300048903 Bacteria 1212
1502 Ga0496100_0449650 3300048903 Bacteria 987
1503 Ga0496100_0546531 3300048903 Bacteria 896
1504 Ga0496101_0000099 3300048904 Bacteria 90235
1505 Ga0496101_0000108 3300048904 Bacteria 86290
1506 Ga0496101_0000750 3300048904 Bacteria 19213
1507 Ga0496101_0000793 3300048904 Bacteria 18695
1508 Ga0496101_0015063 3300048904 Bacteria 5205
1509 Ga0496101_0098732 3300048904 Bacteria 2182
1510 Ga0496101_0112323 3300048904 Bacteria 2052
1511 Ga0496101_0162987 3300048904 Bacteria 1711
1512 Ga0496101_0768929 3300048904 Bacteria 760
1513 Ga0496101_0852392 3300048904 Bacteria 718
1514 Ga0496101_1140795 3300048904 Bacteria 612
1515 Ga0496102_0000005 3300048905 Bacteria 481937
1516 Ga0496102_0000390 3300048905 Bacteria 51759
1517 Ga0496102_0003032 3300048905 Bacteria 14221
1518 Ga0496102_0006978 3300048905 Bacteria 9635
1519 Ga0496102_0030945 3300048905 Bacteria 4794
1520 Ga0496102_0051773 3300048905 Bacteria 3740
1521 Ga0496102_0093526 3300048905 Bacteria 2785
1522 Ga0496102_0140005 3300048905 Bacteria 2268
1523 Ga0496102_0143275 3300048905 Bacteria 2241
1524 Ga0496102_0211602 3300048905 Bacteria 1828
1525 Ga0496102_0216993 3300048905 Bacteria 1803
1526 Ga0496102_0437293 3300048905 Bacteria 1228
1527 Ga0496102_0504239 3300048905 Bacteria 1132
1528 Ga0496102_1061507 3300048905 Bacteria 730
1529 Ga0496102_1595120 3300048905 Bacteria 571
1530 Ga0496103_0000002 3300048906 Bacteria 605387
1531 Ga0496103_0000116 3300048906 Bacteria 86969
1532 Ga0496103_0000663 3300048906 Bacteria 25925
1533 Ga0496103_0001688 3300048906 Bacteria 14442
1534 Ga0496103_0017503 3300048906 Bacteria 4290
1535 Ga0496103_0488755 3300048906 Bacteria 788
1536 Ga0496104_0007517 3300048907 Bacteria 9631
1537 Ga0496104_0011507 3300048907 Bacteria 7929
1538 Ga0496104_0044914 3300048907 Bacteria 4153
1539 Ga0496104_0046988 3300048907 Bacteria 4068
1540 Ga0496104_0659991 3300048907 Bacteria 955
1541 Ga0496104_1474620 3300048907 Bacteria 583
1542 Ga0496105_0064390 3300048908 Bacteria 3025
1543 Ga0496105_0176837 3300048908 Bacteria 1748
1544 Ga0496105_0327777 3300048908 Bacteria 1226
1545 Ga0496105_0501550 3300048908 Bacteria 953
1546 Ga0496105_0508548 3300048908 Bacteria 945
1547 Ga0496105_0953297 3300048908 Bacteria 644
1548 Ga0496106_0000424 3300048909 Bacteria 30065
1549 Ga0496106_0001149 3300048909 Bacteria 19609
1550 Ga0496106_0001741 3300048909 Bacteria 16250
1551 Ga0496106_0002018 3300048909 Bacteria 15276
1552 Ga0496106_0016794 3300048909 Bacteria 5415
1553 Ga0496106_0177217 3300048909 Bacteria 1691
1554 Ga0496106_0212106 3300048909 Bacteria 1543
1555 Ga0496106_0234277 3300048909 Bacteria 1466
1556 Ga0496106_0318636 3300048909 Bacteria 1248
1557 Ga0496106_0624970 3300048909 Bacteria 862
1558 Ga0496106_0846820 3300048909 Bacteria 724
1559 Ga0496106_1472165 3300048909 Bacteria 524
1560 Ga0496107_0000079 3300048910 Bacteria 46405
1561 Ga0496107_0000254 3300048910 Bacteria 28236
1562 Ga0496107_0014513 3300048910 Bacteria 5514
1563 Ga0496107_0214834 3300048910 Bacteria 1430
1564 Ga0496107_0247435 3300048910 Bacteria 1327
1565 Ga0496107_0275597 3300048910 Bacteria 1252
1566 Ga0496107_0706240 3300048910 Bacteria 741
1567 Ga0496108_0005688 3300048911 Bacteria 10091
1568 Ga0496108_0011641 3300048911 Bacteria 7156
1569 Ga0496108_0033237 3300048911 Bacteria 4285
1570 Ga0496108_0071519 3300048911 Bacteria 2927
1571 Ga0496108_0110258 3300048911 Bacteria 2353
1572 Ga0496108_0137681 3300048911 Bacteria 2102
1573 Ga0496108_0174780 3300048911 Bacteria 1859
1574 Ga0496108_0259237 3300048911 Bacteria 1513
1575 Ga0496108_0326318 3300048911 Bacteria 1338
1576 Ga0496108_1260981 3300048911 Bacteria 623
1577 Ga0496109_0000159 3300048912 Bacteria 66124
1578 Ga0496109_0002268 3300048912 Bacteria 15983
1579 Ga0496109_0010817 3300048912 Bacteria 7812
1580 Ga0496109_0023653 3300048912 Bacteria 5454
1581 Ga0496109_0038336 3300048912 Bacteria 4332
1582 Ga0496109_0182877 3300048912 Bacteria 1969
1583 Ga0496109_0418659 3300048912 Bacteria 1266
1584 Ga0496109_0608141 3300048912 Bacteria 1029
1585 Ga0496109_1250478 3300048912 Bacteria 679
1586 Ga0496109_1291365 3300048912 Bacteria 666
1587 Ga0496109_1468055 3300048912 Bacteria 617
1588 Ga0496110_0006109 3300048913 Bacteria 9492
1589 Ga0496110_0085523 3300048913 Bacteria 2815
1590 Ga0496110_0141431 3300048913 Bacteria 2176
1591 Ga0496110_0168926 3300048913 Bacteria 1984
1592 Ga0496110_0253450 3300048913 Bacteria 1602
1593 Ga0496110_0267707 3300048913 Bacteria 1556
1594 Ga0496110_0338005 3300048913 Bacteria 1372
1595 Ga0496110_0554183 3300048913 Bacteria 1045
1596 Ga0496110_1247954 3300048913 Bacteria 652
1597 Ga0496110_1524752 3300048913 Bacteria 578
1598 Ga0496110_1882754 3300048913 Bacteria 508
1599 Ga0496111_0022716 3300048914 Bacteria 4395
1600 Ga0496111_0196695 3300048914 Bacteria 1499
1601 Ga0496111_0298905 3300048914 Bacteria 1193
1602 Ga0496111_0852906 3300048914 Bacteria 657
1603 Ga0496112_0017534 3300048915 Bacteria 6729
1604 Ga0496112_0018053 3300048915 Bacteria 6639
1605 Ga0496112_0018650 3300048915 Bacteria 6539
1606 Ga0496112_0042682 3300048915 Bacteria 4438
1607 Ga0496112_0062477 3300048915 Bacteria 3673
1608 Ga0496112_0083572 3300048915 Bacteria 3158
1609 Ga0496112_0159776 3300048915 Bacteria 2220
1610 Ga0496112_0285554 3300048915 Bacteria 1596
1611 Ga0496112_1156227 3300048915 Bacteria 691
1612 Ga0496113_0001013 3300048916 Bacteria 15097
1613 Ga0496113_0021243 3300048916 Bacteria 4577
1614 Ga0496113_0295987 3300048916 Bacteria 1295
1615 Ga0496113_0356646 3300048916 Bacteria 1173
1616 Ga0496113_0674981 3300048916 Bacteria 826
1617 Ga0496113_0712255 3300048916 Bacteria 800
1618 Ga0496113_1437271 3300048916 Bacteria 533
1619 Ga0496114_0000116 3300048917 Bacteria 57632
1620 Ga0496114_0000711 3300048917 Bacteria 24724
1621 Ga0496114_0001235 3300048917 Bacteria 19335
1622 Ga0496114_0086311 3300048917 Bacteria 2659
1623 Ga0496114_0099480 3300048917 Bacteria 2481
1624 Ga0496114_0183417 3300048917 Bacteria 1828
1625 Ga0496114_0245998 3300048917 Bacteria 1573
1626 Ga0496114_0489472 3300048917 Bacteria 1088
1627 Ga0496114_0646605 3300048917 Bacteria 930
1628 Ga0496114_0818518 3300048917 Bacteria 810
1629 Ga0496115_0002425 3300048918 Bacteria 13379
1630 Ga0496115_0015061 3300048918 Bacteria 5861
1631 Ga0496115_0021113 3300048918 Bacteria 5026
1632 Ga0496115_0425739 3300048918 Bacteria 1075
1633 Ga0496115_1219552 3300048918 Bacteria 564
1634 Ga0496116_0000034 3300048919 Bacteria 409567
1635 Ga0496116_0001408 3300048919 Bacteria 27021
1636 Ga0496116_0002098 3300048919 Bacteria 21291
1637 Ga0496117_0000003 3300048920 Bacteria 1881097
1638 Ga0496117_0001155 3300048920 Bacteria 39752
1639 Ga0496117_0028583 3300048920 Bacteria 4315
1640 Ga0496117_0618140 3300048920 Bacteria 504
1641 Ga0496118_0000001 3300048921 Bacteria 1881100
1642 Ga0496118_0000165 3300048921 Bacteria 119376
1643 Ga0496118_0000348 3300048921 Bacteria 78668
1644 Ga0496118_0029623 3300048921 Bacteria 4586
1645 Ga0496119_0000669 3300048922 Bacteria 45985
1646 Ga0496119_0003552 3300048922 Bacteria 16090
1647 Ga0496119_0010241 3300048922 Bacteria 7906
1648 Ga0496119_0205331 3300048922 Bacteria 1017
1649 Ga0496119_0388086 3300048922 Bacteria 668
1650 Ga0496120_0000594 3300048923 Bacteria 54781
1651 Ga0496120_0002960 3300048923 Bacteria 16171
1652 Ga0496120_0009506 3300048923 Bacteria 6884
1653 Ga0496120_0027390 3300048923 Bacteria 3507
1654 Ga0496120_0265903 3300048923 Bacteria 799
1655 Ga0496120_0350103 3300048923 Bacteria 664
1656 Ga0496121_0000016 3300048924 Bacteria 562911
1657 Ga0496121_0001920 3300048924 Bacteria 33194
1658 Ga0496121_0003113 3300048924 Bacteria 23968
1659 Ga0496121_0785925 3300048924 Bacteria 561
1660 Ga0496122_0000284 3300048925 Bacteria 113244
1661 Ga0496122_0003418 3300048925 Bacteria 20891
1662 Ga0496122_0016911 3300048925 Bacteria 6855
1663 Ga0496122_0296743 3300048925 Bacteria 874
1664 Ga0496123_0003511 3300048926 Bacteria 17464
1665 Ga0496123_0008217 3300048926 Bacteria 9623
1666 Ga0496123_0024695 3300048926 Bacteria 4558
1667 Ga0496124_0000015 3300048927 Bacteria 460700
1668 Ga0496124_0238890 3300048927 Bacteria 1352
1669 Ga0496124_0252667 3300048927 Bacteria 1303
1670 Ga0496125_0000021 3300048928 Bacteria 460688
1671 Ga0496125_0037430 3300048928 Bacteria 4218
1672 Ga0496125_0094243 3300048928 Bacteria 2231
1673 Ga0496125_0274510 3300048928 Bacteria 1048
1674 Ga0496125_0448140 3300048928 Bacteria 740
1675 Ga0496125_0626679 3300048928 Bacteria 583
1676 Ga0496126_0000015 3300048929 Bacteria 663212
1677 Ga0496126_0000178 3300048929 Bacteria 145079
1678 Ga0496126_0000807 3300048929 Bacteria 56090
1679 Ga0496126_0003990 3300048929 Bacteria 18027
1680 Ga0496126_0012073 3300048929 Bacteria 8877
1681 Ga0496126_0029817 3300048929 Bacteria 5179
1682 Ga0496126_0038286 3300048929 Bacteria 4464
1683 Ga0496126_0258251 3300048929 Bacteria 1450
1684 Ga0496126_0594121 3300048929 Bacteria 873
1685 Ga0496126_0888023 3300048929 Bacteria 677
1686 Ga0501305_105422 3300049161 Bacteria 529
1687 Ga0495678_007860 3300049459 Bacteria 5478
1688 Ga0495682_0030079 3300049460 Bacteria 2010
1689 Ga0501031_0001068 3300049568 Bacteria 16636
1690 Ga0501031_0014602 3300049568 Bacteria 5106
1691 Ga0501031_0020290 3300049568 Bacteria 4333
1692 Ga0501031_0050342 3300049568 Bacteria 2714
1693 Ga0501031_0978008 3300049568 Bacteria 541
1694 Ga0501032_0000686 3300049569 Bacteria 27531
1695 Ga0501032_0001416 3300049569 Bacteria 19040
1696 Ga0501032_0003137 3300049569 Bacteria 12721
1697 Ga0501032_0018870 3300049569 Bacteria 4826
1698 Ga0501032_0050349 3300049569 Bacteria 2809
1699 Ga0501032_0343667 3300049569 Bacteria 961
1700 Ga0501032_0583938 3300049569 Bacteria 711
1701 Ga0501032_1057408 3300049569 Bacteria 509
1702 Ga0501033_0013223 3300049570 Bacteria 6288
1703 Ga0501033_0014277 3300049570 Bacteria 6036
1704 Ga0501033_0035727 3300049570 Bacteria 3725
1705 Ga0501033_0049148 3300049570 Bacteria 3131
1706 Ga0501033_0052208 3300049570 Bacteria 3030
1707 Ga0501033_0071252 3300049570 Bacteria 2553
1708 Ga0501033_0187722 3300049570 Bacteria 1480
1709 Ga0501033_0207894 3300049570 Bacteria 1396
1710 Ga0501034_0000700 3300049571 Bacteria 50894
1711 Ga0501034_0000987 3300049571 Bacteria 40823
1712 Ga0501034_0001101 3300049571 Bacteria 38016
1713 Ga0501034_0008658 3300049571 Bacteria 10734
1714 Ga0501034_0018578 3300049571 Bacteria 7127
1715 Ga0501034_0055651 3300049571 Bacteria 3980
1716 Ga0501034_0080810 3300049571 Bacteria 3254
1717 Ga0501034_0153981 3300049571 Bacteria 2274
1718 Ga0501034_0158112 3300049571 Bacteria 2239
1719 Ga0501034_0255631 3300049571 Bacteria 1696
1720 Ga0501034_0304551 3300049571 Bacteria 1529
1721 Ga0501034_0932102 3300049571 Bacteria 755
1722 Ga0501034_0975050 3300049571 Bacteria 732
1723 Ga0501036_0001560 3300049572 Bacteria 17694
1724 Ga0501036_0004005 3300049572 Bacteria 11846
1725 Ga0501036_0010187 3300049572 Bacteria 7746
1726 Ga0501036_0011832 3300049572 Bacteria 7234
1727 Ga0501036_0034998 3300049572 Bacteria 4248
1728 Ga0501036_0088645 3300049572 Bacteria 2614
1729 Ga0501036_0200542 3300049572 Bacteria 1678
1730 Ga0501036_0275877 3300049572 Bacteria 1407
1731 Ga0501036_1415193 3300049572 Bacteria 563
1732 Ga0501037_0000796 3300049573 Bacteria 23665
1733 Ga0501037_0001087 3300049573 Bacteria 20162
1734 Ga0501037_0003517 3300049573 Bacteria 11374
1735 Ga0501037_0020048 3300049573 Bacteria 4936
1736 Ga0501037_0073888 3300049573 Bacteria 2478
1737 Ga0501037_0143192 3300049573 Bacteria 1710
1738 Ga0501037_0410221 3300049573 Bacteria 928
1739 Ga0501037_0417484 3300049573 Bacteria 919
1740 Ga0501038_0001242 3300049574 Bacteria 23113
1741 Ga0501038_0021854 3300049574 Bacteria 5738
1742 Ga0501038_0022452 3300049574 Bacteria 5654
1743 Ga0501038_0022934 3300049574 Bacteria 5587
1744 Ga0501038_0128585 3300049574 Bacteria 2082
1745 Ga0501038_0229890 3300049574 Bacteria 1476
1746 Ga0501038_0235105 3300049574 Bacteria 1456
1747 Ga0501038_0680683 3300049574 Bacteria 772
1748 Ga0501039_0001950 3300049575 Bacteria 15298
1749 Ga0501039_0004622 3300049575 Bacteria 10408
1750 Ga0501039_0014245 3300049575 Bacteria 6088
1751 Ga0501039_0062350 3300049575 Bacteria 2888
1752 Ga0501039_0073151 3300049575 Bacteria 2663
1753 Ga0501039_0083420 3300049575 Bacteria 2489
1754 Ga0501039_0420405 3300049575 Bacteria 1050
1755 Ga0501039_0482092 3300049575 Bacteria 974
1756 Ga0501039_1502394 3300049575 Bacteria 518
1757 Ga0501040_0002076 3300049576 Bacteria 12897
1758 Ga0501040_0004277 3300049576 Bacteria 9287
1759 Ga0501040_0012616 3300049576 Bacteria 5541
1760 Ga0501040_0182649 3300049576 Bacteria 1487
1761 Ga0501040_0320419 3300049576 Bacteria 1109
1762 Ga0501041_0000883 3300049577 Bacteria 16205
1763 Ga0501041_0011660 3300049577 Bacteria 5201
1764 Ga0501041_0180918 3300049577 Bacteria 1320
1765 Ga0501042_0009170 3300049578 Bacteria 6579
1766 Ga0501042_0031635 3300049578 Bacteria 3743
1767 Ga0501042_0069336 3300049578 Bacteria 2521
1768 Ga0501043_0000867 3300049579 Bacteria 26805
1769 Ga0501043_0002585 3300049579 Bacteria 15295
1770 Ga0501043_0005384 3300049579 Bacteria 10336
1771 Ga0501043_0006178 3300049579 Bacteria 9623
1772 Ga0501043_0026492 3300049579 Bacteria 4547
1773 Ga0501043_0038502 3300049579 Bacteria 3759
1774 Ga0501043_0093226 3300049579 Bacteria 2368
1775 Ga0501043_0236408 3300049579 Bacteria 1410
1776 Ga0501043_0343251 3300049579 Bacteria 1135
1777 Ga0501043_0507562 3300049579 Bacteria 900
1778 Ga0501043_0584666 3300049579 Bacteria 826
1779 Ga0501046_0002722 3300049580 Bacteria 16457
1780 Ga0501046_0003795 3300049580 Bacteria 13830
1781 Ga0501046_0013539 3300049580 Bacteria 6901
1782 Ga0501046_0055300 3300049580 Bacteria 3120
1783 Ga0501046_0073322 3300049580 Bacteria 2657
1784 Ga0501047_0000216 3300049581 Bacteria 69275
1785 Ga0501047_0000544 3300049581 Bacteria 40681
1786 Ga0501047_0002484 3300049581 Bacteria 17594
1787 Ga0501047_0027108 3300049581 Bacteria 5519
1788 Ga0501047_0034178 3300049581 Bacteria 4909
1789 Ga0501047_0045820 3300049581 Bacteria 4227
1790 Ga0501047_0068246 3300049581 Bacteria 3425
1791 Ga0501047_0271380 3300049581 Bacteria 1542
1792 Ga0501047_0295297 3300049581 Bacteria 1464
1793 Ga0501047_0335490 3300049581 Bacteria 1350
1794 Ga0501047_0604000 3300049581 Bacteria 918
1795 Ga0501047_0771746 3300049581 Bacteria 777
1796 Ga0501047_1361502 3300049581 Bacteria 524
1797 Ga0501048_0002418 3300049582 Bacteria 14247
1798 Ga0501048_0002590 3300049582 Bacteria 13851
1799 Ga0501048_0003490 3300049582 Bacteria 11951
1800 Ga0501048_0199309 3300049582 Bacteria 1419
1801 Ga0501067_0002500 3300049583 Bacteria 10156
1802 Ga0501068_0000652 3300049584 Bacteria 17789
1803 Ga0501068_0192534 3300049584 Bacteria 1292
1804 Ga0501068_0872184 3300049584 Bacteria 592
1805 Ga0501068_1123447 3300049584 Bacteria 520
1806 Ga0501069_0005601 3300049585 Bacteria 6532
1807 Ga0501069_0012698 3300049585 Bacteria 4483
1808 Ga0501069_0165863 3300049585 Bacteria 1273
1809 Ga0501069_0238129 3300049585 Bacteria 1060
1810 Ga0501069_0532726 3300049585 Bacteria 702
1811 Ga0501069_0585736 3300049585 Bacteria 669
1812 Ga0501069_0945461 3300049585 Bacteria 525
1813 Ga0501070_0000456 3300049586 Bacteria 37018
1814 Ga0501070_0000766 3300049586 Bacteria 29273
1815 Ga0501070_0007603 3300049586 Bacteria 9201
1816 Ga0501070_0108283 3300049586 Bacteria 2296
1817 Ga0501070_0326560 3300049586 Bacteria 1247
1818 Ga0501070_0505795 3300049586 Bacteria 970
1819 Ga0501070_0600534 3300049586 Bacteria 877
1820 Ga0501070_0656884 3300049586 Bacteria 832
1821 Ga0501070_1493345 3300049586 Bacteria 511
1822 Ga0501071_0006265 3300049587 Bacteria 7718
1823 Ga0501071_0011659 3300049587 Bacteria 5933
1824 Ga0501072_0002534 3300049588 Bacteria 13689
1825 Ga0501072_0005287 3300049588 Bacteria 9832
1826 Ga0501072_0776204 3300049588 Bacteria 751
1827 Ga0501073_0055489 3300049589 Bacteria 2772
1828 Ga0501073_0057778 3300049589 Bacteria 2711
1829 Ga0501073_0073139 3300049589 Bacteria 2387
1830 Ga0501073_0137798 3300049589 Bacteria 1691
1831 Ga0501073_0224702 3300049589 Bacteria 1297
1832 Ga0501074_0006059 3300049590 Bacteria 8725
1833 Ga0501074_0006068 3300049590 Bacteria 8722
1834 Ga0501074_0199426 3300049590 Bacteria 1426
1835 Ga0501074_1138889 3300049590 Bacteria 548
1836 Ga0501075_0013356 3300049591 Bacteria 5860
1837 Ga0501076_0006709 3300049592 Bacteria 8350
1838 Ga0501076_0089498 3300049592 Bacteria 2474
1839 Ga0501076_1756910 3300049592 Bacteria 509
1840 Ga0501077_0015072 3300049593 Bacteria 4860
1841 Ga0501077_0129275 3300049593 Bacteria 1601
1842 Ga0501077_0184382 3300049593 Bacteria 1326
1843 Ga0501235_024973 3300049669 Bacteria 1336
1844 Ga0501225_0088809 3300049705 Bacteria 894
1845 Ga0501079_0023146 3300049741 Bacteria 4769
1846 Ga0501079_0029937 3300049741 Bacteria 4182
1847 Ga0501080_0015534 3300049742 Bacteria 7020
1848 Ga0501080_0053708 3300049742 Bacteria 3752
1849 Ga0501080_0056741 3300049742 Bacteria 3646
1850 Ga0501080_0114961 3300049742 Bacteria 2495
1851 Ga0501080_0191273 3300049742 Bacteria 1880
1852 Ga0501080_0691588 3300049742 Bacteria 900
1853 Ga0501080_0717311 3300049742 Bacteria 881
1854 Ga0501080_0974738 3300049742 Bacteria 736
1855 Ga0501081_0138955 3300049743 Bacteria 1740
1856 Ga0501081_0273584 3300049743 Bacteria 1236
1857 Ga0501081_0336567 3300049743 Bacteria 1111
1858 Ga0501081_0991854 3300049743 Bacteria 635
1859 Ga0501081_1435834 3300049743 Bacteria 524
1860 Ga0501083_0001307 3300049744 Bacteria 16868
1861 Ga0501083_0178532 3300049744 Bacteria 1387
1862 Ga0501266_088690 3300049763 Bacteria 534
1863 Ga0501282_003648 3300049778 Bacteria 1658
1864 Ga0501035_0000870 3300049822 Bacteria 32141
1865 Ga0501035_0001097 3300049822 Bacteria 28352
1866 Ga0501035_0001386 3300049822 Bacteria 24909
1867 Ga0501035_0004451 3300049822 Bacteria 13296
1868 Ga0501035_0010236 3300049822 Bacteria 8701
1869 Ga0501035_0018724 3300049822 Bacteria 6377
1870 Ga0501035_0020892 3300049822 Bacteria 6016
1871 Ga0501035_0090680 3300049822 Bacteria 2690
1872 Ga0501035_0101450 3300049822 Bacteria 2525
1873 Ga0501035_0179268 3300049822 Bacteria 1826
1874 Ga0501035_0429294 3300049822 Bacteria 1096
1875 Ga0501035_0753361 3300049822 Bacteria 781
1876 Ga0501044_0001367 3300049823 Bacteria 28613
1877 Ga0501044_0002317 3300049823 Bacteria 21701
1878 Ga0501044_0004810 3300049823 Bacteria 15100
1879 Ga0501044_0007119 3300049823 Bacteria 12303
1880 Ga0501044_0019900 3300049823 Bacteria 7169
1881 Ga0501044_0049478 3300049823 Bacteria 4338
1882 Ga0501044_0053350 3300049823 Bacteria 4159
1883 Ga0501044_0086075 3300049823 Bacteria 3175
1884 Ga0501044_0102858 3300049823 Bacteria 2871
1885 Ga0501044_0104234 3300049823 Bacteria 2850
1886 Ga0501044_0121019 3300049823 Bacteria 2618
1887 Ga0501044_0160265 3300049823 Bacteria 2227
1888 Ga0501044_0197226 3300049823 Bacteria 1972
1889 Ga0501044_0357273 3300049823 Bacteria 1379
1890 Ga0501044_0516620 3300049823 Bacteria 1094
1891 Ga0501044_0604048 3300049823 Bacteria 990
1892 Ga0501045_0003212 3300049824 Bacteria 11175
1893 Ga0501045_0016064 3300049824 Bacteria 5311
1894 Ga0501045_0099953 3300049824 Bacteria 2147
1895 Ga0501045_0781291 3300049824 Bacteria 703
1896 Ga0501045_1393037 3300049824 Bacteria 509
1897 Ga0501212_039845 3300049851 Bacteria 775
1898 nmdc:mga03683_109749_c1 3300050489 Bacteria 1219
1899 nmdc:mga03683_196946_c1 3300050489 Bacteria 923
1900 nmdc:mga03683_21413_c1 3300050489 Bacteria 2492
1901 nmdc:mga03683_255613_c1 3300050489 Bacteria 814
1902 nmdc:mga03683_317642_c1 3300050489 Bacteria 733
1903 nmdc:mga03683_49387_c1 3300050489 Bacteria 1751
1904 nmdc:mga03n38_102027_c1 3300050490 Bacteria 1385
1905 nmdc:mga03n38_104021_c1 3300050490 Bacteria 1373
1906 nmdc:mga03n38_107_c1 3300050490 Bacteria 17345
1907 nmdc:mga03n38_109159_c1 3300050490 Bacteria 1345
1908 nmdc:mga03n38_133580_c1 3300050490 Bacteria 1232
1909 nmdc:mga03n38_135101_c1 3300050490 Bacteria 1226
1910 nmdc:mga03n38_138478_c1 3300050490 Bacteria 1213
1911 nmdc:mga03n38_213599_c1 3300050490 Bacteria 1004
1912 nmdc:mga03n38_2914_c1 3300050490 Bacteria 5393
1913 nmdc:mga03n38_298421_c1 3300050490 Bacteria 865
1914 nmdc:mga03n38_32904_c1 3300050490 Bacteria 2201
1915 nmdc:mga03n38_33091_c1 3300050490 Bacteria 2196
1916 nmdc:mga03n38_336384_c1 3300050490 Bacteria 819
1917 nmdc:mga03n38_349407_c1 3300050490 Bacteria 804
1918 nmdc:mga03n38_483979_c1 3300050490 Bacteria 692
1919 nmdc:mga03n38_5259_c1 3300050490 Bacteria 4389
1920 nmdc:mga03n38_538692_c1 3300050490 Bacteria 659
1921 nmdc:mga03n38_89173_c1 3300050490 Bacteria 1465
1922 nmdc:mga03n38_94257_c1 3300050490 Bacteria 1432
1923 nmdc:mga00v17_108812_c1 3300050491 Bacteria 1756
1924 nmdc:mga00v17_11148_c1 3300050491 Bacteria 4934
1925 nmdc:mga00v17_112072_c1 3300050491 Bacteria 1731
1926 nmdc:mga00v17_117929_c1 3300050491 Bacteria 1688
1927 nmdc:mga00v17_158503_c1 3300050491 Bacteria 1456
1928 nmdc:mga00v17_18215_c1 3300050491 Bacteria 3984
1929 nmdc:mga00v17_214437_c1 3300050491 Bacteria 1246
1930 nmdc:mga00v17_2226_c1 3300050491 Bacteria 9956
1931 nmdc:mga00v17_235637_c1 3300050491 Bacteria 1186
1932 nmdc:mga00v17_260368_c1 3300050491 Bacteria 1125
1933 nmdc:mga00v17_279242_c1 3300050491 Bacteria 1084
1934 nmdc:mga00v17_293564_c1 3300050491 Bacteria 1056
1935 nmdc:mga00v17_329288_c1 3300050491 Bacteria 992
1936 nmdc:mga00v17_45291_c1 3300050491 Bacteria 2657
1937 nmdc:mga00v17_541992_c1 3300050491 Bacteria 753
1938 nmdc:mga00v17_653229_c1 3300050491 Bacteria 676
1939 nmdc:mga00v17_742439_c1 3300050491 Bacteria 628
1940 nmdc:mga00v17_97638_c1 3300050491 Bacteria 1852
1941 nmdc:mga0yw44_22775_c1 3300050492 Bacteria 3518
1942 nmdc:mga0yw44_242484_c1 3300050492 Bacteria 1198
1943 nmdc:mga0yw44_2716_c1 3300050492 Bacteria 7644
1944 nmdc:mga0yw44_290519_c1 3300050492 Bacteria 1094
1945 nmdc:mga0yw44_35428_c1 3300050492 Bacteria 2933
1946 nmdc:mga0yw44_448239_c1 3300050492 Bacteria 874
1947 nmdc:mga0yw44_480209_c1 3300050492 Bacteria 843
1948 nmdc:mga0yw44_61750_c1 3300050492 Bacteria 2300
1949 nmdc:mga0yw44_622061_c1 3300050492 Bacteria 734
1950 nmdc:mga0yw44_659728_c1 3300050492 Bacteria 711
1951 nmdc:mga0yw44_739956_c1 3300050492 Bacteria 668
1952 nmdc:mga0yw44_756391_c1 3300050492 Bacteria 660
1953 nmdc:mga0yw44_826811_c1 3300050492 Bacteria 629
1954 nmdc:mga0yw44_99428_c1 3300050492 Bacteria 1851
1955 nmdc:mga06z11_100757_c1 3300050494 Bacteria 1584
1956 nmdc:mga06z11_241786_c1 3300050494 Bacteria 1060
1957 nmdc:mga06z11_31001_c1 3300050494 Bacteria 2593
1958 nmdc:mga06z11_464827_c1 3300050494 Bacteria 765
1959 nmdc:mga06z11_515432_c1 3300050494 Bacteria 725
1960 nmdc:mga06z11_528606_c1 3300050494 Bacteria 715
1961 nmdc:mga06z11_533_c1 3300050494 Bacteria 14010
1962 nmdc:mga06z11_920561_c1 3300050494 Bacteria 533
1963 nmdc:mga04h51_195285_c1 3300050495 Bacteria 793
1964 nmdc:mga04h51_23177_c1 3300050495 Bacteria 1888
1965 nmdc:mga07m45_116413_c1 3300050496 Bacteria 1542
1966 nmdc:mga07m45_14311_c1 3300050496 Bacteria 4223
1967 nmdc:mga07m45_161483_c1 3300050496 Bacteria 1301
1968 nmdc:mga07m45_298273_c1 3300050496 Bacteria 937
1969 nmdc:mga07m45_45821_c1 3300050496 Bacteria 2456
1970 nmdc:mga07m45_70843_c1 3300050496 Bacteria 1983
1971 nmdc:mga07m45_83179_c1 3300050496 Bacteria 1829
1972 nmdc:mga05p37_15340_c1 3300050507 Bacteria 9205
1973 nmdc:mga05p37_86594_c1 3300050507 Bacteria 3861
1974 nmdc:mga09592_684227_c1 3300050508 Bacteria 874
1975 nmdc:mga0qj67_73761_c1 3300050509 Bacteria 2726
1976 nmdc:mga0qj67_86419_c1 3300050509 Bacteria 2516
1977 nmdc:mga08y16_1386578_c1 3300050511 Bacteria 667
1978 nmdc:mga08y16_1621178_c1 3300050511 Bacteria 604
1979 nmdc:mga08y16_760492_c1 3300050511 Bacteria 964
1980 nmdc:mga0a205_235559_c1 3300050515 Bacteria 1712
1981 nmdc:mga0sz30_105066_c1 3300050516 Bacteria 1235
1982 nmdc:mga0sz30_114790_c1 3300050516 Bacteria 1181
1983 nmdc:mga0sz30_214035_c1 3300050516 Bacteria 856
1984 nmdc:mga0sz30_21480_c1 3300050516 Bacteria 2613
1985 nmdc:mga0sz30_247555_c1 3300050516 Bacteria 793
1986 nmdc:mga0sz30_25097_c1 3300050516 Bacteria 2437
1987 nmdc:mga0sz30_338778_c1 3300050516 Bacteria 672
1988 nmdc:mga0sz30_358061_c1 3300050516 Bacteria 652
1989 nmdc:mga0sz30_38126_c1 3300050516 Bacteria 1599
1990 nmdc:mga0sz30_38437_c1 3300050516 Bacteria 2005
1991 nmdc:mga0sz30_395087_c1 3300050516 Bacteria 619
1992 nmdc:mga0sz30_451939_c1 3300050516 Bacteria 577
1993 nmdc:mga0sz30_465596_c1 3300050516 Bacteria 568
1994 nmdc:mga0sz30_62206_c2 3300050516 Bacteria 620
1995 nmdc:mga0sz30_70896_c1 3300050516 Bacteria 1500
1996 Ga0495601_0026650 3300053077 Bacteria 3570
1997 Ga0495601_0038926 3300053077 Bacteria 2975
1998 Ga0495601_0073237 3300053077 Bacteria 2189
1999 Ga0495612_0005779 3300053078 Bacteria 5107
2000 Ga0495612_0087117 3300053078 Bacteria 1318
2001 Ga0500610_0011119 3300053079 Bacteria 4084
2002 Ga0500610_0147176 3300053079 Bacteria 1184
2003 Ga0500610_0284705 3300053079 Bacteria 739
2004 Ga0500635_0465480 3300053080 Bacteria 501
2005 Ga0495655_0093937 3300053083 Bacteria 878
2006 Ga0495655_0324614 3300053083 Bacteria 534
2007 Ga0495655_0367919 3300053083 Bacteria 506
2008 Ga0495595_0407764 3300053084 Bacteria 689
2009 Ga0495619_0007645 3300053085 Bacteria 6842
2010 Ga0495619_0133108 3300053085 Bacteria 1709
2011 Ga0495619_0209860 3300053085 Bacteria 1349
2012 Ga0495619_0772303 3300053085 Bacteria 651
2013 Ga0500578_0185326 3300053086 Bacteria 1281
2014 Ga0500578_0250628 3300053086 Bacteria 1067
2015 Ga0500578_0361070 3300053086 Bacteria 846
2016 Ga0500643_004993 3300053087 Bacteria 5826
2017 Ga0500643_034977 3300053087 Bacteria 1510
2018 Ga0500643_040244 3300053087 Bacteria 1377
2019 Ga0500643_042530 3300053087 Bacteria 1329
2020 Ga0500581_203034 3300053089 Bacteria 878
2021 Ga0500583_0211859 3300053092 Bacteria 962
2022 Ga0500583_0318492 3300053092 Bacteria 759
2023 Ga0500651_0722005 3300053093 Bacteria 531
2024 Ga0500566_0114405 3300053094 Bacteria 1462
2025 Ga0500640_000199 3300053095 Bacteria 12879
2026 Ga0500641_0119258 3300053096 Bacteria 1137
2027 Ga0500650_0052766 3300053098 Bacteria 1891
2028 Ga0500654_032949 3300053099 Bacteria 3082
2029 Ga0500654_187819 3300053099 Bacteria 646
2030 Ga0500553_034430 3300053101 Bacteria 2517
2031 Ga0500556_0025034 3300053104 Bacteria 1967
2032 Ga0500556_0115219 3300053104 Bacteria 1045
2033 Ga0500558_214684 3300053106 Bacteria 659
2034 Ga0500560_000605 3300053107 Bacteria 5226
2035 Ga0500560_015926 3300053107 Bacteria 2041
2036 Ga0500560_042009 3300053107 Bacteria 1438
2037 Ga0500562_037695 3300053108 Bacteria 1283
2038 Ga0500562_163035 3300053108 Bacteria 606
2039 Ga0500569_000808 3300053109 Bacteria 5512
2040 Ga0500572_027614 3300053111 Bacteria 1556
2041 Ga0500572_259794 3300053111 Bacteria 564
2042 Ga0500594_0187516 3300053118 Bacteria 676
2043 Ga0500595_063465 3300053119 Bacteria 1110
2044 Ga0500608_054416 3300053122 Bacteria 1920
2045 Ga0500614_041281 3300053123 Bacteria 1174
2046 Ga0500618_152749 3300053125 Bacteria 527
2047 Ga0500621_029543 3300053126 Bacteria 2170
2048 Ga0500628_004395 3300053129 Bacteria 2334
2049 Ga0500628_030134 3300053129 Bacteria 1171
2050 Ga0500652_001721 3300053131 Bacteria 6627
2051 Ga0500652_010700 3300053131 Bacteria 3154
2052 Ga0500652_176044 3300053131 Bacteria 878
2053 Ga0500652_269688 3300053131 Bacteria 668
2054 Ga0500655_055522 3300053133 Bacteria 793
2055 Ga0500658_0021304 3300053134 Bacteria 2453
2056 Ga0500559_0146159 3300053136 Bacteria 1109
2057 Ga0500559_0193688 3300053136 Bacteria 958
2058 Ga0500559_0529806 3300053136 Bacteria 539
2059 Ga0500561_0000789 3300053137 Bacteria 5034
2060 Ga0500573_0005248 3300053140 Bacteria 6925
2061 Ga0500573_0024372 3300053140 Bacteria 3479
2062 Ga0500573_0052240 3300053140 Bacteria 2350
2063 Ga0500573_0446074 3300053140 Bacteria 599
2064 Ga0500579_044854 3300053143 Bacteria 2751
2065 Ga0500586_026498 3300053145 Bacteria 1878
2066 Ga0500586_198010 3300053145 Bacteria 661
2067 Ga0500588_0035717 3300053146 Bacteria 1465
2068 Ga0500588_0306182 3300053146 Bacteria 602
2069 Ga0500600_0022759 3300053149 Bacteria 3748
2070 Ga0500603_037368 3300053150 Bacteria 1281
2071 Ga0500616_0041089 3300053153 Bacteria 2483
2072 Ga0500616_0055332 3300053153 Bacteria 2075
2073 Ga0500616_0141584 3300053153 Bacteria 1123
2074 Ga0500620_283881 3300053155 Bacteria 541
2075 Ga0500627_0085476 3300053158 Bacteria 1409
2076 Ga0500633_0022892 3300053160 Bacteria 1920
2077 Ga0500633_0254976 3300053160 Bacteria 651
2078 Ga0500634_0039494 3300053161 Bacteria 2564
2079 Ga0500634_0134890 3300053161 Bacteria 1179
2080 Ga0500645_000032 3300053730 Bacteria 119506
2081 Ga0500645_172225 3300053730 Bacteria 591
2082 Ga0500656_030485 3300053732 Bacteria 715
2083 Ga0500587_003192 3300053739 Bacteria 2308
2084 Ga0501084_0001814 3300054114 Bacteria 17044
2085 Ga0501084_0025061 3300054114 Bacteria 4977
2086 Ga0587073_0223576 3300059492 Bacteria 577
2087 Ga0587080_095102 3300059503 Bacteria 630
2088 Ga0587083_0054650 3300059505 Bacteria 881
2089 Ga0587099_061417 3300059622 Bacteria 519
2090 Ga0587122_008489 3300059628 Bacteria 932
2091 Ga0587067_042151 3300059640 Bacteria 891
2092 Ga0587069_121145 3300059642 Bacteria 555
2093 Ga0587114_057507 3300059655 Bacteria 674
2094 Ga0501082_0003705 3300060353 Bacteria 13353
2095 Ga0501082_0104495 3300060353 Bacteria 2450
2096 Ga0466962_0000056 3300061719 Bacteria 46579
2097 Ga0466962_0000729 3300061719 Bacteria 14725
2098 Ga0466962_0003557 3300061719 Bacteria 7420
2099 Ga0466962_0007132 3300061719 Bacteria 5352
2100 Ga0466962_0017444 3300061719 Bacteria 3456
2101 Ga0466962_0086224 3300061719 Bacteria 1503
2102 Ga0466962_0434474 3300061719 Bacteria 660
2103 Ga0530510_0034383 3300061734 Bacteria 3651

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009147 Ga0114129_10265638 Ga0114129_102656384 87
2 3300039450 Ga0436363_1331240 Ga0436363_1331240_11_277 88
3 3300050492 nmdc:mga0yw44_242484_c1 nmdc:mga0yw44_242484_c1_900_1166 88
4 iso_pu_bacteria 2868088558 2868090607 88
5 3300009177 Ga0105248_12344186 Ga0105248_123441862 91
6 3300014969 Ga0157376_12606991 Ga0157376_126069911 91
7 3300041458 Ga0451798_1003370 Ga0451798_1003370_185_484 91
8 3300046664 Ga0495659_0562685 Ga0495659_0562685_206_481 91
9 3300048904 Ga0496101_0852392 Ga0496101_0852392_62_337 91
10 3300048909 Ga0496106_0624970 Ga0496106_0624970_452_727 91
11 3300050516 nmdc:mga0sz30_338778_c1 nmdc:mga0sz30_338778_c1_45_320 91
12 3300049743 Ga0501081_1435834 Ga0501081_1435834_84_389 93
13 3300031728 Ga0316578_10695755 Ga0316578_106957552 94
14 iso_pu_bacteria 2523231044 2523384142 95
15 iso_pu_bacteria 2547132111 2547410063 95
16 iso_pu_bacteria 2551306166 2552108214 95
17 iso_pu_bacteria 2554235005 2554256882 95
18 iso_pu_bacteria 2565956761 2566996612 95
19 iso_pu_bacteria 2582581312 2585299419 95
20 iso_pu_bacteria 2582581313 2585308196 95
21 iso_pu_bacteria 2582581314 2585319180 95
22 iso_pu_bacteria 2616644814 2616696887 95
23 iso_pu_bacteria 2616644941 2616902026 95
24 iso_pu_bacteria 2643221548 2643764858 95
25 iso_pu_bacteria 2643221578 2643902801 95
26 iso_pu_bacteria 2643221587 2643942076 95
27 iso_pu_bacteria 2643221601 2644017240 95
28 iso_pu_bacteria 2643221631 2644173799 95
29 iso_pu_bacteria 2643221647 2644261701 95
30 iso_pu_bacteria 2643221670 2644389735 95
31 iso_pu_bacteria 2643221673 2644404690 95
32 iso_pu_bacteria 2643221677 2644429159 95
33 iso_pu_bacteria 2643221678 2644439224 95
34 iso_pu_bacteria 2643221682 2644461302 95
35 iso_pu_bacteria 2643221687 2644489447 95
36 iso_pu_bacteria 2643221692 2644516043 95
37 iso_pu_bacteria 2643221714 2644633411 95
38 iso_pu_bacteria 2643221715 2644636251 95
39 iso_pu_bacteria 2731639228 2731908880 95
40 iso_pu_bacteria 2738541264 2738667089 95
41 iso_pu_bacteria 2738541274 2738708748 95
42 iso_pu_bacteria 2738541308 2738891350 95
43 iso_pu_bacteria 2738541356 2739145933 95
44 iso_pu_bacteria 2738543005 2739205425 95
45 iso_pu_bacteria 2744054611 2744957629 95
46 iso_pu_bacteria 2751185725 2753037133 95
47 iso_pu_bacteria 2751185792 2753325002 95
48 iso_pu_bacteria 2767802112 2768643405 95
49 iso_pu_bacteria 2784132148 2784589629 95
50 iso_pu_bacteria 2784746763 2785341974 95
51 iso_pu_bacteria 2784746768 2785370673 95
52 iso_pu_bacteria 2786546132 2786671856 95
53 iso_pu_bacteria 2791355406 2793980307 95
54 iso_pu_bacteria 2799112218 2799186689 95
55 iso_pu_bacteria 2808606359 2808843229 95
56 iso_pu_bacteria 2808606375 2808912818 95
57 iso_pu_bacteria 2808606375 2808921578 95
58 iso_pu_bacteria 2808606448 2809233309 95
59 iso_pu_bacteria 2808606982 2811845196 95
60 iso_pu_bacteria 2811994879 2812356819 95
61 iso_pu_bacteria 2811994917 2812479534 95
62 iso_pu_bacteria 2818991463 2819695309 95
63 iso_pu_bacteria 2842134933 2842138795 95
64 iso_pu_bacteria 2842888712 2842891061 95
65 iso_pu_bacteria 2852635781 2852640433 95
66 iso_pu_bacteria 2862178590 2862181685 95
67 iso_pu_bacteria 2862281513 2862286758 95
68 iso_pu_bacteria 2862290372 2862292195 95
69 iso_pu_bacteria 2862382967 2862387714 95
70 iso_pu_bacteria 2862507626 2862514387 95
71 iso_pu_bacteria 2862574272 2862578278 95
72 iso_pu_bacteria 2863404153 2863411665 95
73 iso_pu_bacteria 2867428634 2867434711 95
74 iso_pu_bacteria 2867475112 2867479144 95
75 iso_pu_bacteria 2873151551 2873154776 95
76 iso_pu_bacteria 2877676314 2877679915 95
77 iso_pu_bacteria 2902792274 2902798010 95
78 iso_pu_bacteria 2902792274 2902799094 95
79 iso_pu_bacteria 2902799365 2902804392 95
80 iso_pu_bacteria 2902810491 2902812375 95
81 iso_pu_bacteria 2902810491 2902815770 95
82 iso_pu_bacteria 2902837492 2902842212 95
83 iso_pu_bacteria 2904535858 2904539130 95
84 iso_pu_bacteria 2912715099 2912718561 95
85 iso_pu_bacteria 2912757875 2912762042 95
86 iso_pu_bacteria 2918501144 2918505723 95
87 iso_pu_bacteria 2919468124 2919475444 95
88 iso_pu_bacteria 2922554459 2922555798 95
89 iso_pu_bacteria 2928142448 2928144860 95
90 iso_pu_bacteria 2929212328 2929214382 95
91 iso_pu_bacteria 2935390628 2935394868 95
92 iso_pu_bacteria 2939582691 2939586269 95
93 iso_pu_bacteria 2946045630 2946048700 95
94 iso_pu_bacteria 2946064051 2946069053 95
95 iso_pu_bacteria 2946072368 2946077000 95
96 iso_pu_bacteria 2947224130 2947227885 95
97 iso_pu_bacteria 2954002825 2954003032 95
98 iso_pu_bacteria 2954380949 2954384870 95
99 iso_pu_bacteria 2954673503 2954678133 95
100 iso_pu_bacteria 2954682443 2954686025 95
101 iso_pu_bacteria 2954691527 2954695683 95
102 iso_pu_bacteria 2954701450 2954710876 95
103 iso_pu_bacteria 2954711539 2954715099 95
104 iso_pu_bacteria 2954721474 2954725041 95
105 iso_pu_bacteria 2954731030 2954736777 95
106 iso_pu_bacteria 2954740390 2954743974 95
107 iso_pu_bacteria 2954749733 2954755624 95
108 iso_pu_bacteria 2954759201 2954762914 95
109 iso_pu_bacteria 2966598605 2966601543 95
110 iso_pu_bacteria 2974315732 2974319892 95
111 iso_pu_bacteria 2984523437 2984523764 95
112 iso_pu_bacteria 2990044586 2990045362 95
113 iso_pu_bacteria 2990059506 2990062205 95
114 iso_pu_bacteria 2995463766 2995468636 95
115 iso_pu_bacteria 2997451912 2997458156 95
116 iso_pu_bacteria 2997600082 2997606378 95
117 iso_pu_bacteria 3001889506 3001890491 95
118 iso_pu_bacteria 3006321560 3006326300 95
119 iso_pu_bacteria 3006393351 3006393465 95
120 iso_pu_bacteria 3006486233 3006492632 95
121 iso_pu_bacteria 3006493962 3006499677 95
122 iso_pu_bacteria 8008558824 8008566438 95
123 iso_pu_bacteria 8008574985 8008577889 95
124 iso_pu_bacteria 8023623736 8023626424 95
125 iso_pu_bacteria 8025478263 8025484836 95
126 iso_pu_bacteria 8025530807 8025534831 95
127 iso_pu_bacteria 8033684223 8033689151 95
128 iso_pu_bacteria 8047710418 8047719891 95
129 iso_pu_bacteria 8047893842 8047897061 95
130 iso_pu_bacteria 8048127548 8048134681 95
131 iso_pu_bacteria 8048356638 8048361891 95
132 iso_pu_bacteria 8048369669 8048374045 95
133 iso_pu_bacteria 8048379754 8048384181 95
134 iso_pu_bacteria 8048406513 8048410734 95
135 iso_pu_bacteria 8053945823 8053948525 95
136 iso_pu_bacteria 8054160619 8054160729 95
137 iso_pu_bacteria 8056447290 8056448877 95
138 iso_pu_bacteria 8056667051 8056667953 95
139 iso_pu_bacteria 8056829672 8056833872 95
140 3300031995 Ga0307409_102087345 Ga0307409_1020873452 96
141 3300041443 Ga0451789_0982272 Ga0451789_0982272_129_419 96
142 3300045976 Ga0466967_0039775 Ga0466967_0039775_709_999 96
143 3300048903 Ga0496100_0295276 Ga0496100_0295276_195_485 96
144 3300048913 Ga0496110_0267707 Ga0496110_0267707_1217_1507 96
145 3300049568 Ga0501031_0050342 Ga0501031_0050342_2020_2310 96
146 3300049572 Ga0501036_0011832 Ga0501036_0011832_6559_6849 96
147 3300049574 Ga0501038_0021854 Ga0501038_0021854_2889_3179 96
148 3300049575 Ga0501039_0073151 Ga0501039_0073151_1829_2119 96
149 3300049576 Ga0501040_0004277 Ga0501040_0004277_6356_6646 96
150 3300049576 Ga0501040_0320419 Ga0501040_0320419_370_660 96
151 3300049577 Ga0501041_0011660 Ga0501041_0011660_326_616 96
152 3300049578 Ga0501042_0031635 Ga0501042_0031635_3342_3632 96
153 3300049579 Ga0501043_0093226 Ga0501043_0093226_1661_1951 96
154 3300049580 Ga0501046_0055300 Ga0501046_0055300_2339_2629 96
155 3300049586 Ga0501070_0600534 Ga0501070_0600534_192_482 96
156 3300049587 Ga0501071_0011659 Ga0501071_0011659_2190_2480 96
157 3300049588 Ga0501072_0005287 Ga0501072_0005287_1767_2057 96
158 3300049590 Ga0501074_0199426 Ga0501074_0199426_326_616 96
159 3300049591 Ga0501075_0013356 Ga0501075_0013356_2933_3223 96
160 3300049592 Ga0501076_0089498 Ga0501076_0089498_1668_1958 96
161 3300049593 Ga0501077_0129275 Ga0501077_0129275_693_983 96
162 3300049741 Ga0501079_0029937 Ga0501079_0029937_1877_2167 96
163 3300049742 Ga0501080_0056741 Ga0501080_0056741_1246_1536 96
164 3300049743 Ga0501081_0138955 Ga0501081_0138955_1371_1661 96
165 3300049743 Ga0501081_0273584 Ga0501081_0273584_47_337 96
166 3300049743 Ga0501081_0991854 Ga0501081_0991854_256_546 96
167 3300049824 Ga0501045_0016064 Ga0501045_0016064_4179_4469 96
168 3300049851 Ga0501212_039845 Ga0501212_039845_26_316 96
169 3300054114 Ga0501084_0025061 Ga0501084_0025061_2597_2887 96
170 3300060353 Ga0501082_0104495 Ga0501082_0104495_1979_2269 96
171 3300003354 JGI25160J50197_1096305 JGI25160J50197_10963051 97
172 3300005718 Ga0068866_10533620 Ga0068866_105336202 97
173 3300013104 Ga0157370_11388264 Ga0157370_113882641 97
174 3300030745 Ga0316182_1311333 Ga0316182_13113331 97
175 3300005341 Ga0070691_11041401 Ga0070691_110414011 98
176 3300031727 Ga0316576_10069280 Ga0316576_100692802 98
177 3300031728 Ga0316578_10007838 Ga0316578_100078385 98
178 3300031728 Ga0316578_10155229 Ga0316578_101552292 98
179 3300031733 Ga0316577_10196594 Ga0316577_101965942 98
180 3300031852 Ga0307410_10097846 Ga0307410_100978461 98
181 3300032005 Ga0307411_10196819 Ga0307411_101968192 98
182 3300032126 Ga0307415_100940326 Ga0307415_1009403262 98
183 3300032137 Ga0316585_10026058 Ga0316585_100260584 98
184 3300032137 Ga0316585_10140083 Ga0316585_101400832 98
185 3300032139 Ga0316580_10179792 Ga0316580_101797922 98
186 3300032139 Ga0316580_10284486 Ga0316580_102844861 98
187 3300032168 Ga0316593_10251358 Ga0316593_102513581 98
188 3300033541 Ga0316596_1054270 Ga0316596_10542702 98
189 3300035398 Ga0316574_0122232 Ga0316574_0122232_826_1137 98
190 3300036647 Ga0316582_0204345 Ga0316582_0204345_112_423 98
191 3300036647 Ga0316582_0430407 Ga0316582_0430407_279_590 98
192 3300036712 Ga0316584_0086906 Ga0316584_0086906_956_1267 98
193 3300036712 Ga0316584_0421280 Ga0316584_0421280_216_527 98
194 3300041441 Ga0451787_711011 Ga0451787_711011_73_372 98
195 3300046664 Ga0495659_0219554 Ga0495659_0219554_260_556 98
196 3300000546 LJNas_1001325 LJNas_10013252 99
197 3300001989 JGI24739J22299_10017756 JGI24739J22299_100177562 99
198 3300001990 JGI24737J22298_10020298 JGI24737J22298_100202982 99
199 3300001991 JGI24743J22301_10007900 JGI24743J22301_100079001 99
200 3300002070 JGI24750J21931_1001262 JGI24750J21931_10012622 99
201 3300002070 JGI24750J21931_1025756 JGI24750J21931_10257562 99
202 3300002073 JGI24745J21846_1004116 JGI24745J21846_10041162 99
203 3300002074 JGI24748J21848_1003666 JGI24748J21848_10036664 99
204 3300002075 JGI24738J21930_10004342 JGI24738J21930_100043422 99
205 3300002076 JGI24749J21850_1003699 JGI24749J21850_10036992 99
206 3300002077 JGI24744J21845_10000088 JGI24744J21845_1000008813 99
207 3300002077 JGI24744J21845_10002005 JGI24744J21845_100020055 99
208 3300002077 JGI24744J21845_10002298 JGI24744J21845_100022983 99
209 3300002239 JGI24034J26672_10035846 JGI24034J26672_100358462 99
210 3300002244 JGI24742J22300_10000958 JGI24742J22300_100009585 99
211 3300002244 JGI24742J22300_10028088 JGI24742J22300_100280882 99
212 3300002459 JGI24751J29686_10037569 JGI24751J29686_100375691 99
213 3300003215 JGI25153J46596_10083828 JGI25153J46596_100838282 99
214 3300003316 rootH1_10017056 rootH1_100170562 99
215 3300003320 rootH2_10032831 rootH2_100328313 99
216 3300003322 rootL2_10002375 rootL2_100023753 99
217 3300003323 rootH1_10061150 rootH1_100611502 99
218 3300003354 JGI25160J50197_1015644 JGI25160J50197_10156442 99
219 3300003354 JGI25160J50197_1022123 JGI25160J50197_10221231 99
220 3300003354 JGI25160J50197_1050490 JGI25160J50197_10504902 99
221 3300003578 Ga0006562J51391_1101924 Ga0006562J51391_11019242 99
222 3300003792 Ga0055540_1000003 Ga0055540_10000035 99
223 3300003792 Ga0055540_1003721 Ga0055540_10037214 99
224 3300003792 Ga0055540_1005958 Ga0055540_10059584 99
225 3300003792 Ga0055540_1006423 Ga0055540_10064233 99
226 3300003792 Ga0055540_1012991 Ga0055540_10129913 99
227 3300003792 Ga0055540_1060386 Ga0055540_10603862 99
228 3300005327 Ga0070658_10000319 Ga0070658_100003199 99
229 3300005327 Ga0070658_10168973 Ga0070658_101689732 99
230 3300005327 Ga0070658_11043273 Ga0070658_110432732 99
231 3300005328 Ga0070676_10005021 Ga0070676_100050213 99
232 3300005329 Ga0070683_100255133 Ga0070683_1002551332 99
233 3300005329 Ga0070683_100544285 Ga0070683_1005442852 99
234 3300005329 Ga0070683_102219522 Ga0070683_1022195221 99
235 3300005330 Ga0070690_100066359 Ga0070690_1000663594 99
236 3300005330 Ga0070690_100514413 Ga0070690_1005144132 99
237 3300005331 Ga0070670_100341739 Ga0070670_1003417392 99
238 3300005331 Ga0070670_101463295 Ga0070670_1014632952 99
239 3300005333 Ga0070677_10131461 Ga0070677_101314612 99
240 3300005334 Ga0068869_100078270 Ga0068869_1000782702 99
241 3300005334 Ga0068869_102158052 Ga0068869_1021580522 99
242 3300005335 Ga0070666_10114765 Ga0070666_101147652 99
243 3300005335 Ga0070666_10206198 Ga0070666_102061982 99
244 3300005335 Ga0070666_10589613 Ga0070666_105896132 99
245 3300005336 Ga0070680_100000061 Ga0070680_10000006115 99
246 3300005336 Ga0070680_100238798 Ga0070680_1002387982 99
247 3300005336 Ga0070680_101437996 Ga0070680_1014379962 99
248 3300005337 Ga0070682_100071052 Ga0070682_1000710522 99
249 3300005337 Ga0070682_100286998 Ga0070682_1002869982 99
250 3300005337 Ga0070682_100841066 Ga0070682_1008410662 99
251 3300005337 Ga0070682_101277581 Ga0070682_1012775811 99
252 3300005337 Ga0070682_101512840 Ga0070682_1015128401 99
253 3300005338 Ga0068868_100001480 Ga0068868_1000014803 99
254 3300005339 Ga0070660_100110954 Ga0070660_1001109542 99
255 3300005339 Ga0070660_100361827 Ga0070660_1003618272 99
256 3300005340 Ga0070689_100020932 Ga0070689_1000209325 99
257 3300005340 Ga0070689_100706067 Ga0070689_1007060672 99
258 3300005341 Ga0070691_10002982 Ga0070691_100029825 99
259 3300005343 Ga0070687_100186584 Ga0070687_1001865842 99
260 3300005343 Ga0070687_100198977 Ga0070687_1001989772 99
261 3300005344 Ga0070661_100990318 Ga0070661_1009903182 99
262 3300005345 Ga0070692_10095309 Ga0070692_100953092 99
263 3300005345 Ga0070692_10401231 Ga0070692_104012312 99
264 3300005347 Ga0070668_100001192 Ga0070668_10000119216 99
265 3300005347 Ga0070668_100006438 Ga0070668_1000064388 99
266 3300005347 Ga0070668_100068621 Ga0070668_1000686214 99
267 3300005347 Ga0070668_101492986 Ga0070668_1014929861 99
268 3300005353 Ga0070669_100004569 Ga0070669_1000045691 99
269 3300005353 Ga0070669_100099405 Ga0070669_1000994052 99
270 3300005354 Ga0070675_101430454 Ga0070675_1014304542 99
271 3300005355 Ga0070671_100047031 Ga0070671_1000470312 99
272 3300005356 Ga0070674_100000187 Ga0070674_10000018715 99
273 3300005356 Ga0070674_100025474 Ga0070674_1000254745 99
274 3300005356 Ga0070674_100300932 Ga0070674_1003009323 99
275 3300005356 Ga0070674_100495203 Ga0070674_1004952032 99
276 3300005364 Ga0070673_100102120 Ga0070673_1001021202 99
277 3300005365 Ga0070688_101080451 Ga0070688_1010804512 99
278 3300005366 Ga0070659_100018793 Ga0070659_1000187932 99
279 3300005366 Ga0070659_100026599 Ga0070659_1000265992 99
280 3300005366 Ga0070659_100436784 Ga0070659_1004367842 99
281 3300005367 Ga0070667_100000056 Ga0070667_100000056110 99
282 3300005367 Ga0070667_100000854 Ga0070667_10000085413 99
283 3300005367 Ga0070667_100003985 Ga0070667_1000039853 99
284 3300005367 Ga0070667_100025316 Ga0070667_1000253162 99
285 3300005367 Ga0070667_100221674 Ga0070667_1002216742 99
286 3300005367 Ga0070667_100591567 Ga0070667_1005915672 99
287 3300005406 Ga0070703_10053183 Ga0070703_100531832 99
288 3300005434 Ga0070709_10032314 Ga0070709_100323144 99
289 3300005434 Ga0070709_10130230 Ga0070709_101302302 99
290 3300005435 Ga0070714_100016403 Ga0070714_1000164033 99
291 3300005435 Ga0070714_100065097 Ga0070714_1000650973 99
292 3300005435 Ga0070714_100252503 Ga0070714_1002525033 99
293 3300005435 Ga0070714_100348335 Ga0070714_1003483352 99
294 3300005435 Ga0070714_100451848 Ga0070714_1004518482 99
295 3300005435 Ga0070714_100863902 Ga0070714_1008639022 99
296 3300005435 Ga0070714_101432416 Ga0070714_1014324162 99
297 3300005435 Ga0070714_101507705 Ga0070714_1015077052 99
298 3300005436 Ga0070713_100015655 Ga0070713_1000156553 99
299 3300005436 Ga0070713_100080518 Ga0070713_1000805182 99
300 3300005436 Ga0070713_100215794 Ga0070713_1002157942 99
301 3300005436 Ga0070713_100265185 Ga0070713_1002651853 99
302 3300005436 Ga0070713_100361968 Ga0070713_1003619682 99
303 3300005436 Ga0070713_100629163 Ga0070713_1006291632 99
304 3300005437 Ga0070710_10000277 Ga0070710_100002776 99
305 3300005437 Ga0070710_10044347 Ga0070710_100443472 99
306 3300005437 Ga0070710_10168660 Ga0070710_101686602 99
307 3300005437 Ga0070710_10370702 Ga0070710_103707022 99
308 3300005438 Ga0070701_10034333 Ga0070701_100343332 99
309 3300005439 Ga0070711_100000493 Ga0070711_1000004932 99
310 3300005439 Ga0070711_100029466 Ga0070711_1000294665 99
311 3300005439 Ga0070711_100253283 Ga0070711_1002532832 99
312 3300005439 Ga0070711_100885304 Ga0070711_1008853041 99
313 3300005440 Ga0070705_100200449 Ga0070705_1002004492 99
314 3300005440 Ga0070705_100263554 Ga0070705_1002635542 99
315 3300005441 Ga0070700_100289210 Ga0070700_1002892102 99
316 3300005444 Ga0070694_100008280 Ga0070694_1000082804 99
317 3300005444 Ga0070694_100118065 Ga0070694_1001180654 99
318 3300005445 Ga0070708_100297322 Ga0070708_1002973221 99
319 3300005455 Ga0070663_100042981 Ga0070663_1000429815 99
320 3300005455 Ga0070663_100362811 Ga0070663_1003628112 99
321 3300005455 Ga0070663_100429842 Ga0070663_1004298422 99
322 3300005455 Ga0070663_101210567 Ga0070663_1012105672 99
323 3300005455 Ga0070663_101289937 Ga0070663_1012899372 99
324 3300005456 Ga0070678_100000280 Ga0070678_10000028028 99
325 3300005456 Ga0070678_100247043 Ga0070678_1002470431 99
326 3300005456 Ga0070678_100300022 Ga0070678_1003000222 99
327 3300005456 Ga0070678_100982985 Ga0070678_1009829852 99
328 3300005456 Ga0070678_101874325 Ga0070678_1018743251 99
329 3300005457 Ga0070662_100001491 Ga0070662_10000149113 99
330 3300005457 Ga0070662_101359820 Ga0070662_1013598201 99
331 3300005458 Ga0070681_10001025 Ga0070681_1000102515 99
332 3300005458 Ga0070681_10754339 Ga0070681_107543392 99
333 3300005458 Ga0070681_11539087 Ga0070681_115390872 99
334 3300005459 Ga0068867_100002048 Ga0068867_10000204814 99
335 3300005466 Ga0070685_10119192 Ga0070685_101191922 99
336 3300005466 Ga0070685_10148015 Ga0070685_101480152 99
337 3300005466 Ga0070685_10838994 Ga0070685_108389942 99
338 3300005530 Ga0070679_100001551 Ga0070679_1000015516 99
339 3300005535 Ga0070684_100169163 Ga0070684_1001691632 99
340 3300005536 Ga0070697_100880770 Ga0070697_1008807702 99
341 3300005539 Ga0068853_100001367 Ga0068853_10000136722 99
342 3300005539 Ga0068853_100084260 Ga0068853_1000842604 99
343 3300005539 Ga0068853_100142792 Ga0068853_1001427922 99
344 3300005539 Ga0068853_100570000 Ga0068853_1005700002 99
345 3300005539 Ga0068853_101643301 Ga0068853_1016433012 99
346 3300005543 Ga0070672_100249143 Ga0070672_1002491432 99
347 3300005543 Ga0070672_100569437 Ga0070672_1005694372 99
348 3300005545 Ga0070695_100008891 Ga0070695_1000088916 99
349 3300005545 Ga0070695_100267175 Ga0070695_1002671752 99
350 3300005546 Ga0070696_100002977 Ga0070696_1000029778 99
351 3300005546 Ga0070696_100854901 Ga0070696_1008549012 99
352 3300005547 Ga0070693_100021947 Ga0070693_1000219472 99
353 3300005547 Ga0070693_100098763 Ga0070693_1000987633 99
354 3300005547 Ga0070693_100531666 Ga0070693_1005316662 99
355 3300005547 Ga0070693_101023388 Ga0070693_1010233881 99
356 3300005548 Ga0070665_100011296 Ga0070665_1000112964 99
357 3300005548 Ga0070665_100039320 Ga0070665_1000393205 99
358 3300005548 Ga0070665_100083036 Ga0070665_1000830364 99
359 3300005548 Ga0070665_100230350 Ga0070665_1002303502 99
360 3300005548 Ga0070665_100316153 Ga0070665_1003161532 99
361 3300005548 Ga0070665_100825882 Ga0070665_1008258822 99
362 3300005548 Ga0070665_101327790 Ga0070665_1013277902 99
363 3300005548 Ga0070665_102564412 Ga0070665_1025644122 99
364 3300005549 Ga0070704_100001052 Ga0070704_1000010523 99
365 3300005549 Ga0070704_100019306 Ga0070704_1000193064 99
366 3300005549 Ga0070704_100819551 Ga0070704_1008195512 99
367 3300005563 Ga0068855_100244028 Ga0068855_1002440283 99
368 3300005563 Ga0068855_100417642 Ga0068855_1004176423 99
369 3300005563 Ga0068855_100590408 Ga0068855_1005904082 99
370 3300005563 Ga0068855_100596191 Ga0068855_1005961912 99
371 3300005563 Ga0068855_100745022 Ga0068855_1007450222 99
372 3300005563 Ga0068855_101397090 Ga0068855_1013970902 99
373 3300005563 Ga0068855_102602693 Ga0068855_1026026932 99
374 3300005564 Ga0070664_101013283 Ga0070664_1010132832 99
375 3300005577 Ga0068857_100597961 Ga0068857_1005979612 99
376 3300005578 Ga0068854_100000458 Ga0068854_10000045811 99
377 3300005578 Ga0068854_100020918 Ga0068854_1000209182 99
378 3300005578 Ga0068854_100252151 Ga0068854_1002521512 99
379 3300005614 Ga0068856_100203470 Ga0068856_1002034702 99
380 3300005615 Ga0070702_100000308 Ga0070702_1000003089 99
381 3300005615 Ga0070702_100148986 Ga0070702_1001489862 99
382 3300005615 Ga0070702_100956426 Ga0070702_1009564262 99
383 3300005616 Ga0068852_100063059 Ga0068852_1000630595 99
384 3300005616 Ga0068852_100154194 Ga0068852_1001541942 99
385 3300005616 Ga0068852_101270523 Ga0068852_1012705232 99
386 3300005616 Ga0068852_101980594 Ga0068852_1019805942 99
387 3300005617 Ga0068859_100000751 Ga0068859_10000075110 99
388 3300005617 Ga0068859_100039348 Ga0068859_1000393482 99
389 3300005617 Ga0068859_100206485 Ga0068859_1002064852 99
390 3300005618 Ga0068864_100132511 Ga0068864_1001325112 99
391 3300005618 Ga0068864_100468211 Ga0068864_1004682112 99
392 3300005618 Ga0068864_101863702 Ga0068864_1018637021 99
393 3300005618 Ga0068864_102197808 Ga0068864_1021978082 99
394 3300005718 Ga0068866_10000187 Ga0068866_1000018714 99
395 3300005718 Ga0068866_10029932 Ga0068866_100299324 99
396 3300005718 Ga0068866_11223904 Ga0068866_112239042 99
397 3300005719 Ga0068861_100000195 Ga0068861_10000019528 99
398 3300005719 Ga0068861_100225745 Ga0068861_1002257452 99
399 3300005719 Ga0068861_101604859 Ga0068861_1016048592 99
400 3300005834 Ga0068851_10393066 Ga0068851_103930661 99
401 3300005840 Ga0068870_10747542 Ga0068870_107475422 99
402 3300005841 Ga0068863_100018953 Ga0068863_1000189533 99
403 3300005841 Ga0068863_100081670 Ga0068863_1000816704 99
404 3300005841 Ga0068863_100128462 Ga0068863_1001284622 99
405 3300005841 Ga0068863_100207411 Ga0068863_1002074112 99
406 3300005841 Ga0068863_101773287 Ga0068863_1017732872 99
407 3300005842 Ga0068858_100006827 Ga0068858_1000068275 99
408 3300005842 Ga0068858_100015158 Ga0068858_1000151587 99
409 3300005842 Ga0068858_100106856 Ga0068858_1001068562 99
410 3300005842 Ga0068858_100269146 Ga0068858_1002691463 99
411 3300005842 Ga0068858_100447887 Ga0068858_1004478872 99
412 3300005842 Ga0068858_100999124 Ga0068858_1009991241 99
413 3300005842 Ga0068858_101387952 Ga0068858_1013879522 99
414 3300005842 Ga0068858_102180194 Ga0068858_1021801942 99
415 3300005843 Ga0068860_100000092 Ga0068860_10000009246 99
416 3300005843 Ga0068860_100001932 Ga0068860_10000193215 99
417 3300005843 Ga0068860_100157374 Ga0068860_1001573742 99
418 3300005844 Ga0068862_100000035 Ga0068862_10000003548 99
419 3300005844 Ga0068862_100006561 Ga0068862_1000065618 99
420 3300005844 Ga0068862_100074824 Ga0068862_1000748242 99
421 3300005844 Ga0068862_101578887 Ga0068862_1015788872 99
422 3300005937 Ga0081455_10024172 Ga0081455_100241725 99
423 3300005937 Ga0081455_10031920 Ga0081455_100319205 99
424 3300005937 Ga0081455_10034690 Ga0081455_100346902 99
425 3300005937 Ga0081455_10091239 Ga0081455_100912394 99
426 3300005937 Ga0081455_10192807 Ga0081455_101928072 99
427 3300005937 Ga0081455_10273175 Ga0081455_102731752 99
428 3300005981 Ga0081538_10136302 Ga0081538_101363022 99
429 3300005983 Ga0081540_1047146 Ga0081540_10471462 99
430 3300005985 Ga0081539_10045318 Ga0081539_100453182 99
431 3300005985 Ga0081539_10050996 Ga0081539_100509962 99
432 3300006028 Ga0070717_10212312 Ga0070717_102123122 99
433 3300006028 Ga0070717_10384114 Ga0070717_103841142 99
434 3300006038 Ga0075365_10004705 Ga0075365_100047054 99
435 3300006038 Ga0075365_10019404 Ga0075365_100194045 99
436 3300006038 Ga0075365_10024575 Ga0075365_100245752 99
437 3300006038 Ga0075365_10082992 Ga0075365_100829921 99
438 3300006038 Ga0075365_10197265 Ga0075365_101972652 99
439 3300006038 Ga0075365_10292279 Ga0075365_102922792 99
440 3300006038 Ga0075365_10470498 Ga0075365_104704982 99
441 3300006038 Ga0075365_10635542 Ga0075365_106355422 99
442 3300006038 Ga0075365_10963222 Ga0075365_109632222 99
443 3300006038 Ga0075365_11198904 Ga0075365_111989042 99
444 3300006042 Ga0075368_10007123 Ga0075368_100071235 99
445 3300006042 Ga0075368_10251780 Ga0075368_102517801 99
446 3300006042 Ga0075368_10293280 Ga0075368_102932802 99
447 3300006042 Ga0075368_10480886 Ga0075368_104808862 99
448 3300006048 Ga0075363_100000383 Ga0075363_1000003836 99
449 3300006048 Ga0075363_100000613 Ga0075363_1000006137 99
450 3300006048 Ga0075363_100002816 Ga0075363_1000028162 99
451 3300006048 Ga0075363_100012126 Ga0075363_1000121263 99
452 3300006048 Ga0075363_100026851 Ga0075363_1000268514 99
453 3300006048 Ga0075363_100032534 Ga0075363_1000325342 99
454 3300006048 Ga0075363_100076456 Ga0075363_1000764562 99
455 3300006048 Ga0075363_100099522 Ga0075363_1000995222 99
456 3300006048 Ga0075363_100135422 Ga0075363_1001354223 99
457 3300006048 Ga0075363_100190303 Ga0075363_1001903032 99
458 3300006048 Ga0075363_100213308 Ga0075363_1002133082 99
459 3300006048 Ga0075363_100274408 Ga0075363_1002744082 99
460 3300006048 Ga0075363_100279189 Ga0075363_1002791892 99
461 3300006048 Ga0075363_100292455 Ga0075363_1002924552 99
462 3300006048 Ga0075363_100299583 Ga0075363_1002995831 99
463 3300006048 Ga0075363_100328371 Ga0075363_1003283712 99
464 3300006048 Ga0075363_100472321 Ga0075363_1004723212 99
465 3300006051 Ga0075364_10003028 Ga0075364_100030283 99
466 3300006051 Ga0075364_10035907 Ga0075364_100359073 99
467 3300006051 Ga0075364_10043671 Ga0075364_100436714 99
468 3300006051 Ga0075364_10044294 Ga0075364_100442942 99
469 3300006051 Ga0075364_10066923 Ga0075364_100669234 99
470 3300006051 Ga0075364_10092827 Ga0075364_100928274 99
471 3300006051 Ga0075364_10132230 Ga0075364_101322302 99
472 3300006051 Ga0075364_10134790 Ga0075364_101347902 99
473 3300006051 Ga0075364_10143695 Ga0075364_101436952 99
474 3300006051 Ga0075364_10199940 Ga0075364_101999402 99
475 3300006051 Ga0075364_10266749 Ga0075364_102667492 99
476 3300006051 Ga0075364_10433398 Ga0075364_104333982 99
477 3300006051 Ga0075364_10626454 Ga0075364_106264542 99
478 3300006051 Ga0075364_10628202 Ga0075364_106282021 99
479 3300006051 Ga0075364_10682480 Ga0075364_106824802 99
480 3300006051 Ga0075364_10869353 Ga0075364_108693532 99
481 3300006051 Ga0075364_10946726 Ga0075364_109467262 99
482 3300006051 Ga0075364_11009446 Ga0075364_110094462 99
483 3300006163 Ga0070715_10053904 Ga0070715_100539043 99
484 3300006163 Ga0070715_10071980 Ga0070715_100719802 99
485 3300006173 Ga0070716_100024573 Ga0070716_1000245732 99
486 3300006173 Ga0070716_100639733 Ga0070716_1006397332 99
487 3300006175 Ga0070712_100001061 Ga0070712_10000106121 99
488 3300006175 Ga0070712_100005282 Ga0070712_1000052824 99
489 3300006177 Ga0075362_10015901 Ga0075362_100159012 99
490 3300006177 Ga0075362_10072661 Ga0075362_100726612 99
491 3300006177 Ga0075362_10083764 Ga0075362_100837642 99
492 3300006177 Ga0075362_10126789 Ga0075362_101267892 99
493 3300006177 Ga0075362_10289765 Ga0075362_102897652 99
494 3300006177 Ga0075362_10352118 Ga0075362_103521182 99
495 3300006178 Ga0075367_10002885 Ga0075367_100028853 99
496 3300006178 Ga0075367_10042461 Ga0075367_100424612 99
497 3300006178 Ga0075367_10186612 Ga0075367_101866123 99
498 3300006178 Ga0075367_10233147 Ga0075367_102331472 99
499 3300006178 Ga0075367_10260938 Ga0075367_102609382 99
500 3300006178 Ga0075367_10399203 Ga0075367_103992032 99
501 3300006178 Ga0075367_10546065 Ga0075367_105460652 99
502 3300006178 Ga0075367_10559833 Ga0075367_105598332 99
503 3300006186 Ga0075369_10001505 Ga0075369_100015057 99
504 3300006186 Ga0075369_10018446 Ga0075369_100184462 99
505 3300006186 Ga0075369_10021403 Ga0075369_100214032 99
506 3300006186 Ga0075369_10026182 Ga0075369_100261822 99
507 3300006186 Ga0075369_10061574 Ga0075369_100615743 99
508 3300006186 Ga0075369_10105102 Ga0075369_101051022 99
509 3300006186 Ga0075369_10118627 Ga0075369_101186272 99
510 3300006186 Ga0075369_10154077 Ga0075369_101540772 99
511 3300006186 Ga0075369_10200650 Ga0075369_102006502 99
512 3300006186 Ga0075369_10271899 Ga0075369_102718992 99
513 3300006237 Ga0097621_100132479 Ga0097621_1001324792 99
514 3300006237 Ga0097621_100392623 Ga0097621_1003926232 99
515 3300006237 Ga0097621_100494859 Ga0097621_1004948592 99
516 3300006353 Ga0075370_10001408 Ga0075370_100014088 99
517 3300006353 Ga0075370_10001448 Ga0075370_1000144810 99
518 3300006353 Ga0075370_10008954 Ga0075370_100089543 99
519 3300006353 Ga0075370_10097924 Ga0075370_100979242 99
520 3300006353 Ga0075370_10104498 Ga0075370_101044982 99
521 3300006353 Ga0075370_10186332 Ga0075370_101863322 99
522 3300006353 Ga0075370_10257482 Ga0075370_102574822 99
523 3300006353 Ga0075370_10398205 Ga0075370_103982052 99
524 3300006353 Ga0075370_10620621 Ga0075370_106206212 99
525 3300006353 Ga0075370_10648252 Ga0075370_106482522 99
526 3300006353 Ga0075370_10664947 Ga0075370_106649472 99
527 3300006358 Ga0068871_100174821 Ga0068871_1001748212 99
528 3300006844 Ga0075428_100015023 Ga0075428_1000150237 99
529 3300006846 Ga0075430_100259087 Ga0075430_1002590872 99
530 3300006847 Ga0075431_101575367 Ga0075431_1015753672 99
531 3300006852 Ga0075433_10984058 Ga0075433_109840582 99
532 3300006852 Ga0075433_11130050 Ga0075433_111300501 99
533 3300006852 Ga0075433_11760735 Ga0075433_117607352 99
534 3300006880 Ga0075429_100558479 Ga0075429_1005584792 99
535 3300006881 Ga0068865_100001276 Ga0068865_1000012767 99
536 3300006881 Ga0068865_100032758 Ga0068865_1000327584 99
537 3300006881 Ga0068865_100630967 Ga0068865_1006309672 99
538 3300006931 Ga0097620_100000751 Ga0097620_10000075110 99
539 3300006931 Ga0097620_100039348 Ga0097620_1000393482 99
540 3300006931 Ga0097620_100206491 Ga0097620_1002064912 99
541 3300006948 Ga0099826_10257458 Ga0099826_102574582 99
542 3300007076 Ga0075435_100931273 Ga0075435_1009312731 99
543 3300007265 Ga0099794_10681931 Ga0099794_106819311 99
544 3300007788 Ga0099795_10038450 Ga0099795_100384502 99
545 3300009011 Ga0105251_10120384 Ga0105251_101203842 99
546 3300009036 Ga0105244_10181460 Ga0105244_101814602 99
547 3300009092 Ga0105250_10016382 Ga0105250_100163823 99
548 3300009092 Ga0105250_10034275 Ga0105250_100342752 99
549 3300009092 Ga0105250_10170611 Ga0105250_101706112 99
550 3300009093 Ga0105240_10619898 Ga0105240_106198982 99
551 3300009093 Ga0105240_10956301 Ga0105240_109563012 99
552 3300009094 Ga0111539_10409140 Ga0111539_104091403 99
553 3300009094 Ga0111539_10828184 Ga0111539_108281842 99
554 3300009094 Ga0111539_11548544 Ga0111539_115485442 99
555 3300009098 Ga0105245_10000870 Ga0105245_100008707 99
556 3300009098 Ga0105245_10152899 Ga0105245_101528992 99
557 3300009098 Ga0105245_10166509 Ga0105245_101665092 99
558 3300009098 Ga0105245_10370949 Ga0105245_103709492 99
559 3300009098 Ga0105245_10476371 Ga0105245_104763712 99
560 3300009098 Ga0105245_10881421 Ga0105245_108814212 99
561 3300009098 Ga0105245_11742491 Ga0105245_117424912 99
562 3300009101 Ga0105247_10000062 Ga0105247_1000006298 99
563 3300009101 Ga0105247_10000637 Ga0105247_1000063723 99
564 3300009101 Ga0105247_10021071 Ga0105247_100210715 99
565 3300009101 Ga0105247_10075913 Ga0105247_100759132 99
566 3300009101 Ga0105247_10140167 Ga0105247_101401672 99
567 3300009101 Ga0105247_10250979 Ga0105247_102509792 99
568 3300009101 Ga0105247_10761866 Ga0105247_107618662 99
569 3300009147 Ga0114129_10093305 Ga0114129_100933052 99
570 3300009147 Ga0114129_10148224 Ga0114129_101482243 99
571 3300009148 Ga0105243_10001020 Ga0105243_1000102016 99
572 3300009148 Ga0105243_10074007 Ga0105243_100740074 99
573 3300009148 Ga0105243_10190530 Ga0105243_101905302 99
574 3300009148 Ga0105243_10283666 Ga0105243_102836663 99
575 3300009148 Ga0105243_10509827 Ga0105243_105098272 99
576 3300009148 Ga0105243_11285122 Ga0105243_112851222 99
577 3300009148 Ga0105243_11528518 Ga0105243_115285182 99
578 3300009148 Ga0105243_12183366 Ga0105243_121833662 99
579 3300009174 Ga0105241_10062601 Ga0105241_100626014 99
580 3300009174 Ga0105241_10183888 Ga0105241_101838883 99
581 3300009174 Ga0105241_10806709 Ga0105241_108067092 99
582 3300009174 Ga0105241_11212921 Ga0105241_112129212 99
583 3300009174 Ga0105241_12287648 Ga0105241_122876481 99
584 3300009176 Ga0105242_10000650 Ga0105242_1000065020 99
585 3300009176 Ga0105242_10130986 Ga0105242_101309865 99
586 3300009176 Ga0105242_11181071 Ga0105242_111810712 99
587 3300009176 Ga0105242_11542909 Ga0105242_115429092 99
588 3300009176 Ga0105242_12699092 Ga0105242_126990922 99
589 3300009176 Ga0105242_12935617 Ga0105242_129356172 99
590 3300009177 Ga0105248_10000036 Ga0105248_10000036109 99
591 3300009177 Ga0105248_10003895 Ga0105248_1000389510 99
592 3300009177 Ga0105248_10014411 Ga0105248_100144115 99
593 3300009177 Ga0105248_10047963 Ga0105248_100479634 99
594 3300009177 Ga0105248_10115569 Ga0105248_101155692 99
595 3300009177 Ga0105248_10151489 Ga0105248_101514894 99
596 3300009177 Ga0105248_10785375 Ga0105248_107853752 99
597 3300009177 Ga0105248_10838239 Ga0105248_108382391 99
598 3300009545 Ga0105237_10000467 Ga0105237_1000046719 99
599 3300009545 Ga0105237_10034141 Ga0105237_100341415 99
600 3300009545 Ga0105237_10052349 Ga0105237_100523495 99
601 3300009545 Ga0105237_10209041 Ga0105237_102090412 99
602 3300009545 Ga0105237_10350429 Ga0105237_103504292 99
603 3300009545 Ga0105237_11745850 Ga0105237_117458502 99
604 3300009545 Ga0105237_11890974 Ga0105237_118909742 99
605 3300009551 Ga0105238_10088868 Ga0105238_100888684 99
606 3300009551 Ga0105238_10131894 Ga0105238_101318942 99
607 3300009551 Ga0105238_10152187 Ga0105238_101521872 99
608 3300009551 Ga0105238_10325317 Ga0105238_103253172 99
609 3300009551 Ga0105238_10956875 Ga0105238_109568752 99
610 3300009551 Ga0105238_12044567 Ga0105238_120445672 99
611 3300009551 Ga0105238_12554437 Ga0105238_125544372 99
612 3300009551 Ga0105238_12633302 Ga0105238_126333021 99
613 3300009553 Ga0105249_10000046 Ga0105249_10000046131 99
614 3300009553 Ga0105249_10001186 Ga0105249_1000118614 99
615 3300009553 Ga0105249_10005021 Ga0105249_100050213 99
616 3300009553 Ga0105249_10734696 Ga0105249_107346961 99
617 3300009553 Ga0105249_11016856 Ga0105249_110168562 99
618 3300009553 Ga0105249_11037881 Ga0105249_110378812 99
619 3300009553 Ga0105249_11389858 Ga0105249_113898582 99
620 3300009553 Ga0105249_11852390 Ga0105249_118523902 99
621 3300010159 Ga0099796_10045462 Ga0099796_100454622 99
622 3300010375 Ga0105239_10003093 Ga0105239_100030935 99
623 3300010375 Ga0105239_10028730 Ga0105239_100287304 99
624 3300010375 Ga0105239_10061068 Ga0105239_100610685 99
625 3300010375 Ga0105239_10241758 Ga0105239_102417582 99
626 3300010375 Ga0105239_10403057 Ga0105239_104030572 99
627 3300010375 Ga0105239_10594153 Ga0105239_105941532 99
628 3300010375 Ga0105239_10893469 Ga0105239_108934692 99
629 3300010375 Ga0105239_11093110 Ga0105239_110931102 99
630 3300010375 Ga0105239_11896191 Ga0105239_118961912 99
631 3300010375 Ga0105239_12608396 Ga0105239_126083962 99
632 3300010375 Ga0105239_12861131 Ga0105239_128611312 99
633 3300010375 Ga0105239_12978285 Ga0105239_129782851 99
634 3300010375 Ga0105239_13365063 Ga0105239_133650632 99
635 3300011119 Ga0105246_10034380 Ga0105246_100343802 99
636 3300011119 Ga0105246_10063318 Ga0105246_100633183 99
637 3300011119 Ga0105246_10232450 Ga0105246_102324502 99
638 3300011119 Ga0105246_11238228 Ga0105246_112382281 99
639 3300011119 Ga0105246_11800899 Ga0105246_118008992 99
640 3300012476 Ga0157344_1019660 Ga0157344_10196602 99
641 3300012503 Ga0157313_1021463 Ga0157313_10214632 99
642 3300012507 Ga0157342_1079190 Ga0157342_10791902 99
643 3300012508 Ga0157315_1005519 Ga0157315_10055192 99
644 3300013100 Ga0157373_10926876 Ga0157373_109268762 99
645 3300013102 Ga0157371_10124561 Ga0157371_101245612 99
646 3300013102 Ga0157371_10309262 Ga0157371_103092622 99
647 3300013104 Ga0157370_10300678 Ga0157370_103006783 99
648 3300013104 Ga0157370_11343214 Ga0157370_113432142 99
649 3300013105 Ga0157369_10051356 Ga0157369_100513565 99
650 3300013105 Ga0157369_10110992 Ga0157369_101109922 99
651 3300013105 Ga0157369_10498685 Ga0157369_104986852 99
652 3300013105 Ga0157369_10748083 Ga0157369_107480832 99
653 3300013296 Ga0157374_10032409 Ga0157374_100324092 99
654 3300013296 Ga0157374_11664878 Ga0157374_116648782 99
655 3300013296 Ga0157374_11809434 Ga0157374_118094342 99
656 3300013297 Ga0157378_10004457 Ga0157378_100044575 99
657 3300013297 Ga0157378_10395003 Ga0157378_103950032 99
658 3300013306 Ga0163162_10001609 Ga0163162_1000160914 99
659 3300013306 Ga0163162_10035606 Ga0163162_100356063 99
660 3300013306 Ga0163162_10412955 Ga0163162_104129552 99
661 3300013306 Ga0163162_10415926 Ga0163162_104159261 99
662 3300013306 Ga0163162_10471848 Ga0163162_104718482 99
663 3300013306 Ga0163162_11569914 Ga0163162_115699141 99
664 3300013306 Ga0163162_12048891 Ga0163162_120488912 99
665 3300013307 Ga0157372_10004145 Ga0157372_1000414516 99
666 3300013307 Ga0157372_10219830 Ga0157372_102198302 99
667 3300013307 Ga0157372_10298165 Ga0157372_102981653 99
668 3300013307 Ga0157372_10323563 Ga0157372_103235632 99
669 3300013307 Ga0157372_13131700 Ga0157372_131317002 99
670 3300013308 Ga0157375_10000419 Ga0157375_1000041930 99
671 3300013308 Ga0157375_11361671 Ga0157375_113616712 99
672 3300013308 Ga0157375_11459471 Ga0157375_114594712 99
673 3300013308 Ga0157375_12957822 Ga0157375_129578222 99
674 3300014325 Ga0163163_10039390 Ga0163163_100393905 99
675 3300014325 Ga0163163_10177849 Ga0163163_101778492 99
676 3300014325 Ga0163163_10564851 Ga0163163_105648511 99
677 3300014325 Ga0163163_11018401 Ga0163163_110184012 99
678 3300014325 Ga0163163_11527267 Ga0163163_115272672 99
679 3300014325 Ga0163163_12221259 Ga0163163_122212592 99
680 3300014326 Ga0157380_10001844 Ga0157380_100018447 99
681 3300014326 Ga0157380_10433095 Ga0157380_104330951 99
682 3300014497 Ga0182008_10002958 Ga0182008_100029585 99
683 3300014745 Ga0157377_10026136 Ga0157377_100261362 99
684 3300014745 Ga0157377_11268421 Ga0157377_112684212 99
685 3300014968 Ga0157379_10029772 Ga0157379_100297722 99
686 3300014968 Ga0157379_10132262 Ga0157379_101322622 99
687 3300014968 Ga0157379_10214503 Ga0157379_102145031 99
688 3300014968 Ga0157379_10314622 Ga0157379_103146222 99
689 3300014968 Ga0157379_11341361 Ga0157379_113413611 99
690 3300014969 Ga0157376_10037960 Ga0157376_100379602 99
691 3300014969 Ga0157376_10057401 Ga0157376_100574012 99
692 3300014969 Ga0157376_10107119 Ga0157376_101071191 99
693 3300014969 Ga0157376_11853195 Ga0157376_118531952 99
694 3300015261 Ga0182006_1084780 Ga0182006_10847802 99
695 3300015265 Ga0182005_1049382 Ga0182005_10493822 99
696 3300015688 Ga0183367_1002 Ga0183367_1002874 99
697 3300017792 Ga0163161_10006906 Ga0163161_100069063 99
698 3300017792 Ga0163161_10172118 Ga0163161_101721183 99
699 3300017792 Ga0163161_10418449 Ga0163161_104184492 99
700 3300017792 Ga0163161_10600751 Ga0163161_106007511 99
701 3300017792 Ga0163161_10636131 Ga0163161_106361312 99
702 3300020069 Ga0197907_10131781 Ga0197907_101317812 99
703 3300020069 Ga0197907_10233448 Ga0197907_102334482 99
704 3300020070 Ga0206356_11143445 Ga0206356_111434452 99
705 3300020077 Ga0206351_10184192 Ga0206351_101841922 99
706 3300020078 Ga0206352_10845590 Ga0206352_108455901 99
707 3300020080 Ga0206350_11195567 Ga0206350_111955672 99
708 3300020081 Ga0206354_10960052 Ga0206354_109600522 99
709 3300020082 Ga0206353_11128098 Ga0206353_111280987 99
710 3300020082 Ga0206353_11287408 Ga0206353_112874082 99
711 3300021361 Ga0213872_10306243 Ga0213872_103062431 99
712 3300021384 Ga0213876_10009953 Ga0213876_100099534 99
713 3300021384 Ga0213876_10011067 Ga0213876_100110672 99
714 3300021384 Ga0213876_10023670 Ga0213876_100236702 99
715 3300021384 Ga0213876_10572096 Ga0213876_105720962 99
716 3300021388 Ga0213875_10032905 Ga0213875_100329052 99
717 3300021388 Ga0213875_10059850 Ga0213875_100598502 99
718 3300021388 Ga0213875_10273228 Ga0213875_102732282 99
719 3300022467 Ga0224712_10000526 Ga0224712_100005265 99
720 3300022467 Ga0224712_10002344 Ga0224712_100023445 99
721 3300025294 Ga0209025_1037599 Ga0209025_10375992 99
722 3300025297 Ga0209758_1007953 Ga0209758_10079531 99
723 3300025302 Ga0207426_1004664 Ga0207426_10046645 99
724 3300025302 Ga0207426_1006367 Ga0207426_10063674 99
725 3300025302 Ga0207426_1038691 Ga0207426_10386912 99
726 3300025303 Ga0209051_1000011 Ga0209051_1000011591 99
727 3300025303 Ga0209051_1000620 Ga0209051_100062027 99
728 3300025303 Ga0209051_1000933 Ga0209051_100093324 99
729 3300025303 Ga0209051_1001428 Ga0209051_10014282 99
730 3300025303 Ga0209051_1033472 Ga0209051_10334722 99
731 3300025303 Ga0209051_1039069 Ga0209051_10390692 99
732 3300025303 Ga0209051_1095550 Ga0209051_10955501 99
733 3300025321 Ga0207656_10092487 Ga0207656_100924872 99
734 3300025321 Ga0207656_10115433 Ga0207656_101154332 99
735 3300025711 Ga0207696_1123242 Ga0207696_11232422 99
736 3300025885 Ga0207653_10045515 Ga0207653_100455152 99
737 3300025893 Ga0207682_10340878 Ga0207682_103408782 99
738 3300025898 Ga0207692_10001940 Ga0207692_100019403 99
739 3300025898 Ga0207692_10136975 Ga0207692_101369752 99
740 3300025898 Ga0207692_10302969 Ga0207692_103029692 99
741 3300025898 Ga0207692_10380415 Ga0207692_103804152 99
742 3300025899 Ga0207642_10000312 Ga0207642_100003127 99
743 3300025899 Ga0207642_10056787 Ga0207642_100567872 99
744 3300025900 Ga0207710_10000060 Ga0207710_1000006097 99
745 3300025900 Ga0207710_10000890 Ga0207710_1000089017 99
746 3300025900 Ga0207710_10130368 Ga0207710_101303683 99
747 3300025901 Ga0207688_10000177 Ga0207688_100001771 99
748 3300025901 Ga0207688_10000841 Ga0207688_1000084117 99
749 3300025903 Ga0207680_10060009 Ga0207680_100600092 99
750 3300025903 Ga0207680_10107266 Ga0207680_101072663 99
751 3300025903 Ga0207680_10235641 Ga0207680_102356413 99
752 3300025903 Ga0207680_10600805 Ga0207680_106008052 99
753 3300025904 Ga0207647_10014202 Ga0207647_100142022 99
754 3300025904 Ga0207647_10028202 Ga0207647_100282024 99
755 3300025905 Ga0207685_10001135 Ga0207685_100011354 99
756 3300025905 Ga0207685_10010029 Ga0207685_100100292 99
757 3300025906 Ga0207699_10126702 Ga0207699_101267022 99
758 3300025906 Ga0207699_10282730 Ga0207699_102827302 99
759 3300025907 Ga0207645_10042119 Ga0207645_100421192 99
760 3300025908 Ga0207643_10540021 Ga0207643_105400212 99
761 3300025908 Ga0207643_10579470 Ga0207643_105794701 99
762 3300025909 Ga0207705_10002093 Ga0207705_100020936 99
763 3300025909 Ga0207705_10486828 Ga0207705_104868282 99
764 3300025911 Ga0207654_10071715 Ga0207654_100717153 99
765 3300025911 Ga0207654_10288853 Ga0207654_102888532 99
766 3300025912 Ga0207707_10000277 Ga0207707_1000027746 99
767 3300025912 Ga0207707_10167030 Ga0207707_101670303 99
768 3300025912 Ga0207707_11302555 Ga0207707_113025552 99
769 3300025914 Ga0207671_10009964 Ga0207671_100099647 99
770 3300025914 Ga0207671_10018152 Ga0207671_100181525 99
771 3300025914 Ga0207671_10027045 Ga0207671_100270452 99
772 3300025914 Ga0207671_10151176 Ga0207671_101511762 99
773 3300025914 Ga0207671_10821232 Ga0207671_108212322 99
774 3300025914 Ga0207671_11168870 Ga0207671_111688701 99
775 3300025915 Ga0207693_10000339 Ga0207693_1000033947 99
776 3300025915 Ga0207693_10000602 Ga0207693_100006023 99
777 3300025915 Ga0207693_10217813 Ga0207693_102178132 99
778 3300025916 Ga0207663_10000907 Ga0207663_100009077 99
779 3300025916 Ga0207663_10122657 Ga0207663_101226572 99
780 3300025916 Ga0207663_11001168 Ga0207663_110011682 99
781 3300025917 Ga0207660_10000115 Ga0207660_1000011525 99
782 3300025917 Ga0207660_10111634 Ga0207660_101116342 99
783 3300025917 Ga0207660_10521538 Ga0207660_105215382 99
784 3300025917 Ga0207660_10831956 Ga0207660_108319562 99
785 3300025917 Ga0207660_11033446 Ga0207660_110334462 99
786 3300025918 Ga0207662_10075302 Ga0207662_100753023 99
787 3300025918 Ga0207662_11040064 Ga0207662_110400641 99
788 3300025919 Ga0207657_10095827 Ga0207657_100958272 99
789 3300025919 Ga0207657_10164966 Ga0207657_101649662 99
790 3300025920 Ga0207649_11409531 Ga0207649_114095311 99
791 3300025920 Ga0207649_11674196 Ga0207649_116741962 99
792 3300025921 Ga0207652_10000333 Ga0207652_100003336 99
793 3300025921 Ga0207652_10547270 Ga0207652_105472702 99
794 3300025922 Ga0207646_10636104 Ga0207646_106361042 99
795 3300025922 Ga0207646_10832617 Ga0207646_108326171 99
796 3300025923 Ga0207681_10000788 Ga0207681_1000078825 99
797 3300025923 Ga0207681_10086689 Ga0207681_100866892 99
798 3300025924 Ga0207694_10048982 Ga0207694_100489822 99
799 3300025924 Ga0207694_10183839 Ga0207694_101838392 99
800 3300025924 Ga0207694_10632582 Ga0207694_106325822 99
801 3300025924 Ga0207694_11119059 Ga0207694_111190592 99
802 3300025925 Ga0207650_10129186 Ga0207650_101291862 99
803 3300025926 Ga0207659_10510272 Ga0207659_105102721 99
804 3300025926 Ga0207659_10968259 Ga0207659_109682591 99
805 3300025926 Ga0207659_11137339 Ga0207659_111373392 99
806 3300025927 Ga0207687_10001983 Ga0207687_100019836 99
807 3300025927 Ga0207687_10102936 Ga0207687_101029362 99
808 3300025927 Ga0207687_10302244 Ga0207687_103022442 99
809 3300025927 Ga0207687_10940733 Ga0207687_109407332 99
810 3300025928 Ga0207700_10070676 Ga0207700_100706762 99
811 3300025928 Ga0207700_10181688 Ga0207700_101816883 99
812 3300025928 Ga0207700_10206533 Ga0207700_102065332 99
813 3300025928 Ga0207700_10271142 Ga0207700_102711421 99
814 3300025928 Ga0207700_10298691 Ga0207700_102986912 99
815 3300025928 Ga0207700_10461851 Ga0207700_104618512 99
816 3300025929 Ga0207664_10068406 Ga0207664_100684062 99
817 3300025929 Ga0207664_10324477 Ga0207664_103244772 99
818 3300025929 Ga0207664_10569422 Ga0207664_105694222 99
819 3300025929 Ga0207664_10677795 Ga0207664_106777952 99
820 3300025929 Ga0207664_11686089 Ga0207664_116860892 99
821 3300025931 Ga0207644_10004647 Ga0207644_100046472 99
822 3300025931 Ga0207644_10020065 Ga0207644_100200655 99
823 3300025931 Ga0207644_10207081 Ga0207644_102070812 99
824 3300025932 Ga0207690_10024212 Ga0207690_100242125 99
825 3300025932 Ga0207690_10061631 Ga0207690_100616312 99
826 3300025932 Ga0207690_10851592 Ga0207690_108515922 99
827 3300025933 Ga0207706_10002589 Ga0207706_1000258920 99
828 3300025934 Ga0207686_10001637 Ga0207686_100016372 99
829 3300025934 Ga0207686_10750390 Ga0207686_107503902 99
830 3300025934 Ga0207686_10789993 Ga0207686_107899932 99
831 3300025935 Ga0207709_10001393 Ga0207709_1000139313 99
832 3300025935 Ga0207709_10074674 Ga0207709_100746742 99
833 3300025935 Ga0207709_10183433 Ga0207709_101834331 99
834 3300025935 Ga0207709_10222341 Ga0207709_102223412 99
835 3300025935 Ga0207709_10326906 Ga0207709_103269062 99
836 3300025935 Ga0207709_11668838 Ga0207709_116688382 99
837 3300025936 Ga0207670_10012017 Ga0207670_100120174 99
838 3300025936 Ga0207670_10739642 Ga0207670_107396422 99
839 3300025936 Ga0207670_11054097 Ga0207670_110540972 99
840 3300025937 Ga0207669_10000205 Ga0207669_1000020510 99
841 3300025937 Ga0207669_10211685 Ga0207669_102116852 99
842 3300025937 Ga0207669_10655942 Ga0207669_106559422 99
843 3300025937 Ga0207669_10744014 Ga0207669_107440141 99
844 3300025937 Ga0207669_11018226 Ga0207669_110182262 99
845 3300025937 Ga0207669_11532880 Ga0207669_115328802 99
846 3300025937 Ga0207669_11791100 Ga0207669_117911002 99
847 3300025938 Ga0207704_10000618 Ga0207704_100006184 99
848 3300025938 Ga0207704_10209532 Ga0207704_102095322 99
849 3300025938 Ga0207704_10361902 Ga0207704_103619023 99
850 3300025938 Ga0207704_11617637 Ga0207704_116176372 99
851 3300025939 Ga0207665_10008088 Ga0207665_100080885 99
852 3300025939 Ga0207665_10011512 Ga0207665_100115125 99
853 3300025939 Ga0207665_10142777 Ga0207665_101427773 99
854 3300025940 Ga0207691_10548394 Ga0207691_105483942 99
855 3300025941 Ga0207711_10000073 Ga0207711_1000007392 99
856 3300025941 Ga0207711_10061372 Ga0207711_100613724 99
857 3300025941 Ga0207711_10157899 Ga0207711_101578992 99
858 3300025941 Ga0207711_10536245 Ga0207711_105362452 99
859 3300025941 Ga0207711_10731525 Ga0207711_107315252 99
860 3300025941 Ga0207711_11955454 Ga0207711_119554541 99
861 3300025942 Ga0207689_10133901 Ga0207689_101339014 99
862 3300025942 Ga0207689_11283094 Ga0207689_112830942 99
863 3300025944 Ga0207661_10086949 Ga0207661_100869492 99
864 3300025944 Ga0207661_10290851 Ga0207661_102908512 99
865 3300025944 Ga0207661_10627582 Ga0207661_106275822 99
866 3300025944 Ga0207661_10735585 Ga0207661_107355851 99
867 3300025944 Ga0207661_10932794 Ga0207661_109327942 99
868 3300025944 Ga0207661_11837205 Ga0207661_118372052 99
869 3300025945 Ga0207679_11528043 Ga0207679_115280432 99
870 3300025949 Ga0207667_10183276 Ga0207667_101832762 99
871 3300025949 Ga0207667_10328404 Ga0207667_103284043 99
872 3300025949 Ga0207667_10705552 Ga0207667_107055522 99
873 3300025949 Ga0207667_11257202 Ga0207667_112572022 99
874 3300025960 Ga0207651_10223155 Ga0207651_102231552 99
875 3300025960 Ga0207651_10270943 Ga0207651_102709431 99
876 3300025961 Ga0207712_10000042 Ga0207712_1000004250 99
877 3300025961 Ga0207712_10072184 Ga0207712_100721843 99
878 3300025961 Ga0207712_10754948 Ga0207712_107549481 99
879 3300025961 Ga0207712_12019647 Ga0207712_120196472 99
880 3300025972 Ga0207668_10006306 Ga0207668_100063066 99
881 3300025972 Ga0207668_10013064 Ga0207668_100130642 99
882 3300025972 Ga0207668_10048285 Ga0207668_100482854 99
883 3300025972 Ga0207668_10753972 Ga0207668_107539722 99
884 3300025981 Ga0207640_10003341 Ga0207640_100033414 99
885 3300025981 Ga0207640_10131790 Ga0207640_101317902 99
886 3300025981 Ga0207640_10477580 Ga0207640_104775802 99
887 3300025981 Ga0207640_10671311 Ga0207640_106713111 99
888 3300025986 Ga0207658_10000449 Ga0207658_1000044931 99
889 3300025986 Ga0207658_10000664 Ga0207658_100006648 99
890 3300025986 Ga0207658_10003954 Ga0207658_100039546 99
891 3300025986 Ga0207658_10004460 Ga0207658_100044603 99
892 3300025986 Ga0207658_10069437 Ga0207658_100694372 99
893 3300025986 Ga0207658_10451997 Ga0207658_104519972 99
894 3300025986 Ga0207658_10852948 Ga0207658_108529482 99
895 3300025986 Ga0207658_11072789 Ga0207658_110727892 99
896 3300025986 Ga0207658_11902673 Ga0207658_119026732 99
897 3300026023 Ga0207677_10016196 Ga0207677_100161962 99
898 3300026023 Ga0207677_10257633 Ga0207677_102576332 99
899 3300026035 Ga0207703_10002964 Ga0207703_100029645 99
900 3300026035 Ga0207703_10059815 Ga0207703_100598153 99
901 3300026035 Ga0207703_10063785 Ga0207703_100637852 99
902 3300026035 Ga0207703_10065586 Ga0207703_100655862 99
903 3300026035 Ga0207703_10151622 Ga0207703_101516222 99
904 3300026035 Ga0207703_10414917 Ga0207703_104149172 99
905 3300026035 Ga0207703_10731486 Ga0207703_107314862 99
906 3300026035 Ga0207703_11092095 Ga0207703_110920952 99
907 3300026041 Ga0207639_10038681 Ga0207639_100386811 99
908 3300026041 Ga0207639_10379569 Ga0207639_103795693 99
909 3300026041 Ga0207639_10793787 Ga0207639_107937872 99
910 3300026041 Ga0207639_10973081 Ga0207639_109730812 99
911 3300026067 Ga0207678_10007047 Ga0207678_100070477 99
912 3300026067 Ga0207678_10118193 Ga0207678_101181932 99
913 3300026067 Ga0207678_10122695 Ga0207678_101226953 99
914 3300026067 Ga0207678_10795511 Ga0207678_107955112 99
915 3300026067 Ga0207678_10930460 Ga0207678_109304602 99
916 3300026067 Ga0207678_11078487 Ga0207678_110784872 99
917 3300026067 Ga0207678_11382732 Ga0207678_113827322 99
918 3300026075 Ga0207708_10003891 Ga0207708_100038913 99
919 3300026075 Ga0207708_10041519 Ga0207708_100415192 99
920 3300026075 Ga0207708_10738176 Ga0207708_107381761 99
921 3300026078 Ga0207702_10903480 Ga0207702_109034802 99
922 3300026078 Ga0207702_12014144 Ga0207702_120141442 99
923 3300026088 Ga0207641_10001094 Ga0207641_1000109423 99
924 3300026088 Ga0207641_10015008 Ga0207641_100150085 99
925 3300026088 Ga0207641_10027939 Ga0207641_100279392 99
926 3300026088 Ga0207641_10070874 Ga0207641_100708742 99
927 3300026088 Ga0207641_10094126 Ga0207641_100941264 99
928 3300026088 Ga0207641_10468585 Ga0207641_104685852 99
929 3300026088 Ga0207641_11917341 Ga0207641_119173412 99
930 3300026089 Ga0207648_10000623 Ga0207648_1000062343 99
931 3300026089 Ga0207648_10047022 Ga0207648_100470222 99
932 3300026089 Ga0207648_11638071 Ga0207648_116380711 99
933 3300026095 Ga0207676_10017255 Ga0207676_100172552 99
934 3300026095 Ga0207676_10203343 Ga0207676_102033432 99
935 3300026095 Ga0207676_10343914 Ga0207676_103439142 99
936 3300026095 Ga0207676_10985563 Ga0207676_109855632 99
937 3300026095 Ga0207676_11040120 Ga0207676_110401202 99
938 3300026095 Ga0207676_11369694 Ga0207676_113696942 99
939 3300026095 Ga0207676_11741940 Ga0207676_117419402 99
940 3300026095 Ga0207676_11947419 Ga0207676_119474192 99
941 3300026116 Ga0207674_10296717 Ga0207674_102967172 99
942 3300026116 Ga0207674_10500764 Ga0207674_105007642 99
943 3300026118 Ga0207675_100001672 Ga0207675_1000016723 99
944 3300026118 Ga0207675_100533225 Ga0207675_1005332252 99
945 3300026118 Ga0207675_101185188 Ga0207675_1011851881 99
946 3300026118 Ga0207675_101475440 Ga0207675_1014754402 99
947 3300026121 Ga0207683_10000539 Ga0207683_100005393 99
948 3300026121 Ga0207683_10017378 Ga0207683_100173783 99
949 3300026121 Ga0207683_10105161 Ga0207683_101051613 99
950 3300026121 Ga0207683_10383305 Ga0207683_103833052 99
951 3300026121 Ga0207683_10495393 Ga0207683_104953932 99
952 3300026121 Ga0207683_10507853 Ga0207683_105078532 99
953 3300026121 Ga0207683_10717855 Ga0207683_107178552 99
954 3300026142 Ga0207698_10047163 Ga0207698_100471632 99
955 3300026142 Ga0207698_10102226 Ga0207698_101022262 99
956 3300026142 Ga0207698_10678063 Ga0207698_106780632 99
957 3300027312 Ga0209371_1029382 Ga0209371_10293822 99
958 3300027512 Ga0209179_1045200 Ga0209179_10452002 99
959 3300027666 Ga0209282_1241770 Ga0209282_12417702 99
960 3300027866 Ga0209813_10018444 Ga0209813_100184442 99
961 3300027866 Ga0209813_10142005 Ga0209813_101420052 99
962 3300027907 Ga0207428_10336973 Ga0207428_103369731 99
963 3300027907 Ga0207428_10532992 Ga0207428_105329922 99
964 3300027907 Ga0207428_10570865 Ga0207428_105708652 99
965 3300028379 Ga0268266_10007218 Ga0268266_100072185 99
966 3300028379 Ga0268266_10012919 Ga0268266_100129195 99
967 3300028379 Ga0268266_10020977 Ga0268266_100209775 99
968 3300028379 Ga0268266_10102670 Ga0268266_101026702 99
969 3300028379 Ga0268266_10156772 Ga0268266_101567722 99
970 3300028380 Ga0268265_10000051 Ga0268265_10000051132 99
971 3300028380 Ga0268265_10003445 Ga0268265_100034456 99
972 3300028380 Ga0268265_10076517 Ga0268265_100765172 99
973 3300028380 Ga0268265_10493002 Ga0268265_104930022 99
974 3300028381 Ga0268264_10000108 Ga0268264_1000010875 99
975 3300028381 Ga0268264_10009938 Ga0268264_100099382 99
976 3300028381 Ga0268264_10197392 Ga0268264_101973921 99
977 3300028381 Ga0268264_10774917 Ga0268264_107749172 99
978 3300028786 Ga0307517_10004659 Ga0307517_100046595 99
979 3300028786 Ga0307517_10036222 Ga0307517_100362222 99
980 3300028786 Ga0307517_10265146 Ga0307517_102651462 99
981 3300028794 Ga0307515_10001177 Ga0307515_1000117727 99
982 3300028794 Ga0307515_10083676 Ga0307515_100836762 99
983 3300028794 Ga0307515_10346614 Ga0307515_103466142 99
984 3300030500 Ga0268256_1023853 Ga0268256_10238532 99
985 3300030521 Ga0307511_10028203 Ga0307511_100282033 99
986 3300030521 Ga0307511_10062540 Ga0307511_100625402 99
987 3300030521 Ga0307511_10132506 Ga0307511_101325062 99
988 3300030521 Ga0307511_10235476 Ga0307511_102354762 99
989 3300030521 Ga0307511_10263096 Ga0307511_102630961 99
990 3300030521 Ga0307511_10276655 Ga0307511_102766552 99
991 3300030521 Ga0307511_10309783 Ga0307511_103097832 99
992 3300030522 Ga0307512_10037650 Ga0307512_100376503 99
993 3300030522 Ga0307512_10064598 Ga0307512_100645982 99
994 3300030522 Ga0307512_10182988 Ga0307512_101829882 99
995 3300030733 Ga0314311_1190625 Ga0314311_11906252 99
996 3300030736 Ga0316180_1107973 Ga0316180_11079732 99
997 3300031251 Ga0265327_10000021 Ga0265327_10000021131 99
998 3300031251 Ga0265327_10000071 Ga0265327_10000071156 99
999 3300031251 Ga0265327_10000630 Ga0265327_1000063017 99
1000 3300031251 Ga0265327_10021466 Ga0265327_100214663 99
1001 3300031456 Ga0307513_10032651 Ga0307513_100326512 99
1002 3300031456 Ga0307513_10033269 Ga0307513_100332692 99
1003 3300031456 Ga0307513_10119884 Ga0307513_101198842 99
1004 3300031456 Ga0307513_10511978 Ga0307513_105119782 99
1005 3300031507 Ga0307509_10169325 Ga0307509_101693252 99
1006 3300031507 Ga0307509_10206018 Ga0307509_102060182 99
1007 3300031507 Ga0307509_10338394 Ga0307509_103383942 99
1008 3300031507 Ga0307509_10441087 Ga0307509_104410872 99
1009 3300031548 Ga0307408_100304208 Ga0307408_1003042082 99
1010 3300031548 Ga0307408_101344318 Ga0307408_1013443182 99
1011 3300031616 Ga0307508_10001775 Ga0307508_100017755 99
1012 3300031616 Ga0307508_10005680 Ga0307508_100056802 99
1013 3300031616 Ga0307508_10020650 Ga0307508_100206504 99
1014 3300031616 Ga0307508_10063849 Ga0307508_100638493 99
1015 3300031616 Ga0307508_10075163 Ga0307508_100751632 99
1016 3300031616 Ga0307508_10117382 Ga0307508_101173823 99
1017 3300031649 Ga0307514_10036472 Ga0307514_100364723 99
1018 3300031649 Ga0307514_10119090 Ga0307514_101190902 99
1019 3300031649 Ga0307514_10190602 Ga0307514_101906022 99
1020 3300031691 Ga0316579_10047194 Ga0316579_100471942 99
1021 3300031691 Ga0316579_10445263 Ga0316579_104452631 99
1022 3300031727 Ga0316576_10557500 Ga0316576_105575002 99
1023 3300031728 Ga0316578_10054210 Ga0316578_100542102 99
1024 3300031730 Ga0307516_10007060 Ga0307516_100070609 99
1025 3300031730 Ga0307516_10023113 Ga0307516_100231134 99
1026 3300031730 Ga0307516_10048980 Ga0307516_100489802 99
1027 3300031731 Ga0307405_10106270 Ga0307405_101062703 99
1028 3300031731 Ga0307405_10763497 Ga0307405_107634972 99
1029 3300031731 Ga0307405_11497678 Ga0307405_114976781 99
1030 3300031733 Ga0316577_10698771 Ga0316577_106987712 99
1031 3300031824 Ga0307413_10179235 Ga0307413_101792352 99
1032 3300031824 Ga0307413_10760075 Ga0307413_107600752 99
1033 3300031824 Ga0307413_10963802 Ga0307413_109638022 99
1034 3300031838 Ga0307518_10156737 Ga0307518_101567373 99
1035 3300031852 Ga0307410_10005427 Ga0307410_100054274 99
1036 3300031852 Ga0307410_10050900 Ga0307410_100509002 99
1037 3300031852 Ga0307410_10154260 Ga0307410_101542601 99
1038 3300031852 Ga0307410_11219754 Ga0307410_112197542 99
1039 3300031901 Ga0307406_10986100 Ga0307406_109861001 99
1040 3300031901 Ga0307406_11413939 Ga0307406_114139392 99
1041 3300031903 Ga0307407_10015605 Ga0307407_100156055 99
1042 3300031903 Ga0307407_11702345 Ga0307407_117023452 99
1043 3300031911 Ga0307412_10273546 Ga0307412_102735462 99
1044 3300031911 Ga0307412_11572325 Ga0307412_115723252 99
1045 3300031995 Ga0307409_100037553 Ga0307409_1000375533 99
1046 3300031995 Ga0307409_100205427 Ga0307409_1002054273 99
1047 3300031995 Ga0307409_100326649 Ga0307409_1003266492 99
1048 3300031995 Ga0307409_100387209 Ga0307409_1003872092 99
1049 3300031995 Ga0307409_100641406 Ga0307409_1006414062 99
1050 3300031995 Ga0307409_100815775 Ga0307409_1008157751 99
1051 3300031995 Ga0307409_102616151 Ga0307409_1026161511 99
1052 3300032002 Ga0307416_100056416 Ga0307416_1000564162 99
1053 3300032002 Ga0307416_100107718 Ga0307416_1001077182 99
1054 3300032002 Ga0307416_100436088 Ga0307416_1004360882 99
1055 3300032002 Ga0307416_101380328 Ga0307416_1013803282 99
1056 3300032002 Ga0307416_101534811 Ga0307416_1015348112 99
1057 3300032002 Ga0307416_103859158 Ga0307416_1038591582 99
1058 3300032005 Ga0307411_10140216 Ga0307411_101402162 99
1059 3300032005 Ga0307411_10561258 Ga0307411_105612582 99
1060 3300032126 Ga0307415_100728871 Ga0307415_1007288712 99
1061 3300032126 Ga0307415_101508448 Ga0307415_1015084482 99
1062 3300032133 Ga0316583_10012794 Ga0316583_100127942 99
1063 3300033179 Ga0307507_10000732 Ga0307507_1000073256 99
1064 3300033179 Ga0307507_10642080 Ga0307507_106420802 99
1065 3300033180 Ga0307510_10035723 Ga0307510_100357232 99
1066 3300033180 Ga0307510_10088739 Ga0307510_100887392 99
1067 3300033180 Ga0307510_10284835 Ga0307510_102848352 99
1068 3300033180 Ga0307510_10416505 Ga0307510_104165051 99
1069 3300033180 Ga0307510_10651932 Ga0307510_106519322 99
1070 3300034816 Ga0373930_0210188 Ga0373930_0210188_52_351 99
1071 3300034957 Ga0373938_0069430 Ga0373938_0069430_510_809 99
1072 3300035084 Ga0373928_0105733 Ga0373928_0105733_265_564 99
1073 3300035085 Ga0373929_0151968 Ga0373929_0151968_50_349 99
1074 3300035088 Ga0373940_0078051 Ga0373940_0078051_533_832 99
1075 3300035091 Ga0373951_0066451 Ga0373951_0066451_393_692 99
1076 3300035112 Ga0373932_0036929 Ga0373932_0036929_992_1291 99
1077 3300035114 Ga0373939_0420583 Ga0373939_0420583_86_385 99
1078 3300035121 Ga0373960_0036799 Ga0373960_0036799_276_575 99
1079 3300035207 Ga0373942_0032327 Ga0373942_0032327_399_698 99
1080 3300035207 Ga0373942_0078542 Ga0373942_0078542_89_388 99
1081 3300035241 Ga0373961_0094945 Ga0373961_0094945_605_904 99
1082 3300035242 Ga0373962_0012789 Ga0373962_0012789_1169_1468 99
1083 3300035242 Ga0373962_0013224 Ga0373962_0013224_977_1276 99
1084 3300035398 Ga0316574_0078180 Ga0316574_0078180_1632_1931 99
1085 3300035410 Ga0373924_0452019 Ga0373924_0452019_116_415 99
1086 3300035691 Ga0373931_0011218 Ga0373931_0011218_1927_2226 99
1087 3300036712 Ga0316584_0053682 Ga0316584_0053682_1924_2223 99
1088 3300037312 Ga0395899_0013414 Ga0395899_0013414_2091_2390 99
1089 3300037312 Ga0395899_0748419 Ga0395899_0748419_288_587 99
1090 3300037418 Ga0395900_0075741 Ga0395900_0075741_2683_2982 99
1091 3300037418 Ga0395900_0427612 Ga0395900_0427612_341_640 99
1092 3300037466 Ga0395898_0006692 Ga0395898_0006692_11050_11349 99
1093 3300037466 Ga0395898_0017702 Ga0395898_0017702_1845_2144 99
1094 3300037471 Ga0395905_0069865 Ga0395905_0069865_2376_2675 99
1095 3300037471 Ga0395905_0528676 Ga0395905_0528676_34_333 99
1096 3300037471 Ga0395905_0686939 Ga0395905_0686939_461_760 99
1097 3300037588 Ga0316581_0167237 Ga0316581_0167237_276_575 99
1098 3300037853 Ga0436364_0195317 Ga0436364_0195317_1512_1811 99
1099 3300037853 Ga0436364_0229870 Ga0436364_0229870_548_847 99
1100 3300037853 Ga0436364_1150617 Ga0436364_1150617_421_720 99
1101 3300037853 Ga0436364_1291536 Ga0436364_1291536_9439_9738 99
1102 3300038443 Ga0395901_0100975 Ga0395901_0100975_2354_2653 99
1103 3300038443 Ga0395901_0550223 Ga0395901_0550223_282_581 99
1104 3300039437 Ga0436365_0678211 Ga0436365_0678211_10081_10380 99
1105 3300039437 Ga0436365_0939033 Ga0436365_0939033_38138_38437 99
1106 3300039437 Ga0436365_0941882 Ga0436365_0941882_392_691 99
1107 3300039437 Ga0436365_1035060 Ga0436365_1035060_2909_3208 99
1108 3300039437 Ga0436365_1714810 Ga0436365_1714810_184_483 99
1109 3300039437 Ga0436365_1908396 Ga0436365_1908396_14643_14942 99
1110 3300039438 Ga0436360_0804941 Ga0436360_0804941_554_853 99
1111 3300039447 Ga0436361_0716923 Ga0436361_0716923_125_424 99
1112 3300039447 Ga0436361_1194425 Ga0436361_1194425_444_743 99
1113 3300039450 Ga0436363_0444811 Ga0436363_0444811_1449_1748 99
1114 3300039450 Ga0436363_0754104 Ga0436363_0754104_797_1096 99
1115 3300039450 Ga0436363_1709932 Ga0436363_1709932_531_830 99
1116 3300039453 Ga0436362_0757592 Ga0436362_0757592_91_390 99
1117 3300039453 Ga0436362_1212714 Ga0436362_1212714_80_379 99
1118 3300041406 Ga0439439_0009171 Ga0439439_0009171_733_1032 99
1119 3300041406 Ga0439439_0047088 Ga0439439_0047088_470_769 99
1120 3300041410 Ga0439461_0013378 Ga0439461_0013378_302_601 99
1121 3300041410 Ga0439461_0014671 Ga0439461_0014671_32_343 99
1122 3300041410 Ga0439461_0024659 Ga0439461_0024659_585_884 99
1123 3300041411 Ga0439466_0003274 Ga0439466_0003274_5270_5569 99
1124 3300041411 Ga0439466_0008207 Ga0439466_0008207_892_1191 99
1125 3300041411 Ga0439466_0013164 Ga0439466_0013164_2255_2554 99
1126 3300041411 Ga0439466_0035103 Ga0439466_0035103_1375_1686 99
1127 3300041413 Ga0439465_0011614 Ga0439465_0011614_1074_1373 99
1128 3300041413 Ga0439465_0013051 Ga0439465_0013051_496_807 99
1129 3300041413 Ga0439465_0034846 Ga0439465_0034846_308_607 99
1130 3300041413 Ga0439465_0131683 Ga0439465_0131683_253_552 99
1131 3300041413 Ga0439465_0336671 Ga0439465_0336671_243_542 99
1132 3300041443 Ga0451789_0165262 Ga0451789_0165262_232_531 99
1133 3300041443 Ga0451789_0361298 Ga0451789_0361298_189_488 99
1134 3300041451 Ga0451791_0176299 Ga0451791_0176299_1068_1367 99
1135 3300041451 Ga0451791_0923786 Ga0451791_0923786_570_869 99
1136 3300041452 Ga0451793_0050578 Ga0451793_0050578_222_521 99
1137 3300041452 Ga0451793_0165491 Ga0451793_0165491_655_954 99
1138 3300041452 Ga0451793_0382258 Ga0451793_0382258_263_562 99
1139 3300041453 Ga0451797_0462824 Ga0451797_0462824_29_328 99
1140 3300041453 Ga0451797_0777865 Ga0451797_0777865_452_751 99
1141 3300041459 Ga0451800_0949963 Ga0451800_0949963_861_1160 99
1142 3300041460 Ga0451802_0290968 Ga0451802_0290968_292_591 99
1143 3300041460 Ga0451802_1000802 Ga0451802_1000802_374_673 99
1144 3300041462 Ga0451806_545077 Ga0451806_545077_252_551 99
1145 3300041463 Ga0451804_0768388 Ga0451804_0768388_121_420 99
1146 3300041486 Ga0451807_1186087 Ga0451807_1186087_137_436 99
1147 3300041486 Ga0451807_1334898 Ga0451807_1334898_531_830 99
1148 3300041486 Ga0451807_2088134 Ga0451807_2088134_225_524 99
1149 3300041491 Ga0451833_0440069 Ga0451833_0440069_549_848 99
1150 3300041492 Ga0451835_0852016 Ga0451835_0852016_214_513 99
1151 3300041494 Ga0451837_0509056 Ga0451837_0509056_734_1033 99
1152 3300041496 Ga0451839_0168767 Ga0451839_0168767_221_520 99
1153 3300041498 Ga0451841_0295423 Ga0451841_0295423_364_663 99
1154 3300041498 Ga0451841_1253551 Ga0451841_1253551_179_478 99
1155 3300041501 Ga0451845_0166486 Ga0451845_0166486_323_622 99
1156 3300041507 Ga0451851_1033401 Ga0451851_1033401_564_863 99
1157 3300041509 Ga0451843_0901391 Ga0451843_0901391_146_445 99
1158 3300041509 Ga0451843_1680136 Ga0451843_1680136_466_765 99
1159 3300041512 Ga0451853_0050097 Ga0451853_0050097_56_355 99
1160 3300041512 Ga0451853_0425702 Ga0451853_0425702_78_377 99
1161 3300041512 Ga0451853_0450169 Ga0451853_0450169_231_530 99
1162 3300041512 Ga0451853_1037975 Ga0451853_1037975_160_459 99
1163 3300041512 Ga0451853_2284613 Ga0451853_2284613_146_445 99
1164 3300041512 Ga0451853_3283147 Ga0451853_3283147_1043_1342 99
1165 3300041512 Ga0451853_3835888 Ga0451853_3835888_582_881 99
1166 3300041512 Ga0451853_3894526 Ga0451853_3894526_700_999 99
1167 3300041997 Ga0439431_0007821 Ga0439431_0007821_1454_1753 99
1168 3300041997 Ga0439431_0100112 Ga0439431_0100112_31_330 99
1169 3300041999 Ga0439433_0008537 Ga0439433_0008537_236_535 99
1170 3300041999 Ga0439433_0014215 Ga0439433_0014215_628_927 99
1171 3300042002 Ga0439442_016793 Ga0439442_016793_825_1124 99
1172 3300042002 Ga0439442_024566 Ga0439442_024566_578_877 99
1173 3300042004 Ga0439445_0001826 Ga0439445_0001826_640_939 99
1174 3300042004 Ga0439445_0101398 Ga0439445_0101398_178_477 99
1175 3300042004 Ga0439445_0135614 Ga0439445_0135614_211_510 99
1176 3300042004 Ga0439445_0147093 Ga0439445_0147093_203_502 99
1177 3300042004 Ga0439445_0262242 Ga0439445_0262242_182_493 99
1178 3300042005 Ga0439448_0004693 Ga0439448_0004693_1217_1516 99
1179 3300042005 Ga0439448_0130866 Ga0439448_0130866_554_853 99
1180 3300042005 Ga0439448_0175236 Ga0439448_0175236_152_451 99
1181 3300042005 Ga0439448_0234069 Ga0439448_0234069_31_330 99
1182 3300042007 Ga0439449_0069372 Ga0439449_0069372_756_1055 99
1183 3300042008 Ga0439450_069576 Ga0439450_069576_114_413 99
1184 3300042011 Ga0439454_050955 Ga0439454_050955_193_492 99
1185 3300042012 Ga0439455_0075109 Ga0439455_0075109_212_511 99
1186 3300042012 Ga0439455_0197971 Ga0439455_0197971_87_386 99
1187 3300042014 Ga0439457_000455 Ga0439457_000455_4535_4834 99
1188 3300042014 Ga0439457_000479 Ga0439457_000479_9097_9396 99
1189 3300042014 Ga0439457_044746 Ga0439457_044746_131_430 99
1190 3300042015 Ga0439462_0024184 Ga0439462_0024184_815_1114 99
1191 3300042016 Ga0439463_161594 Ga0439463_161594_108_407 99
1192 3300042127 Ga0450890_011941 Ga0450890_011941_132_431 99
1193 3300042131 Ga0450894_000142 Ga0450894_000142_8227_8526 99
1194 3300042132 Ga0450895_001889 Ga0450895_001889_1120_1419 99
1195 3300042134 Ga0450898_023027 Ga0450898_023027_426_725 99
1196 3300042134 Ga0450898_034090 Ga0450898_034090_465_764 99
1197 3300042136 Ga0450900_015664 Ga0450900_015664_531_830 99
1198 3300042138 Ga0450903_000121 Ga0450903_000121_15952_16251 99
1199 3300042145 Ga0450906_002225 Ga0450906_002225_3897_4196 99
1200 3300042157 Ga0439458_0001134 Ga0439458_0001134_4055_4354 99
1201 3300042157 Ga0439458_0025509 Ga0439458_0025509_758_1057 99
1202 3300042184 Ga0450908_070131 Ga0450908_070131_210_509 99
1203 3300042435 Ga0439434_0010812 Ga0439434_0010812_892_1191 99
1204 3300042435 Ga0439434_0016765 Ga0439434_0016765_919_1230 99
1205 3300042435 Ga0439434_0018207 Ga0439434_0018207_966_1265 99
1206 3300042436 Ga0439435_0023314 Ga0439435_0023314_1004_1303 99
1207 3300042436 Ga0439435_0290320 Ga0439435_0290320_24_323 99
1208 3300042438 Ga0439459_0003093 Ga0439459_0003093_1231_1530 99
1209 3300042533 Ga0450901_024223 Ga0450901_024223_28_327 99
1210 3300042876 Ga0451577_0101787 Ga0451577_0101787_2171_2470 99
1211 3300042993 Ga0439440_0260273 Ga0439440_0260273_148_447 99
1212 3300044656 Ga0466969_0000470 Ga0466969_0000470_17242_17541 99
1213 3300044656 Ga0466969_0005382 Ga0466969_0005382_1398_1697 99
1214 3300044656 Ga0466969_0009133 Ga0466969_0009133_175_474 99
1215 3300044656 Ga0466969_0020850 Ga0466969_0020850_1434_1733 99
1216 3300044656 Ga0466969_0034108 Ga0466969_0034108_2086_2385 99
1217 3300044656 Ga0466969_0056244 Ga0466969_0056244_535_834 99
1218 3300044656 Ga0466969_0063027 Ga0466969_0063027_304_603 99
1219 3300044656 Ga0466969_0106363 Ga0466969_0106363_956_1255 99
1220 3300044656 Ga0466969_0345685 Ga0466969_0345685_218_517 99
1221 3300044658 Ga0466972_0005853 Ga0466972_0005853_4648_4947 99
1222 3300044658 Ga0466972_0036904 Ga0466972_0036904_1192_1491 99
1223 3300044658 Ga0466972_0038891 Ga0466972_0038891_1633_1932 99
1224 3300044658 Ga0466972_0095647 Ga0466972_0095647_1036_1344 99
1225 3300044658 Ga0466972_0119432 Ga0466972_0119432_473_772 99
1226 3300044658 Ga0466972_0120005 Ga0466972_0120005_397_696 99
1227 3300044658 Ga0466972_0132419 Ga0466972_0132419_795_1094 99
1228 3300044658 Ga0466972_0152676 Ga0466972_0152676_61_360 99
1229 3300044658 Ga0466972_0246199 Ga0466972_0246199_116_415 99
1230 3300044658 Ga0466972_0341192 Ga0466972_0341192_243_542 99
1231 3300044683 Ga0466965_0005281 Ga0466965_0005281_2350_2658 99
1232 3300044683 Ga0466965_0008504 Ga0466965_0008504_2558_2857 99
1233 3300044683 Ga0466965_0023201 Ga0466965_0023201_487_786 99
1234 3300044683 Ga0466965_0023923 Ga0466965_0023923_861_1160 99
1235 3300044683 Ga0466965_0065885 Ga0466965_0065885_380_679 99
1236 3300044683 Ga0466965_0077985 Ga0466965_0077985_793_1092 99
1237 3300044683 Ga0466965_0112919 Ga0466965_0112919_273_572 99
1238 3300044683 Ga0466965_0291718 Ga0466965_0291718_58_357 99
1239 3300044683 Ga0466965_0561309 Ga0466965_0561309_286_585 99
1240 3300044684 Ga0466966_0002225 Ga0466966_0002225_1613_1912 99
1241 3300044684 Ga0466966_0002809 Ga0466966_0002809_9322_9621 99
1242 3300044684 Ga0466966_0002940 Ga0466966_0002940_7143_7442 99
1243 3300044684 Ga0466966_0003767 Ga0466966_0003767_1307_1606 99
1244 3300044684 Ga0466966_0007557 Ga0466966_0007557_1755_2054 99
1245 3300044684 Ga0466966_0010373 Ga0466966_0010373_2091_2390 99
1246 3300044684 Ga0466966_0056388 Ga0466966_0056388_2174_2473 99
1247 3300044684 Ga0466966_0074389 Ga0466966_0074389_1226_1525 99
1248 3300044684 Ga0466966_0092900 Ga0466966_0092900_150_449 99
1249 3300044684 Ga0466966_0653277 Ga0466966_0653277_285_584 99
1250 3300044693 Ga0466961_0002350 Ga0466961_0002350_11052_11351 99
1251 3300044693 Ga0466961_0004001 Ga0466961_0004001_6820_7119 99
1252 3300044693 Ga0466961_0006257 Ga0466961_0006257_1235_1534 99
1253 3300044693 Ga0466961_0008642 Ga0466961_0008642_2668_2967 99
1254 3300044693 Ga0466961_0020414 Ga0466961_0020414_2421_2720 99
1255 3300044693 Ga0466961_0032599 Ga0466961_0032599_626_925 99
1256 3300044693 Ga0466961_0136461 Ga0466961_0136461_10_309 99
1257 3300044693 Ga0466961_0162770 Ga0466961_0162770_718_1017 99
1258 3300044693 Ga0466961_0259254 Ga0466961_0259254_638_937 99
1259 3300044693 Ga0466961_0385157 Ga0466961_0385157_521_820 99
1260 3300044693 Ga0466961_0746316 Ga0466961_0746316_149_448 99
1261 3300044693 Ga0466961_0917618 Ga0466961_0917618_15_314 99
1262 3300044693 Ga0466961_0926254 Ga0466961_0926254_196_495 99
1263 3300044694 Ga0466963_0000656 Ga0466963_0000656_6179_6478 99
1264 3300044694 Ga0466963_0002324 Ga0466963_0002324_8005_8304 99
1265 3300044694 Ga0466963_0062229 Ga0466963_0062229_336_635 99
1266 3300044694 Ga0466963_0097726 Ga0466963_0097726_1135_1434 99
1267 3300044694 Ga0466963_0117681 Ga0466963_0117681_1003_1302 99
1268 3300044694 Ga0466963_0215321 Ga0466963_0215321_677_976 99
1269 3300044694 Ga0466963_0286500 Ga0466963_0286500_428_727 99
1270 3300044694 Ga0466963_0375967 Ga0466963_0375967_506_805 99
1271 3300044694 Ga0466963_0821591 Ga0466963_0821591_154_453 99
1272 3300044706 Ga0466964_0065505 Ga0466964_0065505_1207_1506 99
1273 3300044706 Ga0466964_0120091 Ga0466964_0120091_445_744 99
1274 3300044706 Ga0466964_0139210 Ga0466964_0139210_391_690 99
1275 3300044706 Ga0466964_0658092 Ga0466964_0658092_262_561 99
1276 3300044719 Ga0466971_0000161 Ga0466971_0000161_16843_17142 99
1277 3300044719 Ga0466971_0009498 Ga0466971_0009498_1936_2235 99
1278 3300044719 Ga0466971_0010470 Ga0466971_0010470_1398_1697 99
1279 3300044719 Ga0466971_0037329 Ga0466971_0037329_1860_2159 99
1280 3300044719 Ga0466971_0038008 Ga0466971_0038008_1634_1933 99
1281 3300044719 Ga0466971_0104911 Ga0466971_0104911_188_487 99
1282 3300044719 Ga0466971_0194357 Ga0466971_0194357_64_363 99
1283 3300044719 Ga0466971_0204873 Ga0466971_0204873_596_895 99
1284 3300044719 Ga0466971_0245318 Ga0466971_0245318_505_804 99
1285 3300044735 Ga0466968_0003026 Ga0466968_0003026_5399_5698 99
1286 3300044735 Ga0466968_0004670 Ga0466968_0004670_2949_3248 99
1287 3300044735 Ga0466968_0017639 Ga0466968_0017639_1597_1896 99
1288 3300044735 Ga0466968_0078172 Ga0466968_0078172_484_783 99
1289 3300044735 Ga0466968_0087905 Ga0466968_0087905_973_1272 99
1290 3300044735 Ga0466968_0133985 Ga0466968_0133985_168_467 99
1291 3300044735 Ga0466968_0204497 Ga0466968_0204497_48_347 99
1292 3300044765 Ga0466970_0002119 Ga0466970_0002119_7669_7968 99
1293 3300044765 Ga0466970_0004779 Ga0466970_0004779_4169_4468 99
1294 3300044765 Ga0466970_0008021 Ga0466970_0008021_3287_3586 99
1295 3300044765 Ga0466970_0010155 Ga0466970_0010155_1390_1689 99
1296 3300044765 Ga0466970_0101681 Ga0466970_0101681_1202_1501 99
1297 3300044765 Ga0466970_0102256 Ga0466970_0102256_610_909 99
1298 3300044765 Ga0466970_0293933 Ga0466970_0293933_416_715 99
1299 3300044765 Ga0466970_0629606 Ga0466970_0629606_291_590 99
1300 3300044765 Ga0466970_0897168 Ga0466970_0897168_104_403 99
1301 3300044842 Ga0466957_0001267 Ga0466957_0001267_6948_7247 99
1302 3300044842 Ga0466957_0006730 Ga0466957_0006730_512_811 99
1303 3300044842 Ga0466957_0019108 Ga0466957_0019108_772_1071 99
1304 3300044842 Ga0466957_0023478 Ga0466957_0023478_3090_3389 99
1305 3300044842 Ga0466957_0071734 Ga0466957_0071734_990_1289 99
1306 3300044842 Ga0466957_0087858 Ga0466957_0087858_219_518 99
1307 3300044842 Ga0466957_0144044 Ga0466957_0144044_742_1041 99
1308 3300044842 Ga0466957_0164351 Ga0466957_0164351_226_525 99
1309 3300044842 Ga0466957_0337919 Ga0466957_0337919_319_618 99
1310 3300044842 Ga0466957_0458162 Ga0466957_0458162_357_656 99
1311 3300044842 Ga0466957_0653684 Ga0466957_0653684_164_463 99
1312 3300044842 Ga0466957_0721896 Ga0466957_0721896_326_625 99
1313 3300044901 Ga0466960_0000046 Ga0466960_0000046_8341_8649 99
1314 3300044901 Ga0466960_0001009 Ga0466960_0001009_4743_5042 99
1315 3300044901 Ga0466960_0002661 Ga0466960_0002661_5250_5549 99
1316 3300044901 Ga0466960_0004371 Ga0466960_0004371_288_587 99
1317 3300044901 Ga0466960_0051070 Ga0466960_0051070_765_1064 99
1318 3300044901 Ga0466960_0178961 Ga0466960_0178961_304_603 99
1319 3300044901 Ga0466960_0585153 Ga0466960_0585153_191_490 99
1320 3300045049 Ga0466959_0001597 Ga0466959_0001597_6214_6513 99
1321 3300045049 Ga0466959_0002075 Ga0466959_0002075_4294_4593 99
1322 3300045049 Ga0466959_0005630 Ga0466959_0005630_3188_3487 99
1323 3300045049 Ga0466959_0019524 Ga0466959_0019524_1390_1689 99
1324 3300045049 Ga0466959_0026773 Ga0466959_0026773_129_428 99
1325 3300045049 Ga0466959_0027848 Ga0466959_0027848_3695_3994 99
1326 3300045049 Ga0466959_0045345 Ga0466959_0045345_1482_1781 99
1327 3300045049 Ga0466959_0050561 Ga0466959_0050561_985_1284 99
1328 3300045049 Ga0466959_0064953 Ga0466959_0064953_1933_2232 99
1329 3300045049 Ga0466959_0116305 Ga0466959_0116305_107_406 99
1330 3300045049 Ga0466959_0426793 Ga0466959_0426793_193_492 99
1331 3300045836 Ga0466958_0008122 Ga0466958_0008122_2235_2534 99
1332 3300045836 Ga0466958_0033877 Ga0466958_0033877_514_813 99
1333 3300045836 Ga0466958_0210873 Ga0466958_0210873_267_566 99
1334 3300045836 Ga0466958_0588526 Ga0466958_0588526_346_645 99
1335 3300045836 Ga0466958_0675144 Ga0466958_0675144_330_629 99
1336 3300045836 Ga0466958_0823610 Ga0466958_0823610_173_472 99
1337 3300045836 Ga0466958_0984515 Ga0466958_0984515_27_326 99
1338 3300045976 Ga0466967_0000098 Ga0466967_0000098_2572_2871 99
1339 3300045976 Ga0466967_0001175 Ga0466967_0001175_573_872 99
1340 3300045976 Ga0466967_0004167 Ga0466967_0004167_8483_8782 99
1341 3300045976 Ga0466967_0013920 Ga0466967_0013920_4483_4782 99
1342 3300045976 Ga0466967_0015885 Ga0466967_0015885_4082_4381 99
1343 3300045976 Ga0466967_0044157 Ga0466967_0044157_1248_1547 99
1344 3300045976 Ga0466967_0052656 Ga0466967_0052656_260_559 99
1345 3300045976 Ga0466967_0090102 Ga0466967_0090102_2295_2594 99
1346 3300045976 Ga0466967_0108859 Ga0466967_0108859_1230_1529 99
1347 3300045976 Ga0466967_0206462 Ga0466967_0206462_25_324 99
1348 3300045976 Ga0466967_0213462 Ga0466967_0213462_1211_1510 99
1349 3300045976 Ga0466967_0254036 Ga0466967_0254036_1037_1336 99
1350 3300045976 Ga0466967_0317645 Ga0466967_0317645_558_863 99
1351 3300045976 Ga0466967_0808390 Ga0466967_0808390_116_415 99
1352 3300045976 Ga0466967_1448479 Ga0466967_1448479_355_654 99
1353 3300045976 Ga0466967_1667304 Ga0466967_1667304_105_404 99
1354 3300045976 Ga0466967_1936721 Ga0466967_1936721_211_510 99
1355 3300046452 Ga0495617_002450 Ga0495617_002450_2347_2646 99
1356 3300046453 Ga0495627_032876 Ga0495627_032876_387_686 99
1357 3300046454 Ga0495592_0005902 Ga0495592_0005902_3414_3713 99
1358 3300046454 Ga0495592_0011481 Ga0495592_0011481_4115_4414 99
1359 3300046454 Ga0495592_0017511 Ga0495592_0017511_3153_3452 99
1360 3300046454 Ga0495592_0043495 Ga0495592_0043495_1955_2254 99
1361 3300046454 Ga0495592_0232869 Ga0495592_0232869_882_1181 99
1362 3300046454 Ga0495592_0693649 Ga0495592_0693649_160_459 99
1363 3300046455 Ga0495603_0002752 Ga0495603_0002752_4996_5295 99
1364 3300046455 Ga0495603_0005893 Ga0495603_0005893_890_1189 99
1365 3300046455 Ga0495603_0026486 Ga0495603_0026486_2086_2385 99
1366 3300046455 Ga0495603_0027817 Ga0495603_0027817_2376_2675 99
1367 3300046455 Ga0495603_0057695 Ga0495603_0057695_1412_1711 99
1368 3300046455 Ga0495603_0058400 Ga0495603_0058400_1078_1377 99
1369 3300046455 Ga0495603_0090468 Ga0495603_0090468_391_690 99
1370 3300046455 Ga0495603_0324172 Ga0495603_0324172_116_415 99
1371 3300046457 Ga0495590_0167759 Ga0495590_0167759_421_720 99
1372 3300046459 Ga0495629_0007791 Ga0495629_0007791_7198_7497 99
1373 3300046459 Ga0495629_0019021 Ga0495629_0019021_4203_4502 99
1374 3300046459 Ga0495629_0036510 Ga0495629_0036510_2331_2630 99
1375 3300046459 Ga0495629_0038099 Ga0495629_0038099_1085_1384 99
1376 3300046459 Ga0495629_0050864 Ga0495629_0050864_915_1214 99
1377 3300046459 Ga0495629_0199262 Ga0495629_0199262_212_511 99
1378 3300046459 Ga0495629_0625817 Ga0495629_0625817_29_328 99
1379 3300046459 Ga0495629_0879766 Ga0495629_0879766_235_534 99
1380 3300046460 Ga0495638_0006268 Ga0495638_0006268_492_791 99
1381 3300046460 Ga0495638_0037802 Ga0495638_0037802_1277_1576 99
1382 3300046460 Ga0495638_0047159 Ga0495638_0047159_1858_2157 99
1383 3300046460 Ga0495638_0069235 Ga0495638_0069235_1613_1912 99
1384 3300046460 Ga0495638_0372591 Ga0495638_0372591_282_581 99
1385 3300046461 Ga0495641_0036692 Ga0495641_0036692_1304_1603 99
1386 3300046462 Ga0495651_0001691 Ga0495651_0001691_16112_16411 99
1387 3300046462 Ga0495651_0002270 Ga0495651_0002270_13838_14137 99
1388 3300046462 Ga0495651_0020919 Ga0495651_0020919_3874_4173 99
1389 3300046462 Ga0495651_0032656 Ga0495651_0032656_3455_3754 99
1390 3300046463 Ga0495653_0009684 Ga0495653_0009684_5176_5475 99
1391 3300046463 Ga0495653_0125804 Ga0495653_0125804_1427_1726 99
1392 3300046472 Ga0495580_0007503 Ga0495580_0007503_5175_5474 99
1393 3300046472 Ga0495580_0093565 Ga0495580_0093565_530_829 99
1394 3300046472 Ga0495580_0295347 Ga0495580_0295347_486_785 99
1395 3300046473 Ga0495582_0015462 Ga0495582_0015462_302_601 99
1396 3300046473 Ga0495582_0020967 Ga0495582_0020967_2329_2628 99
1397 3300046473 Ga0495582_0123656 Ga0495582_0123656_1017_1316 99
1398 3300046473 Ga0495582_0286903 Ga0495582_0286903_183_482 99
1399 3300046474 Ga0495605_0040643 Ga0495605_0040643_154_453 99
1400 3300046474 Ga0495605_0136378 Ga0495605_0136378_505_804 99
1401 3300046475 Ga0495639_0035778 Ga0495639_0035778_1187_1486 99
1402 3300046475 Ga0495639_0152229 Ga0495639_0152229_174_473 99
1403 3300046476 Ga0495662_0003027 Ga0495662_0003027_3617_3916 99
1404 3300046476 Ga0495662_0003988 Ga0495662_0003988_6287_6586 99
1405 3300046476 Ga0495662_0004401 Ga0495662_0004401_1520_1819 99
1406 3300046476 Ga0495662_0030461 Ga0495662_0030461_483_782 99
1407 3300046476 Ga0495662_0578598 Ga0495662_0578598_29_328 99
1408 3300046477 Ga0495664_0002306 Ga0495664_0002306_5334_5633 99
1409 3300046477 Ga0495664_0006527 Ga0495664_0006527_2991_3290 99
1410 3300046477 Ga0495664_0168961 Ga0495664_0168961_633_932 99
1411 3300046477 Ga0495664_0638228 Ga0495664_0638228_95_394 99
1412 3300046491 Ga0495584_0489469 Ga0495584_0489469_251_550 99
1413 3300046492 Ga0495585_0006843 Ga0495585_0006843_5834_6133 99
1414 3300046492 Ga0495585_0011896 Ga0495585_0011896_2390_2689 99
1415 3300046492 Ga0495585_0056441 Ga0495585_0056441_207_506 99
1416 3300046492 Ga0495585_0084605 Ga0495585_0084605_1041_1340 99
1417 3300046499 Ga0495594_0012495 Ga0495594_0012495_3577_3876 99
1418 3300046499 Ga0495594_0019099 Ga0495594_0019099_2123_2422 99
1419 3300046499 Ga0495594_0036869 Ga0495594_0036869_415_714 99
1420 3300046499 Ga0495594_0067391 Ga0495594_0067391_1004_1303 99
1421 3300046499 Ga0495594_0105804 Ga0495594_0105804_431_730 99
1422 3300046499 Ga0495594_0425777 Ga0495594_0425777_142_441 99
1423 3300046500 Ga0495596_0007205 Ga0495596_0007205_3192_3491 99
1424 3300046501 Ga0495607_0027724 Ga0495607_0027724_2758_3057 99
1425 3300046501 Ga0495607_0116405 Ga0495607_0116405_656_955 99
1426 3300046506 Ga0495583_0030647 Ga0495583_0030647_235_534 99
1427 3300046506 Ga0495583_0152135 Ga0495583_0152135_641_940 99
1428 3300046506 Ga0495583_0188811 Ga0495583_0188811_105_404 99
1429 3300046506 Ga0495583_0249917 Ga0495583_0249917_367_684 99
1430 3300046507 Ga0495606_0024751 Ga0495606_0024751_484_783 99
1431 3300046507 Ga0495606_0040870 Ga0495606_0040870_1395_1694 99
1432 3300046511 Ga0495608_0001723 Ga0495608_0001723_9356_9655 99
1433 3300046511 Ga0495608_0029184 Ga0495608_0029184_2055_2354 99
1434 3300046511 Ga0495608_0273468 Ga0495608_0273468_109_408 99
1435 3300046511 Ga0495608_0570525 Ga0495608_0570525_279_578 99
1436 3300046513 Ga0495616_0034448 Ga0495616_0034448_194_493 99
1437 3300046514 Ga0495618_0020219 Ga0495618_0020219_798_1097 99
1438 3300046514 Ga0495618_0029070 Ga0495618_0029070_1337_1636 99
1439 3300046514 Ga0495618_0085032 Ga0495618_0085032_645_944 99
1440 3300046514 Ga0495618_0251534 Ga0495618_0251534_301_600 99
1441 3300046515 Ga0495620_0175873 Ga0495620_0175873_84_383 99
1442 3300046515 Ga0495620_0197374 Ga0495620_0197374_30_329 99
1443 3300046516 Ga0495628_0001384 Ga0495628_0001384_18848_19147 99
1444 3300046516 Ga0495628_0012481 Ga0495628_0012481_4536_4835 99
1445 3300046516 Ga0495628_0026361 Ga0495628_0026361_1117_1416 99
1446 3300046516 Ga0495628_0050390 Ga0495628_0050390_19_318 99
1447 3300046516 Ga0495628_0149375 Ga0495628_0149375_929_1228 99
1448 3300046517 Ga0495630_0048762 Ga0495630_0048762_1673_1972 99
1449 3300046517 Ga0495630_0265887 Ga0495630_0265887_550_849 99
1450 3300046517 Ga0495630_0324468 Ga0495630_0324468_762_1061 99
1451 3300046517 Ga0495630_0613214 Ga0495630_0613214_454_753 99
1452 3300046518 Ga0495631_0003549 Ga0495631_0003549_3229_3528 99
1453 3300046518 Ga0495631_0472694 Ga0495631_0472694_23_322 99
1454 3300046519 Ga0495632_0028374 Ga0495632_0028374_2457_2756 99
1455 3300046519 Ga0495632_0430800 Ga0495632_0430800_174_473 99
1456 3300046520 Ga0495637_0006755 Ga0495637_0006755_2993_3292 99
1457 3300046522 Ga0495643_0007275 Ga0495643_0007275_4316_4615 99
1458 3300046522 Ga0495643_0085567 Ga0495643_0085567_206_505 99
1459 3300046523 Ga0495644_0157588 Ga0495644_0157588_26_325 99
1460 3300046524 Ga0495648_0069856 Ga0495648_0069856_1406_1705 99
1461 3300046524 Ga0495648_0112305 Ga0495648_0112305_442_741 99
1462 3300046524 Ga0495648_0204897 Ga0495648_0204897_46_345 99
1463 3300046524 Ga0495648_0413244 Ga0495648_0413244_288_587 99
1464 3300046526 Ga0495666_0000571 Ga0495666_0000571_7804_8103 99
1465 3300046526 Ga0495666_0024248 Ga0495666_0024248_2073_2372 99
1466 3300046526 Ga0495666_0138843 Ga0495666_0138843_155_454 99
1467 3300046526 Ga0495666_0481718 Ga0495666_0481718_187_486 99
1468 3300046528 Ga0495642_0082291 Ga0495642_0082291_1002_1301 99
1469 3300046529 Ga0495652_0002119 Ga0495652_0002119_9190_9489 99
1470 3300046529 Ga0495652_0018989 Ga0495652_0018989_4560_4859 99
1471 3300046529 Ga0495652_0024558 Ga0495652_0024558_838_1137 99
1472 3300046529 Ga0495652_0069396 Ga0495652_0069396_1453_1752 99
1473 3300046529 Ga0495652_0072250 Ga0495652_0072250_1226_1525 99
1474 3300046530 Ga0495654_0007357 Ga0495654_0007357_5154_5453 99
1475 3300046531 Ga0495665_0005483 Ga0495665_0005483_1730_2029 99
1476 3300046531 Ga0495665_0509134 Ga0495665_0509134_290_589 99
1477 3300046533 Ga0495640_0005626 Ga0495640_0005626_4882_5181 99
1478 3300046533 Ga0495640_0013818 Ga0495640_0013818_563_862 99
1479 3300046533 Ga0495640_0016680 Ga0495640_0016680_921_1220 99
1480 3300046533 Ga0495640_0017644 Ga0495640_0017644_3400_3699 99
1481 3300046533 Ga0495640_0142738 Ga0495640_0142738_1056_1355 99
1482 3300046533 Ga0495640_0182550 Ga0495640_0182550_425_724 99
1483 3300046533 Ga0495640_0913821 Ga0495640_0913821_135_434 99
1484 3300046535 Ga0495586_0246189 Ga0495586_0246189_213_512 99
1485 3300046536 Ga0495587_0079197 Ga0495587_0079197_1062_1361 99
1486 3300046536 Ga0495587_0199871 Ga0495587_0199871_184_483 99
1487 3300046536 Ga0495587_0705976 Ga0495587_0705976_130_429 99
1488 3300046538 Ga0495609_0004676 Ga0495609_0004676_1804_2103 99
1489 3300046542 Ga0495597_0031747 Ga0495597_0031747_1476_1775 99
1490 3300046542 Ga0495597_0229000 Ga0495597_0229000_340_639 99
1491 3300046542 Ga0495597_0302666 Ga0495597_0302666_174_473 99
1492 3300046543 Ga0495645_0024216 Ga0495645_0024216_2714_3013 99
1493 3300046543 Ga0495645_0028167 Ga0495645_0028167_3435_3734 99
1494 3300046543 Ga0495645_0045978 Ga0495645_0045978_1358_1657 99
1495 3300046543 Ga0495645_0101595 Ga0495645_0101595_32_331 99
1496 3300046543 Ga0495645_0888778 Ga0495645_0888778_43_342 99
1497 3300046557 Ga0495622_0005380 Ga0495622_0005380_4048_4347 99
1498 3300046557 Ga0495622_0015971 Ga0495622_0015971_2689_2988 99
1499 3300046557 Ga0495622_0056033 Ga0495622_0056033_1350_1649 99
1500 3300046558 Ga0495633_0031583 Ga0495633_0031583_1774_2073 99
1501 3300046559 Ga0495667_0033930 Ga0495667_0033930_1442_1741 99
1502 3300046559 Ga0495667_0153082 Ga0495667_0153082_655_954 99
1503 3300046559 Ga0495667_0323018 Ga0495667_0323018_301_600 99
1504 3300046615 Ga0495656_0329388 Ga0495656_0329388_31_330 99
1505 3300046616 Ga0495668_0000123 Ga0495668_0000123_61293_61592 99
1506 3300046616 Ga0495668_0036571 Ga0495668_0036571_557_856 99
1507 3300046616 Ga0495668_0651628 Ga0495668_0651628_174_473 99
1508 3300046642 Ga0495634_0006120 Ga0495634_0006120_5392_5691 99
1509 3300046642 Ga0495634_0010265 Ga0495634_0010265_3850_4149 99
1510 3300046642 Ga0495634_0050187 Ga0495634_0050187_648_947 99
1511 3300046642 Ga0495634_0213792 Ga0495634_0213792_145_444 99
1512 3300046642 Ga0495634_0276759 Ga0495634_0276759_501_800 99
1513 3300046642 Ga0495634_0382681 Ga0495634_0382681_152_451 99
1514 3300046648 Ga0495611_0057795 Ga0495611_0057795_1316_1615 99
1515 3300046648 Ga0495611_0215774 Ga0495611_0215774_136_435 99
1516 3300046660 Ga0495625_0005807 Ga0495625_0005807_571_870 99
1517 3300046660 Ga0495625_0029488 Ga0495625_0029488_262_561 99
1518 3300046660 Ga0495625_0238937 Ga0495625_0238937_812_1111 99
1519 3300046663 Ga0495635_0002565 Ga0495635_0002565_3850_4149 99
1520 3300046663 Ga0495635_0004355 Ga0495635_0004355_8932_9231 99
1521 3300046663 Ga0495635_0066218 Ga0495635_0066218_1673_1972 99
1522 3300046663 Ga0495635_0071866 Ga0495635_0071866_281_580 99
1523 3300046663 Ga0495635_0088357 Ga0495635_0088357_1572_1871 99
1524 3300046663 Ga0495635_0341668 Ga0495635_0341668_479_778 99
1525 3300046663 Ga0495635_0375901 Ga0495635_0375901_49_348 99
1526 3300046665 Ga0495661_0023540 Ga0495661_0023540_575_874 99
1527 3300046665 Ga0495661_0175298 Ga0495661_0175298_289_588 99
1528 3300046674 Ga0495588_0003543 Ga0495588_0003543_2930_3229 99
1529 3300046674 Ga0495588_0003986 Ga0495588_0003986_1909_2208 99
1530 3300046674 Ga0495588_0005355 Ga0495588_0005355_782_1081 99
1531 3300046674 Ga0495588_0010107 Ga0495588_0010107_1285_1584 99
1532 3300046675 Ga0495657_0003629 Ga0495657_0003629_1974_2273 99
1533 3300046675 Ga0495657_0007083 Ga0495657_0007083_8016_8315 99
1534 3300046675 Ga0495657_0008037 Ga0495657_0008037_3116_3415 99
1535 3300046675 Ga0495657_0008501 Ga0495657_0008501_4516_4815 99
1536 3300046678 Ga0495599_0049987 Ga0495599_0049987_1412_1711 99
1537 3300046678 Ga0495599_0064358 Ga0495599_0064358_1486_1785 99
1538 3300046678 Ga0495599_0326318 Ga0495599_0326318_545_844 99
1539 3300046679 Ga0495623_0059476 Ga0495623_0059476_648_947 99
1540 3300046679 Ga0495623_0075257 Ga0495623_0075257_109_408 99
1541 3300046679 Ga0495623_0135461 Ga0495623_0135461_804_1103 99
1542 3300046679 Ga0495623_0363063 Ga0495623_0363063_372_671 99
1543 3300046680 Ga0495646_0000855 Ga0495646_0000855_14895_15194 99
1544 3300046680 Ga0495646_0010343 Ga0495646_0010343_348_647 99
1545 3300046680 Ga0495646_0051847 Ga0495646_0051847_1532_1831 99
1546 3300046680 Ga0495646_0094322 Ga0495646_0094322_381_680 99
1547 3300046680 Ga0495646_0620530 Ga0495646_0620530_203_502 99
1548 3300046683 Ga0495658_0002176 Ga0495658_0002176_4714_5013 99
1549 3300046683 Ga0495658_0112189 Ga0495658_0112189_68_367 99
1550 3300046683 Ga0495658_0538936 Ga0495658_0538936_84_383 99
1551 3300046684 Ga0495669_0356984 Ga0495669_0356984_315_632 99
1552 3300046689 Ga0495613_0001664 Ga0495613_0001664_2432_2731 99
1553 3300046689 Ga0495613_0006878 Ga0495613_0006878_4595_4894 99
1554 3300046689 Ga0495613_0007886 Ga0495613_0007886_6843_7142 99
1555 3300046689 Ga0495613_0017322 Ga0495613_0017322_1795_2094 99
1556 3300046689 Ga0495613_0042788 Ga0495613_0042788_3012_3311 99
1557 3300046689 Ga0495613_0056747 Ga0495613_0056747_208_507 99
1558 3300046689 Ga0495613_0085162 Ga0495613_0085162_71_370 99
1559 3300046689 Ga0495613_0096472 Ga0495613_0096472_986_1285 99
1560 3300046689 Ga0495613_0539877 Ga0495613_0539877_23_322 99
1561 3300046690 Ga0495624_0075201 Ga0495624_0075201_1215_1514 99
1562 3300046690 Ga0495624_0199910 Ga0495624_0199910_353_652 99
1563 3300046690 Ga0495624_0706154 Ga0495624_0706154_107_406 99
1564 3300046691 Ga0495670_0055508 Ga0495670_0055508_1198_1497 99
1565 3300046691 Ga0495670_0058872 Ga0495670_0058872_813_1112 99
1566 3300046691 Ga0495670_0176563 Ga0495670_0176563_558_857 99
1567 3300046692 Ga0495671_0013941 Ga0495671_0013941_2857_3156 99
1568 3300046692 Ga0495671_0030234 Ga0495671_0030234_1091_1390 99
1569 3300046692 Ga0495671_0147806 Ga0495671_0147806_187_486 99
1570 3300046694 Ga0495649_0031220 Ga0495649_0031220_949_1248 99
1571 3300046694 Ga0495649_0171518 Ga0495649_0171518_643_942 99
1572 3300046694 Ga0495649_0183630 Ga0495649_0183630_505_804 99
1573 3300046694 Ga0495649_0247873 Ga0495649_0247873_422_721 99
1574 3300046694 Ga0495649_0584368 Ga0495649_0584368_178_477 99
1575 3300046794 Ga0495589_0036165 Ga0495589_0036165_1212_1511 99
1576 3300046794 Ga0495589_0042640 Ga0495589_0042640_1096_1395 99
1577 3300046794 Ga0495589_0436546 Ga0495589_0436546_104_403 99
1578 3300046809 Ga0495600_0003542 Ga0495600_0003542_5435_5734 99
1579 3300046809 Ga0495600_0010402 Ga0495600_0010402_551_850 99
1580 3300046809 Ga0495600_0017095 Ga0495600_0017095_3114_3413 99
1581 3300046809 Ga0495600_0051070 Ga0495600_0051070_414_713 99
1582 3300046809 Ga0495600_0350712 Ga0495600_0350712_493_792 99
1583 3300046810 Ga0495660_0031126 Ga0495660_0031126_435_734 99
1584 3300046810 Ga0495660_0038922 Ga0495660_0038922_1082_1381 99
1585 3300047315 Ga0495581_0011118 Ga0495581_0011118_4333_4632 99
1586 3300047315 Ga0495581_0053853 Ga0495581_0053853_1073_1372 99
1587 3300047315 Ga0495581_0081771 Ga0495581_0081771_1324_1623 99
1588 3300047315 Ga0495581_0096503 Ga0495581_0096503_415_714 99
1589 3300047317 Ga0495604_0002351 Ga0495604_0002351_3722_4021 99
1590 3300047317 Ga0495604_0004817 Ga0495604_0004817_8601_8900 99
1591 3300047317 Ga0495604_0007383 Ga0495604_0007383_5059_5358 99
1592 3300047317 Ga0495604_0063067 Ga0495604_0063067_2386_2685 99
1593 3300047317 Ga0495604_0285633 Ga0495604_0285633_605_904 99
1594 3300047318 Ga0495636_0007700 Ga0495636_0007700_2981_3280 99
1595 3300047318 Ga0495636_0036875 Ga0495636_0036875_518_817 99
1596 3300047318 Ga0495636_0037499 Ga0495636_0037499_373_672 99
1597 3300047318 Ga0495636_0087387 Ga0495636_0087387_59_358 99
1598 3300047319 Ga0495674_0067245 Ga0495674_0067245_1196_1495 99
1599 3300047319 Ga0495674_0070922 Ga0495674_0070922_1359_1658 99
1600 3300047319 Ga0495674_0119479 Ga0495674_0119479_1581_1880 99
1601 3300047319 Ga0495674_0268767 Ga0495674_0268767_264_563 99
1602 3300047319 Ga0495674_0283155 Ga0495674_0283155_725_1024 99
1603 3300047320 Ga0495672_0010127 Ga0495672_0010127_5783_6082 99
1604 3300047320 Ga0495672_0028030 Ga0495672_0028030_1406_1705 99
1605 3300047321 Ga0495676_0001590 Ga0495676_0001590_14088_14387 99
1606 3300047321 Ga0495676_0002415 Ga0495676_0002415_3978_4277 99
1607 3300047321 Ga0495676_0147379 Ga0495676_0147379_693_992 99
1608 3300047321 Ga0495676_0290392 Ga0495676_0290392_417_716 99
1609 3300047322 Ga0495680_0178410 Ga0495680_0178410_291_590 99
1610 3300047322 Ga0495680_0452211 Ga0495680_0452211_547_846 99
1611 3300047323 Ga0495683_0000766 Ga0495683_0000766_16094_16393 99
1612 3300047323 Ga0495683_0021951 Ga0495683_0021951_2935_3234 99
1613 3300047443 Ga0495687_001147 Ga0495687_001147_18150_18449 99
1614 3300047443 Ga0495687_003306 Ga0495687_003306_1274_1573 99
1615 3300047443 Ga0495687_039955 Ga0495687_039955_1102_1401 99
1616 3300047443 Ga0495687_140261 Ga0495687_140261_256_555 99
1617 3300047444 Ga0495675_0011687 Ga0495675_0011687_4260_4559 99
1618 3300047444 Ga0495675_0021916 Ga0495675_0021916_447_746 99
1619 3300047444 Ga0495675_0030965 Ga0495675_0030965_1259_1558 99
1620 3300047444 Ga0495675_0059587 Ga0495675_0059587_1942_2241 99
1621 3300047444 Ga0495675_0059974 Ga0495675_0059974_39_338 99
1622 3300047444 Ga0495675_0174278 Ga0495675_0174278_516_815 99
1623 3300047444 Ga0495675_0390066 Ga0495675_0390066_460_759 99
1624 3300047446 Ga0495679_011002 Ga0495679_011002_2417_2716 99
1625 3300047447 Ga0495685_001275 Ga0495685_001275_5218_5517 99
1626 3300047447 Ga0495685_006034 Ga0495685_006034_1785_2084 99
1627 3300047447 Ga0495685_081645 Ga0495685_081645_701_1000 99
1628 3300047447 Ga0495685_108302 Ga0495685_108302_162_461 99
1629 3300047469 Ga0495673_0000456 Ga0495673_0000456_4506_4805 99
1630 3300047470 Ga0495681_0003151 Ga0495681_0003151_3129_3428 99
1631 3300047470 Ga0495681_0020011 Ga0495681_0020011_2037_2336 99
1632 3300047471 Ga0495684_0123494 Ga0495684_0123494_506_805 99
1633 3300047471 Ga0495684_0157647 Ga0495684_0157647_1282_1581 99
1634 3300047472 Ga0495686_0000637 Ga0495686_0000637_37244_37543 99
1635 3300047472 Ga0495686_0063634 Ga0495686_0063634_232_531 99
1636 3300047472 Ga0495686_0232025 Ga0495686_0232025_223_522 99
1637 3300047673 Ga0495593_0001812 Ga0495593_0001812_4647_4946 99
1638 3300047673 Ga0495593_0055656 Ga0495593_0055656_996_1295 99
1639 3300047673 Ga0495593_0346380 Ga0495593_0346380_117_416 99
1640 3300048088 Ga0495602_0055166 Ga0495602_0055166_823_1122 99
1641 3300048088 Ga0495602_0199002 Ga0495602_0199002_1216_1515 99
1642 3300048088 Ga0495602_0397105 Ga0495602_0397105_572_871 99
1643 3300048088 Ga0495602_0518465 Ga0495602_0518465_184_483 99
1644 3300048088 Ga0495602_0531111 Ga0495602_0531111_66_365 99
1645 3300048088 Ga0495602_1102216 Ga0495602_1102216_15_314 99
1646 3300048089 Ga0495614_0000229 Ga0495614_0000229_7697_7996 99
1647 3300048089 Ga0495614_0009446 Ga0495614_0009446_1634_1933 99
1648 3300048089 Ga0495614_0122938 Ga0495614_0122938_828_1127 99
1649 3300048091 Ga0495626_0020580 Ga0495626_0020580_1869_2168 99
1650 3300048091 Ga0495626_0066961 Ga0495626_0066961_1005_1304 99
1651 3300048091 Ga0495626_0153541 Ga0495626_0153541_100_399 99
1652 3300048903 Ga0496100_0000067 Ga0496100_0000067_39689_39988 99
1653 3300048903 Ga0496100_0000461 Ga0496100_0000461_19044_19343 99
1654 3300048903 Ga0496100_0004004 Ga0496100_0004004_5297_5596 99
1655 3300048903 Ga0496100_0004747 Ga0496100_0004747_5437_5736 99
1656 3300048903 Ga0496100_0007759 Ga0496100_0007759_5592_5891 99
1657 3300048903 Ga0496100_0096240 Ga0496100_0096240_1025_1324 99
1658 3300048903 Ga0496100_0148167 Ga0496100_0148167_224_523 99
1659 3300048903 Ga0496100_0249001 Ga0496100_0249001_803_1102 99
1660 3300048903 Ga0496100_0449650 Ga0496100_0449650_303_602 99
1661 3300048903 Ga0496100_0546531 Ga0496100_0546531_513_812 99
1662 3300048904 Ga0496101_0000099 Ga0496101_0000099_29799_30098 99
1663 3300048904 Ga0496101_0000108 Ga0496101_0000108_19688_19987 99
1664 3300048904 Ga0496101_0000750 Ga0496101_0000750_12962_13261 99
1665 3300048904 Ga0496101_0000793 Ga0496101_0000793_5533_5832 99
1666 3300048904 Ga0496101_0015063 Ga0496101_0015063_1310_1609 99
1667 3300048904 Ga0496101_0098732 Ga0496101_0098732_1543_1842 99
1668 3300048904 Ga0496101_0112323 Ga0496101_0112323_445_744 99
1669 3300048904 Ga0496101_0162987 Ga0496101_0162987_1301_1600 99
1670 3300048904 Ga0496101_0768929 Ga0496101_0768929_125_424 99
1671 3300048904 Ga0496101_1140795 Ga0496101_1140795_229_528 99
1672 3300048905 Ga0496102_0000005 Ga0496102_0000005_108565_108864 99
1673 3300048905 Ga0496102_0000390 Ga0496102_0000390_19160_19459 99
1674 3300048905 Ga0496102_0003032 Ga0496102_0003032_2348_2647 99
1675 3300048905 Ga0496102_0006978 Ga0496102_0006978_7795_8094 99
1676 3300048905 Ga0496102_0030945 Ga0496102_0030945_638_937 99
1677 3300048905 Ga0496102_0051773 Ga0496102_0051773_3340_3639 99
1678 3300048905 Ga0496102_0093526 Ga0496102_0093526_1468_1767 99
1679 3300048905 Ga0496102_0140005 Ga0496102_0140005_855_1154 99
1680 3300048905 Ga0496102_0143275 Ga0496102_0143275_42_341 99
1681 3300048905 Ga0496102_0211602 Ga0496102_0211602_1172_1471 99
1682 3300048905 Ga0496102_0216993 Ga0496102_0216993_794_1093 99
1683 3300048905 Ga0496102_0437293 Ga0496102_0437293_448_747 99
1684 3300048905 Ga0496102_0504239 Ga0496102_0504239_643_942 99
1685 3300048905 Ga0496102_1061507 Ga0496102_1061507_180_479 99
1686 3300048905 Ga0496102_1595120 Ga0496102_1595120_249_548 99
1687 3300048906 Ga0496103_0000002 Ga0496103_0000002_373104_373403 99
1688 3300048906 Ga0496103_0000116 Ga0496103_0000116_17217_17516 99
1689 3300048906 Ga0496103_0000663 Ga0496103_0000663_7942_8241 99
1690 3300048906 Ga0496103_0001688 Ga0496103_0001688_6459_6758 99
1691 3300048906 Ga0496103_0017503 Ga0496103_0017503_1868_2167 99
1692 3300048906 Ga0496103_0488755 Ga0496103_0488755_154_453 99
1693 3300048907 Ga0496104_0007517 Ga0496104_0007517_1345_1644 99
1694 3300048907 Ga0496104_0011507 Ga0496104_0011507_7456_7755 99
1695 3300048907 Ga0496104_0044914 Ga0496104_0044914_1768_2067 99
1696 3300048907 Ga0496104_0046988 Ga0496104_0046988_3419_3718 99
1697 3300048907 Ga0496104_0659991 Ga0496104_0659991_639_938 99
1698 3300048907 Ga0496104_1474620 Ga0496104_1474620_222_521 99
1699 3300048908 Ga0496105_0064390 Ga0496105_0064390_2575_2874 99
1700 3300048908 Ga0496105_0176837 Ga0496105_0176837_126_425 99
1701 3300048908 Ga0496105_0327777 Ga0496105_0327777_625_924 99
1702 3300048908 Ga0496105_0501550 Ga0496105_0501550_559_858 99
1703 3300048908 Ga0496105_0508548 Ga0496105_0508548_290_589 99
1704 3300048908 Ga0496105_0953297 Ga0496105_0953297_212_511 99
1705 3300048909 Ga0496106_0000424 Ga0496106_0000424_21885_22184 99
1706 3300048909 Ga0496106_0001149 Ga0496106_0001149_10453_10752 99
1707 3300048909 Ga0496106_0001741 Ga0496106_0001741_7905_8204 99
1708 3300048909 Ga0496106_0002018 Ga0496106_0002018_10314_10613 99
1709 3300048909 Ga0496106_0016794 Ga0496106_0016794_5014_5313 99
1710 3300048909 Ga0496106_0177217 Ga0496106_0177217_98_397 99
1711 3300048909 Ga0496106_0212106 Ga0496106_0212106_975_1274 99
1712 3300048909 Ga0496106_0234277 Ga0496106_0234277_787_1086 99
1713 3300048909 Ga0496106_0318636 Ga0496106_0318636_550_849 99
1714 3300048909 Ga0496106_0846820 Ga0496106_0846820_384_683 99
1715 3300048909 Ga0496106_1472165 Ga0496106_1472165_96_395 99
1716 3300048910 Ga0496107_0000079 Ga0496107_0000079_36987_37286 99
1717 3300048910 Ga0496107_0000254 Ga0496107_0000254_8593_8892 99
1718 3300048910 Ga0496107_0014513 Ga0496107_0014513_405_704 99
1719 3300048910 Ga0496107_0214834 Ga0496107_0214834_283_582 99
1720 3300048910 Ga0496107_0247435 Ga0496107_0247435_399_698 99
1721 3300048910 Ga0496107_0275597 Ga0496107_0275597_171_470 99
1722 3300048910 Ga0496107_0706240 Ga0496107_0706240_63_362 99
1723 3300048911 Ga0496108_0005688 Ga0496108_0005688_807_1106 99
1724 3300048911 Ga0496108_0011641 Ga0496108_0011641_3577_3876 99
1725 3300048911 Ga0496108_0033237 Ga0496108_0033237_1896_2195 99
1726 3300048911 Ga0496108_0071519 Ga0496108_0071519_1203_1502 99
1727 3300048911 Ga0496108_0110258 Ga0496108_0110258_790_1089 99
1728 3300048911 Ga0496108_0137681 Ga0496108_0137681_1125_1424 99
1729 3300048911 Ga0496108_0174780 Ga0496108_0174780_1278_1583 99
1730 3300048911 Ga0496108_0259237 Ga0496108_0259237_120_419 99
1731 3300048911 Ga0496108_0326318 Ga0496108_0326318_960_1259 99
1732 3300048911 Ga0496108_1260981 Ga0496108_1260981_202_501 99
1733 3300048912 Ga0496109_0000159 Ga0496109_0000159_19114_19413 99
1734 3300048912 Ga0496109_0002268 Ga0496109_0002268_14120_14419 99
1735 3300048912 Ga0496109_0010817 Ga0496109_0010817_800_1099 99
1736 3300048912 Ga0496109_0023653 Ga0496109_0023653_1928_2227 99
1737 3300048912 Ga0496109_0038336 Ga0496109_0038336_470_769 99
1738 3300048912 Ga0496109_0182877 Ga0496109_0182877_1178_1477 99
1739 3300048912 Ga0496109_0418659 Ga0496109_0418659_319_618 99
1740 3300048912 Ga0496109_0608141 Ga0496109_0608141_574_873 99
1741 3300048912 Ga0496109_1250478 Ga0496109_1250478_71_370 99
1742 3300048912 Ga0496109_1291365 Ga0496109_1291365_123_422 99
1743 3300048912 Ga0496109_1468055 Ga0496109_1468055_292_591 99
1744 3300048913 Ga0496110_0006109 Ga0496110_0006109_7538_7837 99
1745 3300048913 Ga0496110_0085523 Ga0496110_0085523_2189_2488 99
1746 3300048913 Ga0496110_0141431 Ga0496110_0141431_1816_2121 99
1747 3300048913 Ga0496110_0168926 Ga0496110_0168926_196_495 99
1748 3300048913 Ga0496110_0253450 Ga0496110_0253450_273_572 99
1749 3300048913 Ga0496110_0338005 Ga0496110_0338005_81_380 99
1750 3300048913 Ga0496110_0554183 Ga0496110_0554183_421_720 99
1751 3300048913 Ga0496110_1247954 Ga0496110_1247954_261_560 99
1752 3300048913 Ga0496110_1524752 Ga0496110_1524752_116_415 99
1753 3300048913 Ga0496110_1882754 Ga0496110_1882754_93_392 99
1754 3300048914 Ga0496111_0022716 Ga0496111_0022716_3474_3773 99
1755 3300048914 Ga0496111_0196695 Ga0496111_0196695_912_1211 99
1756 3300048914 Ga0496111_0298905 Ga0496111_0298905_356_655 99
1757 3300048914 Ga0496111_0852906 Ga0496111_0852906_284_583 99
1758 3300048915 Ga0496112_0017534 Ga0496112_0017534_3208_3507 99
1759 3300048915 Ga0496112_0018053 Ga0496112_0018053_369_668 99
1760 3300048915 Ga0496112_0018650 Ga0496112_0018650_925_1224 99
1761 3300048915 Ga0496112_0042682 Ga0496112_0042682_2014_2313 99
1762 3300048915 Ga0496112_0062477 Ga0496112_0062477_2013_2312 99
1763 3300048915 Ga0496112_0083572 Ga0496112_0083572_646_945 99
1764 3300048915 Ga0496112_0159776 Ga0496112_0159776_780_1079 99
1765 3300048915 Ga0496112_0285554 Ga0496112_0285554_11_310 99
1766 3300048915 Ga0496112_1156227 Ga0496112_1156227_101_403 99
1767 3300048916 Ga0496113_0001013 Ga0496113_0001013_9374_9673 99
1768 3300048916 Ga0496113_0021243 Ga0496113_0021243_1110_1409 99
1769 3300048916 Ga0496113_0295987 Ga0496113_0295987_74_373 99
1770 3300048916 Ga0496113_0356646 Ga0496113_0356646_473_772 99
1771 3300048916 Ga0496113_0674981 Ga0496113_0674981_126_425 99
1772 3300048916 Ga0496113_0712255 Ga0496113_0712255_200_499 99
1773 3300048916 Ga0496113_1437271 Ga0496113_1437271_124_423 99
1774 3300048917 Ga0496114_0000116 Ga0496114_0000116_29788_30087 99
1775 3300048917 Ga0496114_0000711 Ga0496114_0000711_15909_16208 99
1776 3300048917 Ga0496114_0001235 Ga0496114_0001235_6439_6738 99
1777 3300048917 Ga0496114_0086311 Ga0496114_0086311_721_1020 99
1778 3300048917 Ga0496114_0099480 Ga0496114_0099480_2171_2470 99
1779 3300048917 Ga0496114_0183417 Ga0496114_0183417_756_1055 99
1780 3300048917 Ga0496114_0245998 Ga0496114_0245998_562_861 99
1781 3300048917 Ga0496114_0489472 Ga0496114_0489472_762_1061 99
1782 3300048917 Ga0496114_0646605 Ga0496114_0646605_39_338 99
1783 3300048917 Ga0496114_0818518 Ga0496114_0818518_97_396 99
1784 3300048918 Ga0496115_0002425 Ga0496115_0002425_3377_3676 99
1785 3300048918 Ga0496115_0015061 Ga0496115_0015061_1782_2081 99
1786 3300048918 Ga0496115_0021113 Ga0496115_0021113_424_723 99
1787 3300048918 Ga0496115_0425739 Ga0496115_0425739_288_587 99
1788 3300048918 Ga0496115_1219552 Ga0496115_1219552_89_388 99
1789 3300048919 Ga0496116_0000034 Ga0496116_0000034_36431_36730 99
1790 3300048919 Ga0496116_0001408 Ga0496116_0001408_22103_22402 99
1791 3300048919 Ga0496116_0002098 Ga0496116_0002098_10996_11295 99
1792 3300048920 Ga0496117_0000003 Ga0496117_0000003_965240_965539 99
1793 3300048920 Ga0496117_0001155 Ga0496117_0001155_3840_4139 99
1794 3300048920 Ga0496117_0028583 Ga0496117_0028583_1626_1925 99
1795 3300048920 Ga0496117_0618140 Ga0496117_0618140_175_474 99
1796 3300048921 Ga0496118_0000001 Ga0496118_0000001_965243_965542 99
1797 3300048921 Ga0496118_0000165 Ga0496118_0000165_35486_35785 99
1798 3300048921 Ga0496118_0000348 Ga0496118_0000348_72521_72820 99
1799 3300048921 Ga0496118_0029623 Ga0496118_0029623_3225_3524 99
1800 3300048922 Ga0496119_0000669 Ga0496119_0000669_26004_26303 99
1801 3300048922 Ga0496119_0003552 Ga0496119_0003552_2121_2420 99
1802 3300048922 Ga0496119_0010241 Ga0496119_0010241_4527_4826 99
1803 3300048922 Ga0496119_0205331 Ga0496119_0205331_35_334 99
1804 3300048922 Ga0496119_0388086 Ga0496119_0388086_193_492 99
1805 3300048923 Ga0496120_0000594 Ga0496120_0000594_34800_35099 99
1806 3300048923 Ga0496120_0002960 Ga0496120_0002960_11451_11750 99
1807 3300048923 Ga0496120_0009506 Ga0496120_0009506_1132_1431 99
1808 3300048923 Ga0496120_0027390 Ga0496120_0027390_2202_2501 99
1809 3300048923 Ga0496120_0265903 Ga0496120_0265903_366_665 99
1810 3300048923 Ga0496120_0350103 Ga0496120_0350103_102_401 99
1811 3300048924 Ga0496121_0000016 Ga0496121_0000016_348282_348581 99
1812 3300048924 Ga0496121_0001920 Ga0496121_0001920_5311_5610 99
1813 3300048924 Ga0496121_0003113 Ga0496121_0003113_8597_8896 99
1814 3300048924 Ga0496121_0785925 Ga0496121_0785925_181_480 99
1815 3300048925 Ga0496122_0000284 Ga0496122_0000284_62201_62500 99
1816 3300048925 Ga0496122_0003418 Ga0496122_0003418_5544_5843 99
1817 3300048925 Ga0496122_0016911 Ga0496122_0016911_1033_1332 99
1818 3300048925 Ga0496122_0296743 Ga0496122_0296743_23_322 99
1819 3300048926 Ga0496123_0003511 Ga0496123_0003511_16023_16322 99
1820 3300048926 Ga0496123_0008217 Ga0496123_0008217_9067_9366 99
1821 3300048926 Ga0496123_0024695 Ga0496123_0024695_2332_2631 99
1822 3300048927 Ga0496124_0000015 Ga0496124_0000015_29809_30108 99
1823 3300048927 Ga0496124_0238890 Ga0496124_0238890_389_688 99
1824 3300048927 Ga0496124_0252667 Ga0496124_0252667_896_1195 99
1825 3300048928 Ga0496125_0000021 Ga0496125_0000021_430593_430892 99
1826 3300048928 Ga0496125_0037430 Ga0496125_0037430_1509_1808 99
1827 3300048928 Ga0496125_0094243 Ga0496125_0094243_1214_1513 99
1828 3300048928 Ga0496125_0274510 Ga0496125_0274510_124_423 99
1829 3300048928 Ga0496125_0448140 Ga0496125_0448140_28_327 99
1830 3300048928 Ga0496125_0626679 Ga0496125_0626679_198_497 99
1831 3300048929 Ga0496126_0000015 Ga0496126_0000015_430593_430892 99
1832 3300048929 Ga0496126_0000178 Ga0496126_0000178_66241_66540 99
1833 3300048929 Ga0496126_0000807 Ga0496126_0000807_31681_31980 99
1834 3300048929 Ga0496126_0003990 Ga0496126_0003990_14158_14457 99
1835 3300048929 Ga0496126_0012073 Ga0496126_0012073_8515_8814 99
1836 3300048929 Ga0496126_0029817 Ga0496126_0029817_4651_4950 99
1837 3300048929 Ga0496126_0038286 Ga0496126_0038286_1431_1730 99
1838 3300048929 Ga0496126_0258251 Ga0496126_0258251_145_444 99
1839 3300048929 Ga0496126_0594121 Ga0496126_0594121_275_574 99
1840 3300048929 Ga0496126_0888023 Ga0496126_0888023_275_574 99
1841 3300049161 Ga0501305_105422 Ga0501305_105422_219_518 99
1842 3300049459 Ga0495678_007860 Ga0495678_007860_3681_3980 99
1843 3300049460 Ga0495682_0030079 Ga0495682_0030079_426_725 99
1844 3300049568 Ga0501031_0001068 Ga0501031_0001068_6901_7200 99
1845 3300049568 Ga0501031_0014602 Ga0501031_0014602_4296_4595 99
1846 3300049568 Ga0501031_0020290 Ga0501031_0020290_3572_3871 99
1847 3300049568 Ga0501031_0978008 Ga0501031_0978008_88_387 99
1848 3300049569 Ga0501032_0000686 Ga0501032_0000686_6616_6915 99
1849 3300049569 Ga0501032_0001416 Ga0501032_0001416_14459_14758 99
1850 3300049569 Ga0501032_0003137 Ga0501032_0003137_9685_9984 99
1851 3300049569 Ga0501032_0018870 Ga0501032_0018870_1439_1738 99
1852 3300049569 Ga0501032_0050349 Ga0501032_0050349_1369_1668 99
1853 3300049569 Ga0501032_0343667 Ga0501032_0343667_38_337 99
1854 3300049569 Ga0501032_0583938 Ga0501032_0583938_388_687 99
1855 3300049569 Ga0501032_1057408 Ga0501032_1057408_102_401 99
1856 3300049570 Ga0501033_0013223 Ga0501033_0013223_3504_3803 99
1857 3300049570 Ga0501033_0014277 Ga0501033_0014277_104_403 99
1858 3300049570 Ga0501033_0035727 Ga0501033_0035727_2977_3276 99
1859 3300049570 Ga0501033_0049148 Ga0501033_0049148_503_802 99
1860 3300049570 Ga0501033_0052208 Ga0501033_0052208_2401_2700 99
1861 3300049570 Ga0501033_0071252 Ga0501033_0071252_143_442 99
1862 3300049570 Ga0501033_0187722 Ga0501033_0187722_699_998 99
1863 3300049570 Ga0501033_0207894 Ga0501033_0207894_1015_1314 99
1864 3300049571 Ga0501034_0000700 Ga0501034_0000700_167_466 99
1865 3300049571 Ga0501034_0000987 Ga0501034_0000987_28498_28797 99
1866 3300049571 Ga0501034_0001101 Ga0501034_0001101_18693_18992 99
1867 3300049571 Ga0501034_0008658 Ga0501034_0008658_206_511 99
1868 3300049571 Ga0501034_0018578 Ga0501034_0018578_4416_4715 99
1869 3300049571 Ga0501034_0055651 Ga0501034_0055651_2434_2733 99
1870 3300049571 Ga0501034_0080810 Ga0501034_0080810_579_878 99
1871 3300049571 Ga0501034_0153981 Ga0501034_0153981_585_884 99
1872 3300049571 Ga0501034_0158112 Ga0501034_0158112_28_327 99
1873 3300049571 Ga0501034_0255631 Ga0501034_0255631_922_1227 99
1874 3300049571 Ga0501034_0304551 Ga0501034_0304551_986_1285 99
1875 3300049571 Ga0501034_0932102 Ga0501034_0932102_214_513 99
1876 3300049571 Ga0501034_0975050 Ga0501034_0975050_386_685 99
1877 3300049572 Ga0501036_0001560 Ga0501036_0001560_12113_12412 99
1878 3300049572 Ga0501036_0004005 Ga0501036_0004005_4672_4971 99
1879 3300049572 Ga0501036_0010187 Ga0501036_0010187_6595_6894 99
1880 3300049572 Ga0501036_0034998 Ga0501036_0034998_1703_2002 99
1881 3300049572 Ga0501036_0088645 Ga0501036_0088645_1074_1373 99
1882 3300049572 Ga0501036_0200542 Ga0501036_0200542_1112_1411 99
1883 3300049572 Ga0501036_0275877 Ga0501036_0275877_520_819 99
1884 3300049572 Ga0501036_1415193 Ga0501036_1415193_246_545 99
1885 3300049573 Ga0501037_0000796 Ga0501037_0000796_16135_16434 99
1886 3300049573 Ga0501037_0001087 Ga0501037_0001087_17274_17573 99
1887 3300049573 Ga0501037_0003517 Ga0501037_0003517_2544_2843 99
1888 3300049573 Ga0501037_0020048 Ga0501037_0020048_69_368 99
1889 3300049573 Ga0501037_0073888 Ga0501037_0073888_1728_2027 99
1890 3300049573 Ga0501037_0143192 Ga0501037_0143192_465_764 99
1891 3300049573 Ga0501037_0410221 Ga0501037_0410221_36_335 99
1892 3300049573 Ga0501037_0417484 Ga0501037_0417484_222_521 99
1893 3300049574 Ga0501038_0001242 Ga0501038_0001242_5426_5725 99
1894 3300049574 Ga0501038_0022452 Ga0501038_0022452_492_791 99
1895 3300049574 Ga0501038_0022934 Ga0501038_0022934_2609_2908 99
1896 3300049574 Ga0501038_0128585 Ga0501038_0128585_639_938 99
1897 3300049574 Ga0501038_0229890 Ga0501038_0229890_94_393 99
1898 3300049574 Ga0501038_0235105 Ga0501038_0235105_216_515 99
1899 3300049574 Ga0501038_0680683 Ga0501038_0680683_415_714 99
1900 3300049575 Ga0501039_0001950 Ga0501039_0001950_14461_14760 99
1901 3300049575 Ga0501039_0004622 Ga0501039_0004622_3209_3508 99
1902 3300049575 Ga0501039_0014245 Ga0501039_0014245_4709_5008 99
1903 3300049575 Ga0501039_0062350 Ga0501039_0062350_2130_2429 99
1904 3300049575 Ga0501039_0083420 Ga0501039_0083420_1444_1743 99
1905 3300049575 Ga0501039_0420405 Ga0501039_0420405_79_384 99
1906 3300049575 Ga0501039_0482092 Ga0501039_0482092_645_944 99
1907 3300049575 Ga0501039_1502394 Ga0501039_1502394_130_429 99
1908 3300049576 Ga0501040_0002076 Ga0501040_0002076_6792_7097 99
1909 3300049576 Ga0501040_0012616 Ga0501040_0012616_184_483 99
1910 3300049576 Ga0501040_0182649 Ga0501040_0182649_1047_1346 99
1911 3300049577 Ga0501041_0000883 Ga0501041_0000883_6677_6976 99
1912 3300049577 Ga0501041_0180918 Ga0501041_0180918_163_462 99
1913 3300049578 Ga0501042_0009170 Ga0501042_0009170_5265_5564 99
1914 3300049578 Ga0501042_0069336 Ga0501042_0069336_2028_2327 99
1915 3300049579 Ga0501043_0000867 Ga0501043_0000867_17070_17369 99
1916 3300049579 Ga0501043_0002585 Ga0501043_0002585_539_838 99
1917 3300049579 Ga0501043_0005384 Ga0501043_0005384_9261_9560 99
1918 3300049579 Ga0501043_0006178 Ga0501043_0006178_1992_2291 99
1919 3300049579 Ga0501043_0026492 Ga0501043_0026492_3792_4091 99
1920 3300049579 Ga0501043_0038502 Ga0501043_0038502_637_936 99
1921 3300049579 Ga0501043_0236408 Ga0501043_0236408_163_462 99
1922 3300049579 Ga0501043_0343251 Ga0501043_0343251_575_874 99
1923 3300049579 Ga0501043_0507562 Ga0501043_0507562_218_517 99
1924 3300049579 Ga0501043_0584666 Ga0501043_0584666_219_518 99
1925 3300049580 Ga0501046_0002722 Ga0501046_0002722_128_427 99
1926 3300049580 Ga0501046_0003795 Ga0501046_0003795_4739_5038 99
1927 3300049580 Ga0501046_0013539 Ga0501046_0013539_515_814 99
1928 3300049580 Ga0501046_0073322 Ga0501046_0073322_1113_1412 99
1929 3300049581 Ga0501047_0000216 Ga0501047_0000216_41686_41985 99
1930 3300049581 Ga0501047_0000544 Ga0501047_0000544_21450_21749 99
1931 3300049581 Ga0501047_0002484 Ga0501047_0002484_13468_13767 99
1932 3300049581 Ga0501047_0027108 Ga0501047_0027108_522_821 99
1933 3300049581 Ga0501047_0034178 Ga0501047_0034178_4122_4421 99
1934 3300049581 Ga0501047_0045820 Ga0501047_0045820_3206_3505 99
1935 3300049581 Ga0501047_0068246 Ga0501047_0068246_525_824 99
1936 3300049581 Ga0501047_0271380 Ga0501047_0271380_1097_1396 99
1937 3300049581 Ga0501047_0295297 Ga0501047_0295297_78_377 99
1938 3300049581 Ga0501047_0335490 Ga0501047_0335490_337_636 99
1939 3300049581 Ga0501047_0604000 Ga0501047_0604000_86_385 99
1940 3300049581 Ga0501047_0771746 Ga0501047_0771746_442_741 99
1941 3300049581 Ga0501047_1361502 Ga0501047_1361502_82_381 99
1942 3300049582 Ga0501048_0002418 Ga0501048_0002418_11463_11762 99
1943 3300049582 Ga0501048_0002590 Ga0501048_0002590_10547_10846 99
1944 3300049582 Ga0501048_0003490 Ga0501048_0003490_2272_2571 99
1945 3300049582 Ga0501048_0199309 Ga0501048_0199309_417_716 99
1946 3300049583 Ga0501067_0002500 Ga0501067_0002500_2861_3160 99
1947 3300049584 Ga0501068_0000652 Ga0501068_0000652_12819_13118 99
1948 3300049584 Ga0501068_0192534 Ga0501068_0192534_813_1112 99
1949 3300049584 Ga0501068_0872184 Ga0501068_0872184_12_311 99
1950 3300049584 Ga0501068_1123447 Ga0501068_1123447_102_401 99
1951 3300049585 Ga0501069_0005601 Ga0501069_0005601_5947_6246 99
1952 3300049585 Ga0501069_0012698 Ga0501069_0012698_554_853 99
1953 3300049585 Ga0501069_0165863 Ga0501069_0165863_497_796 99
1954 3300049585 Ga0501069_0238129 Ga0501069_0238129_512_811 99
1955 3300049585 Ga0501069_0532726 Ga0501069_0532726_32_331 99
1956 3300049585 Ga0501069_0585736 Ga0501069_0585736_78_377 99
1957 3300049585 Ga0501069_0945461 Ga0501069_0945461_133_432 99
1958 3300049586 Ga0501070_0000456 Ga0501070_0000456_435_734 99
1959 3300049586 Ga0501070_0000766 Ga0501070_0000766_28514_28813 99
1960 3300049586 Ga0501070_0007603 Ga0501070_0007603_882_1181 99
1961 3300049586 Ga0501070_0108283 Ga0501070_0108283_586_885 99
1962 3300049586 Ga0501070_0326560 Ga0501070_0326560_382_681 99
1963 3300049586 Ga0501070_0505795 Ga0501070_0505795_234_533 99
1964 3300049586 Ga0501070_0656884 Ga0501070_0656884_421_720 99
1965 3300049586 Ga0501070_1493345 Ga0501070_1493345_37_336 99
1966 3300049587 Ga0501071_0006265 Ga0501071_0006265_3289_3588 99
1967 3300049588 Ga0501072_0002534 Ga0501072_0002534_5120_5419 99
1968 3300049588 Ga0501072_0776204 Ga0501072_0776204_183_482 99
1969 3300049589 Ga0501073_0055489 Ga0501073_0055489_325_624 99
1970 3300049589 Ga0501073_0057778 Ga0501073_0057778_1318_1617 99
1971 3300049589 Ga0501073_0073139 Ga0501073_0073139_1949_2248 99
1972 3300049589 Ga0501073_0137798 Ga0501073_0137798_1209_1508 99
1973 3300049589 Ga0501073_0224702 Ga0501073_0224702_935_1234 99
1974 3300049590 Ga0501074_0006059 Ga0501074_0006059_1741_2040 99
1975 3300049590 Ga0501074_0006068 Ga0501074_0006068_4482_4781 99
1976 3300049590 Ga0501074_1138889 Ga0501074_1138889_90_395 99
1977 3300049592 Ga0501076_0006709 Ga0501076_0006709_5247_5546 99
1978 3300049592 Ga0501076_1756910 Ga0501076_1756910_124_423 99
1979 3300049593 Ga0501077_0015072 Ga0501077_0015072_888_1187 99
1980 3300049593 Ga0501077_0184382 Ga0501077_0184382_515_814 99
1981 3300049669 Ga0501235_024973 Ga0501235_024973_483_782 99
1982 3300049705 Ga0501225_0088809 Ga0501225_0088809_465_764 99
1983 3300049741 Ga0501079_0023146 Ga0501079_0023146_1095_1394 99
1984 3300049742 Ga0501080_0015534 Ga0501080_0015534_967_1266 99
1985 3300049742 Ga0501080_0053708 Ga0501080_0053708_464_763 99
1986 3300049742 Ga0501080_0114961 Ga0501080_0114961_1510_1809 99
1987 3300049742 Ga0501080_0191273 Ga0501080_0191273_958_1257 99
1988 3300049742 Ga0501080_0691588 Ga0501080_0691588_438_737 99
1989 3300049742 Ga0501080_0717311 Ga0501080_0717311_327_626 99
1990 3300049742 Ga0501080_0974738 Ga0501080_0974738_368_667 99
1991 3300049743 Ga0501081_0336567 Ga0501081_0336567_314_619 99
1992 3300049744 Ga0501083_0001307 Ga0501083_0001307_5818_6117 99
1993 3300049744 Ga0501083_0178532 Ga0501083_0178532_966_1265 99
1994 3300049763 Ga0501266_088690 Ga0501266_088690_66_365 99
1995 3300049778 Ga0501282_003648 Ga0501282_003648_788_1087 99
1996 3300049822 Ga0501035_0000870 Ga0501035_0000870_8236_8535 99
1997 3300049822 Ga0501035_0001097 Ga0501035_0001097_10510_10809 99
1998 3300049822 Ga0501035_0001386 Ga0501035_0001386_12080_12379 99
1999 3300049822 Ga0501035_0004451 Ga0501035_0004451_1178_1477 99
2000 3300049822 Ga0501035_0010236 Ga0501035_0010236_8016_8315 99
2001 3300049822 Ga0501035_0018724 Ga0501035_0018724_3640_3939 99
2002 3300049822 Ga0501035_0020892 Ga0501035_0020892_572_871 99
2003 3300049822 Ga0501035_0090680 Ga0501035_0090680_2029_2328 99
2004 3300049822 Ga0501035_0101450 Ga0501035_0101450_125_424 99
2005 3300049822 Ga0501035_0179268 Ga0501035_0179268_687_986 99
2006 3300049822 Ga0501035_0429294 Ga0501035_0429294_713_1012 99
2007 3300049822 Ga0501035_0753361 Ga0501035_0753361_71_370 99
2008 3300049823 Ga0501044_0001367 Ga0501044_0001367_15173_15472 99
2009 3300049823 Ga0501044_0002317 Ga0501044_0002317_9388_9687 99
2010 3300049823 Ga0501044_0004810 Ga0501044_0004810_10103_10402 99
2011 3300049823 Ga0501044_0007119 Ga0501044_0007119_7292_7591 99
2012 3300049823 Ga0501044_0019900 Ga0501044_0019900_2686_2985 99
2013 3300049823 Ga0501044_0049478 Ga0501044_0049478_1450_1749 99
2014 3300049823 Ga0501044_0053350 Ga0501044_0053350_3089_3388 99
2015 3300049823 Ga0501044_0086075 Ga0501044_0086075_1720_2019 99
2016 3300049823 Ga0501044_0102858 Ga0501044_0102858_635_934 99
2017 3300049823 Ga0501044_0104234 Ga0501044_0104234_863_1162 99
2018 3300049823 Ga0501044_0121019 Ga0501044_0121019_1185_1484 99
2019 3300049823 Ga0501044_0160265 Ga0501044_0160265_679_978 99
2020 3300049823 Ga0501044_0197226 Ga0501044_0197226_886_1185 99
2021 3300049823 Ga0501044_0357273 Ga0501044_0357273_680_979 99
2022 3300049823 Ga0501044_0516620 Ga0501044_0516620_10_309 99
2023 3300049823 Ga0501044_0604048 Ga0501044_0604048_166_465 99
2024 3300049824 Ga0501045_0003212 Ga0501045_0003212_5059_5358 99
2025 3300049824 Ga0501045_0099953 Ga0501045_0099953_299_598 99
2026 3300049824 Ga0501045_0781291 Ga0501045_0781291_52_351 99
2027 3300049824 Ga0501045_1393037 Ga0501045_1393037_54_353 99
2028 3300050489 nmdc:mga03683_109749_c1 nmdc:mga03683_109749_c1_878_1195 99
2029 3300050489 nmdc:mga03683_196946_c1 nmdc:mga03683_196946_c1_346_645 99
2030 3300050489 nmdc:mga03683_21413_c1 nmdc:mga03683_21413_c1_451_750 99
2031 3300050489 nmdc:mga03683_255613_c1 nmdc:mga03683_255613_c1_414_713 99
2032 3300050489 nmdc:mga03683_317642_c1 nmdc:mga03683_317642_c1_370_669 99
2033 3300050489 nmdc:mga03683_49387_c1 nmdc:mga03683_49387_c1_764_1063 99
2034 3300050490 nmdc:mga03n38_102027_c1 nmdc:mga03n38_102027_c1_437_736 99
2035 3300050490 nmdc:mga03n38_104021_c1 nmdc:mga03n38_104021_c1_931_1230 99
2036 3300050490 nmdc:mga03n38_107_c1 nmdc:mga03n38_107_c1_4600_4899 99
2037 3300050490 nmdc:mga03n38_109159_c1 nmdc:mga03n38_109159_c1_884_1201 99
2038 3300050490 nmdc:mga03n38_133580_c1 nmdc:mga03n38_133580_c1_521_820 99
2039 3300050490 nmdc:mga03n38_135101_c1 nmdc:mga03n38_135101_c1_170_469 99
2040 3300050490 nmdc:mga03n38_138478_c1 nmdc:mga03n38_138478_c1_555_854 99
2041 3300050490 nmdc:mga03n38_213599_c1 nmdc:mga03n38_213599_c1_671_970 99
2042 3300050490 nmdc:mga03n38_2914_c1 nmdc:mga03n38_2914_c1_123_422 99
2043 3300050490 nmdc:mga03n38_298421_c1 nmdc:mga03n38_298421_c1_297_596 99
2044 3300050490 nmdc:mga03n38_32904_c1 nmdc:mga03n38_32904_c1_1503_1802 99
2045 3300050490 nmdc:mga03n38_33091_c1 nmdc:mga03n38_33091_c1_1072_1371 99
2046 3300050490 nmdc:mga03n38_336384_c1 nmdc:mga03n38_336384_c1_311_610 99
2047 3300050490 nmdc:mga03n38_349407_c1 nmdc:mga03n38_349407_c1_430_729 99
2048 3300050490 nmdc:mga03n38_483979_c1 nmdc:mga03n38_483979_c1_222_521 99
2049 3300050490 nmdc:mga03n38_5259_c1 nmdc:mga03n38_5259_c1_1009_1308 99
2050 3300050490 nmdc:mga03n38_538692_c1 nmdc:mga03n38_538692_c1_216_515 99
2051 3300050490 nmdc:mga03n38_89173_c1 nmdc:mga03n38_89173_c1_727_1026 99
2052 3300050490 nmdc:mga03n38_94257_c1 nmdc:mga03n38_94257_c1_872_1171 99
2053 3300050491 nmdc:mga00v17_108812_c1 nmdc:mga00v17_108812_c1_1418_1717 99
2054 3300050491 nmdc:mga00v17_11148_c1 nmdc:mga00v17_11148_c1_3349_3648 99
2055 3300050491 nmdc:mga00v17_112072_c1 nmdc:mga00v17_112072_c1_1053_1352 99
2056 3300050491 nmdc:mga00v17_117929_c1 nmdc:mga00v17_117929_c1_58_357 99
2057 3300050491 nmdc:mga00v17_158503_c1 nmdc:mga00v17_158503_c1_338_637 99
2058 3300050491 nmdc:mga00v17_18215_c1 nmdc:mga00v17_18215_c1_2148_2447 99
2059 3300050491 nmdc:mga00v17_214437_c1 nmdc:mga00v17_214437_c1_50_349 99
2060 3300050491 nmdc:mga00v17_2226_c1 nmdc:mga00v17_2226_c1_7719_8018 99
2061 3300050491 nmdc:mga00v17_235637_c1 nmdc:mga00v17_235637_c1_147_446 99
2062 3300050491 nmdc:mga00v17_260368_c1 nmdc:mga00v17_260368_c1_732_1031 99
2063 3300050491 nmdc:mga00v17_279242_c1 nmdc:mga00v17_279242_c1_608_907 99
2064 3300050491 nmdc:mga00v17_293564_c1 nmdc:mga00v17_293564_c1_51_350 99
2065 3300050491 nmdc:mga00v17_329288_c1 nmdc:mga00v17_329288_c1_15_314 99
2066 3300050491 nmdc:mga00v17_45291_c1 nmdc:mga00v17_45291_c1_1831_2130 99
2067 3300050491 nmdc:mga00v17_541992_c1 nmdc:mga00v17_541992_c1_117_416 99
2068 3300050491 nmdc:mga00v17_653229_c1 nmdc:mga00v17_653229_c1_292_591 99
2069 3300050491 nmdc:mga00v17_742439_c1 nmdc:mga00v17_742439_c1_12_311 99
2070 3300050491 nmdc:mga00v17_97638_c1 nmdc:mga00v17_97638_c1_232_531 99
2071 3300050492 nmdc:mga0yw44_22775_c1 nmdc:mga0yw44_22775_c1_1712_2011 99
2072 3300050492 nmdc:mga0yw44_2716_c1 nmdc:mga0yw44_2716_c1_1345_1644 99
2073 3300050492 nmdc:mga0yw44_290519_c1 nmdc:mga0yw44_290519_c1_107_406 99
2074 3300050492 nmdc:mga0yw44_35428_c1 nmdc:mga0yw44_35428_c1_2352_2651 99
2075 3300050492 nmdc:mga0yw44_448239_c1 nmdc:mga0yw44_448239_c1_351_650 99
2076 3300050492 nmdc:mga0yw44_480209_c1 nmdc:mga0yw44_480209_c1_502_801 99
2077 3300050492 nmdc:mga0yw44_61750_c1 nmdc:mga0yw44_61750_c1_1852_2151 99
2078 3300050492 nmdc:mga0yw44_622061_c1 nmdc:mga0yw44_622061_c1_417_716 99
2079 3300050492 nmdc:mga0yw44_659728_c1 nmdc:mga0yw44_659728_c1_184_483 99
2080 3300050492 nmdc:mga0yw44_739956_c1 nmdc:mga0yw44_739956_c1_206_505 99
2081 3300050492 nmdc:mga0yw44_756391_c1 nmdc:mga0yw44_756391_c1_205_504 99
2082 3300050492 nmdc:mga0yw44_826811_c1 nmdc:mga0yw44_826811_c1_264_581 99
2083 3300050492 nmdc:mga0yw44_99428_c1 nmdc:mga0yw44_99428_c1_1404_1703 99
2084 3300050494 nmdc:mga06z11_100757_c1 nmdc:mga06z11_100757_c1_994_1293 99
2085 3300050494 nmdc:mga06z11_241786_c1 nmdc:mga06z11_241786_c1_159_458 99
2086 3300050494 nmdc:mga06z11_31001_c1 nmdc:mga06z11_31001_c1_1838_2137 99
2087 3300050494 nmdc:mga06z11_464827_c1 nmdc:mga06z11_464827_c1_437_736 99
2088 3300050494 nmdc:mga06z11_515432_c1 nmdc:mga06z11_515432_c1_19_318 99
2089 3300050494 nmdc:mga06z11_528606_c1 nmdc:mga06z11_528606_c1_157_474 99
2090 3300050494 nmdc:mga06z11_533_c1 nmdc:mga06z11_533_c1_4913_5212 99
2091 3300050494 nmdc:mga06z11_920561_c1 nmdc:mga06z11_920561_c1_131_430 99
2092 3300050495 nmdc:mga04h51_195285_c1 nmdc:mga04h51_195285_c1_398_697 99
2093 3300050495 nmdc:mga04h51_23177_c1 nmdc:mga04h51_23177_c1_1400_1699 99
2094 3300050496 nmdc:mga07m45_116413_c1 nmdc:mga07m45_116413_c1_481_780 99
2095 3300050496 nmdc:mga07m45_14311_c1 nmdc:mga07m45_14311_c1_40_339 99
2096 3300050496 nmdc:mga07m45_161483_c1 nmdc:mga07m45_161483_c1_461_760 99
2097 3300050496 nmdc:mga07m45_298273_c1 nmdc:mga07m45_298273_c1_326_625 99
2098 3300050496 nmdc:mga07m45_45821_c1 nmdc:mga07m45_45821_c1_626_925 99
2099 3300050496 nmdc:mga07m45_70843_c1 nmdc:mga07m45_70843_c1_368_667 99
2100 3300050496 nmdc:mga07m45_83179_c1 nmdc:mga07m45_83179_c1_190_489 99
2101 3300050507 nmdc:mga05p37_15340_c1 nmdc:mga05p37_15340_c1_5387_5686 99
2102 3300050507 nmdc:mga05p37_86594_c1 nmdc:mga05p37_86594_c1_1875_2174 99
2103 3300050508 nmdc:mga09592_684227_c1 nmdc:mga09592_684227_c1_540_839 99
2104 3300050509 nmdc:mga0qj67_73761_c1 nmdc:mga0qj67_73761_c1_1951_2250 99
2105 3300050509 nmdc:mga0qj67_86419_c1 nmdc:mga0qj67_86419_c1_424_723 99
2106 3300050511 nmdc:mga08y16_1386578_c1 nmdc:mga08y16_1386578_c1_140_439 99
2107 3300050511 nmdc:mga08y16_1621178_c1 nmdc:mga08y16_1621178_c1_195_494 99
2108 3300050511 nmdc:mga08y16_760492_c1 nmdc:mga08y16_760492_c1_388_687 99
2109 3300050515 nmdc:mga0a205_235559_c1 nmdc:mga0a205_235559_c1_1190_1489 99
2110 3300050516 nmdc:mga0sz30_105066_c1 nmdc:mga0sz30_105066_c1_539_838 99
2111 3300050516 nmdc:mga0sz30_114790_c1 nmdc:mga0sz30_114790_c1_872_1171 99
2112 3300050516 nmdc:mga0sz30_214035_c1 nmdc:mga0sz30_214035_c1_136_435 99
2113 3300050516 nmdc:mga0sz30_21480_c1 nmdc:mga0sz30_21480_c1_1001_1300 99
2114 3300050516 nmdc:mga0sz30_247555_c1 nmdc:mga0sz30_247555_c1_313_612 99
2115 3300050516 nmdc:mga0sz30_25097_c1 nmdc:mga0sz30_25097_c1_858_1157 99
2116 3300050516 nmdc:mga0sz30_358061_c1 nmdc:mga0sz30_358061_c1_321_620 99
2117 3300050516 nmdc:mga0sz30_38126_c1 nmdc:mga0sz30_38126_c1_683_982 99
2118 3300050516 nmdc:mga0sz30_38437_c1 nmdc:mga0sz30_38437_c1_827_1126 99
2119 3300050516 nmdc:mga0sz30_395087_c1 nmdc:mga0sz30_395087_c1_233_532 99
2120 3300050516 nmdc:mga0sz30_451939_c1 nmdc:mga0sz30_451939_c1_250_549 99
2121 3300050516 nmdc:mga0sz30_465596_c1 nmdc:mga0sz30_465596_c1_148_447 99
2122 3300050516 nmdc:mga0sz30_62206_c2 nmdc:mga0sz30_62206_c2_53_352 99
2123 3300050516 nmdc:mga0sz30_70896_c1 nmdc:mga0sz30_70896_c1_273_572 99
2124 3300053077 Ga0495601_0026650 Ga0495601_0026650_1707_2006 99
2125 3300053077 Ga0495601_0038926 Ga0495601_0038926_1660_1959 99
2126 3300053077 Ga0495601_0073237 Ga0495601_0073237_45_344 99
2127 3300053078 Ga0495612_0005779 Ga0495612_0005779_3699_3998 99
2128 3300053078 Ga0495612_0087117 Ga0495612_0087117_756_1055 99
2129 3300053079 Ga0500610_0011119 Ga0500610_0011119_2289_2588 99
2130 3300053079 Ga0500610_0147176 Ga0500610_0147176_562_861 99
2131 3300053079 Ga0500610_0284705 Ga0500610_0284705_33_332 99
2132 3300053080 Ga0500635_0465480 Ga0500635_0465480_41_340 99
2133 3300053083 Ga0495655_0093937 Ga0495655_0093937_529_828 99
2134 3300053083 Ga0495655_0324614 Ga0495655_0324614_37_336 99
2135 3300053083 Ga0495655_0367919 Ga0495655_0367919_131_457 99
2136 3300053084 Ga0495595_0407764 Ga0495595_0407764_137_436 99
2137 3300053085 Ga0495619_0007645 Ga0495619_0007645_4350_4649 99
2138 3300053085 Ga0495619_0133108 Ga0495619_0133108_274_573 99
2139 3300053085 Ga0495619_0209860 Ga0495619_0209860_144_443 99
2140 3300053085 Ga0495619_0772303 Ga0495619_0772303_242_541 99
2141 3300053086 Ga0500578_0185326 Ga0500578_0185326_208_507 99
2142 3300053086 Ga0500578_0250628 Ga0500578_0250628_705_1004 99
2143 3300053086 Ga0500578_0361070 Ga0500578_0361070_510_809 99
2144 3300053087 Ga0500643_004993 Ga0500643_004993_3981_4280 99
2145 3300053087 Ga0500643_034977 Ga0500643_034977_750_1049 99
2146 3300053087 Ga0500643_040244 Ga0500643_040244_774_1073 99
2147 3300053087 Ga0500643_042530 Ga0500643_042530_733_1032 99
2148 3300053089 Ga0500581_203034 Ga0500581_203034_460_759 99
2149 3300053092 Ga0500583_0211859 Ga0500583_0211859_206_505 99
2150 3300053092 Ga0500583_0318492 Ga0500583_0318492_20_319 99
2151 3300053093 Ga0500651_0722005 Ga0500651_0722005_168_467 99
2152 3300053094 Ga0500566_0114405 Ga0500566_0114405_1086_1385 99
2153 3300053095 Ga0500640_000199 Ga0500640_000199_860_1159 99
2154 3300053096 Ga0500641_0119258 Ga0500641_0119258_280_579 99
2155 3300053098 Ga0500650_0052766 Ga0500650_0052766_1173_1472 99
2156 3300053099 Ga0500654_032949 Ga0500654_032949_309_608 99
2157 3300053099 Ga0500654_187819 Ga0500654_187819_17_316 99
2158 3300053101 Ga0500553_034430 Ga0500553_034430_1311_1610 99
2159 3300053104 Ga0500556_0025034 Ga0500556_0025034_1555_1854 99
2160 3300053104 Ga0500556_0115219 Ga0500556_0115219_463_762 99
2161 3300053106 Ga0500558_214684 Ga0500558_214684_225_524 99
2162 3300053107 Ga0500560_000605 Ga0500560_000605_239_538 99
2163 3300053107 Ga0500560_015926 Ga0500560_015926_261_560 99
2164 3300053107 Ga0500560_042009 Ga0500560_042009_1057_1356 99
2165 3300053108 Ga0500562_037695 Ga0500562_037695_317_616 99
2166 3300053108 Ga0500562_163035 Ga0500562_163035_44_343 99
2167 3300053109 Ga0500569_000808 Ga0500569_000808_2797_3096 99
2168 3300053111 Ga0500572_027614 Ga0500572_027614_961_1260 99
2169 3300053111 Ga0500572_259794 Ga0500572_259794_52_351 99
2170 3300053118 Ga0500594_0187516 Ga0500594_0187516_187_486 99
2171 3300053119 Ga0500595_063465 Ga0500595_063465_64_363 99
2172 3300053122 Ga0500608_054416 Ga0500608_054416_734_1033 99
2173 3300053123 Ga0500614_041281 Ga0500614_041281_535_834 99
2174 3300053125 Ga0500618_152749 Ga0500618_152749_79_378 99
2175 3300053126 Ga0500621_029543 Ga0500621_029543_1575_1874 99
2176 3300053129 Ga0500628_004395 Ga0500628_004395_638_937 99
2177 3300053129 Ga0500628_030134 Ga0500628_030134_835_1134 99
2178 3300053131 Ga0500652_001721 Ga0500652_001721_3642_3941 99
2179 3300053131 Ga0500652_010700 Ga0500652_010700_1035_1334 99
2180 3300053131 Ga0500652_176044 Ga0500652_176044_507_806 99
2181 3300053131 Ga0500652_269688 Ga0500652_269688_138_437 99
2182 3300053133 Ga0500655_055522 Ga0500655_055522_227_526 99
2183 3300053134 Ga0500658_0021304 Ga0500658_0021304_1302_1601 99
2184 3300053136 Ga0500559_0146159 Ga0500559_0146159_756_1055 99
2185 3300053136 Ga0500559_0193688 Ga0500559_0193688_245_544 99
2186 3300053136 Ga0500559_0529806 Ga0500559_0529806_217_516 99
2187 3300053137 Ga0500561_0000789 Ga0500561_0000789_2446_2745 99
2188 3300053140 Ga0500573_0005248 Ga0500573_0005248_3686_3985 99
2189 3300053140 Ga0500573_0024372 Ga0500573_0024372_1761_2060 99
2190 3300053140 Ga0500573_0052240 Ga0500573_0052240_548_847 99
2191 3300053140 Ga0500573_0446074 Ga0500573_0446074_216_515 99
2192 3300053143 Ga0500579_044854 Ga0500579_044854_155_454 99
2193 3300053145 Ga0500586_026498 Ga0500586_026498_444_743 99
2194 3300053145 Ga0500586_198010 Ga0500586_198010_145_444 99
2195 3300053146 Ga0500588_0035717 Ga0500588_0035717_261_560 99
2196 3300053146 Ga0500588_0306182 Ga0500588_0306182_201_500 99
2197 3300053149 Ga0500600_0022759 Ga0500600_0022759_1328_1627 99
2198 3300053150 Ga0500603_037368 Ga0500603_037368_24_323 99
2199 3300053153 Ga0500616_0041089 Ga0500616_0041089_1984_2283 99
2200 3300053153 Ga0500616_0055332 Ga0500616_0055332_669_968 99
2201 3300053153 Ga0500616_0141584 Ga0500616_0141584_768_1067 99
2202 3300053155 Ga0500620_283881 Ga0500620_283881_179_478 99
2203 3300053158 Ga0500627_0085476 Ga0500627_0085476_159_458 99
2204 3300053160 Ga0500633_0022892 Ga0500633_0022892_1045_1344 99
2205 3300053160 Ga0500633_0254976 Ga0500633_0254976_47_346 99
2206 3300053161 Ga0500634_0039494 Ga0500634_0039494_1221_1520 99
2207 3300053161 Ga0500634_0134890 Ga0500634_0134890_47_346 99
2208 3300053730 Ga0500645_000032 Ga0500645_000032_116888_117187 99
2209 3300053730 Ga0500645_172225 Ga0500645_172225_142_441 99
2210 3300053732 Ga0500656_030485 Ga0500656_030485_12_311 99
2211 3300053739 Ga0500587_003192 Ga0500587_003192_1308_1607 99
2212 3300054114 Ga0501084_0001814 Ga0501084_0001814_11310_11609 99
2213 3300059492 Ga0587073_0223576 Ga0587073_0223576_115_414 99
2214 3300059503 Ga0587080_095102 Ga0587080_095102_278_577 99
2215 3300059505 Ga0587083_0054650 Ga0587083_0054650_247_546 99
2216 3300059622 Ga0587099_061417 Ga0587099_061417_74_373 99
2217 3300059628 Ga0587122_008489 Ga0587122_008489_227_526 99
2218 3300059640 Ga0587067_042151 Ga0587067_042151_383_682 99
2219 3300059642 Ga0587069_121145 Ga0587069_121145_208_507 99
2220 3300059655 Ga0587114_057507 Ga0587114_057507_149_448 99
2221 3300060353 Ga0501082_0003705 Ga0501082_0003705_8140_8439 99
2222 3300061719 Ga0466962_0000056 Ga0466962_0000056_25566_25865 99
2223 3300061719 Ga0466962_0000729 Ga0466962_0000729_9128_9427 99
2224 3300061719 Ga0466962_0003557 Ga0466962_0003557_2969_3268 99
2225 3300061719 Ga0466962_0007132 Ga0466962_0007132_2257_2556 99
2226 3300061719 Ga0466962_0017444 Ga0466962_0017444_2580_2879 99
2227 3300061719 Ga0466962_0086224 Ga0466962_0086224_19_318 99
2228 3300061719 Ga0466962_0434474 Ga0466962_0434474_127_426 99
2229 3300061734 Ga0530510_0034383 Ga0530510_0034383_845_1144 99

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00420

Oxidored_q2

NADH-ubiquinone/plastoquinone oxidoreductase chain 4L

7

95

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
7su2-assembly1.cif.gz_C crystal structure of a co-bound ridc1 variant 0.9678 7 45
7rwx-assembly1.cif.gz_B-2 crystal structure of a zn-bound ridc1 variant in the presence of reductant 0.966 7 45
6dy4-assembly2.cif.gz_D fe(ii)-bound structure of the engineered cyt cb562 variant, ch2e 0.9643 7 45
5l31-assembly1.cif.gz_B crystal structure of an engineered metal-free ridc1 variant containing five disulfide bonds. 0.963 7 45
4er9-assembly1.cif.gz_A crystal structure of cytochrome b562 from salmonella enterica subsp. enterica serovar typhimurium str. 14028s 0.9626 6 45
ID Description Score Start End Superfamily
af_Q9XK79_1_97_1.10.287.3510 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.9694 7 84 1.10.287.3510
2qlaA00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Cytochrome c/b562 0.9667 7 45 1.20.120.10
4er9A00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Cytochrome c/b562 0.9626 6 45 1.20.120.10
2bc5B00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Cytochrome c/b562 0.9597 7 45 1.20.120.10
3nmiE00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Cytochrome c/b562 0.956 7 45 1.20.120.10
ID Description Score Start End GO Terms
AF-A0A2E0M9H2-F1-model_v4 NADH-quinone oxidoreductase subunit NuoK 0.9959 1 73 GO:0016651
GO:0030964
GO:0042773
AF-A0A0C9LSE0-F1-model_v4 NADH-quinone oxidoreductase subunit K (EC 7.1.1.-) (NADH dehydrogenase I subunit K) (NDH-1 subunit K) 0.9856 3 84 GO:0005886
GO:0030964
GO:0042773
GO:0048038
GO:0050136
AF-A0A4P5XI80-F1-model_v4 NADH-quinone oxidoreductase subunit K (EC 7.1.1.-) (NADH dehydrogenase I subunit K) (NDH-1 subunit K) 0.9824 3 84 GO:0005886
GO:0030964
GO:0042773
GO:0048038
GO:0050136
AF-A0A7C3TW05-F1-model_v4 NADH-quinone oxidoreductase subunit K (EC 7.1.1.-) (NADH dehydrogenase I subunit K) (NDH-1 subunit K) 0.9794 3 84 GO:0005886
GO:0030964
GO:0042773
GO:0048038
GO:0050136
AF-A0A0R2U7Q2-F1-model_v4 NADH:ubiquinone oxidoreductase subunit K (EC 1.6.5.11) 0.9775 1 79 GO:0016651
GO:0030964
GO:0042773
GO:0048038

Feature Viewer

pLDDT pTM Quality
91.03 0.75 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map