F496404

General Info

Members Datasets Scaffolds Average Seq Length
2107 721 1956 289

Family's Representative Sequence

Representative Sequence 3300009094|Ga0111539_10322485|Ga0111539_103224852
Length 348
Sequence MFELLEIPPQALFGQLLLGLINGSFYAILSLGLAVIFGLLNIINFTHGAQYMMGAFVAWMLLNWLGLGYWWAFILSPVIVGIVGVVLERNLIAQLASTDKVRSLLFLVASLVVFIVSYGVFNWSMALSLFLALAIAGGLGAAWAHLARDRIGVVEGHVDHLYGLLLTFGLALIIQGLFRNEYGSSGLPYQIPAQLTGGQNLGFMFLPNYRGWVVVASLVVCLATWFVIEKTRLGAYLRAATENATLTQAFGINVPRLVTGLAAFAGVLAAPIYSVNPTMGENLIIVVFAVVVIGGMGSILGAIVTGFGLGLIEGLTKVFYPEASNTVIFIIMAIVLLIKPAGLFGRAA

Samples

Sample ID Description Type Environment
1 2508501050 Microvirga lupini Lut6 Isolate Nodule
2 2508501125 Burkholderia sp. WSM2232 Isolate Nodule
3 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
4 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
5 2511231221 Azospirillum lipoferum 4B Isolate Rhizosphere
6 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
7 2513237082 Paraburkholderia mimosarum STM3621 Isolate Nodule
8 2513237150 Cupriavidus taiwanensis STM6018 Isolate Nodule
9 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
10 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
11 2519103095 Burkholderia sp. KJ006 Isolate Nodule
12 2522572158 Azospirillum halopraeferens DSM 3675 Isolate Unclassified
13 2526164713 Paraburkholderia phenoliruptrix JPY366 Isolate Nodule
14 2547132374 Acidovorax radicis N35 Isolate Unclassified
15 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
16 2582581311 Burkholderia sp. WP42 Isolate Rhizosphere
17 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
18 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
19 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
20 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
21 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
22 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
23 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
24 2599185239 Burkholderia sp. NFACC38-1 Isolate Rhizoplane
25 2599185240 Burkholderia sp. NFPP32 Isolate Rhizoplane
26 2599185355 Burkholderia sp. NFACC33-1 Isolate Rhizoplane
27 2600255067 Paraburkholderia kururiensis thiooxydans NBRC 107107 Isolate Unclassified
28 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
29 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
30 2643221596 Acidovorax sp. Root70 Isolate Unclassified
31 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
32 2643221658 Variovorax sp. Root411 Isolate Unclassified
33 2643221672 Variovorax sp. Root434 Isolate Unclassified
34 2643221683 Variovorax sp. Root473 Isolate Unclassified
35 2643221736 Bosea sp. Root483D1 Isolate Unclassified
36 2675903129 Burkholderia pyrrocinia NFIX32 Isolate Rhizoplane
37 2738541277 Variovorax sp. GV051 Isolate Unclassified
38 2738541307 Variovorax sp. GV008 Isolate Unclassified
39 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
40 2738543013 Variovorax sp. BT01 Isolate Unclassified
41 2738543019 Variovorax sp. GV040 Isolate Unclassified
42 2739367655 Pusillimonas sp. YR330 Isolate Unclassified
43 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
44 2773857925 Microvirga vignae BR3299 Isolate Unclassified
45 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
46 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
47 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
48 2816332253 Burkholderia vietnamiensis HI2297 Isolate Unclassified
49 2816332256 Burkholderia vietnamiensis MSMB608WGS Isolate Unclassified
50 2816332286 Burkholderia vietnamiensis HI2221 Isolate Rhizosphere
51 2818991446 Variovorax sp. 1180 Isolate Unclassified
52 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
53 2818991452 Burkholderia cepacia 561 Isolate Unclassified
54 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
55 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
56 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
57 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
58 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
59 2841760612 Bosea sp. Tri-49 Isolate Nodule
60 2841911363 Bosea caraganae RCAM04685 Isolate Nodule
61 2841917233 Bosea caraganae RCAM04680 Isolate Nodule
62 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
63 2842677519 Variovorax sp. R-72495 Isolate Unclassified
64 2842694124 Methylopila sp. R-72369 Isolate Unclassified
65 2842733646 Variovorax sp. R-72446 Isolate Unclassified
66 2842747753 Variovorax sp. R-72060 Isolate Unclassified
67 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
68 2844104063 Bosea sp. Tri-39 Isolate Nodule
69 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
70 2851182111 Bosea sp. Tri-44 Isolate Nodule
71 2851246043 Bosea sp. Tri-54 Isolate Nodule
72 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
73 2863421361 Burkholderia cenocepacia CACua-24 Isolate Rhizosphere
74 2870068957 Burkholderia sp. JP2-270 Isolate Unclassified
75 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
76 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
77 2885198086 Variovorax sp. 679 Isolate Unclassified
78 2885211737 Variovorax sp. 553 Isolate Unclassified
79 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
80 2894772417 Roseomonas oryzicola KCTC 22478 Isolate Rhizosphere
81 2897803580 Azospirillum doebereinerae GSF71 Isolate Unclassified
82 2899924645 Variovorax sp. 369 Isolate Unclassified
83 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
84 2901300506 Cupriavidus sp. UYMSc13B Isolate Unclassified
85 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
86 2904456579 Variovorax sp. 2002 Isolate Unclassified
87 2904479285 Comamonas sediminis 4487 Isolate Rhizosphere
88 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
89 2904564687 Burkholderia sp. 571 Isolate Unclassified
90 2904571731 Burkholderia cenocepacia 574 Isolate Unclassified
91 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
92 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
93 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
94 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
95 2928037797 Variovorax sp. 1126 Isolate Unclassified
96 2928044640 Variovorax sp. 1128 Isolate Unclassified
97 2928051484 Variovorax sp. 1133 Isolate Unclassified
98 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
99 2928070936 Variovorax gossypii 1167 Isolate Unclassified
100 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
101 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
102 2928157003 Burkholderia ambifaria 566 Isolate Unclassified
103 2928163908 Burkholderia sp. 567 Isolate Unclassified
104 2928170801 Burkholderia sp. 572 Isolate Unclassified
105 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
106 2928536128 Burkholderia sola 565 Isolate Unclassified
107 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
108 2929520902 Variovorax beijingensis 502 Isolate Unclassified
109 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
110 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
111 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
112 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
113 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
114 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
115 2981990288 Burkholderia sp. PvR073 Isolate Rhizosphere
116 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere
117 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
118 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
119 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
120 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
121 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
122 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
123 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
124 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
125 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
126 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
127 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
128 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
129 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
130 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
131 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
132 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
133 3300003349 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM Metagenome Rhizosphere
134 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
135 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
136 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
137 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
138 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
139 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
140 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
141 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
142 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
143 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
144 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
145 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
146 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
147 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
148 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
149 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
150 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
151 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
152 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
153 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
154 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
155 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
156 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
157 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
158 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
159 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
160 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
161 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
162 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
163 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
164 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
165 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
166 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
167 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
168 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
169 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
170 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
171 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
172 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
173 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
174 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
175 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
176 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
177 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
178 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
179 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
180 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
181 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
182 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
183 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
184 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
185 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
186 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
187 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
188 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
189 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
190 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
191 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
192 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
193 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
194 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
195 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
196 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
197 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
198 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
199 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
200 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
201 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
202 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
203 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
204 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
205 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
206 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
207 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
208 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
209 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
210 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
211 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
212 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
213 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
214 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
215 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
216 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
217 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
218 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
219 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
220 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
221 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
222 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
223 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
224 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
225 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
226 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
227 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
228 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
229 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
230 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
231 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
232 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
233 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
234 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
235 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
236 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
237 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
238 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
239 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
240 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
241 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
242 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
243 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
244 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
245 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
246 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
247 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
248 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
249 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
250 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
251 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
252 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
253 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
254 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
255 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
256 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
257 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
258 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
259 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
260 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
261 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
262 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
263 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
264 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
265 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
266 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
267 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
268 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
269 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
270 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
271 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
272 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
273 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
274 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
275 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
276 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
277 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
278 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
279 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
280 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
281 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
282 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
283 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
284 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
285 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
286 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
287 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
288 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
289 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
290 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
291 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
292 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
293 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
294 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
295 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
296 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
297 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
298 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
299 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
300 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
301 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
302 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
303 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
304 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
305 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
306 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
307 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
308 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
309 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
310 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
311 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
312 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
313 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
314 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
315 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
316 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
317 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
318 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
319 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
320 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
321 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
322 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
323 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
324 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
325 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
326 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
327 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
328 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
329 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
330 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
331 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
332 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
333 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
334 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
335 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
336 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
337 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
338 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
339 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
340 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
341 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
342 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
343 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
344 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
345 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
346 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
347 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
348 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
349 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
350 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
351 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
352 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
353 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
354 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
355 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
356 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
357 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
358 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
359 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
360 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
361 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
362 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
363 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
364 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
365 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
366 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
367 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
368 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
369 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
370 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
371 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
372 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
373 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
374 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
375 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
376 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
377 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
378 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
379 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
380 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
381 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
382 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
383 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
384 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
385 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
386 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
387 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
388 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
389 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
390 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
391 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
392 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
393 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
394 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
395 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
396 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
397 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
398 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
399 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
400 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
401 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
402 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
403 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
404 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
405 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
406 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
407 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
408 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
409 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
410 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
411 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
412 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
413 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
414 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
415 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
416 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
417 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
418 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
419 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
420 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
421 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
422 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
423 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
424 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
425 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
426 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
427 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
428 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
429 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
430 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
431 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
432 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
433 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
434 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
435 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
436 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
437 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
438 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
439 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
440 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
441 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
442 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
443 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
444 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
445 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
446 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
447 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
448 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
449 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
450 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
451 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
452 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
453 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
454 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
455 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
456 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
457 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
458 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
459 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
460 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
461 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
462 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
463 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
464 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
465 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
466 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
467 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
468 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
469 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
470 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
471 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
472 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
473 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
474 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
475 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
476 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
477 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
478 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
479 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
480 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
481 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
482 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
483 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
484 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
485 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
486 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
487 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
488 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
489 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
490 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
491 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
492 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
493 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
494 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
495 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
496 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
497 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
498 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
499 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
500 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
501 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
502 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
503 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
504 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
505 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
506 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
507 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
508 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
509 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
510 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
511 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
512 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
513 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
514 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
515 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
516 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
517 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
518 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
519 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
520 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
521 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
522 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
523 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
524 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
525 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
526 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
527 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
528 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
529 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
530 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
531 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
532 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
533 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
534 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
535 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
536 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
537 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
538 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
539 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
540 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
541 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
542 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
543 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
544 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
545 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
546 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
547 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
548 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
549 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
550 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
551 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
552 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
553 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
554 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
555 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
556 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
557 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
558 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
559 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
560 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
561 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
562 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
563 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
564 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
565 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
566 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
567 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
568 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
569 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
570 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
571 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
572 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
573 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
574 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
575 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
576 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
577 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
578 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
579 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
580 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
581 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
582 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
583 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
584 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
585 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
586 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
587 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
588 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
589 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
590 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
591 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
592 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
593 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
594 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
595 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
596 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
597 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
598 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
599 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
600 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
601 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
602 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
603 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
604 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
605 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
606 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
607 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
608 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
609 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
610 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
611 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
612 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
613 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
614 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
615 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
616 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
617 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
618 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
619 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
620 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
621 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
622 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
623 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
624 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
625 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
626 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
627 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
628 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
629 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
630 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
631 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
632 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
633 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
634 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
635 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
636 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
637 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
638 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
639 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
640 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
641 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
642 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
643 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
644 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
645 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
646 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
647 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
648 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
649 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
650 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
651 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
652 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
653 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
654 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
655 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
656 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
657 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
658 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
659 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
660 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
661 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
662 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
663 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
664 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
665 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
666 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
667 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
668 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
669 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
670 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
671 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
672 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
673 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
674 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
675 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
676 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
677 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
678 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
679 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
680 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
681 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
682 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
683 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
684 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
685 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
686 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
687 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
688 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
689 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
690 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
691 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
692 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
693 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
694 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
695 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
696 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
697 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
698 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
699 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
700 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
701 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
702 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
703 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
704 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
705 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
706 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
707 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
708 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
709 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
710 639633007 Azoarcus olearius BH72 Isolate Unclassified
711 641736154 Burkholderia ambifaria IOP40-10 Isolate Rhizosphere
712 8018845410 Burkholderia reimsis BE51 Isolate Rhizosphere
713 8020807995 Burkholderia sp. B10 Isolate Rhizosphere
714 8020938398 Burkholderia sp. BE12 Isolate Rhizosphere
715 8020945358 Burkholderia sp. BE17 Isolate Rhizosphere
716 8020953355 Burkholderia sp. BE24 Isolate Rhizosphere
717 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere
718 8039098773 Burkholderia multivorans MSMB612WGS Isolate Unclassified
719 8040167225 Burkholderia vietnamiensis RS1 Isolate Unclassified
720 8040173305 Burkholderia vietnamiensis BE10 Isolate Rhizosphere
721 8054002106 Azospirillum lipoferum 59b Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 92.79
Metatranscriptomes 0.09
Isolates 7.12

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.68
Nodule 1.04
Rhizoplane 3.75
Rhizosphere 76.79
Stem 0
Stem Tuber 0
Unclassified 6.74

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24752J21851_1002365 3300001976 Bacteria 2508
2 JGI24746J21847_1003310 3300001977 Bacteria 2534
3 JGI24740J21852_10003776 3300001979 Bacteria 6599
4 JGI24743J22301_10003473 3300001991 Bacteria 2498
5 JGI24750J21931_1000181 3300002070 Bacteria 10568
6 JGI24745J21846_1000318 3300002073 Bacteria 4145
7 JGI24748J21848_1000571 3300002074 Bacteria 3977
8 JGI24748J21848_1001710 3300002074 Bacteria 2435
9 JGI24738J21930_10001393 3300002075 Bacteria 6712
10 JGI24034J26672_10004122 3300002239 Bacteria 2049
11 JGI25150J39212_1002294 3300002774 Bacteria 4834
12 JGI25159J45721_1001628 3300002987 Bacteria 9133
13 JGI25159J45721_1010099 3300002987 Bacteria 2435
14 JGI25159J45721_1014733 3300002987 Bacteria 1747
15 JGI25151J46595_10001132 3300003187 Bacteria 19370
16 JGI25151J46595_10011005 3300003187 Bacteria 4178
17 JGI25151J46595_10023031 3300003187 Bacteria 2575
18 JGI25151J46595_10027382 3300003187 Bacteria 2286
19 JGI25151J46595_10034292 3300003187 Bacteria 1943
20 JGI25151J46595_10034941 3300003187 Bacteria 1915
21 JGI25151J46595_10040727 3300003187 Bacteria 1698
22 JGI25406J46586_10005366 3300003203 Bacteria 5949
23 JGI26129J50193_1001475 3300003349 Bacteria 1599
24 JGI25160J50197_1000319 3300003354 Bacteria 33363
25 JGI25160J50197_1010760 3300003354 Bacteria 3287
26 JGI25161J50226_1000092 3300003374 Bacteria 72932
27 Ga0006562J51391_1013826 3300003578 Bacteria 5886
28 Ga0006562J51391_1033002 3300003578 Bacteria 4745
29 JGI25404J52841_10007519 3300003659 Bacteria 2306
30 Ga0055532_1004429 3300003758 Bacteria 2124
31 Ga0055525_1000036 3300003759 Bacteria 298878
32 Ga0055526_1018980 3300003771 Bacteria 2529
33 Ga0055537_1000104 3300003773 Bacteria 63394
34 Ga0055537_1000780 3300003773 Bacteria 16027
35 Ga0055537_1004214 3300003773 Bacteria 4166
36 Ga0055537_1011246 3300003773 Bacteria 1830
37 Ga0055524_1010401 3300003775 Bacteria 3707
38 Ga0055524_1033844 3300003775 Bacteria 1423
39 Ga0055536_1000430 3300003781 Bacteria 29951
40 Ga0055536_1005578 3300003781 Bacteria 6105
41 Ga0055536_1021898 3300003781 Bacteria 1923
42 Ga0055536_1022508 3300003781 Bacteria 1879
43 Ga0055534_1000042 3300003784 Bacteria 99433
44 Ga0055534_1002677 3300003784 Bacteria 6022
45 Ga0055534_1006261 3300003784 Bacteria 3029
46 Ga0055534_1013054 3300003784 Bacteria 1611
47 Ga0055528_1001367 3300003790 Bacteria 14998
48 Ga0055528_1006579 3300003790 Bacteria 5258
49 Ga0055530_10001578 3300003791 Bacteria 16321
50 Ga0055530_10018244 3300003791 Bacteria 2171
51 Ga0055540_1001235 3300003792 Bacteria 15714
52 Ga0055540_1006428 3300003792 Bacteria 4670
53 Ga0055540_1009999 3300003792 Bacteria 3199
54 Ga0055540_1018294 3300003792 Bacteria 1923
55 Ga0055531_10003091 3300003794 Bacteria 10752
56 Ga0055531_10006139 3300003794 Bacteria 6877
57 Ga0055543_1000207 3300004625 Bacteria 47618
58 Ga0065165_1000132 3300005262 Bacteria 128732
59 Ga0065165_1000409 3300005262 Bacteria 68773
60 Ga0065714_10066083 3300005288 Bacteria 7644
61 Ga0065712_10070978 3300005290 Bacteria 5563
62 Ga0065712_10077719 3300005290 Bacteria 3442
63 Ga0065712_10078399 3300005290 Bacteria 3350
64 Ga0065712_10096189 3300005290 Bacteria 2192
65 Ga0065712_10096243 3300005290 Bacteria 2190
66 Ga0065715_10089022 3300005293 Bacteria 16633
67 Ga0065715_10103856 3300005293 Bacteria 3003
68 Ga0065715_10155662 3300005293 Bacteria 1675
69 Ga0065707_10010755 3300005295 Bacteria 3314
70 Ga0070658_10008174 3300005327 Bacteria 8410
71 Ga0070676_10002898 3300005328 Bacteria 8857
72 Ga0070676_10009564 3300005328 Bacteria 5236
73 Ga0070676_10191182 3300005328 Bacteria 1337
74 Ga0070683_100001166 3300005329 Bacteria 19905
75 Ga0070683_100253033 3300005329 Bacteria 1675
76 Ga0070683_100342098 3300005329 Bacteria 1424
77 Ga0070683_100365580 3300005329 Bacteria 1374
78 Ga0070690_100009650 3300005330 Bacteria 5597
79 Ga0070690_100033483 3300005330 Bacteria 3217
80 Ga0070690_100190929 3300005330 Bacteria 1420
81 Ga0070670_100010109 3300005331 Bacteria 8049
82 Ga0070670_100147377 3300005331 Bacteria 2037
83 Ga0070677_10000126 3300005333 Bacteria 25482
84 Ga0068869_100019670 3300005334 Bacteria 4619
85 Ga0068869_100078992 3300005334 Bacteria 2451
86 Ga0068869_100200685 3300005334 Bacteria 1573
87 Ga0070666_10052952 3300005335 Bacteria 2736
88 Ga0070666_10122253 3300005335 Bacteria 1806
89 Ga0070666_10318119 3300005335 Bacteria 1110
90 Ga0070680_100005116 3300005336 Bacteria 9901
91 Ga0070680_100014771 3300005336 Bacteria 6108
92 Ga0070680_100089145 3300005336 Bacteria 2552
93 Ga0070680_100098840 3300005336 Bacteria 2421
94 Ga0070680_100306506 3300005336 Bacteria 1347
95 Ga0070682_100001533 3300005337 Bacteria 12954
96 Ga0070682_100003724 3300005337 Bacteria 8473
97 Ga0070682_100024957 3300005337 Bacteria 3564
98 Ga0070682_100060172 3300005337 Bacteria 2402
99 Ga0068868_100003027 3300005338 Bacteria 11693
100 Ga0068868_100003608 3300005338 Bacteria 10786
101 Ga0068868_100015802 3300005338 Bacteria 5592
102 Ga0068868_100066200 3300005338 Bacteria 2872
103 Ga0068868_100134926 3300005338 Bacteria 2022
104 Ga0068868_100215626 3300005338 Bacteria 1606
105 Ga0070660_100000724 3300005339 Bacteria 21893
106 Ga0070660_100001299 3300005339 Bacteria 17019
107 Ga0070660_100007902 3300005339 Bacteria 7422
108 Ga0070660_100010060 3300005339 Bacteria 6672
109 Ga0070660_100015241 3300005339 Bacteria 5545
110 Ga0070660_100029404 3300005339 Bacteria 4118
111 Ga0070689_100003384 3300005340 Bacteria 10600
112 Ga0070689_100007839 3300005340 Bacteria 7485
113 Ga0070689_100048821 3300005340 Bacteria 3265
114 Ga0070689_100165687 3300005340 Bacteria 1788
115 Ga0070691_10000994 3300005341 Bacteria 11602
116 Ga0070691_10004892 3300005341 Bacteria 6095
117 Ga0070687_100000085 3300005343 Bacteria 30647
118 Ga0070661_100002142 3300005344 Bacteria 13609
119 Ga0070661_100014785 3300005344 Bacteria 5503
120 Ga0070661_100026535 3300005344 Bacteria 4167
121 Ga0070661_100035802 3300005344 Bacteria 3607
122 Ga0070661_100219006 3300005344 Bacteria 1459
123 Ga0070692_10000667 3300005345 Bacteria 10947
124 Ga0070692_10002518 3300005345 Bacteria 7129
125 Ga0070692_10173526 3300005345 Bacteria 1244
126 Ga0070668_100001248 3300005347 Bacteria 18134
127 Ga0070668_100145165 3300005347 Bacteria 1915
128 Ga0070668_100159247 3300005347 Bacteria 1831
129 Ga0070669_100005868 3300005353 Bacteria 8857
130 Ga0070669_100375172 3300005353 Bacteria 1159
131 Ga0070675_100043655 3300005354 Bacteria 3664
132 Ga0070675_100173938 3300005354 Bacteria 1858
133 Ga0070675_100280270 3300005354 Bacteria 1464
134 Ga0070675_100372452 3300005354 Bacteria 1270
135 Ga0070671_100009899 3300005355 Bacteria 7656
136 Ga0070671_100010916 3300005355 Bacteria 7295
137 Ga0070671_100021222 3300005355 Bacteria 5304
138 Ga0070671_100023164 3300005355 Bacteria 5078
139 Ga0070671_100046579 3300005355 Bacteria 3606
140 Ga0070671_100086682 3300005355 Bacteria 2620
141 Ga0070671_100148145 3300005355 Bacteria 1982
142 Ga0070674_100003469 3300005356 Bacteria 8857
143 Ga0070674_100011243 3300005356 Bacteria 5442
144 Ga0070674_100091663 3300005356 Bacteria 2195
145 Ga0070674_100315442 3300005356 Bacteria 1251
146 Ga0070673_100000152 3300005364 Bacteria 33183
147 Ga0070673_100001292 3300005364 Bacteria 14589
148 Ga0070673_100007749 3300005364 Bacteria 7107
149 Ga0070673_100022913 3300005364 Bacteria 4556
150 Ga0070688_100000558 3300005365 Bacteria 18862
151 Ga0070688_100012465 3300005365 Bacteria 4765
152 Ga0070688_100023196 3300005365 Bacteria 3647
153 Ga0070688_100112186 3300005365 Bacteria 1815
154 Ga0070659_100000151 3300005366 Bacteria 53009
155 Ga0070659_100002581 3300005366 Bacteria 12874
156 Ga0070659_100011661 3300005366 Bacteria 6504
157 Ga0070659_100044233 3300005366 Bacteria 3485
158 Ga0070659_100102998 3300005366 Bacteria 2298
159 Ga0070659_100160817 3300005366 Bacteria 1836
160 Ga0070667_100005640 3300005367 Bacteria 10453
161 Ga0070667_100042441 3300005367 Bacteria 3816
162 Ga0070667_100167734 3300005367 Bacteria 1937
163 Ga0070703_10003226 3300005406 Bacteria 4654
164 Ga0070703_10008573 3300005406 Bacteria 2875
165 Ga0070703_10017152 3300005406 Bacteria 2085
166 Ga0070709_10001678 3300005434 Bacteria 12027
167 Ga0070709_10028390 3300005434 Bacteria 3336
168 Ga0070709_10030542 3300005434 Bacteria 3234
169 Ga0070709_10127041 3300005434 Bacteria 1736
170 Ga0070714_100058681 3300005435 Bacteria 3298
171 Ga0070714_100068956 3300005435 Bacteria 3053
172 Ga0070714_100231952 3300005435 Bacteria 1701
173 Ga0070714_100695228 3300005435 Bacteria 981
174 Ga0070713_100004299 3300005436 Bacteria 9545
175 Ga0070713_100013856 3300005436 Bacteria 5966
176 Ga0070713_100018974 3300005436 Bacteria 5237
177 Ga0070713_100060940 3300005436 Bacteria 3155
178 Ga0070710_10010866 3300005437 Bacteria 4483
179 Ga0070710_10013537 3300005437 Bacteria 4090
180 Ga0070710_10031626 3300005437 Bacteria 2859
181 Ga0070711_100006663 3300005439 Bacteria 6982
182 Ga0070711_100033311 3300005439 Bacteria 3430
183 Ga0070711_100062704 3300005439 Bacteria 2592
184 Ga0070711_100088211 3300005439 Bacteria 2228
185 Ga0070711_100120247 3300005439 Bacteria 1941
186 Ga0070711_100127762 3300005439 Bacteria 1889
187 Ga0070711_100131967 3300005439 Bacteria 1861
188 Ga0070705_100000874 3300005440 Bacteria 16855
189 Ga0070705_100031418 3300005440 Bacteria 2940
190 Ga0070705_100083692 3300005440 Bacteria 1967
191 Ga0070705_100106424 3300005440 Bacteria 1783
192 Ga0070705_100222061 3300005440 Bacteria 1309
193 Ga0070700_100002863 3300005441 Bacteria 8853
194 Ga0070700_100032741 3300005441 Bacteria 3126
195 Ga0070700_100293672 3300005441 Bacteria 1183
196 Ga0070694_100000390 3300005444 Bacteria 23753
197 Ga0070694_100000998 3300005444 Bacteria 16064
198 Ga0070694_100001507 3300005444 Bacteria 13661
199 Ga0070694_100032223 3300005444 Bacteria 3441
200 Ga0070694_100201333 3300005444 Bacteria 1484
201 Ga0070694_100279091 3300005444 Bacteria 1273
202 Ga0070708_100000402 3300005445 Bacteria 32565
203 Ga0070708_100052979 3300005445 Bacteria 3599
204 Ga0070708_100104286 3300005445 Bacteria 2600
205 Ga0070708_100117348 3300005445 Bacteria 2451
206 Ga0070708_100744908 3300005445 Bacteria 921
207 Ga0070663_100018923 3300005455 Bacteria 4527
208 Ga0070663_100025011 3300005455 Bacteria 4027
209 Ga0070678_100010262 3300005456 Bacteria 5713
210 Ga0070678_100601541 3300005456 Bacteria 982
211 Ga0070662_100001666 3300005457 Bacteria 13661
212 Ga0070662_100002564 3300005457 Bacteria 11189
213 Ga0070662_100010579 3300005457 Bacteria 6063
214 Ga0070662_100037200 3300005457 Bacteria 3450
215 Ga0070662_100053117 3300005457 Bacteria 2932
216 Ga0070662_100194336 3300005457 Bacteria 1607
217 Ga0070681_10006870 3300005458 Bacteria 11073
218 Ga0070681_10007824 3300005458 Bacteria 10454
219 Ga0070681_10009162 3300005458 Bacteria 9725
220 Ga0070681_10012069 3300005458 Bacteria 8567
221 Ga0070681_10017661 3300005458 Bacteria 7129
222 Ga0070681_10023442 3300005458 Bacteria 6206
223 Ga0070681_10026806 3300005458 Bacteria 5793
224 Ga0070681_10038004 3300005458 Bacteria 4827
225 Ga0070681_10085486 3300005458 Bacteria 3106
226 Ga0070681_10105363 3300005458 Bacteria 2762
227 Ga0068867_100004614 3300005459 Bacteria 9695
228 Ga0068867_100005662 3300005459 Bacteria 8853
229 Ga0068867_100128668 3300005459 Bacteria 1965
230 Ga0070685_10006948 3300005466 Bacteria 5775
231 Ga0070685_10056750 3300005466 Bacteria 2277
232 Ga0070685_10060826 3300005466 Bacteria 2210
233 Ga0070706_100000099 3300005467 Bacteria 105782
234 Ga0070706_100000367 3300005467 Bacteria 54314
235 Ga0070706_100008099 3300005467 Bacteria 9801
236 Ga0070706_100012270 3300005467 Bacteria 7940
237 Ga0070706_100026434 3300005467 Bacteria 5340
238 Ga0070706_100037537 3300005467 Bacteria 4475
239 Ga0070706_100133062 3300005467 Bacteria 2321
240 Ga0070706_100157311 3300005467 Bacteria 2121
241 Ga0070707_100001543 3300005468 Bacteria 22396
242 Ga0070707_100002214 3300005468 Bacteria 18546
243 Ga0070707_100004554 3300005468 Bacteria 12984
244 Ga0070707_100005782 3300005468 Bacteria 11537
245 Ga0070707_100005986 3300005468 Bacteria 11345
246 Ga0070707_100042488 3300005468 Bacteria 4352
247 Ga0070707_100048743 3300005468 Bacteria 4058
248 Ga0070707_100196986 3300005468 Bacteria 1964
249 Ga0070698_100004215 3300005471 Bacteria 15801
250 Ga0070698_100011760 3300005471 Bacteria 9285
251 Ga0070698_100025889 3300005471 Bacteria 6112
252 Ga0070698_100106065 3300005471 Bacteria 2779
253 Ga0070698_100109546 3300005471 Bacteria 2728
254 Ga0070698_100129567 3300005471 Bacteria 2479
255 Ga0070698_100445469 3300005471 Bacteria 1230
256 Ga0070699_100000945 3300005518 Bacteria 27089
257 Ga0070699_100025311 3300005518 Bacteria 5118
258 Ga0070699_100030144 3300005518 Bacteria 4681
259 Ga0070699_100074275 3300005518 Bacteria 2958
260 Ga0070699_100198039 3300005518 Bacteria 1786
261 Ga0070699_100538096 3300005518 Bacteria 1063
262 Ga0070679_100007489 3300005530 Bacteria 10209
263 Ga0070679_100028360 3300005530 Bacteria 5519
264 Ga0070679_100029489 3300005530 Bacteria 5414
265 Ga0070679_100033784 3300005530 Bacteria 5065
266 Ga0070679_100042170 3300005530 Bacteria 4544
267 Ga0070679_100044073 3300005530 Bacteria 4444
268 Ga0070679_100060853 3300005530 Bacteria 3764
269 Ga0070679_100071614 3300005530 Bacteria 3457
270 Ga0070679_100081922 3300005530 Bacteria 3217
271 Ga0070679_100115247 3300005530 Bacteria 2673
272 Ga0070684_100000894 3300005535 Bacteria 21105
273 Ga0070684_100054573 3300005535 Bacteria 3481
274 Ga0070684_100071707 3300005535 Bacteria 3048
275 Ga0070684_100147943 3300005535 Bacteria 2127
276 Ga0070697_100000582 3300005536 Bacteria 27575
277 Ga0070697_100018950 3300005536 Bacteria 5429
278 Ga0070697_100044697 3300005536 Bacteria 3588
279 Ga0070697_100054382 3300005536 Bacteria 3254
280 Ga0070697_100170879 3300005536 Bacteria 1840
281 Ga0070697_100240935 3300005536 Bacteria 1544
282 Ga0068853_100000770 3300005539 Bacteria 22242
283 Ga0068853_100010158 3300005539 Bacteria 7605
284 Ga0068853_100081728 3300005539 Bacteria 2829
285 Ga0070672_100008661 3300005543 Bacteria 6974
286 Ga0070672_100079516 3300005543 Bacteria 2625
287 Ga0070672_100145320 3300005543 Bacteria 1959
288 Ga0070686_100035163 3300005544 Bacteria 3093
289 Ga0070695_100000741 3300005545 Bacteria 17438
290 Ga0070695_100026614 3300005545 Bacteria 3580
291 Ga0070695_100479347 3300005545 Bacteria 958
292 Ga0070696_100003955 3300005546 Bacteria 9892
293 Ga0070696_100005009 3300005546 Bacteria 8853
294 Ga0070696_100006635 3300005546 Bacteria 7732
295 Ga0070693_100000418 3300005547 Bacteria 19261
296 Ga0070693_100001405 3300005547 Bacteria 10851
297 Ga0070693_100411193 3300005547 Bacteria 940
298 Ga0070665_100030194 3300005548 Bacteria 5455
299 Ga0070665_100059697 3300005548 Bacteria 3823
300 Ga0070665_100066956 3300005548 Bacteria 3602
301 Ga0070665_100076797 3300005548 Bacteria 3347
302 Ga0070665_100129403 3300005548 Bacteria 2526
303 Ga0070704_100000428 3300005549 Bacteria 19609
304 Ga0070704_100000772 3300005549 Bacteria 15796
305 Ga0070704_100006965 3300005549 Bacteria 6706
306 Ga0070704_100088006 3300005549 Bacteria 2307
307 Ga0070704_100137037 3300005549 Bacteria 1905
308 Ga0070704_100353715 3300005549 Bacteria 1241
309 Ga0068855_100001154 3300005563 Bacteria 32715
310 Ga0068855_100007545 3300005563 Bacteria 13158
311 Ga0068855_100012186 3300005563 Bacteria 10389
312 Ga0068855_100053556 3300005563 Bacteria 4747
313 Ga0068855_100116783 3300005563 Bacteria 3058
314 Ga0070664_100002406 3300005564 Bacteria 15035
315 Ga0070664_100003967 3300005564 Bacteria 11906
316 Ga0070664_100008025 3300005564 Bacteria 8528
317 Ga0070664_100085392 3300005564 Bacteria 2726
318 Ga0070664_100363973 3300005564 Bacteria 1317
319 Ga0070664_100392677 3300005564 Bacteria 1268
320 Ga0068857_100016930 3300005577 Bacteria 6386
321 Ga0068857_100022565 3300005577 Bacteria 5535
322 Ga0068854_100014300 3300005578 Bacteria 5230
323 Ga0068854_100023974 3300005578 Bacteria 4172
324 Ga0068854_100104826 3300005578 Bacteria 2125
325 Ga0068854_100180757 3300005578 Bacteria 1647
326 Ga0068856_100001185 3300005614 Bacteria 27475
327 Ga0068856_100003112 3300005614 Bacteria 16941
328 Ga0068856_100009875 3300005614 Bacteria 9268
329 Ga0068856_100021406 3300005614 Bacteria 6286
330 Ga0068856_100034152 3300005614 Bacteria 4982
331 Ga0068856_100044461 3300005614 Bacteria 4372
332 Ga0068856_100086371 3300005614 Bacteria 3117
333 Ga0068856_100212109 3300005614 Bacteria 1952
334 Ga0068856_100387666 3300005614 Bacteria 1417
335 Ga0068856_100424473 3300005614 Bacteria 1350
336 Ga0070702_100011295 3300005615 Bacteria 4437
337 Ga0070702_100064532 3300005615 Bacteria 2142
338 Ga0070702_100075856 3300005615 Bacteria 1999
339 Ga0068852_100002115 3300005616 Bacteria 13595
340 Ga0068852_100004876 3300005616 Bacteria 9529
341 Ga0068852_100021891 3300005616 Bacteria 5115
342 Ga0068852_100225271 3300005616 Bacteria 1785
343 Ga0068852_100547946 3300005616 Bacteria 1157
344 Ga0068859_100006242 3300005617 Bacteria 12100
345 Ga0068859_100011156 3300005617 Bacteria 9035
346 Ga0068859_100019359 3300005617 Bacteria 6839
347 Ga0068859_100084462 3300005617 Bacteria 3220
348 Ga0068859_100173819 3300005617 Bacteria 2236
349 Ga0068864_100001224 3300005618 Bacteria 21327
350 Ga0068864_100098615 3300005618 Bacteria 2588
351 Ga0068864_100176349 3300005618 Bacteria 1952
352 Ga0068866_10000301 3300005718 Bacteria 23583
353 Ga0068866_10000527 3300005718 Bacteria 17621
354 Ga0068866_10006508 3300005718 Bacteria 4868
355 Ga0068861_100049597 3300005719 Bacteria 3179
356 Ga0068861_100057538 3300005719 Bacteria 2970
357 Ga0068861_100344061 3300005719 Bacteria 1306
358 Ga0068851_10001590 3300005834 Bacteria 9966
359 Ga0068851_10011381 3300005834 Bacteria 4170
360 Ga0068851_10084263 3300005834 Bacteria 1664
361 Ga0068870_10000280 3300005840 Bacteria 18887
362 Ga0068870_10000354 3300005840 Bacteria 17200
363 Ga0068863_100000340 3300005841 Bacteria 47641
364 Ga0068863_100019545 3300005841 Bacteria 6478
365 Ga0068863_100220895 3300005841 Bacteria 1826
366 Ga0068863_100538014 3300005841 Bacteria 1153
367 Ga0068858_100004859 3300005842 Bacteria 13181
368 Ga0068858_100009915 3300005842 Bacteria 9049
369 Ga0068858_100020715 3300005842 Bacteria 6143
370 Ga0068858_100089416 3300005842 Bacteria 2866
371 Ga0068858_100631469 3300005842 Bacteria 1040
372 Ga0068860_100013035 3300005843 Bacteria 8161
373 Ga0068860_100031227 3300005843 Bacteria 5121
374 Ga0068860_100242756 3300005843 Bacteria 1752
375 Ga0068862_100015630 3300005844 Bacteria 6304
376 Ga0081455_10000007 3300005937 Bacteria 269394
377 Ga0081455_10114013 3300005937 Bacteria 2142
378 Ga0081538_10013234 3300005981 Bacteria 6546
379 Ga0081538_10047803 3300005981 Bacteria 2619
380 Ga0081538_10066749 3300005981 Bacteria 2014
381 Ga0081540_1000283 3300005983 Bacteria 52870
382 Ga0081540_1024058 3300005983 Bacteria 3543
383 Ga0081540_1031565 3300005983 Bacteria 2910
384 Ga0081539_10000009 3300005985 Bacteria 509286
385 Ga0070717_10001010 3300006028 Bacteria 18846
386 Ga0070717_10065674 3300006028 Bacteria 3016
387 Ga0070717_10098072 3300006028 Bacteria 2484
388 Ga0070717_10132896 3300006028 Bacteria 2141
389 Ga0070717_10154069 3300006028 Bacteria 1990
390 Ga0075365_10000088 3300006038 Bacteria 26738
391 Ga0075365_10008838 3300006038 Bacteria 5747
392 Ga0075365_10029017 3300006038 Bacteria 3531
393 Ga0075365_10035993 3300006038 Bacteria 3206
394 Ga0075368_10000101 3300006042 Bacteria 21910
395 Ga0075363_100000128 3300006048 Bacteria 18164
396 Ga0075363_100016970 3300006048 Bacteria 3604
397 Ga0075363_100058287 3300006048 Bacteria 2074
398 Ga0075364_10000004 3300006051 Bacteria 110554
399 Ga0075364_10002167 3300006051 Bacteria 11001
400 Ga0075364_10008524 3300006051 Bacteria 6133
401 Ga0075364_10021617 3300006051 Bacteria 4055
402 Ga0075432_10036358 3300006058 Bacteria 1712
403 Ga0070716_100017441 3300006173 Bacteria 3722
404 Ga0070716_100024257 3300006173 Bacteria 3227
405 Ga0070712_100005678 3300006175 Bacteria 7715
406 Ga0070712_100073676 3300006175 Bacteria 2450
407 Ga0070712_100299661 3300006175 Bacteria 1301
408 Ga0075362_10000009 3300006177 Bacteria 111748
409 Ga0075362_10015262 3300006177 Bacteria 3120
410 Ga0075362_10034931 3300006177 Bacteria 2193
411 Ga0075367_10000018 3300006178 Bacteria 34198
412 Ga0075367_10012900 3300006178 Bacteria 4476
413 Ga0075367_10031905 3300006178 Bacteria 3027
414 Ga0075369_10000011 3300006186 Bacteria 76681
415 Ga0075369_10008188 3300006186 Bacteria 4013
416 Ga0075366_10000085 3300006195 Bacteria 36576
417 Ga0075366_10066754 3300006195 Bacteria 2140
418 Ga0075366_10125502 3300006195 Bacteria 1548
419 Ga0097621_100023624 3300006237 Bacteria 4788
420 Ga0097621_100061761 3300006237 Bacteria 3074
421 Ga0097621_100104722 3300006237 Bacteria 2384
422 Ga0097621_100287147 3300006237 Bacteria 1449
423 Ga0075370_10000120 3300006353 Bacteria 25762
424 Ga0075370_10005461 3300006353 Bacteria 6323
425 Ga0075370_10048586 3300006353 Bacteria 2404
426 Ga0075370_10091980 3300006353 Bacteria 1750
427 Ga0075370_10127830 3300006353 Bacteria 1482
428 Ga0068871_100000301 3300006358 Bacteria 34368
429 Ga0068871_100009125 3300006358 Bacteria 7167
430 Ga0068871_100060760 3300006358 Bacteria 3083
431 Ga0068871_100065274 3300006358 Bacteria 2981
432 Ga0068871_100108380 3300006358 Bacteria 2334
433 Ga0068871_100160284 3300006358 Bacteria 1924
434 Ga0075428_100000643 3300006844 Bacteria 35894
435 Ga0075428_100010432 3300006844 Bacteria 10318
436 Ga0075428_100015421 3300006844 Bacteria 8470
437 Ga0075428_100297474 3300006844 Bacteria 1736
438 Ga0075430_100000052 3300006846 Bacteria 60703
439 Ga0075430_100010397 3300006846 Bacteria 7881
440 Ga0075430_100128790 3300006846 Bacteria 2110
441 Ga0075430_100152287 3300006846 Bacteria 1926
442 Ga0075430_100194390 3300006846 Bacteria 1686
443 Ga0075430_100231916 3300006846 Bacteria 1530
444 Ga0075430_100262916 3300006846 Bacteria 1429
445 Ga0075431_100000441 3300006847 Bacteria 33990
446 Ga0075431_100000689 3300006847 Bacteria 29038
447 Ga0075431_100000802 3300006847 Bacteria 27440
448 Ga0075431_100012575 3300006847 Bacteria 8542
449 Ga0075431_100025533 3300006847 Bacteria 6057
450 Ga0075431_100031754 3300006847 Bacteria 5440
451 Ga0075431_100053455 3300006847 Bacteria 4164
452 Ga0075431_100214516 3300006847 Bacteria 1965
453 Ga0075431_100408396 3300006847 Bacteria 1358
454 Ga0075433_10000276 3300006852 Bacteria 30320
455 Ga0075433_10004677 3300006852 Bacteria 10670
456 Ga0075433_10005682 3300006852 Bacteria 9802
457 Ga0075433_10009124 3300006852 Bacteria 7919
458 Ga0075433_10014960 3300006852 Bacteria 6352
459 Ga0075433_10084163 3300006852 Bacteria 2807
460 Ga0075433_10106133 3300006852 Bacteria 2489
461 Ga0075433_10162345 3300006852 Bacteria 1989
462 Ga0075434_100000597 3300006871 Bacteria 27906
463 Ga0075434_100001420 3300006871 Bacteria 20108
464 Ga0075434_100008472 3300006871 Bacteria 9565
465 Ga0075434_100017859 3300006871 Bacteria 6843
466 Ga0075434_100033864 3300006871 Bacteria 5043
467 Ga0075434_100044791 3300006871 Bacteria 4388
468 Ga0075434_100075504 3300006871 Bacteria 3364
469 Ga0075434_100142880 3300006871 Bacteria 2413
470 Ga0075434_100146816 3300006871 Bacteria 2379
471 Ga0075429_100000001 3300006880 Bacteria 139031
472 Ga0075429_100058076 3300006880 Bacteria 3369
473 Ga0068865_100037927 3300006881 Bacteria 3258
474 Ga0075436_100004744 3300006914 Bacteria 9328
475 Ga0075436_100007341 3300006914 Bacteria 7532
476 Ga0075436_100024561 3300006914 Bacteria 4142
477 Ga0075436_100039347 3300006914 Bacteria 3264
478 Ga0075436_100069505 3300006914 Bacteria 2433
479 Ga0097620_100006242 3300006931 Bacteria 12100
480 Ga0097620_100011157 3300006931 Bacteria 9035
481 Ga0097620_100084465 3300006931 Bacteria 3220
482 Ga0097620_100173817 3300006931 Bacteria 2236
483 Ga0099826_10000113 3300006948 Bacteria 36930
484 Ga0099826_10001604 3300006948 Bacteria 13793
485 Ga0099826_10141128 3300006948 Bacteria 1391
486 Ga0075435_100000328 3300007076 Bacteria 29254
487 Ga0075435_100012560 3300007076 Bacteria 6274
488 Ga0075435_100112587 3300007076 Bacteria 2264
489 Ga0075435_100203262 3300007076 Bacteria 1679
490 Ga0075435_100248681 3300007076 Bacteria 1513
491 Ga0099794_10018817 3300007265 Bacteria 3102
492 Ga0099794_10086255 3300007265 Bacteria 1554
493 Ga0105244_10001556 3300009036 Bacteria 18234
494 Ga0105244_10094140 3300009036 Bacteria 1471
495 Ga0105240_10070766 3300009093 Bacteria 4314
496 Ga0105240_10221940 3300009093 Bacteria 2201
497 Ga0105240_10237545 3300009093 Bacteria 2114
498 Ga0105240_10583978 3300009093 Bacteria 1232
499 Ga0105240_10796390 3300009093 Bacteria 1024
500 Ga0111539_10013178 3300009094 Bacteria 10337
501 Ga0111539_10013469 3300009094 Bacteria 10221
502 Ga0111539_10074229 3300009094 Bacteria 4008
503 Ga0111539_10103845 3300009094 Bacteria 3335
504 Ga0111539_10198119 3300009094 Bacteria 2343
505 Ga0111539_10322485 3300009094 Bacteria 1798
506 Ga0111539_10323377 3300009094 Bacteria 1795
507 Ga0111539_10345404 3300009094 Bacteria 1732
508 Ga0111539_10348986 3300009094 Bacteria 1722
509 Ga0105245_10009808 3300009098 Bacteria 8344
510 Ga0105245_10009817 3300009098 Bacteria 8341
511 Ga0105245_10010701 3300009098 Bacteria 7981
512 Ga0105245_10018932 3300009098 Bacteria 6026
513 Ga0105245_10028859 3300009098 Bacteria 4897
514 Ga0105245_10056957 3300009098 Bacteria 3514
515 Ga0105245_10123740 3300009098 Bacteria 2418
516 Ga0105245_10498456 3300009098 Bacteria 1234
517 Ga0105247_10018307 3300009101 Bacteria 4203
518 Ga0105247_10020638 3300009101 Bacteria 3961
519 Ga0105247_10035792 3300009101 Bacteria 3027
520 Ga0114129_10002725 3300009147 Bacteria 24625
521 Ga0114129_10002794 3300009147 Bacteria 24351
522 Ga0114129_10007546 3300009147 Bacteria 15485
523 Ga0114129_10013314 3300009147 Bacteria 11724
524 Ga0114129_10028184 3300009147 Bacteria 7957
525 Ga0114129_10040610 3300009147 Bacteria 6558
526 Ga0114129_10050894 3300009147 Bacteria 5817
527 Ga0114129_10064301 3300009147 Bacteria 5119
528 Ga0114129_10253007 3300009147 Bacteria 2364
529 Ga0114129_10736463 3300009147 Bacteria 1263
530 Ga0105243_10000362 3300009148 Bacteria 48567
531 Ga0105243_10004388 3300009148 Bacteria 11162
532 Ga0105243_10005539 3300009148 Bacteria 9837
533 Ga0105243_10038463 3300009148 Bacteria 3725
534 Ga0105243_10044624 3300009148 Bacteria 3479
535 Ga0105241_10001943 3300009174 Bacteria 15638
536 Ga0105241_10008605 3300009174 Bacteria 7500
537 Ga0105241_10034109 3300009174 Bacteria 3823
538 Ga0105241_10095574 3300009174 Bacteria 2352
539 Ga0105241_10115813 3300009174 Bacteria 2152
540 Ga0105241_10678090 3300009174 Bacteria 939
541 Ga0105242_10004469 3300009176 Bacteria 10872
542 Ga0105242_10007706 3300009176 Bacteria 8285
543 Ga0105242_10013489 3300009176 Bacteria 6318
544 Ga0105242_10029471 3300009176 Bacteria 4378
545 Ga0105242_10352227 3300009176 Bacteria 1360
546 Ga0105242_10369484 3300009176 Bacteria 1330
547 Ga0105248_10003102 3300009177 Bacteria 18407
548 Ga0105248_10043504 3300009177 Bacteria 5035
549 Ga0105248_10153536 3300009177 Bacteria 2598
550 Ga0105248_10184723 3300009177 Bacteria 2349
551 Ga0105248_10229395 3300009177 Bacteria 2090
552 Ga0105248_10526994 3300009177 Bacteria 1332
553 Ga0105237_10082797 3300009545 Bacteria 3200
554 Ga0105237_10130541 3300009545 Bacteria 2507
555 Ga0105237_10160339 3300009545 Bacteria 2247
556 Ga0105237_10316350 3300009545 Bacteria 1564
557 Ga0105238_10156600 3300009551 Bacteria 2253
558 Ga0105238_10243423 3300009551 Bacteria 1776
559 Ga0105238_10259306 3300009551 Bacteria 1718
560 Ga0105249_10001599 3300009553 Bacteria 19830
561 Ga0105249_10070757 3300009553 Bacteria 3221
562 Ga0105249_10158497 3300009553 Bacteria 2185
563 Ga0105249_10231362 3300009553 Bacteria 1823
564 Ga0099796_10010105 3300010159 Bacteria 2582
565 Ga0105239_10009752 3300010375 Bacteria 10796
566 Ga0105239_10081152 3300010375 Bacteria 3570
567 Ga0105246_10007217 3300011119 Bacteria 6810
568 Ga0105246_10106583 3300011119 Bacteria 2051
569 Ga0105246_10200123 3300011119 Bacteria 1552
570 Ga0157373_10000499 3300013100 Bacteria 30965
571 Ga0157373_10001456 3300013100 Bacteria 18090
572 Ga0157373_10012576 3300013100 Bacteria 6222
573 Ga0157373_10014696 3300013100 Bacteria 5735
574 Ga0157373_10040644 3300013100 Bacteria 3327
575 Ga0157373_10201140 3300013100 Bacteria 1404
576 Ga0157373_10295188 3300013100 Bacteria 1150
577 Ga0157371_10001965 3300013102 Bacteria 20388
578 Ga0157371_10010606 3300013102 Bacteria 7160
579 Ga0157371_10037389 3300013102 Bacteria 3474
580 Ga0157370_10003331 3300013104 Bacteria 18930
581 Ga0157370_10048561 3300013104 Bacteria 4065
582 Ga0157370_10057468 3300013104 Bacteria 3699
583 Ga0157370_10138315 3300013104 Bacteria 2269
584 Ga0157370_10147628 3300013104 Bacteria 2189
585 Ga0157370_10202152 3300013104 Bacteria 1843
586 Ga0157370_10206478 3300013104 Bacteria 1821
587 Ga0157370_10216238 3300013104 Bacteria 1776
588 Ga0157369_10003195 3300013105 Bacteria 19536
589 Ga0157369_10004134 3300013105 Bacteria 17188
590 Ga0157369_10029042 3300013105 Bacteria 6114
591 Ga0157369_10045063 3300013105 Bacteria 4799
592 Ga0157369_10066145 3300013105 Bacteria 3889
593 Ga0157374_10001695 3300013296 Bacteria 18451
594 Ga0157374_10002626 3300013296 Bacteria 15152
595 Ga0157374_10057385 3300013296 Bacteria 3636
596 Ga0157374_10567538 3300013296 Bacteria 1143
597 Ga0157378_10003374 3300013297 Bacteria 14202
598 Ga0157378_10009719 3300013297 Bacteria 8379
599 Ga0157378_10043988 3300013297 Bacteria 3964
600 Ga0157378_10128094 3300013297 Bacteria 2347
601 Ga0157378_10145741 3300013297 Bacteria 2202
602 Ga0163162_10010828 3300013306 Bacteria 8874
603 Ga0163162_10038833 3300013306 Bacteria 4752
604 Ga0163162_10124956 3300013306 Bacteria 2678
605 Ga0163162_10136322 3300013306 Bacteria 2565
606 Ga0163162_10140377 3300013306 Bacteria 2529
607 Ga0163162_10607117 3300013306 Bacteria 1220
608 Ga0157372_10001631 3300013307 Bacteria 24355
609 Ga0157372_10002144 3300013307 Bacteria 21446
610 Ga0157372_10004321 3300013307 Bacteria 15190
611 Ga0157372_10005498 3300013307 Bacteria 13464
612 Ga0157372_10017070 3300013307 Bacteria 7793
613 Ga0157372_10033994 3300013307 Bacteria 5601
614 Ga0157372_10149132 3300013307 Bacteria 2698
615 Ga0157372_10210800 3300013307 Bacteria 2252
616 Ga0157372_10212656 3300013307 Bacteria 2241
617 Ga0157372_10323860 3300013307 Bacteria 1794
618 Ga0157372_10358481 3300013307 Bacteria 1699
619 Ga0157372_10402307 3300013307 Bacteria 1595
620 Ga0157372_11015212 3300013307 Bacteria 961
621 Ga0157375_10008254 3300013308 Bacteria 9115
622 Ga0157375_10023648 3300013308 Bacteria 5673
623 Ga0157375_10092120 3300013308 Bacteria 3094
624 Ga0157375_10164395 3300013308 Bacteria 2363
625 Ga0163163_10003775 3300014325 Bacteria 12906
626 Ga0163163_10104554 3300014325 Bacteria 2857
627 Ga0163163_10112333 3300014325 Bacteria 2754
628 Ga0163163_10237660 3300014325 Bacteria 1871
629 Ga0157380_10000891 3300014326 Bacteria 18753
630 Ga0157380_10142966 3300014326 Bacteria 2058
631 Ga0182008_10000923 3300014497 Bacteria 20481
632 Ga0182008_10001629 3300014497 Bacteria 14878
633 Ga0182008_10003912 3300014497 Bacteria 8823
634 Ga0182008_10004163 3300014497 Bacteria 8506
635 Ga0182008_10010606 3300014497 Bacteria 4928
636 Ga0182008_10086624 3300014497 Bacteria 1543
637 Ga0157377_10000517 3300014745 Bacteria 16366
638 Ga0157377_10029892 3300014745 Bacteria 2947
639 Ga0157379_10002694 3300014968 Bacteria 14977
640 Ga0157379_10011995 3300014968 Bacteria 7571
641 Ga0157379_10014180 3300014968 Bacteria 6989
642 Ga0157379_10156053 3300014968 Bacteria 2059
643 Ga0157376_10000088 3300014969 Bacteria 70084
644 Ga0157376_10005595 3300014969 Bacteria 8792
645 Ga0157376_10053185 3300014969 Bacteria 3370
646 Ga0182006_1000007 3300015261 Bacteria 452190
647 Ga0182006_1014285 3300015261 Bacteria 3426
648 Ga0182006_1044633 3300015261 Bacteria 1728
649 Ga0182007_10000022 3300015262 Bacteria 189018
650 Ga0182007_10001812 3300015262 Bacteria 11153
651 Ga0182007_10002663 3300015262 Bacteria 8769
652 Ga0182007_10003476 3300015262 Bacteria 7415
653 Ga0182005_1000010 3300015265 Bacteria 434103
654 Ga0163161_10000144 3300017792 Bacteria 64771
655 Ga0163161_10000157 3300017792 Bacteria 62919
656 Ga0163161_10149013 3300017792 Bacteria 1777
657 Ga0163161_10173782 3300017792 Bacteria 1648
658 Ga0213873_10007625 3300021358 Bacteria 2177
659 Ga0213872_10001066 3300021361 Bacteria 18945
660 Ga0213872_10068185 3300021361 Bacteria 1605
661 Ga0213875_10021717 3300021388 Bacteria 3071
662 Ga0209672_102122 3300025228 Bacteria 5276
663 Ga0209147_105210 3300025229 Bacteria 1986
664 Ga0209563_100014 3300025230 Bacteria 940582
665 Ga0207425_1001149 3300025245 Bacteria 11896
666 Ga0207425_1003000 3300025245 Bacteria 5624
667 Ga0207425_1005417 3300025245 Bacteria 3641
668 Ga0209129_1000083 3300025258 Bacteria 183270
669 Ga0209129_1004634 3300025258 Bacteria 5263
670 Ga0209129_1012302 3300025258 Bacteria 1973
671 Ga0209565_1000083 3300025263 Bacteria 154007
672 Ga0209565_1001165 3300025263 Bacteria 12620
673 Ga0209565_1001782 3300025263 Bacteria 8700
674 Ga0207666_1000059 3300025271 Bacteria 19909
675 Ga0209673_1000089 3300025273 Bacteria 202240
676 Ga0209673_1000323 3300025273 Bacteria 87588
677 Ga0209673_1001607 3300025273 Bacteria 19784
678 Ga0209673_1003753 3300025273 Bacteria 8657
679 Ga0209673_1024705 3300025273 Bacteria 2013
680 Ga0209130_1000208 3300025284 Bacteria 78707
681 Ga0209130_1000231 3300025284 Bacteria 73279
682 Ga0209130_1000400 3300025284 Bacteria 47474
683 Ga0209130_1001602 3300025284 Bacteria 14108
684 Ga0209130_1004131 3300025284 Bacteria 5702
685 Ga0207673_1000330 3300025290 Bacteria 4761
686 Ga0209675_1000081 3300025291 Bacteria 154007
687 Ga0209675_1001031 3300025291 Bacteria 17390
688 Ga0209675_1002633 3300025291 Bacteria 9075
689 Ga0209675_1004304 3300025291 Bacteria 6389
690 Ga0209675_1008754 3300025291 Bacteria 3667
691 Ga0209675_1009968 3300025291 Bacteria 3294
692 Ga0209676_1000004 3300025292 Bacteria 1138360
693 Ga0209676_1000183 3300025292 Bacteria 145352
694 Ga0209676_1001760 3300025292 Bacteria 18385
695 Ga0209676_1002922 3300025292 Bacteria 11168
696 Ga0209676_1004535 3300025292 Bacteria 7696
697 Ga0209676_1025810 3300025292 Bacteria 1877
698 Ga0209025_1000049 3300025294 Bacteria 333459
699 Ga0209025_1000518 3300025294 Bacteria 73450
700 Ga0209025_1001724 3300025294 Bacteria 26449
701 Ga0209025_1001836 3300025294 Bacteria 24946
702 Ga0209025_1002225 3300025294 Bacteria 21372
703 Ga0209025_1006047 3300025294 Bacteria 9571
704 Ga0209025_1006883 3300025294 Bacteria 8670
705 Ga0209025_1007740 3300025294 Bacteria 7919
706 Ga0209025_1014013 3300025294 Bacteria 4981
707 Ga0209025_1022168 3300025294 Bacteria 3382
708 Ga0209025_1027136 3300025294 Bacteria 2850
709 Ga0209025_1030957 3300025294 Bacteria 2545
710 Ga0209025_1052245 3300025294 Bacteria 1615
711 Ga0209564_1002924 3300025295 Bacteria 12417
712 Ga0209564_1005879 3300025295 Bacteria 6809
713 Ga0209564_1006290 3300025295 Bacteria 6463
714 Ga0209564_1009425 3300025295 Bacteria 4648
715 Ga0209758_1000132 3300025297 Bacteria 183273
716 Ga0209758_1000628 3300025297 Bacteria 54130
717 Ga0209758_1006941 3300025297 Bacteria 7896
718 Ga0209758_1011111 3300025297 Bacteria 5263
719 Ga0209050_1000002 3300025298 Bacteria 1792849
720 Ga0209050_1001170 3300025298 Bacteria 31017
721 Ga0209050_1002672 3300025298 Bacteria 14542
722 Ga0209050_1006110 3300025298 Bacteria 7265
723 Ga0209050_1006526 3300025298 Bacteria 6874
724 Ga0209050_1015580 3300025298 Bacteria 3179
725 Ga0209256_1000492 3300025299 Bacteria 58194
726 Ga0209256_1000973 3300025299 Bacteria 34412
727 Ga0209256_1002639 3300025299 Bacteria 14108
728 Ga0207426_1000046 3300025302 Bacteria 422271
729 Ga0207426_1000197 3300025302 Bacteria 146366
730 Ga0207426_1000584 3300025302 Bacteria 48547
731 Ga0207426_1002041 3300025302 Bacteria 14108
732 Ga0209051_1000002 3300025303 Bacteria 1631846
733 Ga0209051_1000533 3300025303 Bacteria 47141
734 Ga0209051_1001870 3300025303 Bacteria 16527
735 Ga0209051_1002364 3300025303 Bacteria 13645
736 Ga0209051_1009018 3300025303 Bacteria 5195
737 Ga0209051_1016781 3300025303 Bacteria 3293
738 Ga0209051_1030165 3300025303 Bacteria 2108
739 Ga0209051_1041625 3300025303 Bacteria 1632
740 Ga0209051_1043267 3300025303 Bacteria 1582
741 Ga0209257_1000002 3300025304 Bacteria 1767052
742 Ga0209257_1000016 3300025304 Bacteria 908015
743 Ga0209257_1000361 3300025304 Bacteria 92239
744 Ga0209257_1009329 3300025304 Bacteria 5291
745 Ga0207697_10004888 3300025315 Bacteria 6320
746 Ga0207697_10005773 3300025315 Bacteria 5706
747 Ga0207697_10027556 3300025315 Bacteria 2323
748 Ga0207656_10009568 3300025321 Bacteria 3600
749 Ga0207656_10025330 3300025321 Bacteria 2407
750 Ga0207656_10073882 3300025321 Bacteria 1520
751 Ga0207655_1007936 3300025728 Bacteria 6816
752 Ga0207653_10001520 3300025885 Bacteria 7508
753 Ga0207653_10002470 3300025885 Bacteria 5874
754 Ga0207653_10019309 3300025885 Bacteria 2149
755 Ga0207682_10000233 3300025893 Bacteria 24983
756 Ga0207682_10000509 3300025893 Bacteria 17874
757 Ga0207692_10012403 3300025898 Bacteria 3660
758 Ga0207692_10024508 3300025898 Bacteria 2806
759 Ga0207692_10119408 3300025898 Bacteria 1474
760 Ga0207710_10006153 3300025900 Bacteria 5135
761 Ga0207688_10000167 3300025901 Bacteria 28809
762 Ga0207688_10026635 3300025901 Bacteria 3180
763 Ga0207688_10050276 3300025901 Bacteria 2333
764 Ga0207680_10008068 3300025903 Bacteria 5158
765 Ga0207680_10019296 3300025903 Bacteria 3643
766 Ga0207680_10027653 3300025903 Bacteria 3162
767 Ga0207680_10187827 3300025903 Bacteria 1401
768 Ga0207647_10006799 3300025904 Bacteria 8296
769 Ga0207647_10049731 3300025904 Bacteria 2599
770 Ga0207647_10065911 3300025904 Bacteria 2197
771 Ga0207685_10006792 3300025905 Bacteria 3145
772 Ga0207685_10100918 3300025905 Bacteria 1234
773 Ga0207699_10014979 3300025906 Bacteria 4016
774 Ga0207699_10018629 3300025906 Bacteria 3683
775 Ga0207699_10107246 3300025906 Bacteria 1784
776 Ga0207699_10116909 3300025906 Bacteria 1718
777 Ga0207699_10142209 3300025906 Bacteria 1578
778 Ga0207645_10000059 3300025907 Bacteria 78254
779 Ga0207645_10000100 3300025907 Bacteria 64057
780 Ga0207645_10019420 3300025907 Bacteria 4455
781 Ga0207645_10032640 3300025907 Bacteria 3347
782 Ga0207645_10116715 3300025907 Bacteria 1731
783 Ga0207643_10000007 3300025908 Bacteria 171706
784 Ga0207643_10000014 3300025908 Bacteria 128891
785 Ga0207643_10028396 3300025908 Bacteria 3107
786 Ga0207705_10111477 3300025909 Bacteria 2022
787 Ga0207705_10147049 3300025909 Bacteria 1764
788 Ga0207705_10439103 3300025909 Bacteria 1011
789 Ga0207684_10000047 3300025910 Bacteria 244386
790 Ga0207684_10000370 3300025910 Bacteria 60789
791 Ga0207684_10002538 3300025910 Bacteria 18333
792 Ga0207684_10005313 3300025910 Bacteria 11914
793 Ga0207684_10021471 3300025910 Bacteria 5513
794 Ga0207684_10026392 3300025910 Bacteria 4952
795 Ga0207684_10033330 3300025910 Bacteria 4379
796 Ga0207684_10042118 3300025910 Bacteria 3870
797 Ga0207684_10049950 3300025910 Bacteria 3548
798 Ga0207684_10060104 3300025910 Bacteria 3227
799 Ga0207684_10084595 3300025910 Bacteria 2702
800 Ga0207684_10215618 3300025910 Bacteria 1656
801 Ga0207654_10017742 3300025911 Bacteria 3726
802 Ga0207654_10027404 3300025911 Bacteria 3096
803 Ga0207654_10166523 3300025911 Bacteria 1428
804 Ga0207654_10192175 3300025911 Bacteria 1339
805 Ga0207707_10000138 3300025912 Bacteria 74881
806 Ga0207707_10005018 3300025912 Bacteria 11624
807 Ga0207707_10016070 3300025912 Bacteria 6527
808 Ga0207707_10022060 3300025912 Bacteria 5566
809 Ga0207707_10052281 3300025912 Bacteria 3557
810 Ga0207707_10077610 3300025912 Bacteria 2899
811 Ga0207707_10091096 3300025912 Bacteria 2665
812 Ga0207707_10199984 3300025912 Bacteria 1742
813 Ga0207707_10240676 3300025912 Bacteria 1573
814 Ga0207695_10292264 3300025913 Bacteria 1522
815 Ga0207695_10550983 3300025913 Bacteria 1035
816 Ga0207671_10051675 3300025914 Bacteria 3046
817 Ga0207671_10082753 3300025914 Bacteria 2409
818 Ga0207671_10227462 3300025914 Bacteria 1463
819 Ga0207693_10003697 3300025915 Bacteria 13040
820 Ga0207693_10010251 3300025915 Bacteria 7607
821 Ga0207693_10010690 3300025915 Bacteria 7449
822 Ga0207693_10022705 3300025915 Bacteria 4985
823 Ga0207693_10052278 3300025915 Bacteria 3204
824 Ga0207693_10119313 3300025915 Bacteria 2071
825 Ga0207693_10214991 3300025915 Bacteria 1511
826 Ga0207663_10016769 3300025916 Bacteria 4070
827 Ga0207663_10048579 3300025916 Bacteria 2627
828 Ga0207663_10081072 3300025916 Bacteria 2124
829 Ga0207663_10129197 3300025916 Bacteria 1743
830 Ga0207660_10000041 3300025917 Bacteria 63485
831 Ga0207660_10000848 3300025917 Bacteria 20138
832 Ga0207660_10016588 3300025917 Bacteria 4878
833 Ga0207660_10039418 3300025917 Bacteria 3302
834 Ga0207660_10189221 3300025917 Bacteria 1602
835 Ga0207662_10000195 3300025918 Bacteria 28315
836 Ga0207662_10041918 3300025918 Bacteria 2696
837 Ga0207657_10000135 3300025919 Bacteria 75248
838 Ga0207657_10000371 3300025919 Bacteria 47425
839 Ga0207657_10002386 3300025919 Bacteria 20326
840 Ga0207657_10008450 3300025919 Bacteria 10444
841 Ga0207657_10011112 3300025919 Bacteria 8950
842 Ga0207657_10015145 3300025919 Bacteria 7489
843 Ga0207657_10023887 3300025919 Bacteria 5678
844 Ga0207657_10040173 3300025919 Bacteria 4148
845 Ga0207649_10001482 3300025920 Bacteria 13783
846 Ga0207649_10003041 3300025920 Bacteria 9241
847 Ga0207649_10265585 3300025920 Bacteria 1242
848 Ga0207652_10002995 3300025921 Bacteria 14105
849 Ga0207652_10005355 3300025921 Bacteria 10409
850 Ga0207652_10015708 3300025921 Bacteria 6167
851 Ga0207652_10019549 3300025921 Bacteria 5572
852 Ga0207652_10033023 3300025921 Bacteria 4356
853 Ga0207652_10103601 3300025921 Bacteria 2516
854 Ga0207652_10199221 3300025921 Bacteria 1802
855 Ga0207652_10228996 3300025921 Bacteria 1675
856 Ga0207652_10299556 3300025921 Bacteria 1451
857 Ga0207652_10385584 3300025921 Bacteria 1265
858 Ga0207646_10000466 3300025922 Bacteria 54002
859 Ga0207646_10007223 3300025922 Bacteria 11333
860 Ga0207646_10025133 3300025922 Bacteria 5451
861 Ga0207646_10035640 3300025922 Bacteria 4493
862 Ga0207646_10052656 3300025922 Bacteria 3643
863 Ga0207646_10066999 3300025922 Bacteria 3205
864 Ga0207681_10001546 3300025923 Bacteria 14821
865 Ga0207681_10256360 3300025923 Bacteria 1368
866 Ga0207694_10079410 3300025924 Bacteria 2573
867 Ga0207694_10334017 3300025924 Bacteria 1252
868 Ga0207650_10001317 3300025925 Bacteria 17984
869 Ga0207650_10007958 3300025925 Bacteria 7225
870 Ga0207650_10036096 3300025925 Bacteria 3594
871 Ga0207659_10003760 3300025926 Bacteria 9152
872 Ga0207659_10003917 3300025926 Bacteria 8979
873 Ga0207659_10017546 3300025926 Bacteria 4678
874 Ga0207659_10231822 3300025926 Bacteria 1489
875 Ga0207687_10000072 3300025927 Bacteria 76222
876 Ga0207687_10002399 3300025927 Bacteria 12708
877 Ga0207687_10004046 3300025927 Bacteria 9824
878 Ga0207687_10040930 3300025927 Bacteria 3179
879 Ga0207687_10069085 3300025927 Bacteria 2518
880 Ga0207700_10009195 3300025928 Bacteria 6161
881 Ga0207700_10061588 3300025928 Bacteria 2846
882 Ga0207700_10083552 3300025928 Bacteria 2500
883 Ga0207700_10102963 3300025928 Bacteria 2281
884 Ga0207700_10115658 3300025928 Bacteria 2166
885 Ga0207700_10163367 3300025928 Bacteria 1851
886 Ga0207700_10390726 3300025928 Bacteria 1218
887 Ga0207664_10001202 3300025929 Bacteria 17189
888 Ga0207664_10025036 3300025929 Bacteria 4488
889 Ga0207664_10026888 3300025929 Bacteria 4355
890 Ga0207664_10079180 3300025929 Bacteria 2667
891 Ga0207664_10113689 3300025929 Bacteria 2255
892 Ga0207644_10001292 3300025931 Bacteria 16118
893 Ga0207644_10003302 3300025931 Bacteria 10425
894 Ga0207644_10014609 3300025931 Bacteria 5257
895 Ga0207644_10049977 3300025931 Bacteria 2995
896 Ga0207644_10104400 3300025931 Bacteria 2133
897 Ga0207644_10148953 3300025931 Bacteria 1809
898 Ga0207690_10003300 3300025932 Bacteria 9652
899 Ga0207690_10004975 3300025932 Bacteria 7849
900 Ga0207690_10021253 3300025932 Bacteria 4023
901 Ga0207690_10055902 3300025932 Bacteria 2660
902 Ga0207690_10065899 3300025932 Bacteria 2478
903 Ga0207690_10086957 3300025932 Bacteria 2198
904 Ga0207690_10109014 3300025932 Bacteria 1991
905 Ga0207690_10160875 3300025932 Bacteria 1673
906 Ga0207690_10225340 3300025932 Bacteria 1436
907 Ga0207706_10000179 3300025933 Bacteria 70768
908 Ga0207706_10008198 3300025933 Bacteria 9637
909 Ga0207706_10010659 3300025933 Bacteria 8395
910 Ga0207706_10027673 3300025933 Bacteria 5069
911 Ga0207706_10032369 3300025933 Bacteria 4657
912 Ga0207706_10212362 3300025933 Bacteria 1696
913 Ga0207686_10001034 3300025934 Bacteria 16473
914 Ga0207686_10001546 3300025934 Bacteria 12982
915 Ga0207686_10062493 3300025934 Bacteria 2365
916 Ga0207686_10135099 3300025934 Bacteria 1697
917 Ga0207686_10224025 3300025934 Bacteria 1360
918 Ga0207709_10000323 3300025935 Bacteria 51730
919 Ga0207709_10001423 3300025935 Bacteria 16760
920 Ga0207709_10002180 3300025935 Bacteria 12510
921 Ga0207709_10010841 3300025935 Bacteria 5020
922 Ga0207670_10007269 3300025936 Bacteria 6170
923 Ga0207670_10007607 3300025936 Bacteria 6060
924 Ga0207670_10033916 3300025936 Bacteria 3294
925 Ga0207670_10177187 3300025936 Bacteria 1603
926 Ga0207669_10000176 3300025937 Bacteria 29979
927 Ga0207669_10021922 3300025937 Bacteria 3383
928 Ga0207704_10013299 3300025938 Bacteria 4114
929 Ga0207704_10065340 3300025938 Bacteria 2277
930 Ga0207704_10548285 3300025938 Bacteria 939
931 Ga0207665_10002312 3300025939 Bacteria 12865
932 Ga0207665_10014000 3300025939 Bacteria 5275
933 Ga0207665_10028429 3300025939 Bacteria 3692
934 Ga0207691_10005440 3300025940 Bacteria 12297
935 Ga0207691_10008719 3300025940 Bacteria 9727
936 Ga0207691_10024412 3300025940 Bacteria 5686
937 Ga0207711_10001106 3300025941 Bacteria 25759
938 Ga0207711_10001412 3300025941 Bacteria 22485
939 Ga0207711_10054504 3300025941 Bacteria 3432
940 Ga0207711_10297221 3300025941 Bacteria 1489
941 Ga0207689_10000340 3300025942 Bacteria 43593
942 Ga0207689_10000366 3300025942 Bacteria 42711
943 Ga0207689_10011579 3300025942 Bacteria 7557
944 Ga0207689_10075610 3300025942 Bacteria 2768
945 Ga0207689_10239592 3300025942 Bacteria 1500
946 Ga0207689_10258146 3300025942 Bacteria 1442
947 Ga0207689_10273117 3300025942 Bacteria 1400
948 Ga0207661_10000087 3300025944 Bacteria 63263
949 Ga0207661_10324767 3300025944 Bacteria 1384
950 Ga0207661_10340880 3300025944 Bacteria 1350
951 Ga0207679_10000029 3300025945 Bacteria 183002
952 Ga0207679_10000212 3300025945 Bacteria 46385
953 Ga0207679_10004897 3300025945 Bacteria 8346
954 Ga0207679_10017886 3300025945 Bacteria 4738
955 Ga0207679_10020500 3300025945 Bacteria 4462
956 Ga0207679_10038663 3300025945 Bacteria 3401
957 Ga0207679_10190787 3300025945 Bacteria 1704
958 Ga0207667_10000296 3300025949 Bacteria 68803
959 Ga0207667_10026324 3300025949 Bacteria 6358
960 Ga0207667_10071531 3300025949 Bacteria 3606
961 Ga0207667_10109162 3300025949 Bacteria 2854
962 Ga0207667_10171393 3300025949 Bacteria 2230
963 Ga0207667_10374146 3300025949 Bacteria 1452
964 Ga0207651_10001426 3300025960 Bacteria 10879
965 Ga0207651_10004291 3300025960 Bacteria 7158
966 Ga0207651_10029362 3300025960 Bacteria 3483
967 Ga0207651_10085237 3300025960 Bacteria 2291
968 Ga0207651_10461367 3300025960 Bacteria 1092
969 Ga0207712_10001547 3300025961 Bacteria 15511
970 Ga0207712_10262138 3300025961 Bacteria 1402
971 Ga0207712_10384491 3300025961 Bacteria 1176
972 Ga0207640_10001474 3300025981 Bacteria 12692
973 Ga0207640_10004722 3300025981 Bacteria 7399
974 Ga0207640_10078853 3300025981 Bacteria 2243
975 Ga0207640_10079397 3300025981 Bacteria 2236
976 Ga0207640_10082980 3300025981 Bacteria 2196
977 Ga0207640_10090523 3300025981 Bacteria 2117
978 Ga0207658_10005146 3300025986 Bacteria 9004
979 Ga0207658_10020207 3300025986 Bacteria 4612
980 Ga0207658_10049391 3300025986 Bacteria 3091
981 Ga0207677_10005872 3300026023 Bacteria 6679
982 Ga0207677_10007549 3300026023 Bacteria 6030
983 Ga0207677_10032098 3300026023 Bacteria 3372
984 Ga0207677_10072219 3300026023 Bacteria 2439
985 Ga0207677_10104308 3300026023 Bacteria 2095
986 Ga0207677_10184137 3300026023 Bacteria 1645
987 Ga0207703_10001566 3300026035 Bacteria 20744
988 Ga0207703_10026810 3300026035 Bacteria 4539
989 Ga0207639_10001773 3300026041 Bacteria 14523
990 Ga0207639_10009108 3300026041 Bacteria 6840
991 Ga0207639_10030650 3300026041 Bacteria 3946
992 Ga0207639_10139704 3300026041 Bacteria 2017
993 Ga0207678_10006632 3300026067 Bacteria 10261
994 Ga0207678_10007393 3300026067 Bacteria 9727
995 Ga0207678_10059246 3300026067 Bacteria 3294
996 Ga0207708_10007017 3300026075 Bacteria 8325
997 Ga0207708_10068643 3300026075 Bacteria 2713
998 Ga0207702_10000997 3300026078 Bacteria 29032
999 Ga0207702_10001150 3300026078 Bacteria 27070
1000 Ga0207702_10002232 3300026078 Bacteria 18580
1001 Ga0207702_10015638 3300026078 Bacteria 6281
1002 Ga0207702_10065241 3300026078 Bacteria 3118
1003 Ga0207702_10208236 3300026078 Bacteria 1817
1004 Ga0207641_10011956 3300026088 Bacteria 7121
1005 Ga0207641_10014477 3300026088 Bacteria 6462
1006 Ga0207641_10153500 3300026088 Bacteria 2087
1007 Ga0207641_10302361 3300026088 Bacteria 1512
1008 Ga0207641_10505287 3300026088 Bacteria 1174
1009 Ga0207648_10001239 3300026089 Bacteria 28649
1010 Ga0207648_10003625 3300026089 Bacteria 16145
1011 Ga0207648_10008796 3300026089 Bacteria 9727
1012 Ga0207648_10249840 3300026089 Bacteria 1581
1013 Ga0207648_10276416 3300026089 Bacteria 1501
1014 Ga0207676_10000429 3300026095 Bacteria 35426
1015 Ga0207676_10001946 3300026095 Bacteria 15063
1016 Ga0207676_10004807 3300026095 Bacteria 9584
1017 Ga0207676_10013792 3300026095 Bacteria 5802
1018 Ga0207676_10325736 3300026095 Bacteria 1412
1019 Ga0207674_10000684 3300026116 Bacteria 44066
1020 Ga0207674_10000697 3300026116 Bacteria 43729
1021 Ga0207674_10023874 3300026116 Bacteria 6541
1022 Ga0207674_10028853 3300026116 Bacteria 5849
1023 Ga0207674_10068749 3300026116 Bacteria 3563
1024 Ga0207674_10416664 3300026116 Bacteria 1298
1025 Ga0207675_100005465 3300026118 Bacteria 12176
1026 Ga0207675_100013598 3300026118 Bacteria 7598
1027 Ga0207675_100021301 3300026118 Bacteria 6038
1028 Ga0207675_100209693 3300026118 Bacteria 1873
1029 Ga0207683_10000029 3300026121 Bacteria 109665
1030 Ga0207683_10001317 3300026121 Bacteria 22408
1031 Ga0207683_10030000 3300026121 Bacteria 4711
1032 Ga0207683_10052262 3300026121 Bacteria 3580
1033 Ga0207683_10160885 3300026121 Bacteria 2029
1034 Ga0207683_10199221 3300026121 Bacteria 1819
1035 Ga0207683_10239388 3300026121 Bacteria 1655
1036 Ga0207698_10018865 3300026142 Bacteria 4711
1037 Ga0207698_10023805 3300026142 Bacteria 4286
1038 Ga0207698_10045457 3300026142 Bacteria 3308
1039 Ga0207698_10084889 3300026142 Bacteria 2568
1040 Ga0207698_10102579 3300026142 Bacteria 2375
1041 Ga0207698_10123448 3300026142 Bacteria 2197
1042 Ga0207698_10434318 3300026142 Bacteria 1263
1043 Ga0209179_1025133 3300027512 Bacteria 1186
1044 Ga0209983_1005029 3300027665 Bacteria 2757
1045 Ga0209282_1000165 3300027666 Bacteria 37517
1046 Ga0209282_1002509 3300027666 Bacteria 10644
1047 Ga0209588_1050337 3300027671 Bacteria 1348
1048 Ga0209971_1003527 3300027682 Bacteria 3701
1049 Ga0209966_1013384 3300027695 Bacteria 1518
1050 Ga0209998_10001898 3300027717 Bacteria 4926
1051 Ga0209813_10000254 3300027866 Bacteria 15521
1052 Ga0209974_10002097 3300027876 Bacteria 7300
1053 Ga0209974_10007927 3300027876 Bacteria 3641
1054 Ga0209974_10011487 3300027876 Bacteria 2972
1055 Ga0209974_10030952 3300027876 Bacteria 1772
1056 Ga0207428_10000100 3300027907 Bacteria 119495
1057 Ga0207428_10000119 3300027907 Bacteria 106261
1058 Ga0207428_10010298 3300027907 Bacteria 8357
1059 Ga0207428_10180526 3300027907 Bacteria 1595
1060 Ga0268266_10040823 3300028379 Bacteria 3956
1061 Ga0268266_10042868 3300028379 Bacteria 3866
1062 Ga0268266_10049818 3300028379 Bacteria 3593
1063 Ga0268266_10088876 3300028379 Bacteria 2704
1064 Ga0268266_10098594 3300028379 Bacteria 2571
1065 Ga0268265_10024411 3300028380 Bacteria 4276
1066 Ga0268265_10074098 3300028380 Bacteria 2661
1067 Ga0268264_10002968 3300028381 Bacteria 14738
1068 Ga0268264_10021447 3300028381 Bacteria 5274
1069 Ga0268264_10070544 3300028381 Bacteria 2958
1070 Ga0268264_10502935 3300028381 Bacteria 1182
1071 Ga0307515_10000195 3300028794 Bacteria 148138
1072 Ga0307515_10000515 3300028794 Bacteria 92187
1073 Ga0307515_10088375 3300028794 Bacteria 3918
1074 Ga0307512_10148172 3300030522 Bacteria 1413
1075 Ga0316177_1194083 3300030731 Bacteria 3178
1076 Ga0316176_1194494 3300030732 Bacteria 2372
1077 Ga0314311_1187085 3300030733 Bacteria 4178
1078 Ga0316178_1021905 3300030735 Bacteria 9973
1079 Ga0265330_10000033 3300031235 Bacteria 126931
1080 Ga0265330_10007169 3300031235 Bacteria 5461
1081 Ga0265332_10000001 3300031238 Bacteria 863783
1082 Ga0265339_10143330 3300031249 Bacteria 1214
1083 Ga0265327_10000425 3300031251 Bacteria 77143
1084 Ga0265327_10095537 3300031251 Bacteria 1442
1085 Ga0307513_10048235 3300031456 Bacteria 4624
1086 Ga0307513_10178655 3300031456 Bacteria 1989
1087 Ga0307513_10440065 3300031456 Bacteria 1030
1088 Ga0307408_100000039 3300031548 Bacteria 177825
1089 Ga0307408_100006354 3300031548 Bacteria 7841
1090 Ga0307408_100020361 3300031548 Bacteria 4476
1091 Ga0307408_100044908 3300031548 Bacteria 3152
1092 Ga0307408_100089774 3300031548 Bacteria 2317
1093 Ga0307408_100145730 3300031548 Bacteria 1863
1094 Ga0307408_100170044 3300031548 Bacteria 1739
1095 Ga0307408_100202823 3300031548 Bacteria 1606
1096 Ga0307408_100224907 3300031548 Bacteria 1533
1097 Ga0307514_10000529 3300031649 Bacteria 74752
1098 Ga0307514_10063859 3300031649 Bacteria 2794
1099 Ga0265314_10000022 3300031711 Bacteria 297299
1100 Ga0265314_10171258 3300031711 Bacteria 1310
1101 Ga0307405_10020362 3300031731 Bacteria 3706
1102 Ga0307405_10071647 3300031731 Bacteria 2230
1103 Ga0307405_10104581 3300031731 Bacteria 1905
1104 Ga0307405_10265491 3300031731 Bacteria 1284
1105 Ga0307518_10003759 3300031838 Bacteria 10903
1106 Ga0307406_10002205 3300031901 Bacteria 10598
1107 Ga0307406_10005358 3300031901 Bacteria 7022
1108 Ga0307406_10102155 3300031901 Bacteria 1955
1109 Ga0307406_10270813 3300031901 Bacteria 1290
1110 Ga0307412_10001651 3300031911 Bacteria 12316
1111 Ga0307412_10023576 3300031911 Bacteria 3789
1112 Ga0307412_10039518 3300031911 Bacteria 3046
1113 Ga0307412_10272685 3300031911 Bacteria 1324
1114 Ga0307409_100228525 3300031995 Bacteria 1685
1115 Ga0307409_100264339 3300031995 Bacteria 1581
1116 Ga0307416_100039425 3300032002 Bacteria 3657
1117 Ga0307416_100063101 3300032002 Bacteria 3033
1118 Ga0307416_100077640 3300032002 Bacteria 2790
1119 Ga0307416_100207503 3300032002 Bacteria 1865
1120 Ga0307416_100260270 3300032002 Bacteria 1695
1121 Ga0307416_100459308 3300032002 Bacteria 1328
1122 Ga0307414_10021629 3300032004 Bacteria 4042
1123 Ga0307414_10060819 3300032004 Bacteria 2673
1124 Ga0307414_10149531 3300032004 Bacteria 1840
1125 Ga0307414_10248893 3300032004 Bacteria 1476
1126 Ga0307414_10273759 3300032004 Bacteria 1415
1127 Ga0307414_10299834 3300032004 Bacteria 1359
1128 Ga0307411_10011834 3300032005 Bacteria 4730
1129 Ga0307411_10055799 3300032005 Bacteria 2601
1130 Ga0307411_10138759 3300032005 Bacteria 1789
1131 Ga0373930_0023220 3300034816 Bacteria 1232
1132 Ga0373938_0003291 3300034957 Bacteria 2638
1133 Ga0373926_0028170 3300035083 Bacteria 1971
1134 Ga0373934_0000354 3300035086 Bacteria 16098
1135 Ga0373934_0043424 3300035086 Bacteria 1776
1136 Ga0373940_0003500 3300035088 Bacteria 3212
1137 Ga0373949_0001408 3300035090 Bacteria 6875
1138 Ga0373951_0003300 3300035091 Bacteria 3944
1139 Ga0373951_0024329 3300035091 Bacteria 1402
1140 Ga0373952_0009002 3300035092 Bacteria 1903
1141 Ga0373923_0068441 3300035111 Bacteria 1520
1142 Ga0373932_0081864 3300035112 Bacteria 1021
1143 Ga0373939_0000003 3300035114 Bacteria 111914
1144 Ga0373939_0001446 3300035114 Bacteria 5745
1145 Ga0373939_0154864 3300035114 Bacteria 837
1146 Ga0373941_0035388 3300035115 Bacteria 1512
1147 Ga0373945_0004052 3300035116 Bacteria 4636
1148 Ga0373953_0035690 3300035117 Bacteria 1955
1149 Ga0373954_0001840 3300035118 Bacteria 8754
1150 Ga0373954_0016077 3300035118 Bacteria 3348
1151 Ga0373956_0000015 3300035119 Bacteria 52635
1152 Ga0373957_0017254 3300035120 Bacteria 2511
1153 Ga0373957_0094294 3300035120 Bacteria 1192
1154 Ga0373960_0008398 3300035121 Bacteria 2474
1155 Ga0373960_0010251 3300035121 Bacteria 2285
1156 Ga0373943_0098144 3300035170 Bacteria 1528
1157 Ga0373946_0013975 3300035171 Bacteria 3023
1158 Ga0373946_0082579 3300035171 Bacteria 1410
1159 Ga0373955_0006536 3300035172 Bacteria 5316
1160 Ga0373942_0010868 3300035207 Bacteria 2148
1161 Ga0373942_0035350 3300035207 Bacteria 1340
1162 Ga0373961_0001706 3300035241 Bacteria 6116
1163 Ga0373961_0013496 3300035241 Bacteria 2061
1164 Ga0373961_0068433 3300035241 Bacteria 1093
1165 Ga0373962_0018254 3300035242 Bacteria 1824
1166 Ga0373962_0029896 3300035242 Bacteria 1488
1167 Ga0373924_0009830 3300035410 Bacteria 3515
1168 Ga0373924_0012738 3300035410 Bacteria 3147
1169 Ga0373924_0034289 3300035410 Bacteria 2054
1170 Ga0373931_0001534 3300035691 Bacteria 9955
1171 Ga0373931_0008185 3300035691 Bacteria 4952
1172 Ga0373931_0013914 3300035691 Bacteria 3926
1173 Ga0373931_0052791 3300035691 Bacteria 2168
1174 Ga0373931_0152206 3300035691 Bacteria 1349
1175 Ga0373935_0020975 3300035692 Bacteria 3996
1176 Ga0373935_0468308 3300035692 Bacteria 912
1177 Ga0373927_0009992 3300035695 Bacteria 6359
1178 Ga0373933_0001774 3300035724 Bacteria 12484
1179 Ga0373933_0009434 3300035724 Bacteria 5330
1180 Ga0373933_0056290 3300035724 Bacteria 2360
1181 Ga0373947_0032531 3300035725 Bacteria 3074
1182 Ga0373947_0033135 3300035725 Bacteria 3048
1183 Ga0373937_0000182 3300036401 Bacteria 61628
1184 Ga0373937_0020416 3300036401 Bacteria 5940
1185 Ga0373937_0030398 3300036401 Bacteria 4893
1186 Ga0373937_0056076 3300036401 Bacteria 3618
1187 Ga0373937_0098771 3300036401 Bacteria 2708
1188 Ga0373937_0150551 3300036401 Bacteria 2179
1189 Ga0373937_0417361 3300036401 Bacteria 1273
1190 Ga0373937_0723199 3300036401 Bacteria 942
1191 Ga0373937_0723241 3300036401 Bacteria 942
1192 Ga0373925_0004459 3300037068 Bacteria 10584
1193 Ga0373925_0027813 3300037068 Bacteria 4139
1194 Ga0373925_0037130 3300037068 Bacteria 3595
1195 Ga0373925_0056356 3300037068 Bacteria 2944
1196 Ga0373925_0079858 3300037068 Bacteria 2486
1197 Ga0373925_0127429 3300037068 Bacteria 1982
1198 Ga0395899_0003231 3300037312 Bacteria 12927
1199 Ga0395899_0168227 3300037312 Bacteria 1545
1200 Ga0395900_0000067 3300037418 Bacteria 193958
1201 Ga0395900_0020030 3300037418 Bacteria 6821
1202 Ga0395900_0282082 3300037418 Bacteria 1653
1203 Ga0395898_0000214 3300037466 Bacteria 149002
1204 Ga0395898_0002933 3300037466 Bacteria 19401
1205 Ga0395898_0012009 3300037466 Bacteria 8967
1206 Ga0395905_0000060 3300037471 Bacteria 193958
1207 Ga0395905_0001506 3300037471 Bacteria 27863
1208 Ga0395905_0002575 3300037471 Bacteria 19972
1209 Ga0395905_0007574 3300037471 Bacteria 10789
1210 Ga0395905_0030893 3300037471 Bacteria 5045
1211 Ga0395905_0038449 3300037471 Bacteria 4490
1212 Ga0395905_0068103 3300037471 Bacteria 3334
1213 Ga0395905_0117467 3300037471 Bacteria 2499
1214 Ga0395905_0418529 3300037471 Bacteria 1236
1215 Ga0436364_0010042 3300037853 Bacteria 102214
1216 Ga0436364_0062636 3300037853 Bacteria 1847
1217 Ga0436364_0566936 3300037853 Bacteria 6471
1218 Ga0436364_0839268 3300037853 Bacteria 1480
1219 Ga0436364_1169737 3300037853 Bacteria 2077
1220 Ga0436364_1266276 3300037853 Bacteria 2234
1221 Ga0395901_0000063 3300038443 Bacteria 149493
1222 Ga0395901_0019056 3300038443 Bacteria 7016
1223 Ga0395901_0029770 3300038443 Bacteria 5623
1224 Ga0395901_0059936 3300038443 Bacteria 3960
1225 Ga0395901_0288219 3300038443 Bacteria 1704
1226 Ga0395901_0431073 3300038443 Bacteria 1351
1227 Ga0242420_015158 3300038996 Bacteria 1331
1228 Ga0436365_1366850 3300039437 Bacteria 3078
1229 Ga0436365_1630009 3300039437 Bacteria 3393
1230 Ga0436365_1916586 3300039437 Bacteria 1313
1231 Ga0436360_0286842 3300039438 Bacteria 1960
1232 Ga0436360_0355657 3300039438 Bacteria 1509
1233 Ga0436361_0225003 3300039447 Bacteria 2861
1234 Ga0436361_0243008 3300039447 Bacteria 1980
1235 Ga0436361_0953105 3300039447 Bacteria 3070
1236 Ga0436361_0993124 3300039447 Bacteria 4758
1237 Ga0436361_1161676 3300039447 Bacteria 1730
1238 Ga0436363_0156420 3300039450 Bacteria 4595
1239 Ga0436362_0196742 3300039453 Bacteria 2403
1240 Ga0436362_0834131 3300039453 Bacteria 5455
1241 Ga0439436_0001036 3300041404 Bacteria 7795
1242 Ga0439436_0029804 3300041404 Bacteria 1587
1243 Ga0439453_0001687 3300041408 Bacteria 2893
1244 Ga0439453_0006616 3300041408 Bacteria 1811
1245 Ga0439466_0004105 3300041411 Bacteria 5624
1246 Ga0439465_0003246 3300041413 Bacteria 5308
1247 Ga0439465_0030452 3300041413 Bacteria 1717
1248 Ga0451793_0984015 3300041452 Bacteria 1481
1249 Ga0451855_0956808 3300041511 Bacteria 996
1250 Ga0439441_000869 3300042001 Bacteria 3641
1251 Ga0439441_005968 3300042001 Bacteria 1913
1252 Ga0439441_006581 3300042001 Bacteria 1849
1253 Ga0439442_006805 3300042002 Bacteria 2295
1254 Ga0439445_0004602 3300042004 Bacteria 3125
1255 Ga0439448_0006616 3300042005 Bacteria 3336
1256 Ga0439432_011973 3300042006 Bacteria 2980
1257 Ga0439432_033561 3300042006 Bacteria 1650
1258 Ga0439449_0005851 3300042007 Bacteria 4701
1259 Ga0439450_011365 3300042008 Bacteria 1743
1260 Ga0439452_001501 3300042010 Bacteria 9458
1261 Ga0439452_007901 3300042010 Bacteria 3225
1262 Ga0439457_005546 3300042014 Bacteria 3165
1263 Ga0450898_013732 3300042134 Bacteria 1354
1264 Ga0450904_000354 3300042139 Bacteria 9595
1265 Ga0439435_0000194 3300042436 Bacteria 8520
1266 Ga0439435_0017059 3300042436 Bacteria 1830
1267 Ga0439444_0000843 3300042437 Bacteria 3709
1268 Ga0439459_0000155 3300042438 Bacteria 7102
1269 Ga0439464_0000442 3300042439 Bacteria 8224
1270 Ga0439460_0000838 3300042461 Bacteria 7002
1271 Ga0450918_002634 3300042531 Bacteria 3384
1272 Ga0451577_0001624 3300042876 Bacteria 29180
1273 Ga0451577_0001635 3300042876 Bacteria 29060
1274 Ga0451577_0003247 3300042876 Bacteria 18283
1275 Ga0451577_0005276 3300042876 Bacteria 13281
1276 Ga0451577_0218301 3300042876 Bacteria 1723
1277 Ga0451577_0298719 3300042876 Bacteria 1459
1278 Ga0451577_0356967 3300042876 Bacteria 1326
1279 Ga0451577_0463770 3300042876 Bacteria 1150
1280 Ga0453683_0000034 3300044673 Bacteria 235218
1281 Ga0453683_0000062 3300044673 Bacteria 179392
1282 Ga0453683_0006980 3300044673 Bacteria 7698
1283 Ga0453683_0023611 3300044673 Bacteria 3917
1284 Ga0453683_0047761 3300044673 Bacteria 2684
1285 Ga0466961_0005894 3300044693 Bacteria 7765
1286 Ga0466964_0087945 3300044706 Bacteria 1347
1287 Ga0453684_0000176 3300044712 Bacteria 283097
1288 Ga0453684_0001136 3300044712 Bacteria 83233
1289 Ga0453684_0001504 3300044712 Bacteria 65595
1290 Ga0453684_0003087 3300044712 Bacteria 38449
1291 Ga0453684_0070906 3300044712 Bacteria 4409
1292 Ga0453684_0075888 3300044712 Bacteria 4222
1293 Ga0453684_0085668 3300044712 Bacteria 3914
1294 Ga0453684_0127159 3300044712 Bacteria 3065
1295 Ga0453684_0146890 3300044712 Bacteria 2807
1296 Ga0453684_0147429 3300044712 Bacteria 2801
1297 Ga0453684_0229254 3300044712 Bacteria 2145
1298 Ga0453684_0341477 3300044712 Bacteria 1690
1299 Ga0453684_0475312 3300044712 Bacteria 1387
1300 Ga0466968_0058950 3300044735 Bacteria 1653
1301 Ga0466968_0078020 3300044735 Bacteria 1451
1302 Ga0466960_0078530 3300044901 Bacteria 1658
1303 Ga0451576_0000260 3300045051 Bacteria 129222
1304 Ga0451576_0001433 3300045051 Bacteria 40801
1305 Ga0451576_0003830 3300045051 Bacteria 20213
1306 Ga0451576_0019396 3300045051 Bacteria 7423
1307 Ga0451576_0021367 3300045051 Bacteria 7033
1308 Ga0451576_0048843 3300045051 Bacteria 4442
1309 Ga0451576_0177123 3300045051 Bacteria 2226
1310 Ga0451576_0342782 3300045051 Bacteria 1564
1311 Ga0451576_0520121 3300045051 Bacteria 1250
1312 Ga0466967_0126727 3300045976 Bacteria 2366
1313 Ga0495592_0024915 3300046454 Bacteria 4546
1314 Ga0495592_0086140 3300046454 Bacteria 2263
1315 Ga0495603_0005200 3300046455 Bacteria 7769
1316 Ga0495603_0095269 3300046455 Bacteria 1739
1317 Ga0495603_0100081 3300046455 Bacteria 1692
1318 Ga0495590_0061125 3300046457 Bacteria 1319
1319 Ga0495629_0000037 3300046459 Bacteria 117099
1320 Ga0495629_0001156 3300046459 Bacteria 20848
1321 Ga0495629_0001563 3300046459 Bacteria 17991
1322 Ga0495629_0033042 3300046459 Bacteria 3661
1323 Ga0495629_0042196 3300046459 Bacteria 3206
1324 Ga0495638_0000141 3300046460 Bacteria 114543
1325 Ga0495638_0000224 3300046460 Bacteria 77870
1326 Ga0495638_0043959 3300046460 Bacteria 2816
1327 Ga0495638_0222369 3300046460 Bacteria 1054
1328 Ga0495651_0000027 3300046462 Bacteria 107496
1329 Ga0495651_0000976 3300046462 Bacteria 22172
1330 Ga0495651_0088242 3300046462 Bacteria 2331
1331 Ga0495651_0094542 3300046462 Bacteria 2236
1332 Ga0495653_0000048 3300046463 Bacteria 109560
1333 Ga0495653_0024941 3300046463 Bacteria 4812
1334 Ga0495653_0030237 3300046463 Bacteria 4316
1335 Ga0495650_0000826 3300046471 Bacteria 37460
1336 Ga0495650_0001789 3300046471 Bacteria 19410
1337 Ga0495580_0000118 3300046472 Bacteria 54013
1338 Ga0495580_0002319 3300046472 Bacteria 16596
1339 Ga0495580_0006778 3300046472 Bacteria 9286
1340 Ga0495580_0010671 3300046472 Bacteria 7135
1341 Ga0495580_0031152 3300046472 Bacteria 3857
1342 Ga0495580_0077628 3300046472 Bacteria 2316
1343 Ga0495580_0271061 3300046472 Bacteria 1159
1344 Ga0495580_0296838 3300046472 Bacteria 1101
1345 Ga0495582_0037321 3300046473 Bacteria 2672
1346 Ga0495582_0044004 3300046473 Bacteria 2459
1347 Ga0495582_0052018 3300046473 Bacteria 2259
1348 Ga0495582_0056914 3300046473 Bacteria 2155
1349 Ga0495582_0083908 3300046473 Bacteria 1770
1350 Ga0495605_0001125 3300046474 Bacteria 17767
1351 Ga0495605_0029999 3300046474 Bacteria 2792
1352 Ga0495639_0018609 3300046475 Bacteria 3026
1353 Ga0495639_0038886 3300046475 Bacteria 2137
1354 Ga0495664_0018484 3300046477 Bacteria 3995
1355 Ga0495584_0017031 3300046491 Bacteria 3704
1356 Ga0495584_0040860 3300046491 Bacteria 2341
1357 Ga0495584_0069962 3300046491 Bacteria 1763
1358 Ga0495585_0060670 3300046492 Bacteria 2081
1359 Ga0495594_0096669 3300046499 Bacteria 1659
1360 Ga0495594_0250500 3300046499 Bacteria 1009
1361 Ga0495596_0001244 3300046500 Bacteria 14824
1362 Ga0495583_0003335 3300046506 Bacteria 12418
1363 Ga0495583_0007472 3300046506 Bacteria 6854
1364 Ga0495583_0031542 3300046506 Bacteria 2568
1365 Ga0495583_0075780 3300046506 Bacteria 1471
1366 Ga0495606_0007939 3300046507 Bacteria 9349
1367 Ga0495606_0015733 3300046507 Bacteria 5809
1368 Ga0495606_0152013 3300046507 Bacteria 1358
1369 Ga0495608_0005730 3300046511 Bacteria 8865
1370 Ga0495608_0059291 3300046511 Bacteria 2522
1371 Ga0495610_0001332 3300046512 Bacteria 21933
1372 Ga0495610_0009568 3300046512 Bacteria 6112
1373 Ga0495610_0071087 3300046512 Bacteria 1623
1374 Ga0495610_0090370 3300046512 Bacteria 1389
1375 Ga0495616_0002253 3300046513 Bacteria 12909
1376 Ga0495616_0048733 3300046513 Bacteria 2126
1377 Ga0495618_0050931 3300046514 Bacteria 2616
1378 Ga0495618_0236487 3300046514 Bacteria 1149
1379 Ga0495620_0001081 3300046515 Bacteria 16662
1380 Ga0495620_0026465 3300046515 Bacteria 2728
1381 Ga0495628_0008183 3300046516 Bacteria 8992
1382 Ga0495628_0253991 3300046516 Bacteria 1311
1383 Ga0495630_0020974 3300046517 Bacteria 4823
1384 Ga0495630_0106023 3300046517 Bacteria 2128
1385 Ga0495631_0000589 3300046518 Bacteria 24095
1386 Ga0495631_0008142 3300046518 Bacteria 5292
1387 Ga0495632_0053727 3300046519 Bacteria 1977
1388 Ga0495637_0004897 3300046520 Bacteria 6893
1389 Ga0495643_0020848 3300046522 Bacteria 3771
1390 Ga0495648_0009825 3300046524 Bacteria 7354
1391 Ga0495648_0022823 3300046524 Bacteria 4297
1392 Ga0495648_0102298 3300046524 Bacteria 1578
1393 Ga0495663_0076584 3300046525 Bacteria 1072
1394 Ga0495642_0005361 3300046528 Bacteria 4918
1395 Ga0495652_0010377 3300046529 Bacteria 8442
1396 Ga0495652_0021029 3300046529 Bacteria 5800
1397 Ga0495652_0037153 3300046529 Bacteria 4227
1398 Ga0495654_0005300 3300046530 Bacteria 7518
1399 Ga0495654_0025422 3300046530 Bacteria 3050
1400 Ga0495654_0063047 3300046530 Bacteria 1776
1401 Ga0495665_0000612 3300046531 Bacteria 18163
1402 Ga0495665_0019635 3300046531 Bacteria 3635
1403 Ga0495665_0021631 3300046531 Bacteria 3457
1404 Ga0495640_0168370 3300046533 Bacteria 1401
1405 Ga0495586_0009675 3300046535 Bacteria 5133
1406 Ga0495587_0000911 3300046536 Bacteria 19535
1407 Ga0495587_0066254 3300046536 Bacteria 2107
1408 Ga0495598_0033446 3300046537 Bacteria 1460
1409 Ga0495598_0095558 3300046537 Bacteria 976
1410 Ga0495609_0000638 3300046538 Bacteria 27258
1411 Ga0495621_0002683 3300046539 Bacteria 4821
1412 Ga0495597_0000116 3300046542 Bacteria 72210
1413 Ga0495597_0000268 3300046542 Bacteria 47622
1414 Ga0495597_0005056 3300046542 Bacteria 7056
1415 Ga0495597_0010288 3300046542 Bacteria 4578
1416 Ga0495597_0082770 3300046542 Bacteria 1371
1417 Ga0495645_0002149 3300046543 Bacteria 13377
1418 Ga0495645_0013977 3300046543 Bacteria 5689
1419 Ga0495645_0116543 3300046543 Bacteria 1885
1420 Ga0495645_0126428 3300046543 Bacteria 1796
1421 Ga0495622_0020911 3300046557 Bacteria 3047
1422 Ga0495622_0068712 3300046557 Bacteria 1636
1423 Ga0495633_0004788 3300046558 Bacteria 8483
1424 Ga0495633_0019675 3300046558 Bacteria 3410
1425 Ga0495667_0003799 3300046559 Bacteria 10137
1426 Ga0495667_0090727 3300046559 Bacteria 1980
1427 Ga0495667_0099507 3300046559 Bacteria 1882
1428 Ga0495656_0002728 3300046615 Bacteria 5899
1429 Ga0495656_0008420 3300046615 Bacteria 3679
1430 Ga0495656_0172689 3300046615 Bacteria 1058
1431 Ga0495668_0047548 3300046616 Bacteria 2382
1432 Ga0495668_0150835 3300046616 Bacteria 1273
1433 Ga0495634_0232010 3300046642 Bacteria 1135
1434 Ga0495611_0012765 3300046648 Bacteria 3570
1435 Ga0495611_0081780 3300046648 Bacteria 1486
1436 Ga0495625_0001339 3300046660 Bacteria 30508
1437 Ga0495625_0008416 3300046660 Bacteria 8808
1438 Ga0495625_0057538 3300046660 Bacteria 2764
1439 Ga0495625_0134870 3300046660 Bacteria 1670
1440 Ga0495625_0187669 3300046660 Bacteria 1371
1441 Ga0495635_0010092 3300046663 Bacteria 6603
1442 Ga0495635_0033796 3300046663 Bacteria 3547
1443 Ga0495659_0011648 3300046664 Bacteria 2834
1444 Ga0495661_0050951 3300046665 Bacteria 2502
1445 Ga0495588_0014032 3300046674 Bacteria 3828
1446 Ga0495588_0049665 3300046674 Bacteria 2158
1447 Ga0495588_0082506 3300046674 Bacteria 1679
1448 Ga0495588_0245111 3300046674 Bacteria 945
1449 Ga0495657_0024016 3300046675 Bacteria 4348
1450 Ga0495657_0181205 3300046675 Bacteria 1293
1451 Ga0495599_0011662 3300046678 Bacteria 5407
1452 Ga0495599_0151313 3300046678 Bacteria 1437
1453 Ga0495623_0023846 3300046679 Bacteria 3947
1454 Ga0495623_0036194 3300046679 Bacteria 3163
1455 Ga0495623_0053265 3300046679 Bacteria 2555
1456 Ga0495646_0006008 3300046680 Bacteria 7696
1457 Ga0495646_0015480 3300046680 Bacteria 4839
1458 Ga0495646_0028518 3300046680 Bacteria 3494
1459 Ga0495647_0039540 3300046681 Bacteria 1788
1460 Ga0495658_0010276 3300046683 Bacteria 4681
1461 Ga0495658_0017275 3300046683 Bacteria 3724
1462 Ga0495658_0035696 3300046683 Bacteria 2738
1463 Ga0495658_0091110 3300046683 Bacteria 1805
1464 Ga0495613_0004559 3300046689 Bacteria 10393
1465 Ga0495613_0010190 3300046689 Bacteria 6982
1466 Ga0495613_0031127 3300046689 Bacteria 3963
1467 Ga0495613_0034682 3300046689 Bacteria 3747
1468 Ga0495613_0075962 3300046689 Bacteria 2446
1469 Ga0495624_0010363 3300046690 Bacteria 6422
1470 Ga0495624_0044611 3300046690 Bacteria 2826
1471 Ga0495670_0032094 3300046691 Bacteria 2611
1472 Ga0495670_0035154 3300046691 Bacteria 2496
1473 Ga0495670_0099230 3300046691 Bacteria 1498
1474 Ga0495670_0115320 3300046691 Bacteria 1393
1475 Ga0495671_0029873 3300046692 Bacteria 2795
1476 Ga0495649_0007039 3300046694 Bacteria 6924
1477 Ga0495649_0012076 3300046694 Bacteria 5039
1478 Ga0495649_0027776 3300046694 Bacteria 3138
1479 Ga0495649_0032739 3300046694 Bacteria 2862
1480 Ga0495649_0164652 3300046694 Bacteria 1162
1481 Ga0495589_0011570 3300046794 Bacteria 4581
1482 Ga0495589_0018414 3300046794 Bacteria 3580
1483 Ga0495600_0021667 3300046809 Bacteria 4119
1484 Ga0495600_0045959 3300046809 Bacteria 2849
1485 Ga0495600_0056973 3300046809 Bacteria 2553
1486 Ga0495600_0108390 3300046809 Bacteria 1809
1487 Ga0495600_0161621 3300046809 Bacteria 1448
1488 Ga0495660_0046843 3300046810 Bacteria 2370
1489 Ga0495581_0001747 3300047315 Bacteria 12126
1490 Ga0495581_0002351 3300047315 Bacteria 10667
1491 Ga0495604_0001863 3300047317 Bacteria 17177
1492 Ga0495604_0020790 3300047317 Bacteria 5240
1493 Ga0495674_0001578 3300047319 Bacteria 22344
1494 Ga0495674_0002056 3300047319 Bacteria 19727
1495 Ga0495674_0002205 3300047319 Bacteria 19149
1496 Ga0495674_0005323 3300047319 Bacteria 12343
1497 Ga0495674_0203242 3300047319 Bacteria 1643
1498 Ga0495674_0363455 3300047319 Bacteria 1173
1499 Ga0495674_0408047 3300047319 Bacteria 1096
1500 Ga0495672_0003207 3300047320 Bacteria 14219
1501 Ga0495672_0003446 3300047320 Bacteria 13529
1502 Ga0495672_0011051 3300047320 Bacteria 6394
1503 Ga0495672_0026030 3300047320 Bacteria 3737
1504 Ga0495672_0057541 3300047320 Bacteria 2257
1505 Ga0495672_0088939 3300047320 Bacteria 1701
1506 Ga0495676_0024655 3300047321 Bacteria 5203
1507 Ga0495676_0052608 3300047321 Bacteria 3249
1508 Ga0495676_0428655 3300047321 Bacteria 874
1509 Ga0495680_0007430 3300047322 Bacteria 10048
1510 Ga0495680_0016527 3300047322 Bacteria 6335
1511 Ga0495680_0028529 3300047322 Bacteria 4575
1512 Ga0495680_0040974 3300047322 Bacteria 3685
1513 Ga0495683_0002291 3300047323 Bacteria 11670
1514 Ga0495683_0019244 3300047323 Bacteria 3524
1515 Ga0495683_0096770 3300047323 Bacteria 1424
1516 Ga0495687_003219 3300047443 Bacteria 12089
1517 Ga0495675_0053087 3300047444 Bacteria 2573
1518 Ga0495677_0005821 3300047445 Bacteria 4665
1519 Ga0495673_0020505 3300047469 Bacteria 3289
1520 Ga0495673_0083582 3300047469 Bacteria 1317
1521 Ga0495684_0011986 3300047471 Bacteria 6684
1522 Ga0495684_0015752 3300047471 Bacteria 5817
1523 Ga0495684_0210709 3300047471 Bacteria 1429
1524 Ga0495593_0003668 3300047673 Bacteria 9166
1525 Ga0495593_0014086 3300047673 Bacteria 4551
1526 Ga0495593_0026716 3300047673 Bacteria 3184
1527 Ga0495593_0050189 3300047673 Bacteria 2211
1528 Ga0495602_0012427 3300048088 Bacteria 8754
1529 Ga0495602_0013432 3300048088 Bacteria 8370
1530 Ga0495602_0030864 3300048088 Bacteria 5076
1531 Ga0495602_0040234 3300048088 Bacteria 4291
1532 Ga0495602_0151047 3300048088 Bacteria 1826
1533 Ga0495614_0002409 3300048089 Bacteria 8314
1534 Ga0495614_0003269 3300048089 Bacteria 7242
1535 Ga0495614_0039818 3300048089 Bacteria 2017
1536 Ga0495614_0122828 3300048089 Bacteria 1146
1537 Ga0495615_0006944 3300048090 Bacteria 2126
1538 Ga0495626_0011832 3300048091 Bacteria 4596
1539 Ga0495626_0026060 3300048091 Bacteria 2853
1540 Ga0496100_0002293 3300048903 Bacteria 9676
1541 Ga0496100_0013989 3300048903 Bacteria 4646
1542 Ga0496100_0046783 3300048903 Bacteria 2784
1543 Ga0496100_0176376 3300048903 Bacteria 1543
1544 Ga0496101_0003592 3300048904 Bacteria 9679
1545 Ga0496101_0040730 3300048904 Bacteria 3309
1546 Ga0496101_0113226 3300048904 Bacteria 2044
1547 Ga0496101_0159102 3300048904 Bacteria 1732
1548 Ga0496101_0245487 3300048904 Bacteria 1394
1549 Ga0496102_0005918 3300048905 Bacteria 10413
1550 Ga0496102_0016898 3300048905 Bacteria 6385
1551 Ga0496102_0273735 3300048905 Bacteria 1592
1552 Ga0496103_0002596 3300048906 Bacteria 11311
1553 Ga0496103_0006318 3300048906 Bacteria 7084
1554 Ga0496103_0053072 3300048906 Bacteria 2512
1555 Ga0496103_0071606 3300048906 Bacteria 2170
1556 Ga0496104_0006365 3300048907 Bacteria 10386
1557 Ga0496104_0012609 3300048907 Bacteria 7607
1558 Ga0496104_0013003 3300048907 Bacteria 7494
1559 Ga0496104_0015712 3300048907 Bacteria 6866
1560 Ga0496104_0059727 3300048907 Bacteria 3610
1561 Ga0496104_0129718 3300048907 Bacteria 2421
1562 Ga0496104_0210022 3300048907 Bacteria 1858
1563 Ga0496104_0226187 3300048907 Bacteria 1783
1564 Ga0496104_0605812 3300048907 Bacteria 1005
1565 Ga0496105_0001841 3300048908 Bacteria 15201
1566 Ga0496105_0004700 3300048908 Bacteria 10297
1567 Ga0496105_0029729 3300048908 Bacteria 4473
1568 Ga0496105_0265993 3300048908 Bacteria 1386
1569 Ga0496106_0011982 3300048909 Bacteria 6398
1570 Ga0496106_0022766 3300048909 Bacteria 4655
1571 Ga0496106_0066727 3300048909 Bacteria 2741
1572 Ga0496106_0192365 3300048909 Bacteria 1623
1573 Ga0496106_0253620 3300048909 Bacteria 1407
1574 Ga0496107_0028075 3300048910 Bacteria 3998
1575 Ga0496107_0052544 3300048910 Bacteria 2939
1576 Ga0496107_0194657 3300048910 Bacteria 1507
1577 Ga0496108_0008415 3300048911 Bacteria 8373
1578 Ga0496108_0020388 3300048911 Bacteria 5450
1579 Ga0496108_0173537 3300048911 Bacteria 1866
1580 Ga0496109_0000488 3300048912 Bacteria 33914
1581 Ga0496109_0030918 3300048912 Bacteria 4801
1582 Ga0496109_0089960 3300048912 Bacteria 2839
1583 Ga0496109_0094897 3300048912 Bacteria 2761
1584 Ga0496109_0151258 3300048912 Bacteria 2173
1585 Ga0496110_0011628 3300048913 Bacteria 7216
1586 Ga0496110_0039591 3300048913 Bacteria 4105
1587 Ga0496110_0163165 3300048913 Bacteria 2020
1588 Ga0496110_0189532 3300048913 Bacteria 1868
1589 Ga0496110_0264582 3300048913 Bacteria 1565
1590 Ga0496110_0374126 3300048913 Bacteria 1298
1591 Ga0496111_0014962 3300048914 Bacteria 5315
1592 Ga0496111_0219626 3300048914 Bacteria 1412
1593 Ga0496112_0008342 3300048915 Bacteria 9275
1594 Ga0496112_0175434 3300048915 Bacteria 2108
1595 Ga0496112_0189155 3300048915 Bacteria 2021
1596 Ga0496112_0418747 3300048915 Bacteria 1278
1597 Ga0496112_0480506 3300048915 Bacteria 1179
1598 Ga0496113_0022983 3300048916 Bacteria 4418
1599 Ga0496113_0109824 3300048916 Bacteria 2145
1600 Ga0496113_0262484 3300048916 Bacteria 1380
1601 Ga0496114_0004834 3300048917 Bacteria 10496
1602 Ga0496114_0011440 3300048917 Bacteria 7091
1603 Ga0496114_0030392 3300048917 Bacteria 4444
1604 Ga0496114_0134938 3300048917 Bacteria 2134
1605 Ga0496114_0333219 3300048917 Bacteria 1342
1606 Ga0496114_0546153 3300048917 Bacteria 1024
1607 Ga0496115_0019198 3300048918 Bacteria 5259
1608 Ga0496115_0042078 3300048918 Bacteria 3639
1609 Ga0496116_0002454 3300048919 Bacteria 19457
1610 Ga0496116_0022481 3300048919 Bacteria 4723
1611 Ga0496116_0027209 3300048919 Bacteria 4166
1612 Ga0496116_0032935 3300048919 Bacteria 3686
1613 Ga0496117_0000005 3300048920 Bacteria 777468
1614 Ga0496117_0000105 3300048920 Bacteria 188970
1615 Ga0496117_0020434 3300048920 Bacteria 5398
1616 Ga0496117_0083704 3300048920 Bacteria 2084
1617 Ga0496118_0000022 3300048921 Bacteria 438602
1618 Ga0496118_0004662 3300048921 Bacteria 16079
1619 Ga0496118_0089002 3300048921 Bacteria 2133
1620 Ga0496118_0107375 3300048921 Bacteria 1864
1621 Ga0496121_0000511 3300048924 Bacteria 73863
1622 Ga0496121_0005938 3300048924 Bacteria 15445
1623 Ga0496121_0010809 3300048924 Bacteria 10222
1624 Ga0496121_0012354 3300048924 Bacteria 9334
1625 Ga0496121_0041760 3300048924 Bacteria 4003
1626 Ga0496121_0171540 3300048924 Bacteria 1575
1627 Ga0496122_0000342 3300048925 Bacteria 100753
1628 Ga0496122_0002912 3300048925 Bacteria 23381
1629 Ga0496122_0025741 3300048925 Bacteria 5097
1630 Ga0496122_0029962 3300048925 Bacteria 4572
1631 Ga0496122_0058371 3300048925 Bacteria 2857
1632 Ga0496122_0146357 3300048925 Bacteria 1467
1633 Ga0496123_0000057 3300048926 Bacteria 228608
1634 Ga0496123_0002872 3300048926 Bacteria 20237
1635 Ga0496123_0055606 3300048926 Bacteria 2594
1636 Ga0496124_0043856 3300048927 Bacteria 3841
1637 Ga0496124_0127138 3300048927 Bacteria 2029
1638 Ga0496124_0157093 3300048927 Bacteria 1777
1639 Ga0496125_0001605 3300048928 Bacteria 31945
1640 Ga0496125_0009940 3300048928 Bacteria 9672
1641 Ga0496125_0011221 3300048928 Bacteria 8981
1642 Ga0496125_0045201 3300048928 Bacteria 3710
1643 Ga0496125_0048499 3300048928 Bacteria 3540
1644 Ga0496125_0055066 3300048928 Bacteria 3244
1645 Ga0496125_0111121 3300048928 Bacteria 1984
1646 Ga0496126_0148492 3300048929 Bacteria 2011
1647 Ga0496126_0330767 3300048929 Bacteria 1250
1648 Ga0495678_023009 3300049459 Bacteria 2716
1649 Ga0495682_0036496 3300049460 Bacteria 1810
1650 Ga0501031_0098741 3300049568 Bacteria 1905
1651 Ga0501032_0016838 3300049569 Bacteria 5136
1652 Ga0501033_0000318 3300049570 Bacteria 45707
1653 Ga0501033_0008248 3300049570 Bacteria 8065
1654 Ga0501033_0035836 3300049570 Bacteria 3719
1655 Ga0501033_0042576 3300049570 Bacteria 3385
1656 Ga0501034_0000067 3300049571 Bacteria 184398
1657 Ga0501034_0000423 3300049571 Bacteria 70979
1658 Ga0501034_0000516 3300049571 Bacteria 62005
1659 Ga0501034_0012327 3300049571 Bacteria 8831
1660 Ga0501034_0026019 3300049571 Bacteria 5960
1661 Ga0501034_0137086 3300049571 Bacteria 2428
1662 Ga0501034_0144539 3300049571 Bacteria 2356
1663 Ga0501036_0049064 3300049572 Bacteria 3574
1664 Ga0501036_0105363 3300049572 Bacteria 2385
1665 Ga0501036_0236317 3300049572 Bacteria 1533
1666 Ga0501036_0475565 3300049572 Bacteria 1040
1667 Ga0501037_0000136 3300049573 Bacteria 68536
1668 Ga0501038_0035538 3300049574 Bacteria 4374
1669 Ga0501038_0070876 3300049574 Bacteria 2958
1670 Ga0501039_0078580 3300049575 Bacteria 2567
1671 Ga0501039_0344861 3300049575 Bacteria 1170
1672 Ga0501040_0000097 3300049576 Bacteria 43974
1673 Ga0501040_0007189 3300049576 Bacteria 7210
1674 Ga0501040_0013223 3300049576 Bacteria 5428
1675 Ga0501040_0060122 3300049576 Bacteria 2611
1676 Ga0501040_0222903 3300049576 Bacteria 1342
1677 Ga0501041_0002429 3300049577 Bacteria 10567
1678 Ga0501041_0004393 3300049577 Bacteria 8160
1679 Ga0501041_0011279 3300049577 Bacteria 5283
1680 Ga0501041_0105269 3300049577 Bacteria 1748
1681 Ga0501042_0000054 3300049578 Bacteria 40211
1682 Ga0501042_0001617 3300049578 Bacteria 13402
1683 Ga0501042_0087488 3300049578 Bacteria 2235
1684 Ga0501042_0089192 3300049578 Bacteria 2213
1685 Ga0501042_0114618 3300049578 Bacteria 1941
1686 Ga0501043_0000006 3300049579 Bacteria 234413
1687 Ga0501043_0037239 3300049579 Bacteria 3826
1688 Ga0501043_0076715 3300049579 Bacteria 2626
1689 Ga0501043_0503752 3300049579 Bacteria 904
1690 Ga0501046_0000221 3300049580 Bacteria 59296
1691 Ga0501046_0046978 3300049580 Bacteria 3425
1692 Ga0501046_0080662 3300049580 Bacteria 2514
1693 Ga0501047_0005589 3300049581 Bacteria 11838
1694 Ga0501047_0014025 3300049581 Bacteria 7615
1695 Ga0501047_0055700 3300049581 Bacteria 3823
1696 Ga0501047_0129283 3300049581 Bacteria 2406
1697 Ga0501047_0198610 3300049581 Bacteria 1867
1698 Ga0501047_0456691 3300049581 Bacteria 1106
1699 Ga0501048_0023635 3300049582 Bacteria 4491
1700 Ga0501048_0224488 3300049582 Bacteria 1333
1701 Ga0501067_0012440 3300049583 Bacteria 4721
1702 Ga0501067_0288806 3300049583 Bacteria 913
1703 Ga0501068_0028661 3300049584 Bacteria 3294
1704 Ga0501068_0038398 3300049584 Bacteria 2869
1705 Ga0501069_0000024 3300049585 Bacteria 117140
1706 Ga0501069_0008395 3300049585 Bacteria 5426
1707 Ga0501069_0037849 3300049585 Bacteria 2662
1708 Ga0501069_0074531 3300049585 Bacteria 1904
1709 Ga0501070_0000093 3300049586 Bacteria 76623
1710 Ga0501070_0001707 3300049586 Bacteria 19484
1711 Ga0501070_0003776 3300049586 Bacteria 13081
1712 Ga0501070_0004270 3300049586 Bacteria 12288
1713 Ga0501070_0142156 3300049586 Bacteria 1981
1714 Ga0501070_0163546 3300049586 Bacteria 1834
1715 Ga0501071_0014312 3300049587 Bacteria 5426
1716 Ga0501071_0037623 3300049587 Bacteria 3455
1717 Ga0501071_0043546 3300049587 Bacteria 3219
1718 Ga0501072_0005845 3300049588 Bacteria 9375
1719 Ga0501072_0023240 3300049588 Bacteria 4814
1720 Ga0501073_0011759 3300049589 Bacteria 6391
1721 Ga0501073_0016103 3300049589 Bacteria 5420
1722 Ga0501073_0045453 3300049589 Bacteria 3092
1723 Ga0501074_0001523 3300049590 Bacteria 15668
1724 Ga0501074_0004672 3300049590 Bacteria 9810
1725 Ga0501074_0007470 3300049590 Bacteria 7904
1726 Ga0501075_0007289 3300049591 Bacteria 7670
1727 Ga0501075_0009385 3300049591 Bacteria 6844
1728 Ga0501075_0100865 3300049591 Bacteria 2192
1729 Ga0501075_0291105 3300049591 Bacteria 1244
1730 Ga0501076_0002094 3300049592 Bacteria 13687
1731 Ga0501076_0004801 3300049592 Bacteria 9647
1732 Ga0501076_0056115 3300049592 Bacteria 3125
1733 Ga0501077_0004048 3300049593 Bacteria 8852
1734 Ga0501077_0013437 3300049593 Bacteria 5135
1735 Ga0501077_0015498 3300049593 Bacteria 4799
1736 Ga0501249_002446 3300049679 Bacteria 3753
1737 Ga0501079_0000054 3300049741 Bacteria 51028
1738 Ga0501079_0002815 3300049741 Bacteria 12686
1739 Ga0501079_0022471 3300049741 Bacteria 4837
1740 Ga0501080_0001346 3300049742 Bacteria 20520
1741 Ga0501080_0011055 3300049742 Bacteria 8260
1742 Ga0501080_0038346 3300049742 Bacteria 4473
1743 Ga0501080_0048499 3300049742 Bacteria 3953
1744 Ga0501080_0167951 3300049742 Bacteria 2024
1745 Ga0501080_0232814 3300049742 Bacteria 1683
1746 Ga0501080_0342006 3300049742 Bacteria 1352
1747 Ga0501080_0375523 3300049742 Bacteria 1281
1748 Ga0501081_0001342 3300049743 Bacteria 15013
1749 Ga0501081_0025641 3300049743 Bacteria 3968
1750 Ga0501081_0058602 3300049743 Bacteria 2665
1751 Ga0501083_0000097 3300049744 Bacteria 59474
1752 Ga0501083_0008220 3300049744 Bacteria 7378
1753 Ga0501083_0023124 3300049744 Bacteria 4312
1754 Ga0501262_000184 3300049759 Bacteria 7786
1755 Ga0501035_0000068 3300049822 Bacteria 128392
1756 Ga0501035_0001129 3300049822 Bacteria 27882
1757 Ga0501035_0006366 3300049822 Bacteria 11103
1758 Ga0501035_0008638 3300049822 Bacteria 9482
1759 Ga0501035_0015071 3300049822 Bacteria 7132
1760 Ga0501035_0047639 3300049822 Bacteria 3846
1761 Ga0501035_0112108 3300049822 Bacteria 2390
1762 Ga0501035_0122409 3300049822 Bacteria 2273
1763 Ga0501044_0000084 3300049823 Bacteria 114544
1764 Ga0501044_0000096 3300049823 Bacteria 109532
1765 Ga0501044_0015238 3300049823 Bacteria 8281
1766 Ga0501044_0016109 3300049823 Bacteria 8036
1767 Ga0501044_0017784 3300049823 Bacteria 7625
1768 Ga0501044_0078478 3300049823 Bacteria 3346
1769 Ga0501044_0114010 3300049823 Bacteria 2709
1770 Ga0501044_0615659 3300049823 Bacteria 978
1771 Ga0501045_0000766 3300049824 Bacteria 20598
1772 Ga0501045_0028180 3300049824 Bacteria 4051
1773 Ga0501045_0031830 3300049824 Bacteria 3820
1774 Ga0501045_0090040 3300049824 Bacteria 2267
1775 nmdc:mga03683_11_c1 3300050489 Bacteria 120565
1776 nmdc:mga03683_29395_c1 3300050489 Bacteria 2191
1777 nmdc:mga03683_44378_c1 3300050489 Bacteria 1837
1778 nmdc:mga03n38_18256_c1 3300050490 Bacteria 2766
1779 nmdc:mga03n38_1_c1 3300050490 Bacteria 91975
1780 nmdc:mga03n38_22503_c1 3300050490 Bacteria 2552
1781 nmdc:mga00v17_1_c1 3300050491 Bacteria 292294
1782 nmdc:mga00v17_2288_c1 3300050491 Bacteria 9831
1783 nmdc:mga00v17_48740_c1 3300050491 Bacteria 2568
1784 nmdc:mga0yw44_10209_c1 3300050492 Bacteria 4788
1785 nmdc:mga0yw44_61_c1 3300050492 Bacteria 34409
1786 nmdc:mga0k408_1033_c1 3300050493 Bacteria 15290
1787 nmdc:mga0k408_41530_c1 3300050493 Bacteria 2648
1788 nmdc:mga06z11_50492_c1 3300050494 Bacteria 2126
1789 nmdc:mga06z11_6052_c1 3300050494 Bacteria 4894
1790 nmdc:mga06z11_800_c1 3300050494 Bacteria 11496
1791 nmdc:mga04h51_245_c1 3300050495 Bacteria 14216
1792 nmdc:mga07m45_408_c1 3300050496 Bacteria 7392
1793 nmdc:mga07m45_4403_c2 3300050496 Bacteria 3027
1794 nmdc:mga07m45_447_c1 3300050496 Bacteria 17238
1795 nmdc:mga07m45_49601_c1 3300050496 Bacteria 1274
1796 nmdc:mga07m45_59826_c1 3300050496 Bacteria 2155
1797 nmdc:mga07m45_73_c1 3300050496 Bacteria 25931
1798 nmdc:mga05p37_19161_c1 3300050507 Bacteria 8276
1799 nmdc:mga05p37_246876_c1 3300050507 Bacteria 2143
1800 nmdc:mga05p37_251472_c1 3300050507 Bacteria 2120
1801 nmdc:mga05p37_3855_c1 3300050507 Bacteria 17548
1802 nmdc:mga05p37_38812_c1 3300050507 Bacteria 5843
1803 nmdc:mga05p37_45113_c1 3300050507 Bacteria 5423
1804 nmdc:mga05p37_51739_c1 3300050507 Bacteria 5050
1805 nmdc:mga05p37_6370_c1 3300050507 Bacteria 13904
1806 nmdc:mga05p37_877695_c1 3300050507 Bacteria 970
1807 nmdc:mga09592_1525_c1 3300050508 Bacteria 18665
1808 nmdc:mga09592_44489_c1 3300050508 Bacteria 3738
1809 nmdc:mga09592_797_c1 3300050508 Bacteria 24389
1810 nmdc:mga0qj67_130126_c1 3300050509 Bacteria 2038
1811 nmdc:mga0qj67_1874_c1 3300050509 Bacteria 14910
1812 nmdc:mga0qj67_201182_c1 3300050509 Bacteria 1618
1813 nmdc:mga0qj67_232546_c1 3300050509 Bacteria 1496
1814 nmdc:mga0qj67_379714_c1 3300050509 Bacteria 1141
1815 nmdc:mga06r32_148638_c1 3300050510 Bacteria 2320
1816 nmdc:mga06r32_1637_c1 3300050510 Bacteria 20211
1817 nmdc:mga06r32_200246_c1 3300050510 Bacteria 1985
1818 nmdc:mga06r32_2962_c1 3300050510 Bacteria 12463
1819 nmdc:mga06r32_30241_c1 3300050510 Bacteria 5082
1820 nmdc:mga06r32_543_c1 3300050510 Bacteria 32734
1821 nmdc:mga06r32_61287_c1 3300050510 Bacteria 3621
1822 nmdc:mga06r32_62871_c1 3300050510 Bacteria 3577
1823 nmdc:mga06r32_639325_c1 3300050510 Bacteria 1033
1824 nmdc:mga06r32_759070_c1 3300050510 Bacteria 933
1825 nmdc:mga08y16_1196_c1 3300050511 Bacteria 25597
1826 nmdc:mga08y16_176140_c1 3300050511 Bacteria 2221
1827 nmdc:mga08y16_268513_c1 3300050511 Bacteria 1761
1828 nmdc:mga08y16_282920_c1 3300050511 Bacteria 1710
1829 nmdc:mga08y16_287910_c1 3300050511 Bacteria 1694
1830 nmdc:mga08y16_326820_c1 3300050511 Bacteria 1578
1831 nmdc:mga08y16_349639_c1 3300050511 Bacteria 1519
1832 nmdc:mga08y16_35524_c1 3300050511 Bacteria 5234
1833 nmdc:mga08y16_6264_c1 3300050511 Bacteria 12472
1834 nmdc:mga08y16_6269_c1 3300050511 Bacteria 12468
1835 nmdc:mga08y16_95139_c1 3300050511 Bacteria 3103
1836 nmdc:mga0n895_103852_c1 3300050512 Bacteria 2854
1837 nmdc:mga0n895_10962_c1 3300050512 Bacteria 8056
1838 nmdc:mga0n895_2213_c1 3300050512 Bacteria 15039
1839 nmdc:mga0n895_2422_c1 3300050512 Bacteria 14549
1840 nmdc:mga0n895_480965_c1 3300050512 Bacteria 1252
1841 nmdc:mga0n895_54879_c1 3300050512 Bacteria 3920
1842 nmdc:mga0n895_668_c1 3300050512 Bacteria 24028
1843 nmdc:mga0n895_90961_c1 3300050512 Bacteria 3053
1844 nmdc:mga0rr50_148687_c1 3300050513 Bacteria 1891
1845 nmdc:mga0rr50_2496_c1 3300050513 Bacteria 10402
1846 nmdc:mga0rr50_331294_c1 3300050513 Bacteria 1278
1847 nmdc:mga0rr50_43903_c1 3300050513 Bacteria 3275
1848 nmdc:mga08x19_288458_c1 3300050514 Bacteria 1138
1849 nmdc:mga08x19_3746_c1 3300050514 Bacteria 9052
1850 nmdc:mga08x19_52786_c1 3300050514 Bacteria 2615
1851 nmdc:mga08x19_550_c1 3300050514 Bacteria 24591
1852 nmdc:mga08x19_55517_c1 3300050514 Bacteria 2553
1853 nmdc:mga08x19_6928_c1 3300050514 Bacteria 6732
1854 nmdc:mga08x19_98851_c1 3300050514 Bacteria 1934
1855 nmdc:mga0a205_10565_c1 3300050515 Bacteria 8483
1856 nmdc:mga0a205_16908_c1 3300050515 Bacteria 6829
1857 nmdc:mga0a205_211454_c1 3300050515 Bacteria 1828
1858 nmdc:mga0a205_26496_c1 3300050515 Bacteria 5530
1859 nmdc:mga0a205_32349_c1 3300050515 Bacteria 5016
1860 nmdc:mga0a205_34820_c1 3300050515 Bacteria 4833
1861 nmdc:mga0a205_584_c1 3300050515 Bacteria 28859
1862 nmdc:mga0a205_68159_c1 3300050515 Bacteria 3436
1863 nmdc:mga0a205_7303_c1 3300050515 Bacteria 9995
1864 nmdc:mga0a205_89630_c1 3300050515 Bacteria 2973
1865 nmdc:mga0a205_9995_c1 3300050515 Bacteria 8706
1866 nmdc:mga0sz30_121302_c1 3300050516 Bacteria 1149
1867 nmdc:mga0sz30_26045_c1 3300050516 Bacteria 2395
1868 nmdc:mga0sz30_5_c1 3300050516 Bacteria 189060
1869 nmdc:mga0sz30_89117_c1 3300050516 Bacteria 1341
1870 Ga0495601_0108249 3300053077 Bacteria 1798
1871 Ga0495612_0003957 3300053078 Bacteria 6150
1872 Ga0500610_0000402 3300053079 Bacteria 13215
1873 Ga0495595_0000244 3300053084 Bacteria 21433
1874 Ga0495595_0038397 3300053084 Bacteria 2181
1875 Ga0495619_0006093 3300053085 Bacteria 7635
1876 Ga0495619_0061218 3300053085 Bacteria 2504
1877 Ga0500578_0047317 3300053086 Bacteria 2760
1878 Ga0500643_010551 3300053087 Bacteria 3426
1879 Ga0500644_0003444 3300053088 Bacteria 3912
1880 Ga0500646_0029413 3300053090 Bacteria 1504
1881 Ga0500651_0000164 3300053093 Bacteria 42896
1882 Ga0500651_0089158 3300053093 Bacteria 1901
1883 Ga0500566_0005587 3300053094 Bacteria 7469
1884 Ga0500641_0020853 3300053096 Bacteria 2490
1885 Ga0500641_0049599 3300053096 Bacteria 1722
1886 Ga0500650_0029685 3300053098 Bacteria 2475
1887 Ga0500556_0000004 3300053104 Bacteria 666287
1888 Ga0500557_003445 3300053105 Bacteria 3142
1889 Ga0500560_001919 3300053107 Bacteria 3808
1890 Ga0500569_016797 3300053109 Bacteria 1861
1891 Ga0500571_045129 3300053110 Bacteria 2345
1892 Ga0500572_000095 3300053111 Bacteria 28917
1893 Ga0500572_001864 3300053111 Bacteria 5337
1894 Ga0500594_0004273 3300053118 Bacteria 3152
1895 Ga0500595_013922 3300053119 Bacteria 3067
1896 Ga0500607_000307 3300053121 Bacteria 46367
1897 Ga0500607_025574 3300053121 Bacteria 3284
1898 Ga0500608_001229 3300053122 Bacteria 9146
1899 Ga0500608_003410 3300053122 Bacteria 5953
1900 Ga0500608_075018 3300053122 Bacteria 1604
1901 Ga0500618_001780 3300053125 Bacteria 9105
1902 Ga0500642_0000186 3300053130 Bacteria 25633
1903 Ga0500642_0012991 3300053130 Bacteria 3043
1904 Ga0500658_0000132 3300053134 Bacteria 35240
1905 Ga0500658_0003190 3300053134 Bacteria 6248
1906 Ga0500658_0070848 3300053134 Bacteria 1470
1907 Ga0500559_0000067 3300053136 Bacteria 83330
1908 Ga0500559_0000298 3300053136 Bacteria 38374
1909 Ga0500559_0021198 3300053136 Bacteria 2752
1910 Ga0500561_0000180 3300053137 Bacteria 11594
1911 Ga0500568_0000269 3300053139 Bacteria 44003
1912 Ga0500568_0000447 3300053139 Bacteria 31023
1913 Ga0500568_0001151 3300053139 Bacteria 17695
1914 Ga0500568_0001430 3300053139 Bacteria 15482
1915 Ga0500568_0007916 3300053139 Bacteria 5170
1916 Ga0500574_000961 3300053141 Bacteria 4022
1917 Ga0500577_0064643 3300053142 Bacteria 1417
1918 Ga0500586_004477 3300053145 Bacteria 3428
1919 Ga0500590_135140 3300053148 Bacteria 1135
1920 Ga0500604_0053435 3300053151 Bacteria 1252
1921 Ga0500616_0000014 3300053153 Bacteria 637918
1922 Ga0500616_0000931 3300053153 Bacteria 32000
1923 Ga0500616_0042090 3300053153 Bacteria 2447
1924 Ga0500616_0150462 3300053153 Bacteria 1078
1925 Ga0500622_0000513 3300053156 Bacteria 35999
1926 Ga0500622_0002182 3300053156 Bacteria 14471
1927 Ga0500624_006778 3300053157 Bacteria 1558
1928 Ga0500633_0067692 3300053160 Bacteria 1270
1929 Ga0500634_0006941 3300053161 Bacteria 5532
1930 Ga0500634_0045881 3300053161 Bacteria 2363
1931 Ga0500634_0151615 3300053161 Bacteria 1083
1932 Ga0500639_019482 3300053163 Bacteria 3581
1933 Ga0500636_0000163 3300053177 Bacteria 34947
1934 Ga0500636_0020857 3300053177 Bacteria 3878
1935 Ga0500645_001533 3300053730 Bacteria 11552
1936 Ga0500645_002397 3300053730 Bacteria 8411
1937 Ga0500645_016490 3300053730 Bacteria 2325
1938 Ga0500645_034041 3300053730 Bacteria 1522
1939 Ga0501084_0002533 3300054114 Bacteria 14728
1940 Ga0501084_0005314 3300054114 Bacteria 10543
1941 Ga0501084_0006726 3300054114 Bacteria 9450
1942 Ga0501084_0013576 3300054114 Bacteria 6740
1943 Ga0501084_0071275 3300054114 Bacteria 2910
1944 Ga0501084_0075593 3300054114 Bacteria 2822
1945 Ga0501084_0283140 3300054114 Bacteria 1400
1946 Ga0501084_0314889 3300054114 Bacteria 1322
1947 Ga0500661_016256 3300055283 Bacteria 1331
1948 Ga0590075_028269 3300059424 Bacteria 1416
1949 Ga0501082_0000389 3300060353 Bacteria 38981
1950 Ga0501082_0001815 3300060353 Bacteria 18801
1951 Ga0501082_0023411 3300060353 Bacteria 5328
1952 Ga0501082_0117115 3300060353 Bacteria 2308
1953 Ga0501082_0352999 3300060353 Bacteria 1282
1954 Ga0530510_0005953 3300061734 Bacteria 8458
1955 Ga0530510_0019782 3300061734 Bacteria 4783
1956 Ga0530510_0080989 3300061734 Bacteria 2363

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050512 nmdc:mga0n895_54879_c1 nmdc:mga0n895_54879_c1_1666_2532 232
2 3300014325 Ga0163163_10237660 Ga0163163_102376602 235
3 3300025315 Ga0207697_10027556 Ga0207697_100275561 236
4 3300013308 Ga0157375_10092120 Ga0157375_100921203 240
5 3300031251 Ga0265327_10000425 Ga0265327_1000042531 241
6 3300049577 Ga0501041_0105269 Ga0501041_0105269_1010_1738 242
7 3300037068 Ga0373925_0079858 Ga0373925_0079858_449_1381 243
8 3300048924 Ga0496121_0010809 Ga0496121_0010809_6376_7230 243
9 3300035114 Ga0373939_0154864 Ga0373939_0154864_93_827 244
10 3300046660 Ga0495625_0134870 Ga0495625_0134870_23_757 244
11 3300049742 Ga0501080_0342006 Ga0501080_0342006_595_1329 244
12 3300049742 Ga0501080_0375523 Ga0501080_0375523_537_1271 244
13 3300050496 nmdc:mga07m45_49601_c1 nmdc:mga07m45_49601_c1_517_1251 244
14 3300009147 Ga0114129_10736463 Ga0114129_107364632 246
15 3300025916 Ga0207663_10081072 Ga0207663_100810722 246
16 3300031838 Ga0307518_10003759 Ga0307518_100037596 246
17 3300049571 Ga0501034_0000423 Ga0501034_0000423_69886_70770 246
18 3300037466 Ga0395898_0012009 Ga0395898_0012009_3588_4463 248
19 3300038443 Ga0395901_0019056 Ga0395901_0019056_1684_2559 248
20 3300013100 Ga0157373_10000499 Ga0157373_1000049927 249
21 3300031731 Ga0307405_10104581 Ga0307405_101045812 249
22 3300031911 Ga0307412_10023576 Ga0307412_100235764 249
23 3300032004 Ga0307414_10060819 Ga0307414_100608192 249
24 3300044901 Ga0466960_0078530 Ga0466960_0078530_67_942 249
25 3300046557 Ga0495622_0020911 Ga0495622_0020911_1039_1923 249
26 3300046558 Ga0495633_0004788 Ga0495633_0004788_4520_5404 249
27 3300005347 Ga0070668_100159247 Ga0070668_1001592472 250
28 3300005471 Ga0070698_100011760 Ga0070698_1000117608 250
29 3300005536 Ga0070697_100240935 Ga0070697_1002409352 250
30 3300005543 Ga0070672_100079516 Ga0070672_1000795163 250
31 3300014497 Ga0182008_10000923 Ga0182008_100009234 250
32 3300015261 Ga0182006_1000007 Ga0182006_1000007295 250
33 3300015262 Ga0182007_10000022 Ga0182007_1000002244 250
34 3300015265 Ga0182005_1000010 Ga0182005_1000010275 250
35 3300046615 Ga0495656_0002728 Ga0495656_0002728_688_1563 250
36 3300048919 Ga0496116_0032935 Ga0496116_0032935_2564_3448 250
37 3300048920 Ga0496117_0000005 Ga0496117_0000005_142253_143137 250
38 3300048921 Ga0496118_0000022 Ga0496118_0000022_295466_296350 250
39 3300048924 Ga0496121_0012354 Ga0496121_0012354_2954_3838 250
40 3300048925 Ga0496122_0002912 Ga0496122_0002912_5958_6842 250
41 3300048926 Ga0496123_0002872 Ga0496123_0002872_8859_9743 250
42 3300048928 Ga0496125_0045201 Ga0496125_0045201_118_1002 250
43 3300003659 JGI25404J52841_10007519 JGI25404J52841_100075192 251
44 3300005983 Ga0081540_1000283 Ga0081540_100028334 251
45 3300028794 Ga0307515_10000195 Ga0307515_1000019578 252
46 3300039437 Ga0436365_1630009 Ga0436365_1630009_2577_3383 252
47 3300046615 Ga0495656_0172689 Ga0495656_0172689_121_990 253
48 3300003187 JGI25151J46595_10001132 JGI25151J46595_100011323 254
49 3300006846 Ga0075430_100231916 Ga0075430_1002319162 254
50 3300006847 Ga0075431_100031754 Ga0075431_1000317545 254
51 3300025294 Ga0209025_1001724 Ga0209025_100172411 254
52 3300049575 Ga0501039_0344861 Ga0501039_0344861_19_891 254
53 3300049587 Ga0501071_0043546 Ga0501071_0043546_869_1741 254
54 3300049588 Ga0501072_0023240 Ga0501072_0023240_822_1694 254
55 3300049593 Ga0501077_0013437 Ga0501077_0013437_2132_3004 254
56 3300049742 Ga0501080_0048499 Ga0501080_0048499_1584_2456 254
57 3300049743 Ga0501081_0001342 Ga0501081_0001342_2165_3037 254
58 3300050510 nmdc:mga06r32_30241_c1 nmdc:mga06r32_30241_c1_1898_2776 254
59 3300054114 Ga0501084_0006726 Ga0501084_0006726_1217_2089 254
60 3300006048 Ga0075363_100016970 Ga0075363_1000169703 256
61 3300013100 Ga0157373_10040644 Ga0157373_100406443 256
62 3300025909 Ga0207705_10147049 Ga0207705_101470492 256
63 3300041511 Ga0451855_0956808 Ga0451855_0956808_192_965 257
64 3300044673 Ga0453683_0000062 Ga0453683_0000062_42325_43230 257
65 3300048927 Ga0496124_0157093 Ga0496124_0157093_873_1748 257
66 3300003578 Ga0006562J51391_1033002 Ga0006562J51391_10330024 258
67 3300044673 Ga0453683_0000034 Ga0453683_0000034_174878_175843 258
68 3300044712 Ga0453684_0075888 Ga0453684_0075888_1279_2244 258
69 3300046660 Ga0495625_0008416 Ga0495625_0008416_1201_2022 258
70 3300047323 Ga0495683_0002291 Ga0495683_0002291_3292_4113 258
71 3300047443 Ga0495687_003219 Ga0495687_003219_7175_7996 258
72 3300048917 Ga0496114_0333219 Ga0496114_0333219_412_1200 258
73 3300049460 Ga0495682_0036496 Ga0495682_0036496_431_1252 258
74 3300053109 Ga0500569_016797 Ga0500569_016797_1013_1834 258
75 3300042876 Ga0451577_0001624 Ga0451577_0001624_11732_12637 259
76 3300044712 Ga0453684_0000176 Ga0453684_0000176_201873_202778 259
77 3300046460 Ga0495638_0000224 Ga0495638_0000224_67269_68144 259
78 3300048925 Ga0496122_0058371 Ga0496122_0058371_983_1858 259
79 3300049576 Ga0501040_0000097 Ga0501040_0000097_6684_7583 259
80 3300049576 Ga0501040_0007189 Ga0501040_0007189_318_1217 259
81 3300049578 Ga0501042_0000054 Ga0501042_0000054_30863_31762 259
82 3300025292 Ga0209676_1025810 Ga0209676_10258102 260
83 3300036401 Ga0373937_0056076 Ga0373937_0056076_372_1256 260
84 3300053136 Ga0500559_0000298 Ga0500559_0000298_8531_9406 260
85 3300053163 Ga0500639_019482 Ga0500639_019482_1951_2826 260
86 3300013296 Ga0157374_10567538 Ga0157374_105675381 261
87 3300026088 Ga0207641_10302361 Ga0207641_103023612 261
88 3300035112 Ga0373932_0081864 Ga0373932_0081864_224_1009 261
89 3300049822 Ga0501035_0047639 Ga0501035_0047639_2997_3833 261
90 3300053111 Ga0500572_000095 Ga0500572_000095_12497_13372 261
91 3300053153 Ga0500616_0150462 Ga0500616_0150462_81_866 261
92 3300009177 Ga0105248_10526994 Ga0105248_105269942 263
93 3300032004 Ga0307414_10273759 Ga0307414_102737592 263
94 3300050490 nmdc:mga03n38_22503_c1 nmdc:mga03n38_22503_c1_998_1873 263
95 3300005445 Ga0070708_100744908 Ga0070708_1007449081 264
96 3300005471 Ga0070698_100445469 Ga0070698_1004454692 264
97 3300005518 Ga0070699_100030144 Ga0070699_1000301442 264
98 3300037068 Ga0373925_0027813 Ga0373925_0027813_554_1420 264
99 3300044673 Ga0453683_0023611 Ga0453683_0023611_1124_2029 264
100 3300035692 Ga0373935_0468308 Ga0373935_0468308_33_902 265
101 3300042139 Ga0450904_000354 Ga0450904_000354_820_1704 265
102 3300044706 Ga0466964_0087945 Ga0466964_0087945_517_1335 265
103 3300044712 Ga0453684_0001504 Ga0453684_0001504_29183_30088 265
104 3300053093 Ga0500651_0089158 Ga0500651_0089158_986_1861 265
105 3300053094 Ga0500566_0005587 Ga0500566_0005587_5272_6147 265
106 3300053122 Ga0500608_001229 Ga0500608_001229_1672_2547 265
107 3300053148 Ga0500590_135140 Ga0500590_135140_224_1099 265
108 3300053157 Ga0500624_006778 Ga0500624_006778_26_901 265
109 3300031251 Ga0265327_10095537 Ga0265327_100955372 266
110 3300046615 Ga0495656_0008420 Ga0495656_0008420_2668_3552 266
111 3300048090 Ga0495615_0006944 Ga0495615_0006944_70_954 266
112 3300041404 Ga0439436_0001036 Ga0439436_0001036_57_929 267
113 3300049581 Ga0501047_0055700 Ga0501047_0055700_1257_2162 267
114 3300031548 Ga0307408_100170044 Ga0307408_1001700442 268
115 3300031731 Ga0307405_10265491 Ga0307405_102654912 268
116 3300032002 Ga0307416_100207503 Ga0307416_1002075032 268
117 3300035241 Ga0373961_0068433 Ga0373961_0068433_12_818 268
118 3300042006 Ga0439432_011973 Ga0439432_011973_1639_2514 268
119 3300042007 Ga0439449_0005851 Ga0439449_0005851_3718_4593 268
120 3300042134 Ga0450898_013732 Ga0450898_013732_353_1228 268
121 3300055283 Ga0500661_016256 Ga0500661_016256_17_823 268
122 3300003771 Ga0055526_1018980 Ga0055526_10189802 269
123 3300005434 Ga0070709_10127041 Ga0070709_101270412 269
124 3300005614 Ga0068856_100212109 Ga0068856_1002121092 269
125 3300009174 Ga0105241_10115813 Ga0105241_101158132 269
126 3300025295 Ga0209564_1006290 Ga0209564_10062903 269
127 3300032004 Ga0307414_10248893 Ga0307414_102488932 269
128 iso_pu_bacteria 2582581867 2585399502 269
129 3300005467 Ga0070706_100000367 Ga0070706_10000036736 270
130 3300006195 Ga0075366_10066754 Ga0075366_100667542 270
131 3300025910 Ga0207684_10005313 Ga0207684_100053135 270
132 3300030522 Ga0307512_10148172 Ga0307512_101481722 270
133 3300042876 Ga0451577_0356967 Ga0451577_0356967_418_1281 270
134 3300048926 Ga0496123_0055606 Ga0496123_0055606_1727_2581 270
135 3300049822 Ga0501035_0015071 Ga0501035_0015071_1712_2617 270
136 3300049823 Ga0501044_0017784 Ga0501044_0017784_5272_6177 270
137 3300050494 nmdc:mga06z11_50492_c1 nmdc:mga06z11_50492_c1_924_1808 270
138 3300005345 Ga0070692_10173526 Ga0070692_101735262 271
139 3300005366 Ga0070659_100160817 Ga0070659_1001608172 271
140 3300005458 Ga0070681_10105363 Ga0070681_101053633 271
141 3300005467 Ga0070706_100000099 Ga0070706_1000000996 271
142 3300005468 Ga0070707_100002214 Ga0070707_10000221416 271
143 3300005471 Ga0070698_100106065 Ga0070698_1001060653 271
144 3300005530 Ga0070679_100028360 Ga0070679_1000283605 271
145 3300006847 Ga0075431_100408396 Ga0075431_1004083962 271
146 3300009101 Ga0105247_10035792 Ga0105247_100357922 271
147 3300013105 Ga0157369_10003195 Ga0157369_100031959 271
148 3300013307 Ga0157372_10149132 Ga0157372_101491322 271
149 3300025917 Ga0207660_10016588 Ga0207660_100165883 271
150 3300025921 Ga0207652_10015708 Ga0207652_100157083 271
151 3300025921 Ga0207652_10385584 Ga0207652_103855842 271
152 3300025932 Ga0207690_10021253 Ga0207690_100212532 271
153 3300025944 Ga0207661_10324767 Ga0207661_103247672 271
154 3300027665 Ga0209983_1005029 Ga0209983_10050292 271
155 3300027876 Ga0209974_10030952 Ga0209974_100309522 271
156 3300037853 Ga0436364_1266276 Ga0436364_1266276_407_1303 271
157 3300041408 Ga0439453_0006616 Ga0439453_0006616_464_1351 271
158 3300042001 Ga0439441_006581 Ga0439441_006581_597_1484 271
159 3300042436 Ga0439435_0017059 Ga0439435_0017059_239_1126 271
160 3300042437 Ga0439444_0000843 Ga0439444_0000843_2681_3568 271
161 3300045976 Ga0466967_0126727 Ga0466967_0126727_1242_2138 271
162 3300048925 Ga0496122_0029962 Ga0496122_0029962_2870_3763 271
163 3300049570 Ga0501033_0008248 Ga0501033_0008248_1842_2738 271
164 3300049822 Ga0501035_0001129 Ga0501035_0001129_5686_6582 271
165 3300050510 nmdc:mga06r32_759070_c1 nmdc:mga06r32_759070_c1_26_913 271
166 3300003187 JGI25151J46595_10011005 JGI25151J46595_100110053 272
167 3300003187 JGI25151J46595_10023031 JGI25151J46595_100230313 272
168 3300003775 Ga0055524_1033844 Ga0055524_10338442 272
169 3300003781 Ga0055536_1000430 Ga0055536_100043027 272
170 3300003784 Ga0055534_1006261 Ga0055534_10062612 272
171 3300003784 Ga0055534_1013054 Ga0055534_10130542 272
172 3300005330 Ga0070690_100190929 Ga0070690_1001909292 272
173 3300005355 Ga0070671_100046579 Ga0070671_1000465793 272
174 3300005436 Ga0070713_100013856 Ga0070713_1000138565 272
175 3300005436 Ga0070713_100018974 Ga0070713_1000189742 272
176 3300005437 Ga0070710_10031626 Ga0070710_100316263 272
177 3300005439 Ga0070711_100006663 Ga0070711_1000066637 272
178 3300005439 Ga0070711_100120247 Ga0070711_1001202473 272
179 3300005441 Ga0070700_100032741 Ga0070700_1000327414 272
180 3300005444 Ga0070694_100279091 Ga0070694_1002790911 272
181 3300005456 Ga0070678_100010262 Ga0070678_1000102627 272
182 3300005471 Ga0070698_100109546 Ga0070698_1001095462 272
183 3300005518 Ga0070699_100538096 Ga0070699_1005380961 272
184 3300005548 Ga0070665_100129403 Ga0070665_1001294032 272
185 3300005549 Ga0070704_100137037 Ga0070704_1001370372 272
186 3300005614 Ga0068856_100034152 Ga0068856_1000341524 272
187 3300005617 Ga0068859_100084462 Ga0068859_1000844622 272
188 3300005841 Ga0068863_100220895 Ga0068863_1002208952 272
189 3300006028 Ga0070717_10001010 Ga0070717_1000101011 272
190 3300006028 Ga0070717_10065674 Ga0070717_100656743 272
191 3300006028 Ga0070717_10154069 Ga0070717_101540691 272
192 3300006173 Ga0070716_100024257 Ga0070716_1000242573 272
193 3300006175 Ga0070712_100005678 Ga0070712_1000056783 272
194 3300006175 Ga0070712_100073676 Ga0070712_1000736763 272
195 3300006358 Ga0068871_100065274 Ga0068871_1000652742 272
196 3300006844 Ga0075428_100000643 Ga0075428_10000064318 272
197 3300006846 Ga0075430_100000052 Ga0075430_10000005215 272
198 3300006847 Ga0075431_100000441 Ga0075431_1000004417 272
199 3300006880 Ga0075429_100000001 Ga0075429_100000001130 272
200 3300006881 Ga0068865_100037927 Ga0068865_1000379274 272
201 3300006931 Ga0097620_100084465 Ga0097620_1000844652 272
202 3300006948 Ga0099826_10000113 Ga0099826_100001132 272
203 3300009094 Ga0111539_10323377 Ga0111539_103233772 272
204 3300009098 Ga0105245_10028859 Ga0105245_100288593 272
205 3300009147 Ga0114129_10002725 Ga0114129_1000272513 272
206 3300009174 Ga0105241_10034109 Ga0105241_100341094 272
207 3300009176 Ga0105242_10013489 Ga0105242_100134893 272
208 3300013296 Ga0157374_10057385 Ga0157374_100573852 272
209 3300013297 Ga0157378_10043988 Ga0157378_100439882 272
210 3300013307 Ga0157372_10212656 Ga0157372_102126562 272
211 3300013308 Ga0157375_10023648 Ga0157375_100236487 272
212 3300025291 Ga0209675_1008754 Ga0209675_10087543 272
213 3300025291 Ga0209675_1009968 Ga0209675_10099683 272
214 3300025292 Ga0209676_1000183 Ga0209676_1000183134 272
215 3300025294 Ga0209025_1001836 Ga0209025_100183614 272
216 3300025294 Ga0209025_1002225 Ga0209025_10022253 272
217 3300025294 Ga0209025_1006883 Ga0209025_10068834 272
218 3300025294 Ga0209025_1014013 Ga0209025_10140132 272
219 3300025295 Ga0209564_1005879 Ga0209564_10058795 272
220 3300025299 Ga0209256_1000492 Ga0209256_100049253 272
221 3300025303 Ga0209051_1009018 Ga0209051_10090182 272
222 3300025303 Ga0209051_1041625 Ga0209051_10416252 272
223 3300025898 Ga0207692_10119408 Ga0207692_101194082 272
224 3300025903 Ga0207680_10019296 Ga0207680_100192962 272
225 3300025905 Ga0207685_10006792 Ga0207685_100067922 272
226 3300025906 Ga0207699_10107246 Ga0207699_101072462 272
227 3300025915 Ga0207693_10003697 Ga0207693_1000369713 272
228 3300025915 Ga0207693_10022705 Ga0207693_100227052 272
229 3300025915 Ga0207693_10052278 Ga0207693_100522783 272
230 3300025928 Ga0207700_10061588 Ga0207700_100615881 272
231 3300025931 Ga0207644_10104400 Ga0207644_101044001 272
232 3300025938 Ga0207704_10548285 Ga0207704_105482851 272
233 3300025939 Ga0207665_10002312 Ga0207665_100023125 272
234 3300026116 Ga0207674_10068749 Ga0207674_100687491 272
235 3300026121 Ga0207683_10052262 Ga0207683_100522622 272
236 3300027512 Ga0209179_1025133 Ga0209179_10251331 272
237 3300027666 Ga0209282_1000165 Ga0209282_10001653 272
238 3300028381 Ga0268264_10502935 Ga0268264_105029351 272
239 3300036401 Ga0373937_0098771 Ga0373937_0098771_1184_2068 272
240 3300038443 Ga0395901_0431073 Ga0395901_0431073_387_1256 272
241 3300039438 Ga0436360_0355657 Ga0436360_0355657_432_1319 272
242 3300041404 Ga0439436_0029804 Ga0439436_0029804_16_891 272
243 3300041413 Ga0439465_0003246 Ga0439465_0003246_3116_3991 272
244 3300042004 Ga0439445_0004602 Ga0439445_0004602_1559_2434 272
245 3300042006 Ga0439432_033561 Ga0439432_033561_388_1263 272
246 3300042010 Ga0439452_001501 Ga0439452_001501_3360_4235 272
247 3300042014 Ga0439457_005546 Ga0439457_005546_441_1316 272
248 3300046474 Ga0495605_0001125 Ga0495605_0001125_2344_3231 272
249 3300046512 Ga0495610_0001332 Ga0495610_0001332_151_1038 272
250 3300046512 Ga0495610_0090370 Ga0495610_0090370_10_840 272
251 3300046531 Ga0495665_0019635 Ga0495665_0019635_2684_3568 272
252 3300046537 Ga0495598_0033446 Ga0495598_0033446_426_1313 272
253 3300048903 Ga0496100_0046783 Ga0496100_0046783_1837_2721 272
254 3300048904 Ga0496101_0113226 Ga0496101_0113226_760_1644 272
255 3300048905 Ga0496102_0016898 Ga0496102_0016898_1169_2053 272
256 3300048906 Ga0496103_0053072 Ga0496103_0053072_692_1576 272
257 3300048907 Ga0496104_0129718 Ga0496104_0129718_1482_2366 272
258 3300048909 Ga0496106_0066727 Ga0496106_0066727_1790_2674 272
259 3300048912 Ga0496109_0030918 Ga0496109_0030918_2412_3296 272
260 3300048917 Ga0496114_0030392 Ga0496114_0030392_1282_2166 272
261 3300049571 Ga0501034_0012327 Ga0501034_0012327_785_1669 272
262 3300050507 nmdc:mga05p37_19161_c1 nmdc:mga05p37_19161_c1_4052_4936 272
263 3300050508 nmdc:mga09592_797_c1 nmdc:mga09592_797_c1_22383_23267 272
264 3300050509 nmdc:mga0qj67_1874_c1 nmdc:mga0qj67_1874_c1_3252_4136 272
265 3300050510 nmdc:mga06r32_1637_c1 nmdc:mga06r32_1637_c1_3384_4268 272
266 3300050511 nmdc:mga08y16_268513_c1 nmdc:mga08y16_268513_c1_272_1156 272
267 3300005458 Ga0070681_10023442 Ga0070681_100234427 273
268 3300014968 Ga0157379_10156053 Ga0157379_101560532 273
269 3300025273 Ga0209673_1024705 Ga0209673_10247052 273
270 3300028794 Ga0307515_10000515 Ga0307515_100005152 273
271 3300031456 Ga0307513_10048235 Ga0307513_100482352 273
272 3300031649 Ga0307514_10000529 Ga0307514_1000052958 273
273 3300046473 Ga0495582_0052018 Ga0495582_0052018_1051_1935 273
274 3300047319 Ga0495674_0408047 Ga0495674_0408047_46_930 273
275 3300003773 Ga0055537_1000780 Ga0055537_10007802 274
276 3300005338 Ga0068868_100215626 Ga0068868_1002156262 274
277 3300005834 Ga0068851_10001590 Ga0068851_100015908 274
278 3300006038 Ga0075365_10000088 Ga0075365_1000008831 274
279 3300006042 Ga0075368_10000101 Ga0075368_1000010112 274
280 3300006048 Ga0075363_100000128 Ga0075363_1000001286 274
281 3300006051 Ga0075364_10000004 Ga0075364_1000000482 274
282 3300006177 Ga0075362_10000009 Ga0075362_1000000984 274
283 3300006178 Ga0075367_10000018 Ga0075367_1000001829 274
284 3300006186 Ga0075369_10000011 Ga0075369_1000001149 274
285 3300006195 Ga0075366_10000085 Ga0075366_1000008526 274
286 3300006353 Ga0075370_10000120 Ga0075370_1000012026 274
287 3300006852 Ga0075433_10004677 Ga0075433_100046772 274
288 3300006871 Ga0075434_100033864 Ga0075434_1000338641 274
289 3300009093 Ga0105240_10221940 Ga0105240_102219402 274
290 3300009553 Ga0105249_10158497 Ga0105249_101584972 274
291 3300025321 Ga0207656_10009568 Ga0207656_100095682 274
292 3300025939 Ga0207665_10014000 Ga0207665_100140002 274
293 3300025961 Ga0207712_10262138 Ga0207712_102621382 274
294 3300026023 Ga0207677_10184137 Ga0207677_101841372 274
295 3300026142 Ga0207698_10102579 Ga0207698_101025791 274
296 3300027866 Ga0209813_10000254 Ga0209813_1000025414 274
297 3300046522 Ga0495643_0020848 Ga0495643_0020848_550_1437 274
298 3300048907 Ga0496104_0015712 Ga0496104_0015712_55_921 274
299 3300048913 Ga0496110_0039591 Ga0496110_0039591_1149_2015 274
300 3300050489 nmdc:mga03683_11_c1 nmdc:mga03683_11_c1_45267_46154 274
301 3300050490 nmdc:mga03n38_1_c1 nmdc:mga03n38_1_c1_80561_81448 274
302 3300050491 nmdc:mga00v17_1_c1 nmdc:mga00v17_1_c1_150381_151268 274
303 3300050492 nmdc:mga0yw44_61_c1 nmdc:mga0yw44_61_c1_1418_2305 274
304 3300050493 nmdc:mga0k408_1033_c1 nmdc:mga0k408_1033_c1_8449_9336 274
305 3300050494 nmdc:mga06z11_800_c1 nmdc:mga06z11_800_c1_7335_8222 274
306 3300050495 nmdc:mga04h51_245_c1 nmdc:mga04h51_245_c1_10622_11509 274
307 3300050496 nmdc:mga07m45_447_c1 nmdc:mga07m45_447_c1_1951_2838 274
308 3300050512 nmdc:mga0n895_668_c1 nmdc:mga0n895_668_c1_4757_5638 274
309 3300050514 nmdc:mga08x19_6928_c1 nmdc:mga08x19_6928_c1_1051_1932 274
310 3300050515 nmdc:mga0a205_89630_c1 nmdc:mga0a205_89630_c1_729_1610 274
311 3300050516 nmdc:mga0sz30_5_c1 nmdc:mga0sz30_5_c1_94186_95073 274
312 3300053107 Ga0500560_001919 Ga0500560_001919_830_1717 274
313 3300053111 Ga0500572_001864 Ga0500572_001864_3653_4540 274
314 3300053137 Ga0500561_0000180 Ga0500561_0000180_4824_5711 274
315 3300053161 Ga0500634_0006941 Ga0500634_0006941_2299_3186 274
316 3300053177 Ga0500636_0000163 Ga0500636_0000163_10492_11379 274
317 3300005439 Ga0070711_100127762 Ga0070711_1001277622 275
318 3300005445 Ga0070708_100052979 Ga0070708_1000529792 275
319 3300005467 Ga0070706_100012270 Ga0070706_1000122707 275
320 3300005468 Ga0070707_100196986 Ga0070707_1001969862 275
321 3300025910 Ga0207684_10000047 Ga0207684_10000047102 275
322 3300025910 Ga0207684_10049950 Ga0207684_100499502 275
323 3300025910 Ga0207684_10084595 Ga0207684_100845952 275
324 3300025922 Ga0207646_10035640 Ga0207646_100356403 275
325 3300037418 Ga0395900_0020030 Ga0395900_0020030_5744_6628 275
326 3300037466 Ga0395898_0002933 Ga0395898_0002933_638_1522 275
327 3300037471 Ga0395905_0007574 Ga0395905_0007574_4444_5328 275
328 3300037471 Ga0395905_0117467 Ga0395905_0117467_769_1653 275
329 3300038443 Ga0395901_0288219 Ga0395901_0288219_83_967 275
330 3300042876 Ga0451577_0218301 Ga0451577_0218301_181_1047 275
331 3300042876 Ga0451577_0298719 Ga0451577_0298719_503_1387 275
332 3300044673 Ga0453683_0047761 Ga0453683_0047761_70_948 275
333 3300044693 Ga0466961_0005894 Ga0466961_0005894_1674_2558 275
334 3300044712 Ga0453684_0070906 Ga0453684_0070906_409_1287 275
335 3300044712 Ga0453684_0085668 Ga0453684_0085668_2013_2891 275
336 3300044712 Ga0453684_0229254 Ga0453684_0229254_341_1207 275
337 3300044712 Ga0453684_0341477 Ga0453684_0341477_373_1239 275
338 3300044735 Ga0466968_0058950 Ga0466968_0058950_70_954 275
339 3300045051 Ga0451576_0177123 Ga0451576_0177123_995_1873 275
340 3300046457 Ga0495590_0061125 Ga0495590_0061125_11_838 275
341 3300046491 Ga0495584_0017031 Ga0495584_0017031_187_1074 275
342 3300046506 Ga0495583_0007472 Ga0495583_0007472_1997_2884 275
343 3300046512 Ga0495610_0009568 Ga0495610_0009568_1475_2362 275
344 3300046515 Ga0495620_0001081 Ga0495620_0001081_9132_10019 275
345 3300046519 Ga0495632_0053727 Ga0495632_0053727_360_1247 275
346 3300046542 Ga0495597_0010288 Ga0495597_0010288_2967_3854 275
347 3300046692 Ga0495671_0029873 Ga0495671_0029873_79_966 275
348 3300046694 Ga0495649_0032739 Ga0495649_0032739_1550_2437 275
349 3300046810 Ga0495660_0046843 Ga0495660_0046843_414_1301 275
350 3300047320 Ga0495672_0011051 Ga0495672_0011051_4974_5861 275
351 3300047321 Ga0495676_0428655 Ga0495676_0428655_31_858 275
352 3300047469 Ga0495673_0020505 Ga0495673_0020505_43_930 275
353 3300047673 Ga0495593_0050189 Ga0495593_0050189_1348_2175 275
354 3300048088 Ga0495602_0030864 Ga0495602_0030864_36_863 275
355 3300048091 Ga0495626_0011832 Ga0495626_0011832_2356_3243 275
356 3300049572 Ga0501036_0475565 Ga0501036_0475565_89_955 275
357 3300049577 Ga0501041_0011279 Ga0501041_0011279_1817_2683 275
358 3300049578 Ga0501042_0114618 Ga0501042_0114618_612_1478 275
359 3300049591 Ga0501075_0291105 Ga0501075_0291105_94_960 275
360 3300049824 Ga0501045_0031830 Ga0501045_0031830_471_1337 275
361 3300050507 nmdc:mga05p37_251472_c1 nmdc:mga05p37_251472_c1_554_1435 275
362 3300053139 Ga0500568_0000269 Ga0500568_0000269_5623_6510 275
363 3300053153 Ga0500616_0000931 Ga0500616_0000931_3503_4390 275
364 3300053156 Ga0500622_0002182 Ga0500622_0002182_5504_6391 275
365 3300053730 Ga0500645_001533 Ga0500645_001533_3064_3966 275
366 3300060353 Ga0501082_0117115 Ga0501082_0117115_1355_2221 275
367 3300002774 JGI25150J39212_1002294 JGI25150J39212_10022945 276
368 3300002987 JGI25159J45721_1001628 JGI25159J45721_10016287 276
369 3300003187 JGI25151J46595_10034292 JGI25151J46595_100342922 276
370 3300003354 JGI25160J50197_1000319 JGI25160J50197_10003196 276
371 3300003354 JGI25160J50197_1010760 JGI25160J50197_10107601 276
372 3300003374 JGI25161J50226_1000092 JGI25161J50226_100009220 276
373 3300003773 Ga0055537_1004214 Ga0055537_10042144 276
374 3300004625 Ga0055543_1000207 Ga0055543_100020715 276
375 3300006051 Ga0075364_10008524 Ga0075364_100085244 276
376 3300006353 Ga0075370_10091980 Ga0075370_100919802 276
377 3300025245 Ga0207425_1003000 Ga0207425_10030002 276
378 3300025263 Ga0209565_1001165 Ga0209565_10011659 276
379 3300025284 Ga0209130_1000231 Ga0209130_100023150 276
380 3300025284 Ga0209130_1000400 Ga0209130_100040039 276
381 3300025291 Ga0209675_1002633 Ga0209675_10026337 276
382 3300025294 Ga0209025_1022168 Ga0209025_10221684 276
383 3300025297 Ga0209758_1006941 Ga0209758_10069415 276
384 3300025298 Ga0209050_1002672 Ga0209050_10026727 276
385 3300025302 Ga0207426_1000046 Ga0207426_1000046410 276
386 3300025302 Ga0207426_1000197 Ga0207426_100019779 276
387 3300039447 Ga0436361_0993124 Ga0436361_0993124_733_1617 276
388 3300041413 Ga0439465_0030452 Ga0439465_0030452_639_1526 276
389 3300044712 Ga0453684_0001136 Ga0453684_0001136_3518_4396 276
390 3300045051 Ga0451576_0000260 Ga0451576_0000260_100556_101461 276
391 3300045051 Ga0451576_0520121 Ga0451576_0520121_30_935 276
392 3300046512 Ga0495610_0071087 Ga0495610_0071087_391_1278 276
393 3300049579 Ga0501043_0503752 Ga0501043_0503752_12_881 276
394 3300050496 nmdc:mga07m45_59826_c1 nmdc:mga07m45_59826_c1_1207_2109 276
395 3300053088 Ga0500644_0003444 Ga0500644_0003444_1280_2218 276
396 3300053730 Ga0500645_016490 Ga0500645_016490_762_1700 276
397 3300005983 Ga0081540_1031565 Ga0081540_10315652 277
398 3300009094 Ga0111539_10198119 Ga0111539_101981192 277
399 3300025298 Ga0209050_1006110 Ga0209050_10061103 277
400 3300035086 Ga0373934_0000354 Ga0373934_0000354_14131_15018 277
401 3300035119 Ga0373956_0000015 Ga0373956_0000015_42417_43304 277
402 3300035724 Ga0373933_0001774 Ga0373933_0001774_759_1646 277
403 3300036401 Ga0373937_0000182 Ga0373937_0000182_25157_26044 277
404 3300038443 Ga0395901_0059936 Ga0395901_0059936_1175_2062 277
405 3300045051 Ga0451576_0003830 Ga0451576_0003830_10911_11795 277
406 3300046460 Ga0495638_0000141 Ga0495638_0000141_5596_6483 277
407 3300046462 Ga0495651_0000027 Ga0495651_0000027_34459_35346 277
408 3300046474 Ga0495605_0029999 Ga0495605_0029999_364_1251 277
409 3300046492 Ga0495585_0060670 Ga0495585_0060670_844_1731 277
410 3300046507 Ga0495606_0152013 Ga0495606_0152013_98_985 277
411 3300046518 Ga0495631_0008142 Ga0495631_0008142_535_1422 277
412 3300046616 Ga0495668_0150835 Ga0495668_0150835_367_1254 277
413 3300049459 Ga0495678_023009 Ga0495678_023009_400_1287 277
414 3300050511 nmdc:mga08y16_326820_c1 nmdc:mga08y16_326820_c1_257_1141 277
415 3300053086 Ga0500578_0047317 Ga0500578_0047317_1156_2043 277
416 3300053105 Ga0500557_003445 Ga0500557_003445_1824_2711 277
417 3300053118 Ga0500594_0004273 Ga0500594_0004273_1494_2381 277
418 3300053142 Ga0500577_0064643 Ga0500577_0064643_469_1356 277
419 3300053160 Ga0500633_0067692 Ga0500633_0067692_212_1099 277
420 3300053730 Ga0500645_002397 Ga0500645_002397_1205_2107 277
421 3300005337 Ga0070682_100024957 Ga0070682_1000249572 278
422 3300046471 Ga0495650_0000826 Ga0495650_0000826_14976_15860 278
423 3300046473 Ga0495582_0056914 Ga0495582_0056914_579_1463 278
424 3300046500 Ga0495596_0001244 Ga0495596_0001244_10914_11798 278
425 3300046524 Ga0495648_0009825 Ga0495648_0009825_1351_2235 278
426 3300046530 Ga0495654_0005300 Ga0495654_0005300_5280_6182 278
427 3300046538 Ga0495609_0000638 Ga0495609_0000638_5283_6167 278
428 3300046674 Ga0495588_0014032 Ga0495588_0014032_2488_3372 278
429 3300046694 Ga0495649_0164652 Ga0495649_0164652_109_993 278
430 3300046794 Ga0495589_0011570 Ga0495589_0011570_1519_2403 278
431 3300047320 Ga0495672_0003207 Ga0495672_0003207_1760_2644 278
432 3300047321 Ga0495676_0052608 Ga0495676_0052608_587_1471 278
433 3300048091 Ga0495626_0026060 Ga0495626_0026060_349_1233 278
434 3300005437 Ga0070710_10010866 Ga0070710_100108665 279
435 3300005618 Ga0068864_100176349 Ga0068864_1001763492 279
436 3300026121 Ga0207683_10160885 Ga0207683_101608851 279
437 3300046455 Ga0495603_0100081 Ga0495603_0100081_101_985 279
438 3300046473 Ga0495582_0037321 Ga0495582_0037321_1587_2471 279
439 3300046491 Ga0495584_0040860 Ga0495584_0040860_310_1194 279
440 3300046491 Ga0495584_0069962 Ga0495584_0069962_712_1596 279
441 3300046499 Ga0495594_0096669 Ga0495594_0096669_502_1386 279
442 3300046513 Ga0495616_0048733 Ga0495616_0048733_1041_1925 279
443 3300046530 Ga0495654_0025422 Ga0495654_0025422_410_1294 279
444 3300046542 Ga0495597_0005056 Ga0495597_0005056_2342_3226 279
445 3300046557 Ga0495622_0068712 Ga0495622_0068712_555_1439 279
446 3300046558 Ga0495633_0019675 Ga0495633_0019675_1222_2106 279
447 3300046616 Ga0495668_0047548 Ga0495668_0047548_983_1867 279
448 3300046648 Ga0495611_0012765 Ga0495611_0012765_101_985 279
449 3300046674 Ga0495588_0245111 Ga0495588_0245111_19_903 279
450 3300046689 Ga0495613_0031127 Ga0495613_0031127_2668_3552 279
451 3300046691 Ga0495670_0035154 Ga0495670_0035154_1268_2152 279
452 3300046694 Ga0495649_0012076 Ga0495649_0012076_1716_2600 279
453 3300047320 Ga0495672_0003446 Ga0495672_0003446_3343_4227 279
454 3300047320 Ga0495672_0026030 Ga0495672_0026030_290_1174 279
455 3300047445 Ga0495677_0005821 Ga0495677_0005821_3274_4158 279
456 3300048089 Ga0495614_0003269 Ga0495614_0003269_4989_5873 279
457 3300048919 Ga0496116_0002454 Ga0496116_0002454_10883_11767 279
458 3300048919 Ga0496116_0022481 Ga0496116_0022481_1867_2751 279
459 3300049570 Ga0501033_0042576 Ga0501033_0042576_501_1406 279
460 3300049571 Ga0501034_0000067 Ga0501034_0000067_175294_176178 279
461 iso_pu_bacteria 2831265667 2831265780 279
462 iso_pu_bacteria 2899924645 2899930537 279
463 iso_pu_bacteria 2928037797 2928039651 279
464 iso_pu_bacteria 2928044640 2928044744 279
465 iso_pu_bacteria 2928051484 2928052544 279
466 iso_pu_bacteria 2928064002 2928064793 279
467 iso_pu_bacteria 2928084124 2928087125 279
468 iso_pu_bacteria 2929160207 2929160601 279
469 iso_pu_bacteria 2929160207 2929164362 279
470 3300003187 JGI25151J46595_10040727 JGI25151J46595_100407272 280
471 3300005455 Ga0070663_100025011 Ga0070663_1000250113 280
472 3300007265 Ga0099794_10086255 Ga0099794_100862552 280
473 3300009094 Ga0111539_10322485 Ga0111539_103224852 280
474 3300010375 Ga0105239_10081152 Ga0105239_100811524 280
475 3300025294 Ga0209025_1000049 Ga0209025_10000492 280
476 3300026067 Ga0207678_10059246 Ga0207678_100592462 280
477 3300041411 Ga0439466_0004105 Ga0439466_0004105_1079_1954 280
478 3300042002 Ga0439442_006805 Ga0439442_006805_486_1361 280
479 3300042531 Ga0450918_002634 Ga0450918_002634_771_1646 280
480 3300046472 Ga0495580_0000118 Ga0495580_0000118_21958_22842 280
481 3300048914 Ga0496111_0014962 Ga0496111_0014962_38_880 280
482 3300049579 Ga0501043_0037239 Ga0501043_0037239_1974_2879 280
483 3300049580 Ga0501046_0080662 Ga0501046_0080662_480_1385 280
484 3300049581 Ga0501047_0456691 Ga0501047_0456691_24_929 280
485 3300049586 Ga0501070_0142156 Ga0501070_0142156_539_1444 280
486 3300049823 Ga0501044_0015238 Ga0501044_0015238_447_1352 280
487 3300049823 Ga0501044_0114010 Ga0501044_0114010_1792_2697 280
488 3300005339 Ga0070660_100007902 Ga0070660_1000079023 281
489 3300005344 Ga0070661_100014785 Ga0070661_1000147855 281
490 3300013104 Ga0157370_10206478 Ga0157370_102064782 281
491 3300025919 Ga0207657_10008450 Ga0207657_100084503 281
492 3300025920 Ga0207649_10265585 Ga0207649_102655852 281
493 3300032004 Ga0307414_10021629 Ga0307414_100216294 281
494 3300038443 Ga0395901_0029770 Ga0395901_0029770_1630_2505 281
495 3300044712 Ga0453684_0146890 Ga0453684_0146890_1208_2095 281
496 3300049568 Ga0501031_0098741 Ga0501031_0098741_241_1146 281
497 3300049569 Ga0501032_0016838 Ga0501032_0016838_2286_3191 281
498 3300049570 Ga0501033_0000318 Ga0501033_0000318_31923_32828 281
499 3300049572 Ga0501036_0105363 Ga0501036_0105363_182_1087 281
500 3300049573 Ga0501037_0000136 Ga0501037_0000136_37627_38532 281
501 3300049574 Ga0501038_0070876 Ga0501038_0070876_1943_2848 281
502 3300049579 Ga0501043_0000006 Ga0501043_0000006_81876_82781 281
503 3300049581 Ga0501047_0129283 Ga0501047_0129283_1208_2113 281
504 3300049584 Ga0501068_0028661 Ga0501068_0028661_1995_2900 281
505 3300049585 Ga0501069_0000024 Ga0501069_0000024_36705_37610 281
506 3300049585 Ga0501069_0008395 Ga0501069_0008395_537_1442 281
507 3300049586 Ga0501070_0000093 Ga0501070_0000093_17505_18410 281
508 3300049586 Ga0501070_0001707 Ga0501070_0001707_3536_4441 281
509 3300049587 Ga0501071_0014312 Ga0501071_0014312_807_1712 281
510 3300049589 Ga0501073_0011759 Ga0501073_0011759_1855_2760 281
511 3300049590 Ga0501074_0001523 Ga0501074_0001523_3894_4799 281
512 3300049742 Ga0501080_0001346 Ga0501080_0001346_6715_7620 281
513 3300049742 Ga0501080_0167951 Ga0501080_0167951_103_1008 281
514 3300049744 Ga0501083_0000097 Ga0501083_0000097_30924_31829 281
515 3300049822 Ga0501035_0000068 Ga0501035_0000068_69402_70307 281
516 3300049822 Ga0501035_0008638 Ga0501035_0008638_1289_2194 281
517 3300049822 Ga0501035_0122409 Ga0501035_0122409_538_1443 281
518 3300049823 Ga0501044_0000096 Ga0501044_0000096_71923_72828 281
519 3300049823 Ga0501044_0078478 Ga0501044_0078478_1667_2572 281
520 iso_pu_bacteria 2904479285 2904480485 281
521 3300001979 JGI24740J21852_10003776 JGI24740J21852_100037764 282
522 3300002987 JGI25159J45721_1010099 JGI25159J45721_10100992 282
523 3300003187 JGI25151J46595_10027382 JGI25151J46595_100273822 282
524 3300003578 Ga0006562J51391_1013826 Ga0006562J51391_10138265 282
525 3300003758 Ga0055532_1004429 Ga0055532_10044291 282
526 3300003773 Ga0055537_1011246 Ga0055537_10112463 282
527 3300003781 Ga0055536_1005578 Ga0055536_10055784 282
528 3300003781 Ga0055536_1021898 Ga0055536_10218982 282
529 3300003781 Ga0055536_1022508 Ga0055536_10225082 282
530 3300003784 Ga0055534_1002677 Ga0055534_10026775 282
531 3300003790 Ga0055528_1006579 Ga0055528_10065795 282
532 3300003791 Ga0055530_10001578 Ga0055530_100015782 282
533 3300003791 Ga0055530_10018244 Ga0055530_100182442 282
534 3300003792 Ga0055540_1006428 Ga0055540_10064282 282
535 3300003792 Ga0055540_1009999 Ga0055540_10099993 282
536 3300003792 Ga0055540_1018294 Ga0055540_10182942 282
537 3300003794 Ga0055531_10006139 Ga0055531_100061396 282
538 3300005457 Ga0070662_100194336 Ga0070662_1001943362 282
539 3300005539 Ga0068853_100081728 Ga0068853_1000817282 282
540 3300005548 Ga0070665_100030194 Ga0070665_1000301945 282
541 3300005616 Ga0068852_100547946 Ga0068852_1005479462 282
542 3300006237 Ga0097621_100287147 Ga0097621_1002871472 282
543 3300006353 Ga0075370_10005461 Ga0075370_100054612 282
544 3300006358 Ga0068871_100060760 Ga0068871_1000607604 282
545 3300009036 Ga0105244_10001556 Ga0105244_100015567 282
546 3300009148 Ga0105243_10000362 Ga0105243_100003622 282
547 3300009148 Ga0105243_10005539 Ga0105243_100055397 282
548 3300009545 Ga0105237_10316350 Ga0105237_103163502 282
549 3300011119 Ga0105246_10106583 Ga0105246_101065832 282
550 3300013100 Ga0157373_10295188 Ga0157373_102951882 282
551 3300013104 Ga0157370_10138315 Ga0157370_101383152 282
552 3300013105 Ga0157369_10045063 Ga0157369_100450634 282
553 3300013307 Ga0157372_10017070 Ga0157372_100170703 282
554 3300014497 Ga0182008_10001629 Ga0182008_1000162916 282
555 3300014497 Ga0182008_10003912 Ga0182008_100039122 282
556 3300014497 Ga0182008_10004163 Ga0182008_100041632 282
557 3300014497 Ga0182008_10010606 Ga0182008_100106063 282
558 3300015261 Ga0182006_1014285 Ga0182006_10142851 282
559 3300015261 Ga0182006_1044633 Ga0182006_10446332 282
560 3300015262 Ga0182007_10001812 Ga0182007_100018127 282
561 3300015262 Ga0182007_10003476 Ga0182007_100034766 282
562 3300017792 Ga0163161_10000157 Ga0163161_100001572 282
563 3300017792 Ga0163161_10149013 Ga0163161_101490132 282
564 3300021361 Ga0213872_10001066 Ga0213872_100010663 282
565 3300025228 Ga0209672_102122 Ga0209672_1021225 282
566 3300025229 Ga0209147_105210 Ga0209147_1052102 282
567 3300025245 Ga0207425_1001149 Ga0207425_10011495 282
568 3300025258 Ga0209129_1000083 Ga0209129_1000083165 282
569 3300025258 Ga0209129_1004634 Ga0209129_10046342 282
570 3300025263 Ga0209565_1001782 Ga0209565_10017827 282
571 3300025273 Ga0209673_1000089 Ga0209673_1000089188 282
572 3300025273 Ga0209673_1003753 Ga0209673_10037537 282
573 3300025284 Ga0209130_1001602 Ga0209130_10016026 282
574 3300025284 Ga0209130_1004131 Ga0209130_10041312 282
575 3300025291 Ga0209675_1001031 Ga0209675_100103116 282
576 3300025291 Ga0209675_1004304 Ga0209675_10043044 282
577 3300025292 Ga0209676_1000004 Ga0209676_1000004513 282
578 3300025292 Ga0209676_1001760 Ga0209676_10017607 282
579 3300025292 Ga0209676_1002922 Ga0209676_100292211 282
580 3300025292 Ga0209676_1004535 Ga0209676_10045355 282
581 3300025294 Ga0209025_1000518 Ga0209025_100051871 282
582 3300025294 Ga0209025_1007740 Ga0209025_10077405 282
583 3300025294 Ga0209025_1030957 Ga0209025_10309573 282
584 3300025295 Ga0209564_1002924 Ga0209564_10029245 282
585 3300025297 Ga0209758_1000132 Ga0209758_1000132165 282
586 3300025297 Ga0209758_1011111 Ga0209758_10111115 282
587 3300025298 Ga0209050_1000002 Ga0209050_10000021023 282
588 3300025298 Ga0209050_1001170 Ga0209050_100117015 282
589 3300025298 Ga0209050_1015580 Ga0209050_10155802 282
590 3300025299 Ga0209256_1000973 Ga0209256_100097327 282
591 3300025299 Ga0209256_1002639 Ga0209256_10026396 282
592 3300025302 Ga0207426_1000584 Ga0207426_100058442 282
593 3300025302 Ga0207426_1002041 Ga0207426_10020416 282
594 3300025303 Ga0209051_1000002 Ga0209051_1000002792 282
595 3300025303 Ga0209051_1001870 Ga0209051_100187010 282
596 3300025303 Ga0209051_1002364 Ga0209051_100236411 282
597 3300025303 Ga0209051_1016781 Ga0209051_10167813 282
598 3300025303 Ga0209051_1043267 Ga0209051_10432672 282
599 3300025304 Ga0209257_1000002 Ga0209257_1000002933 282
600 3300025304 Ga0209257_1000361 Ga0209257_100036148 282
601 3300025304 Ga0209257_1009329 Ga0209257_10093292 282
602 3300025321 Ga0207656_10025330 Ga0207656_100253302 282
603 3300025728 Ga0207655_1007936 Ga0207655_10079364 282
604 3300025914 Ga0207671_10082753 Ga0207671_100827533 282
605 3300025924 Ga0207694_10334017 Ga0207694_103340172 282
606 3300025933 Ga0207706_10027673 Ga0207706_100276733 282
607 3300025934 Ga0207686_10135099 Ga0207686_101350992 282
608 3300025935 Ga0207709_10000323 Ga0207709_100003232 282
609 3300025935 Ga0207709_10002180 Ga0207709_100021804 282
610 3300025945 Ga0207679_10004897 Ga0207679_100048972 282
611 3300026041 Ga0207639_10139704 Ga0207639_101397042 282
612 3300026142 Ga0207698_10084889 Ga0207698_100848892 282
613 3300027876 Ga0209974_10011487 Ga0209974_100114873 282
614 3300028379 Ga0268266_10088876 Ga0268266_100888762 282
615 3300028380 Ga0268265_10074098 Ga0268265_100740981 282
616 3300031235 Ga0265330_10000033 Ga0265330_1000003392 282
617 3300031238 Ga0265332_10000001 Ga0265332_10000001216 282
618 3300031711 Ga0265314_10000022 Ga0265314_10000022221 282
619 3300031731 Ga0307405_10071647 Ga0307405_100716472 282
620 3300031911 Ga0307412_10039518 Ga0307412_100395183 282
621 3300032002 Ga0307416_100459308 Ga0307416_1004593081 282
622 3300041452 Ga0451793_0984015 Ga0451793_0984015_198_1073 282
623 3300046475 Ga0495639_0018609 Ga0495639_0018609_685_1560 282
624 3300046513 Ga0495616_0002253 Ga0495616_0002253_10564_11439 282
625 3300046515 Ga0495620_0026465 Ga0495620_0026465_1501_2376 282
626 3300046518 Ga0495631_0000589 Ga0495631_0000589_21489_22364 282
627 3300046542 Ga0495597_0000268 Ga0495597_0000268_13794_14678 282
628 3300046660 Ga0495625_0187669 Ga0495625_0187669_347_1222 282
629 3300046683 Ga0495658_0091110 Ga0495658_0091110_555_1430 282
630 3300046691 Ga0495670_0099230 Ga0495670_0099230_125_1000 282
631 3300046809 Ga0495600_0161621 Ga0495600_0161621_512_1387 282
632 3300047321 Ga0495676_0024655 Ga0495676_0024655_4159_5034 282
633 3300047673 Ga0495593_0014086 Ga0495593_0014086_174_1049 282
634 3300048088 Ga0495602_0151047 Ga0495602_0151047_161_1036 282
635 3300048089 Ga0495614_0002409 Ga0495614_0002409_4038_4913 282
636 3300048904 Ga0496101_0040730 Ga0496101_0040730_1690_2565 282
637 3300048904 Ga0496101_0245487 Ga0496101_0245487_32_907 282
638 3300048908 Ga0496105_0029729 Ga0496105_0029729_3187_4062 282
639 3300048913 Ga0496110_0189532 Ga0496110_0189532_375_1250 282
640 3300048920 Ga0496117_0020434 Ga0496117_0020434_4062_4937 282
641 3300048920 Ga0496117_0083704 Ga0496117_0083704_788_1663 282
642 3300048921 Ga0496118_0004662 Ga0496118_0004662_5979_6854 282
643 3300048921 Ga0496118_0107375 Ga0496118_0107375_527_1402 282
644 3300048924 Ga0496121_0000511 Ga0496121_0000511_24684_25565 282
645 3300048925 Ga0496122_0000342 Ga0496122_0000342_16743_17618 282
646 3300048926 Ga0496123_0000057 Ga0496123_0000057_187225_188100 282
647 3300048927 Ga0496124_0043856 Ga0496124_0043856_1649_2524 282
648 3300049741 Ga0501079_0022471 Ga0501079_0022471_3099_3947 282
649 3300050496 nmdc:mga07m45_408_c1 nmdc:mga07m45_408_c1_146_1021 282
650 3300050496 nmdc:mga07m45_4403_c2 nmdc:mga07m45_4403_c2_620_1495 282
651 3300053093 Ga0500651_0000164 Ga0500651_0000164_30055_30930 282
652 3300053110 Ga0500571_045129 Ga0500571_045129_134_1009 282
653 3300053122 Ga0500608_075018 Ga0500608_075018_491_1366 282
654 3300053134 Ga0500658_0000132 Ga0500658_0000132_30191_31066 282
655 3300053134 Ga0500658_0003190 Ga0500658_0003190_1180_2055 282
656 3300053136 Ga0500559_0021198 Ga0500559_0021198_370_1245 282
657 3300053139 Ga0500568_0001151 Ga0500568_0001151_15654_16529 282
658 3300053141 Ga0500574_000961 Ga0500574_000961_1584_2459 282
659 3300053153 Ga0500616_0042090 Ga0500616_0042090_884_1759 282
660 3300053161 Ga0500634_0151615 Ga0500634_0151615_49_924 282
661 3300006846 Ga0075430_100194390 Ga0075430_1001943901 283
662 3300031548 Ga0307408_100006354 Ga0307408_1000063543 283
663 3300031731 Ga0307405_10020362 Ga0307405_100203622 283
664 3300031901 Ga0307406_10270813 Ga0307406_102708132 283
665 3300031911 Ga0307412_10001651 Ga0307412_1000165111 283
666 3300032004 Ga0307414_10149531 Ga0307414_101495312 283
667 3300032005 Ga0307411_10011834 Ga0307411_100118342 283
668 3300037471 Ga0395905_0002575 Ga0395905_0002575_16178_17059 283
669 iso_pu_bacteria 2904449895 2904456328 283
670 iso_pu_bacteria 2904456579 2904462837 283
671 iso_pu_bacteria 2929520902 2929524412 283
672 iso_pu_bacteria 3002141150 3002145543 283
673 3300005339 Ga0070660_100029404 Ga0070660_1000294042 284
674 3300005366 Ga0070659_100102998 Ga0070659_1001029982 284
675 3300005530 Ga0070679_100081922 Ga0070679_1000819223 284
676 3300005616 Ga0068852_100225271 Ga0068852_1002252711 284
677 3300013104 Ga0157370_10147628 Ga0157370_101476281 284
678 3300013104 Ga0157370_10202152 Ga0157370_102021522 284
679 3300013105 Ga0157369_10004134 Ga0157369_100041344 284
680 3300013307 Ga0157372_10210800 Ga0157372_102108002 284
681 3300013307 Ga0157372_10402307 Ga0157372_104023072 284
682 3300013307 Ga0157372_11015212 Ga0157372_110152121 284
683 3300025909 Ga0207705_10439103 Ga0207705_104391031 284
684 3300025919 Ga0207657_10015145 Ga0207657_100151457 284
685 3300025919 Ga0207657_10023887 Ga0207657_100238873 284
686 3300025919 Ga0207657_10040173 Ga0207657_100401732 284
687 3300025932 Ga0207690_10055902 Ga0207690_100559021 284
688 3300025932 Ga0207690_10086957 Ga0207690_100869572 284
689 3300026142 Ga0207698_10434318 Ga0207698_104343181 284
690 3300048913 Ga0496110_0011628 Ga0496110_0011628_4860_5714 284
691 3300049570 Ga0501033_0035836 Ga0501033_0035836_2633_3538 284
692 3300049571 Ga0501034_0137086 Ga0501034_0137086_545_1450 284
693 3300049586 Ga0501070_0004270 Ga0501070_0004270_4189_5094 284
694 3300049742 Ga0501080_0011055 Ga0501080_0011055_7198_8103 284
695 3300049822 Ga0501035_0006366 Ga0501035_0006366_4457_5362 284
696 iso_pu_bacteria 2881101125 2881103565 284
697 iso_pu_bacteria 8054002106 8054008292 284
698 3300005290 Ga0065712_10070978 Ga0065712_100709782 285
699 3300005295 Ga0065707_10010755 Ga0065707_100107552 285
700 3300005434 Ga0070709_10001678 Ga0070709_100016789 285
701 3300005436 Ga0070713_100060940 Ga0070713_1000609402 285
702 3300005437 Ga0070710_10013537 Ga0070710_100135371 285
703 3300005439 Ga0070711_100088211 Ga0070711_1000882112 285
704 3300005458 Ga0070681_10012069 Ga0070681_100120695 285
705 3300005458 Ga0070681_10026806 Ga0070681_100268065 285
706 3300005467 Ga0070706_100037537 Ga0070706_1000375374 285
707 3300005468 Ga0070707_100042488 Ga0070707_1000424883 285
708 3300005546 Ga0070696_100003955 Ga0070696_1000039556 285
709 3300006847 Ga0075431_100214516 Ga0075431_1002145162 285
710 3300006871 Ga0075434_100146816 Ga0075434_1001468162 285
711 3300009093 Ga0105240_10237545 Ga0105240_102375452 285
712 3300009094 Ga0111539_10103845 Ga0111539_101038452 285
713 3300009098 Ga0105245_10498456 Ga0105245_104984562 285
714 3300009545 Ga0105237_10082797 Ga0105237_100827972 285
715 3300009551 Ga0105238_10156600 Ga0105238_101566001 285
716 3300009553 Ga0105249_10070757 Ga0105249_100707572 285
717 3300013104 Ga0157370_10216238 Ga0157370_102162382 285
718 3300013307 Ga0157372_10033994 Ga0157372_100339944 285
719 3300014326 Ga0157380_10142966 Ga0157380_101429662 285
720 3300025904 Ga0207647_10065911 Ga0207647_100659112 285
721 3300025906 Ga0207699_10142209 Ga0207699_101422092 285
722 3300025910 Ga0207684_10042118 Ga0207684_100421183 285
723 3300025912 Ga0207707_10240676 Ga0207707_102406761 285
724 3300025914 Ga0207671_10051675 Ga0207671_100516753 285
725 3300025922 Ga0207646_10052656 Ga0207646_100526563 285
726 3300025926 Ga0207659_10231822 Ga0207659_102318222 285
727 3300025928 Ga0207700_10163367 Ga0207700_101633671 285
728 3300025929 Ga0207664_10026888 Ga0207664_100268883 285
729 3300025949 Ga0207667_10374146 Ga0207667_103741462 285
730 3300026095 Ga0207676_10325736 Ga0207676_103257362 285
731 3300026118 Ga0207675_100209693 Ga0207675_1002096932 285
732 3300027907 Ga0207428_10180526 Ga0207428_101805261 285
733 3300041408 Ga0439453_0001687 Ga0439453_0001687_720_1601 285
734 3300042436 Ga0439435_0000194 Ga0439435_0000194_1134_2015 285
735 3300046472 Ga0495580_0271061 Ga0495580_0271061_87_983 285
736 3300048928 Ga0496125_0009940 Ga0496125_0009940_6986_7873 285
737 3300049580 Ga0501046_0046978 Ga0501046_0046978_2520_3401 285
738 3300049743 Ga0501081_0025641 Ga0501081_0025641_2871_3752 285
739 3300050510 nmdc:mga06r32_639325_c1 nmdc:mga06r32_639325_c1_22_903 285
740 3300050511 nmdc:mga08y16_349639_c1 nmdc:mga08y16_349639_c1_579_1469 285
741 3300050512 nmdc:mga0n895_90961_c1 nmdc:mga0n895_90961_c1_1360_2274 285
742 3300050514 nmdc:mga08x19_288458_c1 nmdc:mga08x19_288458_c1_236_1114 285
743 3300054114 Ga0501084_0071275 Ga0501084_0071275_1974_2855 285
744 iso_pu_bacteria 2508501050 2508732941 285
745 iso_pu_bacteria 2904449895 2904454891 285
746 3300005290 Ga0065712_10077719 Ga0065712_100777194 286
747 3300005327 Ga0070658_10008174 Ga0070658_1000817412 286
748 3300005336 Ga0070680_100098840 Ga0070680_1000988402 286
749 3300005458 Ga0070681_10006870 Ga0070681_100068704 286
750 3300005530 Ga0070679_100033784 Ga0070679_1000337844 286
751 3300005530 Ga0070679_100115247 Ga0070679_1001152472 286
752 3300005937 Ga0081455_10114013 Ga0081455_101140132 286
753 3300009093 Ga0105240_10796390 Ga0105240_107963901 286
754 3300009176 Ga0105242_10029471 Ga0105242_100294713 286
755 3300013297 Ga0157378_10145741 Ga0157378_101457412 286
756 3300025909 Ga0207705_10111477 Ga0207705_101114771 286
757 3300025912 Ga0207707_10016070 Ga0207707_100160703 286
758 3300025913 Ga0207695_10550983 Ga0207695_105509831 286
759 3300025917 Ga0207660_10039418 Ga0207660_100394183 286
760 3300025921 Ga0207652_10103601 Ga0207652_101036012 286
761 3300025921 Ga0207652_10199221 Ga0207652_101992211 286
762 3300025923 Ga0207681_10256360 Ga0207681_102563601 286
763 3300025934 Ga0207686_10062493 Ga0207686_100624932 286
764 3300026121 Ga0207683_10199221 Ga0207683_101992212 286
765 3300032002 Ga0307416_100260270 Ga0307416_1002602702 286
766 3300037418 Ga0395900_0282082 Ga0395900_0282082_50_940 286
767 3300039437 Ga0436365_1366850 Ga0436365_1366850_1959_2834 286
768 3300039447 Ga0436361_0225003 Ga0436361_0225003_1502_2389 286
769 3300042001 Ga0439441_000869 Ga0439441_000869_1786_2670 286
770 3300046537 Ga0495598_0095558 Ga0495598_0095558_76_963 286
771 3300049581 Ga0501047_0014025 Ga0501047_0014025_4508_5380 286
772 3300049584 Ga0501068_0038398 Ga0501068_0038398_1681_2553 286
773 3300049585 Ga0501069_0037849 Ga0501069_0037849_507_1379 286
774 3300049586 Ga0501070_0003776 Ga0501070_0003776_6008_6880 286
775 3300049589 Ga0501073_0016103 Ga0501073_0016103_2662_3534 286
776 3300049590 Ga0501074_0007470 Ga0501074_0007470_5711_6583 286
777 3300049742 Ga0501080_0038346 Ga0501080_0038346_1887_2759 286
778 3300049822 Ga0501035_0112108 Ga0501035_0112108_818_1690 286
779 3300049823 Ga0501044_0016109 Ga0501044_0016109_4660_5532 286
780 3300050511 nmdc:mga08y16_6264_c1 nmdc:mga08y16_6264_c1_3938_4822 286
781 3300054114 Ga0501084_0013576 Ga0501084_0013576_578_1450 286
782 iso_pu_bacteria 2894772417 2894772696 286
783 3300001977 JGI24746J21847_1003310 JGI24746J21847_10033101 287
784 3300002070 JGI24750J21931_1000181 JGI24750J21931_10001816 287
785 3300002073 JGI24745J21846_1000318 JGI24745J21846_10003184 287
786 3300002074 JGI24748J21848_1000571 JGI24748J21848_10005712 287
787 3300002075 JGI24738J21930_10001393 JGI24738J21930_100013934 287
788 3300002987 JGI25159J45721_1014733 JGI25159J45721_10147331 287
789 3300003187 JGI25151J46595_10034941 JGI25151J46595_100349411 287
790 3300003203 JGI25406J46586_10005366 JGI25406J46586_100053664 287
791 3300003349 JGI26129J50193_1001475 JGI26129J50193_10014751 287
792 3300003759 Ga0055525_1000036 Ga0055525_1000036185 287
793 3300003773 Ga0055537_1000104 Ga0055537_100010432 287
794 3300003775 Ga0055524_1010401 Ga0055524_10104014 287
795 3300003784 Ga0055534_1000042 Ga0055534_100004245 287
796 3300003790 Ga0055528_1001367 Ga0055528_10013672 287
797 3300003792 Ga0055540_1001235 Ga0055540_10012357 287
798 3300003794 Ga0055531_10003091 Ga0055531_100030913 287
799 3300005262 Ga0065165_1000132 Ga0065165_100013246 287
800 3300005262 Ga0065165_1000409 Ga0065165_10004092 287
801 3300005288 Ga0065714_10066083 Ga0065714_100660836 287
802 3300005290 Ga0065712_10078399 Ga0065712_100783992 287
803 3300005290 Ga0065712_10096189 Ga0065712_100961892 287
804 3300005293 Ga0065715_10089022 Ga0065715_1008902214 287
805 3300005293 Ga0065715_10103856 Ga0065715_101038563 287
806 3300005293 Ga0065715_10155662 Ga0065715_101556622 287
807 3300005328 Ga0070676_10002898 Ga0070676_100028983 287
808 3300005328 Ga0070676_10009564 Ga0070676_100095644 287
809 3300005328 Ga0070676_10191182 Ga0070676_101911822 287
810 3300005329 Ga0070683_100001166 Ga0070683_1000011667 287
811 3300005329 Ga0070683_100342098 Ga0070683_1003420982 287
812 3300005329 Ga0070683_100365580 Ga0070683_1003655802 287
813 3300005330 Ga0070690_100009650 Ga0070690_1000096505 287
814 3300005330 Ga0070690_100033483 Ga0070690_1000334833 287
815 3300005331 Ga0070670_100010109 Ga0070670_1000101097 287
816 3300005331 Ga0070670_100147377 Ga0070670_1001473772 287
817 3300005333 Ga0070677_10000126 Ga0070677_1000012621 287
818 3300005334 Ga0068869_100078992 Ga0068869_1000789922 287
819 3300005334 Ga0068869_100200685 Ga0068869_1002006852 287
820 3300005335 Ga0070666_10052952 Ga0070666_100529522 287
821 3300005335 Ga0070666_10318119 Ga0070666_103181192 287
822 3300005336 Ga0070680_100005116 Ga0070680_1000051168 287
823 3300005336 Ga0070680_100014771 Ga0070680_1000147717 287
824 3300005336 Ga0070680_100089145 Ga0070680_1000891452 287
825 3300005337 Ga0070682_100001533 Ga0070682_10000153312 287
826 3300005337 Ga0070682_100003724 Ga0070682_1000037242 287
827 3300005337 Ga0070682_100060172 Ga0070682_1000601722 287
828 3300005338 Ga0068868_100003027 Ga0068868_1000030272 287
829 3300005338 Ga0068868_100003608 Ga0068868_1000036085 287
830 3300005338 Ga0068868_100015802 Ga0068868_1000158022 287
831 3300005338 Ga0068868_100066200 Ga0068868_1000662002 287
832 3300005339 Ga0070660_100001299 Ga0070660_1000012994 287
833 3300005339 Ga0070660_100010060 Ga0070660_1000100603 287
834 3300005339 Ga0070660_100015241 Ga0070660_1000152412 287
835 3300005340 Ga0070689_100003384 Ga0070689_1000033847 287
836 3300005340 Ga0070689_100007839 Ga0070689_1000078394 287
837 3300005340 Ga0070689_100165687 Ga0070689_1001656872 287
838 3300005341 Ga0070691_10000994 Ga0070691_100009948 287
839 3300005341 Ga0070691_10004892 Ga0070691_100048925 287
840 3300005343 Ga0070687_100000085 Ga0070687_1000000852 287
841 3300005344 Ga0070661_100002142 Ga0070661_10000214215 287
842 3300005344 Ga0070661_100035802 Ga0070661_1000358022 287
843 3300005345 Ga0070692_10000667 Ga0070692_100006674 287
844 3300005345 Ga0070692_10002518 Ga0070692_100025188 287
845 3300005347 Ga0070668_100001248 Ga0070668_10000124815 287
846 3300005347 Ga0070668_100145165 Ga0070668_1001451652 287
847 3300005353 Ga0070669_100005868 Ga0070669_1000058688 287
848 3300005353 Ga0070669_100375172 Ga0070669_1003751721 287
849 3300005354 Ga0070675_100280270 Ga0070675_1002802702 287
850 3300005354 Ga0070675_100372452 Ga0070675_1003724521 287
851 3300005355 Ga0070671_100009899 Ga0070671_1000098994 287
852 3300005355 Ga0070671_100010916 Ga0070671_1000109163 287
853 3300005355 Ga0070671_100021222 Ga0070671_1000212225 287
854 3300005355 Ga0070671_100086682 Ga0070671_1000866822 287
855 3300005355 Ga0070671_100148145 Ga0070671_1001481452 287
856 3300005356 Ga0070674_100003469 Ga0070674_1000034698 287
857 3300005356 Ga0070674_100011243 Ga0070674_1000112435 287
858 3300005356 Ga0070674_100315442 Ga0070674_1003154422 287
859 3300005364 Ga0070673_100000152 Ga0070673_1000001524 287
860 3300005364 Ga0070673_100001292 Ga0070673_10000129211 287
861 3300005364 Ga0070673_100007749 Ga0070673_1000077496 287
862 3300005364 Ga0070673_100022913 Ga0070673_1000229133 287
863 3300005365 Ga0070688_100000558 Ga0070688_10000055816 287
864 3300005365 Ga0070688_100012465 Ga0070688_1000124652 287
865 3300005365 Ga0070688_100112186 Ga0070688_1001121862 287
866 3300005366 Ga0070659_100000151 Ga0070659_10000015131 287
867 3300005366 Ga0070659_100011661 Ga0070659_1000116614 287
868 3300005367 Ga0070667_100005640 Ga0070667_1000056404 287
869 3300005367 Ga0070667_100042441 Ga0070667_1000424413 287
870 3300005367 Ga0070667_100167734 Ga0070667_1001677341 287
871 3300005406 Ga0070703_10003226 Ga0070703_100032262 287
872 3300005406 Ga0070703_10008573 Ga0070703_100085732 287
873 3300005406 Ga0070703_10017152 Ga0070703_100171522 287
874 3300005434 Ga0070709_10028390 Ga0070709_100283903 287
875 3300005434 Ga0070709_10030542 Ga0070709_100305422 287
876 3300005435 Ga0070714_100058681 Ga0070714_1000586812 287
877 3300005435 Ga0070714_100231952 Ga0070714_1002319521 287
878 3300005435 Ga0070714_100695228 Ga0070714_1006952281 287
879 3300005436 Ga0070713_100004299 Ga0070713_1000042997 287
880 3300005439 Ga0070711_100033311 Ga0070711_1000333113 287
881 3300005439 Ga0070711_100062704 Ga0070711_1000627042 287
882 3300005439 Ga0070711_100131967 Ga0070711_1001319672 287
883 3300005440 Ga0070705_100000874 Ga0070705_1000008742 287
884 3300005440 Ga0070705_100031418 Ga0070705_1000314181 287
885 3300005440 Ga0070705_100083692 Ga0070705_1000836922 287
886 3300005440 Ga0070705_100106424 Ga0070705_1001064242 287
887 3300005440 Ga0070705_100222061 Ga0070705_1002220611 287
888 3300005441 Ga0070700_100002863 Ga0070700_1000028638 287
889 3300005441 Ga0070700_100293672 Ga0070700_1002936721 287
890 3300005444 Ga0070694_100000390 Ga0070694_10000039023 287
891 3300005444 Ga0070694_100000998 Ga0070694_10000099811 287
892 3300005444 Ga0070694_100001507 Ga0070694_10000150715 287
893 3300005444 Ga0070694_100032223 Ga0070694_1000322232 287
894 3300005444 Ga0070694_100201333 Ga0070694_1002013332 287
895 3300005445 Ga0070708_100000402 Ga0070708_10000040221 287
896 3300005445 Ga0070708_100104286 Ga0070708_1001042862 287
897 3300005445 Ga0070708_100117348 Ga0070708_1001173482 287
898 3300005456 Ga0070678_100601541 Ga0070678_1006015411 287
899 3300005457 Ga0070662_100001666 Ga0070662_10000166615 287
900 3300005457 Ga0070662_100002564 Ga0070662_1000025642 287
901 3300005457 Ga0070662_100037200 Ga0070662_1000372003 287
902 3300005458 Ga0070681_10009162 Ga0070681_100091626 287
903 3300005458 Ga0070681_10017661 Ga0070681_100176618 287
904 3300005458 Ga0070681_10038004 Ga0070681_100380044 287
905 3300005458 Ga0070681_10085486 Ga0070681_100854862 287
906 3300005459 Ga0068867_100004614 Ga0068867_10000461412 287
907 3300005459 Ga0068867_100005662 Ga0068867_1000056628 287
908 3300005466 Ga0070685_10006948 Ga0070685_100069482 287
909 3300005466 Ga0070685_10060826 Ga0070685_100608262 287
910 3300005467 Ga0070706_100008099 Ga0070706_1000080992 287
911 3300005467 Ga0070706_100026434 Ga0070706_1000264342 287
912 3300005467 Ga0070706_100133062 Ga0070706_1001330622 287
913 3300005467 Ga0070706_100157311 Ga0070706_1001573112 287
914 3300005468 Ga0070707_100001543 Ga0070707_10000154312 287
915 3300005468 Ga0070707_100004554 Ga0070707_1000045546 287
916 3300005468 Ga0070707_100005782 Ga0070707_1000057823 287
917 3300005468 Ga0070707_100005986 Ga0070707_1000059864 287
918 3300005468 Ga0070707_100048743 Ga0070707_1000487432 287
919 3300005471 Ga0070698_100004215 Ga0070698_1000042154 287
920 3300005471 Ga0070698_100025889 Ga0070698_1000258892 287
921 3300005471 Ga0070698_100129567 Ga0070698_1001295672 287
922 3300005518 Ga0070699_100000945 Ga0070699_10000094510 287
923 3300005518 Ga0070699_100025311 Ga0070699_1000253115 287
924 3300005518 Ga0070699_100074275 Ga0070699_1000742752 287
925 3300005518 Ga0070699_100198039 Ga0070699_1001980392 287
926 3300005530 Ga0070679_100007489 Ga0070679_1000074893 287
927 3300005530 Ga0070679_100042170 Ga0070679_1000421704 287
928 3300005530 Ga0070679_100044073 Ga0070679_1000440735 287
929 3300005530 Ga0070679_100060853 Ga0070679_1000608533 287
930 3300005530 Ga0070679_100071614 Ga0070679_1000716142 287
931 3300005535 Ga0070684_100000894 Ga0070684_10000089422 287
932 3300005535 Ga0070684_100054573 Ga0070684_1000545732 287
933 3300005535 Ga0070684_100147943 Ga0070684_1001479432 287
934 3300005536 Ga0070697_100000582 Ga0070697_10000058218 287
935 3300005536 Ga0070697_100018950 Ga0070697_1000189503 287
936 3300005536 Ga0070697_100044697 Ga0070697_1000446973 287
937 3300005536 Ga0070697_100054382 Ga0070697_1000543822 287
938 3300005536 Ga0070697_100170879 Ga0070697_1001708792 287
939 3300005539 Ga0068853_100000770 Ga0068853_10000077012 287
940 3300005539 Ga0068853_100010158 Ga0068853_1000101582 287
941 3300005543 Ga0070672_100008661 Ga0070672_1000086615 287
942 3300005545 Ga0070695_100000741 Ga0070695_1000007417 287
943 3300005545 Ga0070695_100026614 Ga0070695_1000266143 287
944 3300005545 Ga0070695_100479347 Ga0070695_1004793471 287
945 3300005546 Ga0070696_100005009 Ga0070696_1000050098 287
946 3300005546 Ga0070696_100006635 Ga0070696_1000066352 287
947 3300005547 Ga0070693_100000418 Ga0070693_1000004185 287
948 3300005547 Ga0070693_100001405 Ga0070693_1000014057 287
949 3300005547 Ga0070693_100411193 Ga0070693_1004111931 287
950 3300005548 Ga0070665_100059697 Ga0070665_1000596975 287
951 3300005548 Ga0070665_100076797 Ga0070665_1000767972 287
952 3300005549 Ga0070704_100000428 Ga0070704_10000042815 287
953 3300005549 Ga0070704_100000772 Ga0070704_10000077211 287
954 3300005549 Ga0070704_100006965 Ga0070704_1000069655 287
955 3300005549 Ga0070704_100088006 Ga0070704_1000880061 287
956 3300005549 Ga0070704_100353715 Ga0070704_1003537152 287
957 3300005563 Ga0068855_100001154 Ga0068855_10000115419 287
958 3300005563 Ga0068855_100007545 Ga0068855_10000754514 287
959 3300005563 Ga0068855_100116783 Ga0068855_1001167833 287
960 3300005564 Ga0070664_100002406 Ga0070664_1000024064 287
961 3300005564 Ga0070664_100363973 Ga0070664_1003639731 287
962 3300005564 Ga0070664_100392677 Ga0070664_1003926772 287
963 3300005577 Ga0068857_100016930 Ga0068857_1000169305 287
964 3300005578 Ga0068854_100014300 Ga0068854_1000143004 287
965 3300005578 Ga0068854_100023974 Ga0068854_1000239742 287
966 3300005614 Ga0068856_100003112 Ga0068856_1000031126 287
967 3300005614 Ga0068856_100021406 Ga0068856_1000214062 287
968 3300005614 Ga0068856_100044461 Ga0068856_1000444616 287
969 3300005614 Ga0068856_100086371 Ga0068856_1000863713 287
970 3300005614 Ga0068856_100387666 Ga0068856_1003876662 287
971 3300005614 Ga0068856_100424473 Ga0068856_1004244732 287
972 3300005615 Ga0070702_100011295 Ga0070702_1000112954 287
973 3300005615 Ga0070702_100064532 Ga0070702_1000645323 287
974 3300005615 Ga0070702_100075856 Ga0070702_1000758562 287
975 3300005616 Ga0068852_100002115 Ga0068852_10000211515 287
976 3300005616 Ga0068852_100004876 Ga0068852_1000048769 287
977 3300005616 Ga0068852_100021891 Ga0068852_1000218916 287
978 3300005617 Ga0068859_100006242 Ga0068859_1000062427 287
979 3300005617 Ga0068859_100011156 Ga0068859_1000111562 287
980 3300005617 Ga0068859_100019359 Ga0068859_1000193595 287
981 3300005617 Ga0068859_100173819 Ga0068859_1001738192 287
982 3300005618 Ga0068864_100001224 Ga0068864_10000122420 287
983 3300005718 Ga0068866_10000301 Ga0068866_1000030116 287
984 3300005718 Ga0068866_10000527 Ga0068866_100005276 287
985 3300005719 Ga0068861_100057538 Ga0068861_1000575384 287
986 3300005719 Ga0068861_100344061 Ga0068861_1003440611 287
987 3300005834 Ga0068851_10084263 Ga0068851_100842632 287
988 3300005840 Ga0068870_10000280 Ga0068870_1000028016 287
989 3300005840 Ga0068870_10000354 Ga0068870_1000035416 287
990 3300005841 Ga0068863_100000340 Ga0068863_10000034027 287
991 3300005841 Ga0068863_100019545 Ga0068863_1000195455 287
992 3300005841 Ga0068863_100538014 Ga0068863_1005380142 287
993 3300005842 Ga0068858_100004859 Ga0068858_1000048599 287
994 3300005842 Ga0068858_100009915 Ga0068858_1000099155 287
995 3300005842 Ga0068858_100020715 Ga0068858_1000207153 287
996 3300005842 Ga0068858_100089416 Ga0068858_1000894162 287
997 3300005842 Ga0068858_100631469 Ga0068858_1006314692 287
998 3300005843 Ga0068860_100013035 Ga0068860_1000130358 287
999 3300005843 Ga0068860_100031227 Ga0068860_1000312273 287
1000 3300005844 Ga0068862_100015630 Ga0068862_1000156305 287
1001 3300005937 Ga0081455_10000007 Ga0081455_10000007205 287
1002 3300005981 Ga0081538_10013234 Ga0081538_100132342 287
1003 3300005981 Ga0081538_10047803 Ga0081538_100478032 287
1004 3300005981 Ga0081538_10066749 Ga0081538_100667492 287
1005 3300005983 Ga0081540_1024058 Ga0081540_10240582 287
1006 3300005985 Ga0081539_10000009 Ga0081539_10000009381 287
1007 3300006028 Ga0070717_10098072 Ga0070717_100980723 287
1008 3300006028 Ga0070717_10132896 Ga0070717_101328962 287
1009 3300006038 Ga0075365_10008838 Ga0075365_100088382 287
1010 3300006038 Ga0075365_10029017 Ga0075365_100290174 287
1011 3300006038 Ga0075365_10035993 Ga0075365_100359933 287
1012 3300006048 Ga0075363_100058287 Ga0075363_1000582872 287
1013 3300006051 Ga0075364_10002167 Ga0075364_100021679 287
1014 3300006051 Ga0075364_10021617 Ga0075364_100216172 287
1015 3300006058 Ga0075432_10036358 Ga0075432_100363582 287
1016 3300006173 Ga0070716_100017441 Ga0070716_1000174413 287
1017 3300006175 Ga0070712_100299661 Ga0070712_1002996612 287
1018 3300006177 Ga0075362_10015262 Ga0075362_100152623 287
1019 3300006177 Ga0075362_10034931 Ga0075362_100349312 287
1020 3300006178 Ga0075367_10012900 Ga0075367_100129004 287
1021 3300006178 Ga0075367_10031905 Ga0075367_100319052 287
1022 3300006186 Ga0075369_10008188 Ga0075369_100081882 287
1023 3300006195 Ga0075366_10125502 Ga0075366_101255021 287
1024 3300006237 Ga0097621_100023624 Ga0097621_1000236242 287
1025 3300006237 Ga0097621_100061761 Ga0097621_1000617613 287
1026 3300006237 Ga0097621_100104722 Ga0097621_1001047222 287
1027 3300006353 Ga0075370_10048586 Ga0075370_100485863 287
1028 3300006353 Ga0075370_10127830 Ga0075370_101278302 287
1029 3300006358 Ga0068871_100000301 Ga0068871_10000030122 287
1030 3300006358 Ga0068871_100009125 Ga0068871_1000091256 287
1031 3300006358 Ga0068871_100108380 Ga0068871_1001083802 287
1032 3300006358 Ga0068871_100160284 Ga0068871_1001602842 287
1033 3300006844 Ga0075428_100010432 Ga0075428_1000104326 287
1034 3300006844 Ga0075428_100015421 Ga0075428_1000154215 287
1035 3300006844 Ga0075428_100297474 Ga0075428_1002974742 287
1036 3300006846 Ga0075430_100010397 Ga0075430_1000103978 287
1037 3300006846 Ga0075430_100128790 Ga0075430_1001287903 287
1038 3300006846 Ga0075430_100152287 Ga0075430_1001522872 287
1039 3300006846 Ga0075430_100262916 Ga0075430_1002629162 287
1040 3300006847 Ga0075431_100000689 Ga0075431_1000006894 287
1041 3300006847 Ga0075431_100000802 Ga0075431_10000080226 287
1042 3300006847 Ga0075431_100012575 Ga0075431_1000125755 287
1043 3300006847 Ga0075431_100025533 Ga0075431_1000255338 287
1044 3300006847 Ga0075431_100053455 Ga0075431_1000534554 287
1045 3300006852 Ga0075433_10000276 Ga0075433_1000027625 287
1046 3300006852 Ga0075433_10005682 Ga0075433_100056824 287
1047 3300006852 Ga0075433_10009124 Ga0075433_100091243 287
1048 3300006852 Ga0075433_10014960 Ga0075433_100149606 287
1049 3300006852 Ga0075433_10084163 Ga0075433_100841633 287
1050 3300006852 Ga0075433_10106133 Ga0075433_101061333 287
1051 3300006852 Ga0075433_10162345 Ga0075433_101623452 287
1052 3300006871 Ga0075434_100000597 Ga0075434_10000059716 287
1053 3300006871 Ga0075434_100001420 Ga0075434_10000142012 287
1054 3300006871 Ga0075434_100008472 Ga0075434_1000084728 287
1055 3300006871 Ga0075434_100017859 Ga0075434_1000178592 287
1056 3300006871 Ga0075434_100044791 Ga0075434_1000447913 287
1057 3300006871 Ga0075434_100075504 Ga0075434_1000755044 287
1058 3300006871 Ga0075434_100142880 Ga0075434_1001428802 287
1059 3300006880 Ga0075429_100058076 Ga0075429_1000580762 287
1060 3300006914 Ga0075436_100004744 Ga0075436_1000047449 287
1061 3300006914 Ga0075436_100007341 Ga0075436_1000073418 287
1062 3300006914 Ga0075436_100024561 Ga0075436_1000245612 287
1063 3300006914 Ga0075436_100039347 Ga0075436_1000393472 287
1064 3300006914 Ga0075436_100069505 Ga0075436_1000695052 287
1065 3300006931 Ga0097620_100006242 Ga0097620_1000062427 287
1066 3300006931 Ga0097620_100011157 Ga0097620_1000111572 287
1067 3300006931 Ga0097620_100173817 Ga0097620_1001738172 287
1068 3300006948 Ga0099826_10001604 Ga0099826_100016046 287
1069 3300006948 Ga0099826_10141128 Ga0099826_101411282 287
1070 3300007076 Ga0075435_100000328 Ga0075435_10000032815 287
1071 3300007076 Ga0075435_100012560 Ga0075435_1000125606 287
1072 3300007076 Ga0075435_100112587 Ga0075435_1001125872 287
1073 3300007076 Ga0075435_100203262 Ga0075435_1002032622 287
1074 3300007076 Ga0075435_100248681 Ga0075435_1002486812 287
1075 3300007265 Ga0099794_10018817 Ga0099794_100188172 287
1076 3300009036 Ga0105244_10094140 Ga0105244_100941401 287
1077 3300009093 Ga0105240_10070766 Ga0105240_100707665 287
1078 3300009094 Ga0111539_10013178 Ga0111539_100131789 287
1079 3300009094 Ga0111539_10013469 Ga0111539_100134696 287
1080 3300009094 Ga0111539_10345404 Ga0111539_103454043 287
1081 3300009094 Ga0111539_10348986 Ga0111539_103489862 287
1082 3300009098 Ga0105245_10009808 Ga0105245_100098082 287
1083 3300009098 Ga0105245_10009817 Ga0105245_100098172 287
1084 3300009098 Ga0105245_10010701 Ga0105245_100107013 287
1085 3300009098 Ga0105245_10018932 Ga0105245_100189323 287
1086 3300009098 Ga0105245_10056957 Ga0105245_100569574 287
1087 3300009098 Ga0105245_10123740 Ga0105245_101237401 287
1088 3300009101 Ga0105247_10018307 Ga0105247_100183074 287
1089 3300009101 Ga0105247_10020638 Ga0105247_100206381 287
1090 3300009147 Ga0114129_10002794 Ga0114129_1000279423 287
1091 3300009147 Ga0114129_10007546 Ga0114129_100075466 287
1092 3300009147 Ga0114129_10013314 Ga0114129_100133148 287
1093 3300009147 Ga0114129_10028184 Ga0114129_100281846 287
1094 3300009147 Ga0114129_10040610 Ga0114129_100406103 287
1095 3300009147 Ga0114129_10064301 Ga0114129_100643013 287
1096 3300009147 Ga0114129_10253007 Ga0114129_102530072 287
1097 3300009148 Ga0105243_10004388 Ga0105243_100043888 287
1098 3300009148 Ga0105243_10038463 Ga0105243_100384633 287
1099 3300009148 Ga0105243_10044624 Ga0105243_100446242 287
1100 3300009174 Ga0105241_10001943 Ga0105241_100019432 287
1101 3300009174 Ga0105241_10008605 Ga0105241_100086057 287
1102 3300009174 Ga0105241_10095574 Ga0105241_100955742 287
1103 3300009174 Ga0105241_10678090 Ga0105241_106780901 287
1104 3300009176 Ga0105242_10004469 Ga0105242_100044695 287
1105 3300009176 Ga0105242_10007706 Ga0105242_100077066 287
1106 3300009176 Ga0105242_10352227 Ga0105242_103522272 287
1107 3300009176 Ga0105242_10369484 Ga0105242_103694842 287
1108 3300009177 Ga0105248_10003102 Ga0105248_1000310218 287
1109 3300009177 Ga0105248_10043504 Ga0105248_100435044 287
1110 3300009177 Ga0105248_10153536 Ga0105248_101535362 287
1111 3300009177 Ga0105248_10184723 Ga0105248_101847232 287
1112 3300009177 Ga0105248_10229395 Ga0105248_102293952 287
1113 3300009545 Ga0105237_10130541 Ga0105237_101305413 287
1114 3300009545 Ga0105237_10160339 Ga0105237_101603392 287
1115 3300009551 Ga0105238_10243423 Ga0105238_102434232 287
1116 3300009551 Ga0105238_10259306 Ga0105238_102593062 287
1117 3300009553 Ga0105249_10001599 Ga0105249_100015998 287
1118 3300010159 Ga0099796_10010105 Ga0099796_100101053 287
1119 3300010375 Ga0105239_10009752 Ga0105239_100097526 287
1120 3300011119 Ga0105246_10007217 Ga0105246_100072172 287
1121 3300011119 Ga0105246_10200123 Ga0105246_102001232 287
1122 3300013100 Ga0157373_10001456 Ga0157373_100014563 287
1123 3300013100 Ga0157373_10012576 Ga0157373_100125762 287
1124 3300013100 Ga0157373_10201140 Ga0157373_102011402 287
1125 3300013102 Ga0157371_10010606 Ga0157371_100106065 287
1126 3300013102 Ga0157371_10037389 Ga0157371_100373894 287
1127 3300013104 Ga0157370_10003331 Ga0157370_100033312 287
1128 3300013104 Ga0157370_10057468 Ga0157370_100574682 287
1129 3300013105 Ga0157369_10029042 Ga0157369_100290422 287
1130 3300013105 Ga0157369_10066145 Ga0157369_100661453 287
1131 3300013296 Ga0157374_10001695 Ga0157374_1000169515 287
1132 3300013296 Ga0157374_10002626 Ga0157374_1000262614 287
1133 3300013297 Ga0157378_10003374 Ga0157378_100033748 287
1134 3300013297 Ga0157378_10009719 Ga0157378_100097198 287
1135 3300013297 Ga0157378_10128094 Ga0157378_101280943 287
1136 3300013306 Ga0163162_10010828 Ga0163162_100108286 287
1137 3300013306 Ga0163162_10038833 Ga0163162_100388334 287
1138 3300013306 Ga0163162_10124956 Ga0163162_101249562 287
1139 3300013306 Ga0163162_10136322 Ga0163162_101363222 287
1140 3300013306 Ga0163162_10140377 Ga0163162_101403772 287
1141 3300013306 Ga0163162_10607117 Ga0163162_106071171 287
1142 3300013307 Ga0157372_10002144 Ga0157372_1000214416 287
1143 3300013307 Ga0157372_10004321 Ga0157372_1000432116 287
1144 3300013307 Ga0157372_10323860 Ga0157372_103238602 287
1145 3300013308 Ga0157375_10008254 Ga0157375_100082549 287
1146 3300013308 Ga0157375_10164395 Ga0157375_101643952 287
1147 3300014325 Ga0163163_10003775 Ga0163163_100037757 287
1148 3300014325 Ga0163163_10104554 Ga0163163_101045543 287
1149 3300014326 Ga0157380_10000891 Ga0157380_1000089115 287
1150 3300014497 Ga0182008_10086624 Ga0182008_100866242 287
1151 3300014745 Ga0157377_10000517 Ga0157377_100005175 287
1152 3300014968 Ga0157379_10002694 Ga0157379_100026947 287
1153 3300014968 Ga0157379_10011995 Ga0157379_100119958 287
1154 3300014969 Ga0157376_10000088 Ga0157376_1000008869 287
1155 3300014969 Ga0157376_10005595 Ga0157376_100055953 287
1156 3300014969 Ga0157376_10053185 Ga0157376_100531853 287
1157 3300015262 Ga0182007_10002663 Ga0182007_100026632 287
1158 3300017792 Ga0163161_10000144 Ga0163161_100001442 287
1159 3300021358 Ga0213873_10007625 Ga0213873_100076252 287
1160 3300021361 Ga0213872_10068185 Ga0213872_100681852 287
1161 3300021388 Ga0213875_10021717 Ga0213875_100217173 287
1162 3300025230 Ga0209563_100014 Ga0209563_100014570 287
1163 3300025245 Ga0207425_1005417 Ga0207425_10054174 287
1164 3300025258 Ga0209129_1012302 Ga0209129_10123021 287
1165 3300025263 Ga0209565_1000083 Ga0209565_100008346 287
1166 3300025271 Ga0207666_1000059 Ga0207666_100005918 287
1167 3300025273 Ga0209673_1000323 Ga0209673_100032343 287
1168 3300025273 Ga0209673_1001607 Ga0209673_10016074 287
1169 3300025284 Ga0209130_1000208 Ga0209130_100020855 287
1170 3300025290 Ga0207673_1000330 Ga0207673_10003305 287
1171 3300025291 Ga0209675_1000081 Ga0209675_100008146 287
1172 3300025294 Ga0209025_1006047 Ga0209025_10060478 287
1173 3300025294 Ga0209025_1027136 Ga0209025_10271362 287
1174 3300025294 Ga0209025_1052245 Ga0209025_10522452 287
1175 3300025295 Ga0209564_1009425 Ga0209564_10094252 287
1176 3300025297 Ga0209758_1000628 Ga0209758_100062810 287
1177 3300025298 Ga0209050_1006526 Ga0209050_10065266 287
1178 3300025303 Ga0209051_1000533 Ga0209051_100053320 287
1179 3300025303 Ga0209051_1030165 Ga0209051_10301652 287
1180 3300025304 Ga0209257_1000016 Ga0209257_1000016723 287
1181 3300025315 Ga0207697_10005773 Ga0207697_100057736 287
1182 3300025885 Ga0207653_10001520 Ga0207653_100015203 287
1183 3300025885 Ga0207653_10002470 Ga0207653_100024705 287
1184 3300025885 Ga0207653_10019309 Ga0207653_100193091 287
1185 3300025893 Ga0207682_10000509 Ga0207682_100005094 287
1186 3300025898 Ga0207692_10012403 Ga0207692_100124032 287
1187 3300025898 Ga0207692_10024508 Ga0207692_100245083 287
1188 3300025900 Ga0207710_10006153 Ga0207710_100061534 287
1189 3300025901 Ga0207688_10000167 Ga0207688_1000016728 287
1190 3300025901 Ga0207688_10026635 Ga0207688_100266352 287
1191 3300025903 Ga0207680_10008068 Ga0207680_100080686 287
1192 3300025903 Ga0207680_10027653 Ga0207680_100276532 287
1193 3300025903 Ga0207680_10187827 Ga0207680_101878272 287
1194 3300025904 Ga0207647_10006799 Ga0207647_100067998 287
1195 3300025904 Ga0207647_10049731 Ga0207647_100497311 287
1196 3300025905 Ga0207685_10100918 Ga0207685_101009182 287
1197 3300025906 Ga0207699_10014979 Ga0207699_100149792 287
1198 3300025906 Ga0207699_10018629 Ga0207699_100186292 287
1199 3300025907 Ga0207645_10000059 Ga0207645_100000594 287
1200 3300025907 Ga0207645_10000100 Ga0207645_1000010069 287
1201 3300025907 Ga0207645_10116715 Ga0207645_101167152 287
1202 3300025908 Ga0207643_10000007 Ga0207643_10000007180 287
1203 3300025908 Ga0207643_10000014 Ga0207643_1000001470 287
1204 3300025910 Ga0207684_10000370 Ga0207684_1000037010 287
1205 3300025910 Ga0207684_10002538 Ga0207684_100025388 287
1206 3300025910 Ga0207684_10021471 Ga0207684_100214714 287
1207 3300025910 Ga0207684_10026392 Ga0207684_100263924 287
1208 3300025910 Ga0207684_10033330 Ga0207684_100333302 287
1209 3300025910 Ga0207684_10060104 Ga0207684_100601043 287
1210 3300025910 Ga0207684_10215618 Ga0207684_102156181 287
1211 3300025911 Ga0207654_10017742 Ga0207654_100177422 287
1212 3300025911 Ga0207654_10027404 Ga0207654_100274042 287
1213 3300025911 Ga0207654_10166523 Ga0207654_101665232 287
1214 3300025911 Ga0207654_10192175 Ga0207654_101921751 287
1215 3300025912 Ga0207707_10000138 Ga0207707_1000013813 287
1216 3300025912 Ga0207707_10005018 Ga0207707_100050184 287
1217 3300025912 Ga0207707_10077610 Ga0207707_100776102 287
1218 3300025912 Ga0207707_10091096 Ga0207707_100910962 287
1219 3300025912 Ga0207707_10199984 Ga0207707_101999842 287
1220 3300025913 Ga0207695_10292264 Ga0207695_102922642 287
1221 3300025914 Ga0207671_10227462 Ga0207671_102274621 287
1222 3300025915 Ga0207693_10010251 Ga0207693_100102514 287
1223 3300025915 Ga0207693_10010690 Ga0207693_100106903 287
1224 3300025915 Ga0207693_10119313 Ga0207693_101193132 287
1225 3300025915 Ga0207693_10214991 Ga0207693_102149912 287
1226 3300025916 Ga0207663_10016769 Ga0207663_100167693 287
1227 3300025916 Ga0207663_10048579 Ga0207663_100485793 287
1228 3300025916 Ga0207663_10129197 Ga0207663_101291972 287
1229 3300025917 Ga0207660_10000041 Ga0207660_100000413 287
1230 3300025917 Ga0207660_10000848 Ga0207660_100008484 287
1231 3300025917 Ga0207660_10189221 Ga0207660_101892212 287
1232 3300025918 Ga0207662_10000195 Ga0207662_1000019529 287
1233 3300025919 Ga0207657_10000135 Ga0207657_1000013564 287
1234 3300025919 Ga0207657_10002386 Ga0207657_1000238618 287
1235 3300025919 Ga0207657_10011112 Ga0207657_100111123 287
1236 3300025920 Ga0207649_10001482 Ga0207649_100014822 287
1237 3300025920 Ga0207649_10003041 Ga0207649_100030418 287
1238 3300025921 Ga0207652_10002995 Ga0207652_100029952 287
1239 3300025921 Ga0207652_10005355 Ga0207652_1000535510 287
1240 3300025921 Ga0207652_10033023 Ga0207652_100330232 287
1241 3300025921 Ga0207652_10228996 Ga0207652_102289962 287
1242 3300025921 Ga0207652_10299556 Ga0207652_102995561 287
1243 3300025922 Ga0207646_10000466 Ga0207646_1000046626 287
1244 3300025922 Ga0207646_10007223 Ga0207646_100072232 287
1245 3300025922 Ga0207646_10025133 Ga0207646_100251333 287
1246 3300025922 Ga0207646_10066999 Ga0207646_100669993 287
1247 3300025923 Ga0207681_10001546 Ga0207681_1000154615 287
1248 3300025924 Ga0207694_10079410 Ga0207694_100794103 287
1249 3300025925 Ga0207650_10001317 Ga0207650_100013175 287
1250 3300025925 Ga0207650_10007958 Ga0207650_100079586 287
1251 3300025926 Ga0207659_10003760 Ga0207659_100037604 287
1252 3300025927 Ga0207687_10000072 Ga0207687_1000007271 287
1253 3300025927 Ga0207687_10002399 Ga0207687_100023998 287
1254 3300025927 Ga0207687_10004046 Ga0207687_100040464 287
1255 3300025927 Ga0207687_10040930 Ga0207687_100409302 287
1256 3300025927 Ga0207687_10069085 Ga0207687_100690852 287
1257 3300025928 Ga0207700_10009195 Ga0207700_100091957 287
1258 3300025928 Ga0207700_10083552 Ga0207700_100835522 287
1259 3300025928 Ga0207700_10102963 Ga0207700_101029632 287
1260 3300025928 Ga0207700_10115658 Ga0207700_101156582 287
1261 3300025929 Ga0207664_10001202 Ga0207664_100012029 287
1262 3300025929 Ga0207664_10025036 Ga0207664_100250363 287
1263 3300025929 Ga0207664_10079180 Ga0207664_100791802 287
1264 3300025931 Ga0207644_10001292 Ga0207644_1000129215 287
1265 3300025931 Ga0207644_10003302 Ga0207644_100033027 287
1266 3300025931 Ga0207644_10148953 Ga0207644_101489532 287
1267 3300025932 Ga0207690_10003300 Ga0207690_100033002 287
1268 3300025932 Ga0207690_10004975 Ga0207690_100049752 287
1269 3300025932 Ga0207690_10160875 Ga0207690_101608752 287
1270 3300025933 Ga0207706_10010659 Ga0207706_100106596 287
1271 3300025933 Ga0207706_10032369 Ga0207706_100323693 287
1272 3300025933 Ga0207706_10212362 Ga0207706_102123622 287
1273 3300025934 Ga0207686_10001034 Ga0207686_1000103412 287
1274 3300025934 Ga0207686_10001546 Ga0207686_100015467 287
1275 3300025934 Ga0207686_10224025 Ga0207686_102240252 287
1276 3300025935 Ga0207709_10001423 Ga0207709_1000142315 287
1277 3300025935 Ga0207709_10010841 Ga0207709_100108412 287
1278 3300025936 Ga0207670_10007269 Ga0207670_100072692 287
1279 3300025936 Ga0207670_10007607 Ga0207670_100076072 287
1280 3300025936 Ga0207670_10033916 Ga0207670_100339162 287
1281 3300025936 Ga0207670_10177187 Ga0207670_101771871 287
1282 3300025937 Ga0207669_10000176 Ga0207669_1000017629 287
1283 3300025937 Ga0207669_10021922 Ga0207669_100219223 287
1284 3300025938 Ga0207704_10013299 Ga0207704_100132992 287
1285 3300025939 Ga0207665_10028429 Ga0207665_100284292 287
1286 3300025940 Ga0207691_10008719 Ga0207691_100087198 287
1287 3300025940 Ga0207691_10024412 Ga0207691_100244123 287
1288 3300025941 Ga0207711_10001106 Ga0207711_1000110615 287
1289 3300025941 Ga0207711_10001412 Ga0207711_1000141219 287
1290 3300025941 Ga0207711_10054504 Ga0207711_100545042 287
1291 3300025941 Ga0207711_10297221 Ga0207711_102972212 287
1292 3300025942 Ga0207689_10000340 Ga0207689_1000034031 287
1293 3300025942 Ga0207689_10000366 Ga0207689_1000036617 287
1294 3300025942 Ga0207689_10075610 Ga0207689_100756103 287
1295 3300025942 Ga0207689_10239592 Ga0207689_102395921 287
1296 3300025942 Ga0207689_10258146 Ga0207689_102581462 287
1297 3300025942 Ga0207689_10273117 Ga0207689_102731171 287
1298 3300025944 Ga0207661_10000087 Ga0207661_100000872 287
1299 3300025944 Ga0207661_10340880 Ga0207661_103408801 287
1300 3300025945 Ga0207679_10000029 Ga0207679_1000002917 287
1301 3300025945 Ga0207679_10000212 Ga0207679_1000021228 287
1302 3300025945 Ga0207679_10038663 Ga0207679_100386633 287
1303 3300025949 Ga0207667_10000296 Ga0207667_1000029649 287
1304 3300025949 Ga0207667_10171393 Ga0207667_101713932 287
1305 3300025960 Ga0207651_10001426 Ga0207651_100014268 287
1306 3300025960 Ga0207651_10004291 Ga0207651_100042912 287
1307 3300025960 Ga0207651_10029362 Ga0207651_100293622 287
1308 3300025960 Ga0207651_10461367 Ga0207651_104613671 287
1309 3300025961 Ga0207712_10001547 Ga0207712_1000154715 287
1310 3300025961 Ga0207712_10384491 Ga0207712_103844912 287
1311 3300025981 Ga0207640_10001474 Ga0207640_100014742 287
1312 3300025981 Ga0207640_10004722 Ga0207640_100047223 287
1313 3300025981 Ga0207640_10078853 Ga0207640_100788532 287
1314 3300025986 Ga0207658_10005146 Ga0207658_100051467 287
1315 3300025986 Ga0207658_10049391 Ga0207658_100493912 287
1316 3300026023 Ga0207677_10005872 Ga0207677_100058727 287
1317 3300026023 Ga0207677_10007549 Ga0207677_100075491 287
1318 3300026023 Ga0207677_10032098 Ga0207677_100320982 287
1319 3300026023 Ga0207677_10072219 Ga0207677_100722192 287
1320 3300026035 Ga0207703_10001566 Ga0207703_1000156614 287
1321 3300026035 Ga0207703_10026810 Ga0207703_100268104 287
1322 3300026041 Ga0207639_10001773 Ga0207639_100017735 287
1323 3300026041 Ga0207639_10009108 Ga0207639_100091082 287
1324 3300026067 Ga0207678_10007393 Ga0207678_100073938 287
1325 3300026075 Ga0207708_10007017 Ga0207708_100070176 287
1326 3300026078 Ga0207702_10001150 Ga0207702_1000115013 287
1327 3300026078 Ga0207702_10015638 Ga0207702_100156382 287
1328 3300026078 Ga0207702_10065241 Ga0207702_100652412 287
1329 3300026078 Ga0207702_10208236 Ga0207702_102082362 287
1330 3300026088 Ga0207641_10011956 Ga0207641_100119562 287
1331 3300026088 Ga0207641_10014477 Ga0207641_100144774 287
1332 3300026088 Ga0207641_10153500 Ga0207641_101535002 287
1333 3300026088 Ga0207641_10505287 Ga0207641_105052871 287
1334 3300026089 Ga0207648_10001239 Ga0207648_1000123918 287
1335 3300026089 Ga0207648_10008796 Ga0207648_100087964 287
1336 3300026089 Ga0207648_10249840 Ga0207648_102498402 287
1337 3300026089 Ga0207648_10276416 Ga0207648_102764162 287
1338 3300026095 Ga0207676_10000429 Ga0207676_1000042911 287
1339 3300026095 Ga0207676_10001946 Ga0207676_100019468 287
1340 3300026095 Ga0207676_10004807 Ga0207676_100048078 287
1341 3300026116 Ga0207674_10000684 Ga0207674_1000068431 287
1342 3300026116 Ga0207674_10000697 Ga0207674_1000069749 287
1343 3300026116 Ga0207674_10028853 Ga0207674_100288533 287
1344 3300026116 Ga0207674_10416664 Ga0207674_104166642 287
1345 3300026118 Ga0207675_100005465 Ga0207675_1000054658 287
1346 3300026118 Ga0207675_100013598 Ga0207675_1000135989 287
1347 3300026121 Ga0207683_10000029 Ga0207683_100000294 287
1348 3300026121 Ga0207683_10001317 Ga0207683_100013178 287
1349 3300026121 Ga0207683_10239388 Ga0207683_102393882 287
1350 3300026142 Ga0207698_10018865 Ga0207698_100188652 287
1351 3300026142 Ga0207698_10023805 Ga0207698_100238052 287
1352 3300026142 Ga0207698_10123448 Ga0207698_101234481 287
1353 3300027666 Ga0209282_1002509 Ga0209282_10025095 287
1354 3300027671 Ga0209588_1050337 Ga0209588_10503372 287
1355 3300027695 Ga0209966_1013384 Ga0209966_10133842 287
1356 3300027717 Ga0209998_10001898 Ga0209998_100018982 287
1357 3300027876 Ga0209974_10002097 Ga0209974_100020978 287
1358 3300027907 Ga0207428_10000100 Ga0207428_10000100132 287
1359 3300027907 Ga0207428_10000119 Ga0207428_1000011942 287
1360 3300027907 Ga0207428_10010298 Ga0207428_100102983 287
1361 3300028379 Ga0268266_10040823 Ga0268266_100408235 287
1362 3300028379 Ga0268266_10049818 Ga0268266_100498184 287
1363 3300028379 Ga0268266_10098594 Ga0268266_100985942 287
1364 3300028380 Ga0268265_10024411 Ga0268265_100244113 287
1365 3300028381 Ga0268264_10002968 Ga0268264_1000296815 287
1366 3300028381 Ga0268264_10021447 Ga0268264_100214476 287
1367 3300028381 Ga0268264_10070544 Ga0268264_100705443 287
1368 3300028794 Ga0307515_10088375 Ga0307515_100883752 287
1369 3300030731 Ga0316177_1194083 Ga0316177_11940833 287
1370 3300030732 Ga0316176_1194494 Ga0316176_11944942 287
1371 3300030733 Ga0314311_1187085 Ga0314311_11870853 287
1372 3300030735 Ga0316178_1021905 Ga0316178_10219055 287
1373 3300031235 Ga0265330_10007169 Ga0265330_100071692 287
1374 3300031249 Ga0265339_10143330 Ga0265339_101433302 287
1375 3300031456 Ga0307513_10178655 Ga0307513_101786552 287
1376 3300031456 Ga0307513_10440065 Ga0307513_104400651 287
1377 3300031548 Ga0307408_100000039 Ga0307408_100000039176 287
1378 3300031548 Ga0307408_100020361 Ga0307408_1000203613 287
1379 3300031548 Ga0307408_100089774 Ga0307408_1000897743 287
1380 3300031548 Ga0307408_100145730 Ga0307408_1001457302 287
1381 3300031548 Ga0307408_100202823 Ga0307408_1002028232 287
1382 3300031548 Ga0307408_100224907 Ga0307408_1002249072 287
1383 3300031649 Ga0307514_10063859 Ga0307514_100638593 287
1384 3300031711 Ga0265314_10171258 Ga0265314_101712582 287
1385 3300031901 Ga0307406_10002205 Ga0307406_100022054 287
1386 3300031901 Ga0307406_10102155 Ga0307406_101021552 287
1387 3300031911 Ga0307412_10272685 Ga0307412_102726852 287
1388 3300031995 Ga0307409_100228525 Ga0307409_1002285252 287
1389 3300031995 Ga0307409_100264339 Ga0307409_1002643392 287
1390 3300032002 Ga0307416_100063101 Ga0307416_1000631012 287
1391 3300032002 Ga0307416_100077640 Ga0307416_1000776402 287
1392 3300032004 Ga0307414_10299834 Ga0307414_102998342 287
1393 3300032005 Ga0307411_10055799 Ga0307411_100557992 287
1394 3300032005 Ga0307411_10138759 Ga0307411_101387592 287
1395 3300034816 Ga0373930_0023220 Ga0373930_0023220_191_1078 287
1396 3300034957 Ga0373938_0003291 Ga0373938_0003291_599_1486 287
1397 3300035083 Ga0373926_0028170 Ga0373926_0028170_329_1225 287
1398 3300035086 Ga0373934_0043424 Ga0373934_0043424_792_1679 287
1399 3300035088 Ga0373940_0003500 Ga0373940_0003500_75_962 287
1400 3300035090 Ga0373949_0001408 Ga0373949_0001408_3949_4836 287
1401 3300035091 Ga0373951_0003300 Ga0373951_0003300_462_1349 287
1402 3300035091 Ga0373951_0024329 Ga0373951_0024329_458_1339 287
1403 3300035092 Ga0373952_0009002 Ga0373952_0009002_156_1037 287
1404 3300035111 Ga0373923_0068441 Ga0373923_0068441_236_1099 287
1405 3300035114 Ga0373939_0000003 Ga0373939_0000003_31097_31984 287
1406 3300035114 Ga0373939_0001446 Ga0373939_0001446_582_1469 287
1407 3300035115 Ga0373941_0035388 Ga0373941_0035388_90_977 287
1408 3300035116 Ga0373945_0004052 Ga0373945_0004052_3202_4065 287
1409 3300035117 Ga0373953_0035690 Ga0373953_0035690_629_1492 287
1410 3300035118 Ga0373954_0001840 Ga0373954_0001840_922_1785 287
1411 3300035118 Ga0373954_0016077 Ga0373954_0016077_665_1552 287
1412 3300035120 Ga0373957_0017254 Ga0373957_0017254_1465_2328 287
1413 3300035120 Ga0373957_0094294 Ga0373957_0094294_75_962 287
1414 3300035121 Ga0373960_0008398 Ga0373960_0008398_1090_1971 287
1415 3300035121 Ga0373960_0010251 Ga0373960_0010251_302_1189 287
1416 3300035170 Ga0373943_0098144 Ga0373943_0098144_183_1070 287
1417 3300035171 Ga0373946_0013975 Ga0373946_0013975_1091_1978 287
1418 3300035171 Ga0373946_0082579 Ga0373946_0082579_500_1396 287
1419 3300035172 Ga0373955_0006536 Ga0373955_0006536_1024_1887 287
1420 3300035207 Ga0373942_0010868 Ga0373942_0010868_162_1025 287
1421 3300035207 Ga0373942_0035350 Ga0373942_0035350_399_1295 287
1422 3300035241 Ga0373961_0001706 Ga0373961_0001706_125_1012 287
1423 3300035241 Ga0373961_0013496 Ga0373961_0013496_638_1525 287
1424 3300035242 Ga0373962_0018254 Ga0373962_0018254_162_1049 287
1425 3300035242 Ga0373962_0029896 Ga0373962_0029896_552_1433 287
1426 3300035410 Ga0373924_0009830 Ga0373924_0009830_1070_1933 287
1427 3300035410 Ga0373924_0012738 Ga0373924_0012738_1190_2077 287
1428 3300035410 Ga0373924_0034289 Ga0373924_0034289_537_1424 287
1429 3300035691 Ga0373931_0001534 Ga0373931_0001534_5966_6853 287
1430 3300035691 Ga0373931_0008185 Ga0373931_0008185_1936_2823 287
1431 3300035691 Ga0373931_0013914 Ga0373931_0013914_1834_2715 287
1432 3300035691 Ga0373931_0152206 Ga0373931_0152206_113_1009 287
1433 3300035692 Ga0373935_0020975 Ga0373935_0020975_817_1704 287
1434 3300035695 Ga0373927_0009992 Ga0373927_0009992_2675_3538 287
1435 3300035724 Ga0373933_0009434 Ga0373933_0009434_1175_2062 287
1436 3300035724 Ga0373933_0056290 Ga0373933_0056290_161_1048 287
1437 3300035725 Ga0373947_0032531 Ga0373947_0032531_1119_2006 287
1438 3300035725 Ga0373947_0033135 Ga0373947_0033135_1208_2071 287
1439 3300036401 Ga0373937_0020416 Ga0373937_0020416_252_1139 287
1440 3300036401 Ga0373937_0030398 Ga0373937_0030398_976_1863 287
1441 3300036401 Ga0373937_0150551 Ga0373937_0150551_1045_1932 287
1442 3300036401 Ga0373937_0417361 Ga0373937_0417361_10_873 287
1443 3300036401 Ga0373937_0723199 Ga0373937_0723199_60_923 287
1444 3300036401 Ga0373937_0723241 Ga0373937_0723241_20_883 287
1445 3300037068 Ga0373925_0004459 Ga0373925_0004459_1288_2151 287
1446 3300037068 Ga0373925_0037130 Ga0373925_0037130_1191_2054 287
1447 3300037068 Ga0373925_0056356 Ga0373925_0056356_1811_2698 287
1448 3300037068 Ga0373925_0127429 Ga0373925_0127429_484_1371 287
1449 3300037312 Ga0395899_0003231 Ga0395899_0003231_5247_6131 287
1450 3300037312 Ga0395899_0168227 Ga0395899_0168227_558_1442 287
1451 3300037418 Ga0395900_0000067 Ga0395900_0000067_137585_138472 287
1452 3300037466 Ga0395898_0000214 Ga0395898_0000214_137559_138446 287
1453 3300037471 Ga0395905_0000060 Ga0395905_0000060_55487_56374 287
1454 3300037471 Ga0395905_0001506 Ga0395905_0001506_20386_21276 287
1455 3300037471 Ga0395905_0030893 Ga0395905_0030893_3765_4652 287
1456 3300037471 Ga0395905_0038449 Ga0395905_0038449_1567_2454 287
1457 3300037471 Ga0395905_0068103 Ga0395905_0068103_2062_2949 287
1458 3300037471 Ga0395905_0418529 Ga0395905_0418529_153_1037 287
1459 3300037853 Ga0436364_0010042 Ga0436364_0010042_993_1889 287
1460 3300037853 Ga0436364_0062636 Ga0436364_0062636_678_1577 287
1461 3300037853 Ga0436364_0566936 Ga0436364_0566936_1368_2255 287
1462 3300037853 Ga0436364_0839268 Ga0436364_0839268_138_1010 287
1463 3300037853 Ga0436364_1169737 Ga0436364_1169737_543_1439 287
1464 3300038443 Ga0395901_0000063 Ga0395901_0000063_11022_11909 287
1465 3300038996 Ga0242420_015158 Ga0242420_015158_405_1292 287
1466 3300039437 Ga0436365_1916586 Ga0436365_1916586_129_1025 287
1467 3300039438 Ga0436360_0286842 Ga0436360_0286842_499_1386 287
1468 3300039447 Ga0436361_0243008 Ga0436361_0243008_228_1112 287
1469 3300039447 Ga0436361_0953105 Ga0436361_0953105_537_1400 287
1470 3300039447 Ga0436361_1161676 Ga0436361_1161676_121_1005 287
1471 3300039450 Ga0436363_0156420 Ga0436363_0156420_1293_2180 287
1472 3300039453 Ga0436362_0196742 Ga0436362_0196742_983_1912 287
1473 3300039453 Ga0436362_0834131 Ga0436362_0834131_3493_4380 287
1474 3300042001 Ga0439441_005968 Ga0439441_005968_668_1555 287
1475 3300042005 Ga0439448_0006616 Ga0439448_0006616_228_1109 287
1476 3300042008 Ga0439450_011365 Ga0439450_011365_804_1691 287
1477 3300042010 Ga0439452_007901 Ga0439452_007901_1622_2497 287
1478 3300042438 Ga0439459_0000155 Ga0439459_0000155_3789_4670 287
1479 3300042439 Ga0439464_0000442 Ga0439464_0000442_1308_2189 287
1480 3300042461 Ga0439460_0000838 Ga0439460_0000838_4462_5343 287
1481 3300042876 Ga0451577_0001635 Ga0451577_0001635_2326_3213 287
1482 3300042876 Ga0451577_0003247 Ga0451577_0003247_3315_4196 287
1483 3300042876 Ga0451577_0005276 Ga0451577_0005276_8202_9086 287
1484 3300042876 Ga0451577_0463770 Ga0451577_0463770_100_966 287
1485 3300044673 Ga0453683_0006980 Ga0453683_0006980_4616_5503 287
1486 3300044712 Ga0453684_0003087 Ga0453684_0003087_11930_12808 287
1487 3300044712 Ga0453684_0127159 Ga0453684_0127159_1909_2796 287
1488 3300044712 Ga0453684_0147429 Ga0453684_0147429_1250_2134 287
1489 3300044712 Ga0453684_0475312 Ga0453684_0475312_316_1197 287
1490 3300044735 Ga0466968_0078020 Ga0466968_0078020_91_960 287
1491 3300045051 Ga0451576_0001433 Ga0451576_0001433_13954_14838 287
1492 3300045051 Ga0451576_0019396 Ga0451576_0019396_3033_3914 287
1493 3300045051 Ga0451576_0021367 Ga0451576_0021367_4737_5624 287
1494 3300045051 Ga0451576_0048843 Ga0451576_0048843_391_1272 287
1495 3300045051 Ga0451576_0342782 Ga0451576_0342782_492_1373 287
1496 3300046454 Ga0495592_0024915 Ga0495592_0024915_1488_2375 287
1497 3300046454 Ga0495592_0086140 Ga0495592_0086140_1186_2073 287
1498 3300046455 Ga0495603_0005200 Ga0495603_0005200_757_1641 287
1499 3300046455 Ga0495603_0095269 Ga0495603_0095269_670_1533 287
1500 3300046459 Ga0495629_0000037 Ga0495629_0000037_28358_29260 287
1501 3300046459 Ga0495629_0001156 Ga0495629_0001156_15593_16513 287
1502 3300046459 Ga0495629_0001563 Ga0495629_0001563_5373_6257 287
1503 3300046459 Ga0495629_0033042 Ga0495629_0033042_1454_2338 287
1504 3300046459 Ga0495629_0042196 Ga0495629_0042196_928_1791 287
1505 3300046460 Ga0495638_0000224 Ga0495638_0000224_36036_36914 287
1506 3300046460 Ga0495638_0043959 Ga0495638_0043959_66_953 287
1507 3300046460 Ga0495638_0222369 Ga0495638_0222369_168_1043 287
1508 3300046462 Ga0495651_0000976 Ga0495651_0000976_3294_4181 287
1509 3300046462 Ga0495651_0088242 Ga0495651_0088242_682_1545 287
1510 3300046462 Ga0495651_0094542 Ga0495651_0094542_339_1226 287
1511 3300046463 Ga0495653_0000048 Ga0495653_0000048_81009_81911 287
1512 3300046463 Ga0495653_0024941 Ga0495653_0024941_1036_1923 287
1513 3300046463 Ga0495653_0030237 Ga0495653_0030237_1030_1914 287
1514 3300046471 Ga0495650_0001789 Ga0495650_0001789_12041_12925 287
1515 3300046472 Ga0495580_0002319 Ga0495580_0002319_3066_3950 287
1516 3300046472 Ga0495580_0006778 Ga0495580_0006778_2048_2950 287
1517 3300046472 Ga0495580_0010671 Ga0495580_0010671_3629_4531 287
1518 3300046472 Ga0495580_0031152 Ga0495580_0031152_1108_1971 287
1519 3300046472 Ga0495580_0077628 Ga0495580_0077628_1084_1947 287
1520 3300046472 Ga0495580_0296838 Ga0495580_0296838_26_913 287
1521 3300046473 Ga0495582_0044004 Ga0495582_0044004_26_913 287
1522 3300046473 Ga0495582_0083908 Ga0495582_0083908_847_1749 287
1523 3300046475 Ga0495639_0038886 Ga0495639_0038886_853_1716 287
1524 3300046477 Ga0495664_0018484 Ga0495664_0018484_1347_2234 287
1525 3300046499 Ga0495594_0250500 Ga0495594_0250500_22_885 287
1526 3300046506 Ga0495583_0003335 Ga0495583_0003335_10554_11456 287
1527 3300046506 Ga0495583_0031542 Ga0495583_0031542_177_1061 287
1528 3300046506 Ga0495583_0075780 Ga0495583_0075780_503_1378 287
1529 3300046507 Ga0495606_0007939 Ga0495606_0007939_2518_3402 287
1530 3300046507 Ga0495606_0015733 Ga0495606_0015733_3323_4207 287
1531 3300046511 Ga0495608_0005730 Ga0495608_0005730_6308_7195 287
1532 3300046511 Ga0495608_0059291 Ga0495608_0059291_452_1339 287
1533 3300046514 Ga0495618_0050931 Ga0495618_0050931_1425_2312 287
1534 3300046514 Ga0495618_0236487 Ga0495618_0236487_16_903 287
1535 3300046516 Ga0495628_0008183 Ga0495628_0008183_3963_4865 287
1536 3300046516 Ga0495628_0253991 Ga0495628_0253991_20_907 287
1537 3300046517 Ga0495630_0020974 Ga0495630_0020974_2522_3424 287
1538 3300046517 Ga0495630_0106023 Ga0495630_0106023_154_1041 287
1539 3300046524 Ga0495648_0022823 Ga0495648_0022823_882_1784 287
1540 3300046524 Ga0495648_0102298 Ga0495648_0102298_297_1199 287
1541 3300046525 Ga0495663_0076584 Ga0495663_0076584_79_963 287
1542 3300046528 Ga0495642_0005361 Ga0495642_0005361_967_1851 287
1543 3300046529 Ga0495652_0010377 Ga0495652_0010377_5059_5943 287
1544 3300046529 Ga0495652_0021029 Ga0495652_0021029_3419_4306 287
1545 3300046529 Ga0495652_0037153 Ga0495652_0037153_711_1598 287
1546 3300046530 Ga0495654_0063047 Ga0495654_0063047_148_1032 287
1547 3300046531 Ga0495665_0000612 Ga0495665_0000612_6065_6949 287
1548 3300046531 Ga0495665_0021631 Ga0495665_0021631_1303_2166 287
1549 3300046533 Ga0495640_0168370 Ga0495640_0168370_477_1340 287
1550 3300046535 Ga0495586_0009675 Ga0495586_0009675_3616_4500 287
1551 3300046536 Ga0495587_0000911 Ga0495587_0000911_15684_16571 287
1552 3300046536 Ga0495587_0066254 Ga0495587_0066254_185_1072 287
1553 3300046539 Ga0495621_0002683 Ga0495621_0002683_1036_1899 287
1554 3300046542 Ga0495597_0000116 Ga0495597_0000116_13352_14227 287
1555 3300046542 Ga0495597_0082770 Ga0495597_0082770_156_1040 287
1556 3300046543 Ga0495645_0002149 Ga0495645_0002149_6815_7699 287
1557 3300046543 Ga0495645_0013977 Ga0495645_0013977_4635_5519 287
1558 3300046543 Ga0495645_0116543 Ga0495645_0116543_233_1120 287
1559 3300046543 Ga0495645_0126428 Ga0495645_0126428_107_970 287
1560 3300046559 Ga0495667_0003799 Ga0495667_0003799_7357_8244 287
1561 3300046559 Ga0495667_0090727 Ga0495667_0090727_611_1474 287
1562 3300046559 Ga0495667_0099507 Ga0495667_0099507_315_1202 287
1563 3300046642 Ga0495634_0232010 Ga0495634_0232010_137_1021 287
1564 3300046648 Ga0495611_0081780 Ga0495611_0081780_515_1417 287
1565 3300046660 Ga0495625_0001339 Ga0495625_0001339_6335_7198 287
1566 3300046663 Ga0495635_0010092 Ga0495635_0010092_2361_3248 287
1567 3300046663 Ga0495635_0033796 Ga0495635_0033796_2431_3315 287
1568 3300046664 Ga0495659_0011648 Ga0495659_0011648_159_1022 287
1569 3300046665 Ga0495661_0050951 Ga0495661_0050951_212_1087 287
1570 3300046674 Ga0495588_0049665 Ga0495588_0049665_819_1703 287
1571 3300046674 Ga0495588_0082506 Ga0495588_0082506_127_1002 287
1572 3300046675 Ga0495657_0024016 Ga0495657_0024016_1647_2534 287
1573 3300046675 Ga0495657_0181205 Ga0495657_0181205_129_1016 287
1574 3300046678 Ga0495599_0011662 Ga0495599_0011662_1349_2236 287
1575 3300046678 Ga0495599_0151313 Ga0495599_0151313_357_1244 287
1576 3300046679 Ga0495623_0023846 Ga0495623_0023846_1247_2134 287
1577 3300046679 Ga0495623_0036194 Ga0495623_0036194_1287_2171 287
1578 3300046679 Ga0495623_0053265 Ga0495623_0053265_357_1244 287
1579 3300046680 Ga0495646_0006008 Ga0495646_0006008_2533_3435 287
1580 3300046680 Ga0495646_0015480 Ga0495646_0015480_386_1270 287
1581 3300046680 Ga0495646_0028518 Ga0495646_0028518_1491_2378 287
1582 3300046681 Ga0495647_0039540 Ga0495647_0039540_465_1328 287
1583 3300046683 Ga0495658_0010276 Ga0495658_0010276_1784_2647 287
1584 3300046683 Ga0495658_0017275 Ga0495658_0017275_981_1844 287
1585 3300046683 Ga0495658_0035696 Ga0495658_0035696_298_1185 287
1586 3300046689 Ga0495613_0004559 Ga0495613_0004559_1793_2677 287
1587 3300046689 Ga0495613_0010190 Ga0495613_0010190_3270_4133 287
1588 3300046689 Ga0495613_0034682 Ga0495613_0034682_1987_2889 287
1589 3300046689 Ga0495613_0075962 Ga0495613_0075962_692_1579 287
1590 3300046690 Ga0495624_0010363 Ga0495624_0010363_3097_3981 287
1591 3300046690 Ga0495624_0044611 Ga0495624_0044611_1207_2094 287
1592 3300046691 Ga0495670_0115320 Ga0495670_0115320_255_1139 287
1593 3300046694 Ga0495649_0007039 Ga0495649_0007039_403_1287 287
1594 3300046694 Ga0495649_0027776 Ga0495649_0027776_963_1865 287
1595 3300046794 Ga0495589_0018414 Ga0495589_0018414_1787_2671 287
1596 3300046809 Ga0495600_0021667 Ga0495600_0021667_16_903 287
1597 3300046809 Ga0495600_0045959 Ga0495600_0045959_587_1474 287
1598 3300046809 Ga0495600_0056973 Ga0495600_0056973_766_1629 287
1599 3300046809 Ga0495600_0108390 Ga0495600_0108390_23_910 287
1600 3300047315 Ga0495581_0001747 Ga0495581_0001747_2048_2932 287
1601 3300047315 Ga0495581_0002351 Ga0495581_0002351_4567_5430 287
1602 3300047317 Ga0495604_0001863 Ga0495604_0001863_14740_15627 287
1603 3300047317 Ga0495604_0020790 Ga0495604_0020790_1807_2691 287
1604 3300047319 Ga0495674_0001578 Ga0495674_0001578_19034_19921 287
1605 3300047319 Ga0495674_0002056 Ga0495674_0002056_11318_12220 287
1606 3300047319 Ga0495674_0002205 Ga0495674_0002205_4775_5677 287
1607 3300047319 Ga0495674_0005323 Ga0495674_0005323_2399_3301 287
1608 3300047319 Ga0495674_0203242 Ga0495674_0203242_61_948 287
1609 3300047319 Ga0495674_0363455 Ga0495674_0363455_182_1066 287
1610 3300047320 Ga0495672_0057541 Ga0495672_0057541_598_1500 287
1611 3300047320 Ga0495672_0088939 Ga0495672_0088939_706_1593 287
1612 3300047322 Ga0495680_0007430 Ga0495680_0007430_2976_3860 287
1613 3300047322 Ga0495680_0016527 Ga0495680_0016527_2193_3080 287
1614 3300047322 Ga0495680_0028529 Ga0495680_0028529_2780_3667 287
1615 3300047322 Ga0495680_0040974 Ga0495680_0040974_2175_3038 287
1616 3300047323 Ga0495683_0019244 Ga0495683_0019244_895_1797 287
1617 3300047323 Ga0495683_0096770 Ga0495683_0096770_435_1319 287
1618 3300047444 Ga0495675_0053087 Ga0495675_0053087_860_1744 287
1619 3300047469 Ga0495673_0083582 Ga0495673_0083582_187_1089 287
1620 3300047471 Ga0495684_0011986 Ga0495684_0011986_4713_5576 287
1621 3300047471 Ga0495684_0015752 Ga0495684_0015752_1772_2659 287
1622 3300047471 Ga0495684_0210709 Ga0495684_0210709_215_1102 287
1623 3300047673 Ga0495593_0003668 Ga0495593_0003668_4137_5039 287
1624 3300047673 Ga0495593_0026716 Ga0495593_0026716_688_1572 287
1625 3300048088 Ga0495602_0012427 Ga0495602_0012427_1632_2516 287
1626 3300048088 Ga0495602_0013432 Ga0495602_0013432_7090_7977 287
1627 3300048088 Ga0495602_0040234 Ga0495602_0040234_2943_3830 287
1628 3300048089 Ga0495614_0039818 Ga0495614_0039818_806_1690 287
1629 3300048089 Ga0495614_0122828 Ga0495614_0122828_224_1087 287
1630 3300048903 Ga0496100_0002293 Ga0496100_0002293_7469_8353 287
1631 3300048903 Ga0496100_0013989 Ga0496100_0013989_914_1801 287
1632 3300048903 Ga0496100_0176376 Ga0496100_0176376_235_1119 287
1633 3300048904 Ga0496101_0003592 Ga0496101_0003592_905_1789 287
1634 3300048904 Ga0496101_0159102 Ga0496101_0159102_486_1373 287
1635 3300048905 Ga0496102_0005918 Ga0496102_0005918_3082_3966 287
1636 3300048905 Ga0496102_0273735 Ga0496102_0273735_629_1516 287
1637 3300048906 Ga0496103_0002596 Ga0496103_0002596_508_1395 287
1638 3300048906 Ga0496103_0071606 Ga0496103_0071606_217_1080 287
1639 3300048907 Ga0496104_0012609 Ga0496104_0012609_856_1740 287
1640 3300048907 Ga0496104_0013003 Ga0496104_0013003_1327_2211 287
1641 3300048907 Ga0496104_0059727 Ga0496104_0059727_779_1663 287
1642 3300048907 Ga0496104_0210022 Ga0496104_0210022_842_1729 287
1643 3300048907 Ga0496104_0226187 Ga0496104_0226187_363_1247 287
1644 3300048907 Ga0496104_0605812 Ga0496104_0605812_59_922 287
1645 3300048908 Ga0496105_0001841 Ga0496105_0001841_9045_9929 287
1646 3300048908 Ga0496105_0004700 Ga0496105_0004700_5178_6062 287
1647 3300048908 Ga0496105_0265993 Ga0496105_0265993_92_988 287
1648 3300048909 Ga0496106_0011982 Ga0496106_0011982_1751_2638 287
1649 3300048909 Ga0496106_0192365 Ga0496106_0192365_495_1382 287
1650 3300048909 Ga0496106_0253620 Ga0496106_0253620_69_944 287
1651 3300048910 Ga0496107_0028075 Ga0496107_0028075_508_1395 287
1652 3300048910 Ga0496107_0194657 Ga0496107_0194657_79_966 287
1653 3300048911 Ga0496108_0008415 Ga0496108_0008415_3377_4264 287
1654 3300048911 Ga0496108_0020388 Ga0496108_0020388_1256_2119 287
1655 3300048911 Ga0496108_0173537 Ga0496108_0173537_333_1217 287
1656 3300048912 Ga0496109_0000488 Ga0496109_0000488_32526_33413 287
1657 3300048912 Ga0496109_0089960 Ga0496109_0089960_1385_2248 287
1658 3300048912 Ga0496109_0151258 Ga0496109_0151258_665_1561 287
1659 3300048913 Ga0496110_0163165 Ga0496110_0163165_518_1402 287
1660 3300048913 Ga0496110_0264582 Ga0496110_0264582_635_1531 287
1661 3300048913 Ga0496110_0374126 Ga0496110_0374126_67_930 287
1662 3300048914 Ga0496111_0219626 Ga0496111_0219626_455_1351 287
1663 3300048915 Ga0496112_0008342 Ga0496112_0008342_5607_6470 287
1664 3300048915 Ga0496112_0175434 Ga0496112_0175434_998_1894 287
1665 3300048915 Ga0496112_0189155 Ga0496112_0189155_74_937 287
1666 3300048915 Ga0496112_0418747 Ga0496112_0418747_79_966 287
1667 3300048915 Ga0496112_0480506 Ga0496112_0480506_94_981 287
1668 3300048916 Ga0496113_0022983 Ga0496113_0022983_432_1319 287
1669 3300048916 Ga0496113_0109824 Ga0496113_0109824_596_1492 287
1670 3300048916 Ga0496113_0262484 Ga0496113_0262484_368_1252 287
1671 3300048917 Ga0496114_0004834 Ga0496114_0004834_3150_4034 287
1672 3300048917 Ga0496114_0134938 Ga0496114_0134938_961_1848 287
1673 3300048917 Ga0496114_0546153 Ga0496114_0546153_69_932 287
1674 3300048918 Ga0496115_0019198 Ga0496115_0019198_3677_4564 287
1675 3300048918 Ga0496115_0042078 Ga0496115_0042078_205_1089 287
1676 3300048919 Ga0496116_0027209 Ga0496116_0027209_653_1528 287
1677 3300048920 Ga0496117_0000105 Ga0496117_0000105_109781_110665 287
1678 3300048921 Ga0496118_0089002 Ga0496118_0089002_1247_2122 287
1679 3300048924 Ga0496121_0005938 Ga0496121_0005938_3894_4778 287
1680 3300048924 Ga0496121_0041760 Ga0496121_0041760_415_1290 287
1681 3300048924 Ga0496121_0171540 Ga0496121_0171540_66_953 287
1682 3300048925 Ga0496122_0025741 Ga0496122_0025741_3527_4402 287
1683 3300048925 Ga0496122_0146357 Ga0496122_0146357_387_1274 287
1684 3300048927 Ga0496124_0127138 Ga0496124_0127138_931_1806 287
1685 3300048928 Ga0496125_0001605 Ga0496125_0001605_5810_6694 287
1686 3300048928 Ga0496125_0011221 Ga0496125_0011221_6311_7186 287
1687 3300048928 Ga0496125_0048499 Ga0496125_0048499_2602_3477 287
1688 3300048928 Ga0496125_0055066 Ga0496125_0055066_1872_2747 287
1689 3300048928 Ga0496125_0111121 Ga0496125_0111121_460_1335 287
1690 3300048929 Ga0496126_0148492 Ga0496126_0148492_252_1136 287
1691 3300048929 Ga0496126_0330767 Ga0496126_0330767_258_1142 287
1692 3300049571 Ga0501034_0000516 Ga0501034_0000516_57265_58152 287
1693 3300049571 Ga0501034_0026019 Ga0501034_0026019_2522_3409 287
1694 3300049571 Ga0501034_0144539 Ga0501034_0144539_392_1279 287
1695 3300049572 Ga0501036_0049064 Ga0501036_0049064_2529_3413 287
1696 3300049572 Ga0501036_0236317 Ga0501036_0236317_330_1214 287
1697 3300049574 Ga0501038_0035538 Ga0501038_0035538_129_1013 287
1698 3300049575 Ga0501039_0078580 Ga0501039_0078580_1192_2076 287
1699 3300049576 Ga0501040_0013223 Ga0501040_0013223_3201_4082 287
1700 3300049576 Ga0501040_0060122 Ga0501040_0060122_292_1176 287
1701 3300049576 Ga0501040_0222903 Ga0501040_0222903_252_1139 287
1702 3300049577 Ga0501041_0002429 Ga0501041_0002429_5909_6790 287
1703 3300049577 Ga0501041_0004393 Ga0501041_0004393_6136_7020 287
1704 3300049578 Ga0501042_0001617 Ga0501042_0001617_7469_8350 287
1705 3300049578 Ga0501042_0087488 Ga0501042_0087488_994_1878 287
1706 3300049578 Ga0501042_0089192 Ga0501042_0089192_1234_2106 287
1707 3300049579 Ga0501043_0076715 Ga0501043_0076715_384_1265 287
1708 3300049580 Ga0501046_0000221 Ga0501046_0000221_52216_53097 287
1709 3300049581 Ga0501047_0005589 Ga0501047_0005589_4011_4892 287
1710 3300049581 Ga0501047_0198610 Ga0501047_0198610_636_1520 287
1711 3300049582 Ga0501048_0023635 Ga0501048_0023635_1004_1885 287
1712 3300049582 Ga0501048_0224488 Ga0501048_0224488_65_952 287
1713 3300049583 Ga0501067_0012440 Ga0501067_0012440_1371_2255 287
1714 3300049583 Ga0501067_0288806 Ga0501067_0288806_19_900 287
1715 3300049585 Ga0501069_0074531 Ga0501069_0074531_562_1446 287
1716 3300049586 Ga0501070_0163546 Ga0501070_0163546_100_987 287
1717 3300049587 Ga0501071_0037623 Ga0501071_0037623_2221_3105 287
1718 3300049588 Ga0501072_0005845 Ga0501072_0005845_1192_2076 287
1719 3300049589 Ga0501073_0045453 Ga0501073_0045453_1605_2492 287
1720 3300049590 Ga0501074_0004672 Ga0501074_0004672_1058_1939 287
1721 3300049591 Ga0501075_0007289 Ga0501075_0007289_60_941 287
1722 3300049591 Ga0501075_0009385 Ga0501075_0009385_3991_4875 287
1723 3300049591 Ga0501075_0100865 Ga0501075_0100865_326_1210 287
1724 3300049592 Ga0501076_0002094 Ga0501076_0002094_12415_13299 287
1725 3300049592 Ga0501076_0004801 Ga0501076_0004801_4929_5810 287
1726 3300049592 Ga0501076_0056115 Ga0501076_0056115_1710_2594 287
1727 3300049593 Ga0501077_0004048 Ga0501077_0004048_1969_2850 287
1728 3300049593 Ga0501077_0015498 Ga0501077_0015498_1845_2729 287
1729 3300049679 Ga0501249_002446 Ga0501249_002446_939_1814 287
1730 3300049741 Ga0501079_0000054 Ga0501079_0000054_20352_21233 287
1731 3300049741 Ga0501079_0002815 Ga0501079_0002815_9026_9910 287
1732 3300049742 Ga0501080_0232814 Ga0501080_0232814_132_1016 287
1733 3300049743 Ga0501081_0058602 Ga0501081_0058602_443_1327 287
1734 3300049744 Ga0501083_0008220 Ga0501083_0008220_2159_3040 287
1735 3300049744 Ga0501083_0023124 Ga0501083_0023124_1488_2351 287
1736 3300049759 Ga0501262_000184 Ga0501262_000184_4229_5092 287
1737 3300049823 Ga0501044_0000084 Ga0501044_0000084_48463_49350 287
1738 3300049823 Ga0501044_0615659 Ga0501044_0615659_35_922 287
1739 3300049824 Ga0501045_0000766 Ga0501045_0000766_19253_20137 287
1740 3300049824 Ga0501045_0028180 Ga0501045_0028180_216_1100 287
1741 3300049824 Ga0501045_0090040 Ga0501045_0090040_853_1737 287
1742 3300050489 nmdc:mga03683_29395_c1 nmdc:mga03683_29395_c1_944_1807 287
1743 3300050489 nmdc:mga03683_44378_c1 nmdc:mga03683_44378_c1_159_1046 287
1744 3300050490 nmdc:mga03n38_18256_c1 nmdc:mga03n38_18256_c1_1023_1910 287
1745 3300050491 nmdc:mga00v17_2288_c1 nmdc:mga00v17_2288_c1_6283_7158 287
1746 3300050491 nmdc:mga00v17_48740_c1 nmdc:mga00v17_48740_c1_376_1251 287
1747 3300050492 nmdc:mga0yw44_10209_c1 nmdc:mga0yw44_10209_c1_951_1838 287
1748 3300050493 nmdc:mga0k408_41530_c1 nmdc:mga0k408_41530_c1_1415_2302 287
1749 3300050494 nmdc:mga06z11_6052_c1 nmdc:mga06z11_6052_c1_806_1693 287
1750 3300050496 nmdc:mga07m45_73_c1 nmdc:mga07m45_73_c1_17962_18825 287
1751 3300050507 nmdc:mga05p37_246876_c1 nmdc:mga05p37_246876_c1_332_1216 287
1752 3300050507 nmdc:mga05p37_3855_c1 nmdc:mga05p37_3855_c1_3064_3948 287
1753 3300050507 nmdc:mga05p37_38812_c1 nmdc:mga05p37_38812_c1_4409_5293 287
1754 3300050507 nmdc:mga05p37_45113_c1 nmdc:mga05p37_45113_c1_1404_2291 287
1755 3300050507 nmdc:mga05p37_51739_c1 nmdc:mga05p37_51739_c1_2196_3083 287
1756 3300050507 nmdc:mga05p37_6370_c1 nmdc:mga05p37_6370_c1_11985_12872 287
1757 3300050507 nmdc:mga05p37_877695_c1 nmdc:mga05p37_877695_c1_50_940 287
1758 3300050508 nmdc:mga09592_1525_c1 nmdc:mga09592_1525_c1_1968_2855 287
1759 3300050508 nmdc:mga09592_44489_c1 nmdc:mga09592_44489_c1_1835_2719 287
1760 3300050509 nmdc:mga0qj67_130126_c1 nmdc:mga0qj67_130126_c1_751_1638 287
1761 3300050509 nmdc:mga0qj67_201182_c1 nmdc:mga0qj67_201182_c1_103_990 287
1762 3300050509 nmdc:mga0qj67_232546_c1 nmdc:mga0qj67_232546_c1_250_1137 287
1763 3300050509 nmdc:mga0qj67_379714_c1 nmdc:mga0qj67_379714_c1_103_987 287
1764 3300050510 nmdc:mga06r32_148638_c1 nmdc:mga06r32_148638_c1_149_1033 287
1765 3300050510 nmdc:mga06r32_200246_c1 nmdc:mga06r32_200246_c1_852_1739 287
1766 3300050510 nmdc:mga06r32_2962_c1 nmdc:mga06r32_2962_c1_10295_11182 287
1767 3300050510 nmdc:mga06r32_543_c1 nmdc:mga06r32_543_c1_14362_15249 287
1768 3300050510 nmdc:mga06r32_61287_c1 nmdc:mga06r32_61287_c1_1135_2019 287
1769 3300050510 nmdc:mga06r32_62871_c1 nmdc:mga06r32_62871_c1_97_966 287
1770 3300050511 nmdc:mga08y16_1196_c1 nmdc:mga08y16_1196_c1_14628_15515 287
1771 3300050511 nmdc:mga08y16_282920_c1 nmdc:mga08y16_282920_c1_361_1254 287
1772 3300050511 nmdc:mga08y16_287910_c1 nmdc:mga08y16_287910_c1_129_1016 287
1773 3300050511 nmdc:mga08y16_35524_c1 nmdc:mga08y16_35524_c1_2846_3733 287
1774 3300050511 nmdc:mga08y16_6269_c1 nmdc:mga08y16_6269_c1_9913_10800 287
1775 3300050511 nmdc:mga08y16_95139_c1 nmdc:mga08y16_95139_c1_1637_2524 287
1776 3300050512 nmdc:mga0n895_103852_c1 nmdc:mga0n895_103852_c1_1343_2212 287
1777 3300050512 nmdc:mga0n895_10962_c1 nmdc:mga0n895_10962_c1_6315_7202 287
1778 3300050512 nmdc:mga0n895_2213_c1 nmdc:mga0n895_2213_c1_1360_2244 287
1779 3300050512 nmdc:mga0n895_2422_c1 nmdc:mga0n895_2422_c1_1408_2295 287
1780 3300050512 nmdc:mga0n895_480965_c1 nmdc:mga0n895_480965_c1_28_891 287
1781 3300050513 nmdc:mga0rr50_148687_c1 nmdc:mga0rr50_148687_c1_183_1070 287
1782 3300050513 nmdc:mga0rr50_2496_c1 nmdc:mga0rr50_2496_c1_6989_7873 287
1783 3300050513 nmdc:mga0rr50_331294_c1 nmdc:mga0rr50_331294_c1_131_1027 287
1784 3300050513 nmdc:mga0rr50_43903_c1 nmdc:mga0rr50_43903_c1_1916_2803 287
1785 3300050514 nmdc:mga08x19_3746_c1 nmdc:mga08x19_3746_c1_1543_2427 287
1786 3300050514 nmdc:mga08x19_52786_c1 nmdc:mga08x19_52786_c1_278_1165 287
1787 3300050514 nmdc:mga08x19_550_c1 nmdc:mga08x19_550_c1_18718_19605 287
1788 3300050514 nmdc:mga08x19_55517_c1 nmdc:mga08x19_55517_c1_680_1561 287
1789 3300050514 nmdc:mga08x19_98851_c1 nmdc:mga08x19_98851_c1_729_1625 287
1790 3300050515 nmdc:mga0a205_10565_c1 nmdc:mga0a205_10565_c1_1271_2155 287
1791 3300050515 nmdc:mga0a205_16908_c1 nmdc:mga0a205_16908_c1_1534_2421 287
1792 3300050515 nmdc:mga0a205_211454_c1 nmdc:mga0a205_211454_c1_550_1419 287
1793 3300050515 nmdc:mga0a205_26496_c1 nmdc:mga0a205_26496_c1_1651_2538 287
1794 3300050515 nmdc:mga0a205_32349_c1 nmdc:mga0a205_32349_c1_2448_3335 287
1795 3300050515 nmdc:mga0a205_34820_c1 nmdc:mga0a205_34820_c1_216_1103 287
1796 3300050515 nmdc:mga0a205_584_c1 nmdc:mga0a205_584_c1_19760_20647 287
1797 3300050515 nmdc:mga0a205_68159_c1 nmdc:mga0a205_68159_c1_443_1327 287
1798 3300050515 nmdc:mga0a205_7303_c1 nmdc:mga0a205_7303_c1_3002_3889 287
1799 3300050515 nmdc:mga0a205_9995_c1 nmdc:mga0a205_9995_c1_744_1625 287
1800 3300050516 nmdc:mga0sz30_121302_c1 nmdc:mga0sz30_121302_c1_61_948 287
1801 3300050516 nmdc:mga0sz30_26045_c1 nmdc:mga0sz30_26045_c1_1204_2079 287
1802 3300050516 nmdc:mga0sz30_89117_c1 nmdc:mga0sz30_89117_c1_284_1171 287
1803 3300053077 Ga0495601_0108249 Ga0495601_0108249_812_1699 287
1804 3300053078 Ga0495612_0003957 Ga0495612_0003957_1296_2183 287
1805 3300053084 Ga0495595_0000244 Ga0495595_0000244_19048_19935 287
1806 3300053084 Ga0495595_0038397 Ga0495595_0038397_161_1048 287
1807 3300053085 Ga0495619_0006093 Ga0495619_0006093_1080_1967 287
1808 3300053085 Ga0495619_0061218 Ga0495619_0061218_1596_2483 287
1809 3300053087 Ga0500643_010551 Ga0500643_010551_12_887 287
1810 3300053090 Ga0500646_0029413 Ga0500646_0029413_431_1306 287
1811 3300053096 Ga0500641_0020853 Ga0500641_0020853_596_1471 287
1812 3300053096 Ga0500641_0049599 Ga0500641_0049599_170_1057 287
1813 3300053098 Ga0500650_0029685 Ga0500650_0029685_811_1686 287
1814 3300053104 Ga0500556_0000004 Ga0500556_0000004_632609_633484 287
1815 3300053119 Ga0500595_013922 Ga0500595_013922_303_1190 287
1816 3300053121 Ga0500607_025574 Ga0500607_025574_738_1613 287
1817 3300053122 Ga0500608_003410 Ga0500608_003410_555_1430 287
1818 3300053125 Ga0500618_001780 Ga0500618_001780_660_1553 287
1819 3300053130 Ga0500642_0000186 Ga0500642_0000186_13282_14157 287
1820 3300053130 Ga0500642_0012991 Ga0500642_0012991_1189_2100 287
1821 3300053134 Ga0500658_0070848 Ga0500658_0070848_192_1067 287
1822 3300053136 Ga0500559_0000067 Ga0500559_0000067_653_1528 287
1823 3300053139 Ga0500568_0000447 Ga0500568_0000447_5896_6783 287
1824 3300053139 Ga0500568_0001430 Ga0500568_0001430_3205_4080 287
1825 3300053139 Ga0500568_0007916 Ga0500568_0007916_657_1535 287
1826 3300053145 Ga0500586_004477 Ga0500586_004477_671_1546 287
1827 3300053151 Ga0500604_0053435 Ga0500604_0053435_187_1062 287
1828 3300053153 Ga0500616_0000014 Ga0500616_0000014_604301_605176 287
1829 3300053156 Ga0500622_0000513 Ga0500622_0000513_25448_26323 287
1830 3300053161 Ga0500634_0045881 Ga0500634_0045881_467_1342 287
1831 3300053177 Ga0500636_0020857 Ga0500636_0020857_2632_3519 287
1832 3300053730 Ga0500645_034041 Ga0500645_034041_367_1236 287
1833 3300054114 Ga0501084_0002533 Ga0501084_0002533_8549_9433 287
1834 3300054114 Ga0501084_0005314 Ga0501084_0005314_2798_3679 287
1835 3300054114 Ga0501084_0075593 Ga0501084_0075593_530_1393 287
1836 3300054114 Ga0501084_0283140 Ga0501084_0283140_207_1091 287
1837 3300054114 Ga0501084_0314889 Ga0501084_0314889_201_1073 287
1838 3300059424 Ga0590075_028269 Ga0590075_028269_162_1049 287
1839 3300060353 Ga0501082_0000389 Ga0501082_0000389_9381_10262 287
1840 3300060353 Ga0501082_0001815 Ga0501082_0001815_15064_15951 287
1841 3300060353 Ga0501082_0023411 Ga0501082_0023411_1583_2467 287
1842 3300060353 Ga0501082_0352999 Ga0501082_0352999_264_1127 287
1843 3300061734 Ga0530510_0005953 Ga0530510_0005953_359_1240 287
1844 3300061734 Ga0530510_0019782 Ga0530510_0019782_1193_2077 287
1845 3300061734 Ga0530510_0080989 Ga0530510_0080989_44_910 287
1846 iso_pu_bacteria 2508501125 2509128038 287
1847 iso_pu_bacteria 2511231027 2511391037 287
1848 iso_pu_bacteria 2511231221 2512032988 287
1849 iso_pu_bacteria 2513020051 2513228370 287
1850 iso_pu_bacteria 2513237082 2513556031 287
1851 iso_pu_bacteria 2513237150 2513952711 287
1852 iso_pu_bacteria 2513237159 2514002663 287
1853 iso_pu_bacteria 2513237351 2514590722 287
1854 iso_pu_bacteria 2519103095 2519457298 287
1855 iso_pu_bacteria 2522572158 2523104543 287
1856 iso_pu_bacteria 2522572158 2523106040 287
1857 iso_pu_bacteria 2522572158 2523107591 287
1858 iso_pu_bacteria 2526164713 2527078479 287
1859 iso_pu_bacteria 2547132374 2548500060 287
1860 iso_pu_bacteria 2582581299 2585232900 287
1861 iso_pu_bacteria 2582581311 2585292160 287
1862 iso_pu_bacteria 2585427528 2585542906 287
1863 iso_pu_bacteria 2585427593 2585841152 287
1864 iso_pu_bacteria 2599185214 2599622949 287
1865 iso_pu_bacteria 2599185226 2599671428 287
1866 iso_pu_bacteria 2599185227 2599679535 287
1867 iso_pu_bacteria 2599185229 2599691551 287
1868 iso_pu_bacteria 2599185239 2599738762 287
1869 iso_pu_bacteria 2599185240 2599747628 287
1870 iso_pu_bacteria 2599185355 2600209512 287
1871 iso_pu_bacteria 2600255067 2600814246 287
1872 iso_pu_bacteria 2602042107 2603859617 287
1873 iso_pu_bacteria 2643221544 2643743489 287
1874 iso_pu_bacteria 2643221596 2643993734 287
1875 iso_pu_bacteria 2643221628 2644162769 287
1876 iso_pu_bacteria 2643221658 2644325076 287
1877 iso_pu_bacteria 2643221672 2644400196 287
1878 iso_pu_bacteria 2643221683 2644467629 287
1879 iso_pu_bacteria 2643221736 2644743511 287
1880 iso_pu_bacteria 2675903129 2676745571 287
1881 iso_pu_bacteria 2738541277 2738718800 287
1882 iso_pu_bacteria 2738541277 2738723560 287
1883 iso_pu_bacteria 2738541307 2738886625 287
1884 iso_pu_bacteria 2738543013 2739252279 287
1885 iso_pu_bacteria 2738543019 2739280818 287
1886 iso_pu_bacteria 2738543019 2739284291 287
1887 iso_pu_bacteria 2739367655 2739612164 287
1888 iso_pu_bacteria 2739367655 2739612371 287
1889 iso_pu_bacteria 2767802442 2770198869 287
1890 iso_pu_bacteria 2773857925 2774870336 287
1891 iso_pu_bacteria 2775506902 2776272904 287
1892 iso_pu_bacteria 2775506904 2776282253 287
1893 iso_pu_bacteria 2791355137 2792839293 287
1894 iso_pu_bacteria 2816332253 2817259499 287
1895 iso_pu_bacteria 2816332256 2817277168 287
1896 iso_pu_bacteria 2816332286 2817454082 287
1897 iso_pu_bacteria 2818991446 2819602258 287
1898 iso_pu_bacteria 2818991452 2819634715 287
1899 iso_pu_bacteria 2821443989 2821450646 287
1900 iso_pu_bacteria 2838054893 2838056494 287
1901 iso_pu_bacteria 2838122688 2838127293 287
1902 iso_pu_bacteria 2840764183 2840770330 287
1903 iso_pu_bacteria 2841760612 2841764523 287
1904 iso_pu_bacteria 2841911363 2841915672 287
1905 iso_pu_bacteria 2841917233 2841920874 287
1906 iso_pu_bacteria 2841983080 2841987393 287
1907 iso_pu_bacteria 2842677519 2842681769 287
1908 iso_pu_bacteria 2842694124 2842694737 287
1909 iso_pu_bacteria 2842733646 2842736211 287
1910 iso_pu_bacteria 2842747753 2842748047 287
1911 iso_pu_bacteria 2842871566 2842874239 287
1912 iso_pu_bacteria 2844104063 2844108029 287
1913 iso_pu_bacteria 2844533157 2844537839 287
1914 iso_pu_bacteria 2851182111 2851187961 287
1915 iso_pu_bacteria 2851246043 2851250135 287
1916 iso_pu_bacteria 2857524615 2857528976 287
1917 iso_pu_bacteria 2863421361 2863425403 287
1918 iso_pu_bacteria 2870068957 2870069642 287
1919 iso_pu_bacteria 2881101125 2881103105 287
1920 iso_pu_bacteria 2885192300 2885196124 287
1921 iso_pu_bacteria 2885198086 2885203364 287
1922 iso_pu_bacteria 2885211737 2885217286 287
1923 iso_pu_bacteria 2893066018 2893070433 287
1924 iso_pu_bacteria 2897803580 2897808291 287
1925 iso_pu_bacteria 2897803580 2897809074 287
1926 iso_pu_bacteria 2900634093 2900636813 287
1927 iso_pu_bacteria 2900634093 2900643336 287
1928 iso_pu_bacteria 2901300506 2901307418 287
1929 iso_pu_bacteria 2904541872 2904542273 287
1930 iso_pu_bacteria 2904541872 2904543368 287
1931 iso_pu_bacteria 2904541872 2904546890 287
1932 iso_pu_bacteria 2904564687 2904570149 287
1933 iso_pu_bacteria 2904571731 2904577319 287
1934 iso_pu_bacteria 2904578770 2904582528 287
1935 iso_pu_bacteria 2919073203 2919076375 287
1936 iso_pu_bacteria 2919462493 2919463988 287
1937 iso_pu_bacteria 2928070936 2928074739 287
1938 iso_pu_bacteria 2928070936 2928077669 287
1939 iso_pu_bacteria 2928115317 2928115318 287
1940 iso_pu_bacteria 2928157003 2928163718 287
1941 iso_pu_bacteria 2928163908 2928170531 287
1942 iso_pu_bacteria 2928170801 2928175852 287
1943 iso_pu_bacteria 2928521798 2928525028 287
1944 iso_pu_bacteria 2928536128 2928541492 287
1945 iso_pu_bacteria 2929160207 2929167558 287
1946 iso_pu_bacteria 2929520902 2929525113 287
1947 iso_pu_bacteria 2937843397 2937844861 287
1948 iso_pu_bacteria 2945909444 2945910938 287
1949 iso_pu_bacteria 2945972063 2945976513 287
1950 iso_pu_bacteria 2945984333 2945986824 287
1951 iso_pu_bacteria 2954011201 2954011359 287
1952 iso_pu_bacteria 2954767861 2954771537 287
1953 iso_pu_bacteria 2981990288 2981992008 287
1954 iso_pu_bacteria 2981990288 2981995757 287
1955 iso_pu_bacteria 2990710928 2990711666 287
1956 iso_pu_bacteria 3005409236 3005411712 287
1957 iso_pu_bacteria 3005445848 3005450327 287
1958 iso_pu_bacteria 639633007 639785226 287
1959 iso_pu_bacteria 641736154 642416026 287
1960 iso_pu_bacteria 8018845410 8018848089 287
1961 iso_pu_bacteria 8020807995 8020810289 287
1962 iso_pu_bacteria 8020938398 8020939189 287
1963 iso_pu_bacteria 8020945358 8020948520 287
1964 iso_pu_bacteria 8020953355 8020956247 287
1965 iso_pu_bacteria 8021120328 8021127048 287
1966 iso_pu_bacteria 8039098773 8039101471 287
1967 iso_pu_bacteria 8040167225 8040169595 287
1968 iso_pu_bacteria 8040173305 8040174628 287
1969 iso_pu_bacteria 8054002106 8054002373 287
1970 iso_pu_bacteria 8054002106 8054006769 287
1971 iso_pu_bacteria 8054002106 8054007356 287
1972 iso_pu_bacteria 2738541317 2738945094 290
1973 iso_pu_bacteria 2913308742 2913309720 290
1974 3300005336 Ga0070680_100306506 Ga0070680_1003065062 291
1975 3300005435 Ga0070714_100068956 Ga0070714_1000689564 291
1976 3300005458 Ga0070681_10007824 Ga0070681_100078246 291
1977 3300005530 Ga0070679_100029489 Ga0070679_1000294895 291
1978 3300005563 Ga0068855_100053556 Ga0068855_1000535563 291
1979 3300005564 Ga0070664_100085392 Ga0070664_1000853922 291
1980 3300005614 Ga0068856_100009875 Ga0068856_1000098756 291
1981 3300009093 Ga0105240_10583978 Ga0105240_105839781 291
1982 3300009147 Ga0114129_10050894 Ga0114129_100508945 291
1983 3300013104 Ga0157370_10048561 Ga0157370_100485612 291
1984 3300013307 Ga0157372_10005498 Ga0157372_1000549815 291
1985 3300013307 Ga0157372_10358481 Ga0157372_103584812 291
1986 3300025912 Ga0207707_10022060 Ga0207707_100220606 291
1987 3300025921 Ga0207652_10019549 Ga0207652_100195493 291
1988 3300025928 Ga0207700_10390726 Ga0207700_103907262 291
1989 3300025929 Ga0207664_10113689 Ga0207664_101136892 291
1990 3300025945 Ga0207679_10190787 Ga0207679_101907872 291
1991 3300025949 Ga0207667_10071531 Ga0207667_100715311 291
1992 3300025949 Ga0207667_10109162 Ga0207667_101091622 291
1993 3300025981 Ga0207640_10090523 Ga0207640_100905232 291
1994 3300026078 Ga0207702_10002232 Ga0207702_100022322 291
1995 3300046520 Ga0495637_0004897 Ga0495637_0004897_3085_3987 291
1996 3300046660 Ga0495625_0057538 Ga0495625_0057538_1276_2178 291
1997 3300046691 Ga0495670_0032094 Ga0495670_0032094_1007_1909 291
1998 3300053079 Ga0500610_0000402 Ga0500610_0000402_4152_5054 291
1999 3300053121 Ga0500607_000307 Ga0500607_000307_13274_14176 291
2000 iso_pu_bacteria 2511231002 2511243175 291
2001 iso_pu_bacteria 2818991449 2819613960 291
2002 3300001976 JGI24752J21851_1002365 JGI24752J21851_10023652 292
2003 3300001991 JGI24743J22301_10003473 JGI24743J22301_100034733 292
2004 3300002074 JGI24748J21848_1001710 JGI24748J21848_10017102 292
2005 3300002239 JGI24034J26672_10004122 JGI24034J26672_100041222 292
2006 3300005290 Ga0065712_10096243 Ga0065712_100962432 292
2007 3300005329 Ga0070683_100253033 Ga0070683_1002530332 292
2008 3300005334 Ga0068869_100019670 Ga0068869_1000196705 292
2009 3300005335 Ga0070666_10122253 Ga0070666_101222531 292
2010 3300005338 Ga0068868_100134926 Ga0068868_1001349262 292
2011 3300005339 Ga0070660_100000724 Ga0070660_10000072421 292
2012 3300005340 Ga0070689_100048821 Ga0070689_1000488212 292
2013 3300005344 Ga0070661_100026535 Ga0070661_1000265352 292
2014 3300005344 Ga0070661_100219006 Ga0070661_1002190062 292
2015 3300005354 Ga0070675_100043655 Ga0070675_1000436554 292
2016 3300005354 Ga0070675_100173938 Ga0070675_1001739382 292
2017 3300005355 Ga0070671_100023164 Ga0070671_1000231643 292
2018 3300005356 Ga0070674_100091663 Ga0070674_1000916632 292
2019 3300005365 Ga0070688_100023196 Ga0070688_1000231964 292
2020 3300005366 Ga0070659_100002581 Ga0070659_1000025814 292
2021 3300005366 Ga0070659_100044233 Ga0070659_1000442334 292
2022 3300005455 Ga0070663_100018923 Ga0070663_1000189231 292
2023 3300005457 Ga0070662_100010579 Ga0070662_1000105794 292
2024 3300005457 Ga0070662_100053117 Ga0070662_1000531172 292
2025 3300005459 Ga0068867_100128668 Ga0068867_1001286682 292
2026 3300005466 Ga0070685_10056750 Ga0070685_100567502 292
2027 3300005535 Ga0070684_100071707 Ga0070684_1000717073 292
2028 3300005543 Ga0070672_100145320 Ga0070672_1001453202 292
2029 3300005544 Ga0070686_100035163 Ga0070686_1000351632 292
2030 3300005548 Ga0070665_100066956 Ga0070665_1000669562 292
2031 3300005563 Ga0068855_100012186 Ga0068855_1000121868 292
2032 3300005564 Ga0070664_100003967 Ga0070664_1000039679 292
2033 3300005564 Ga0070664_100008025 Ga0070664_1000080255 292
2034 3300005577 Ga0068857_100022565 Ga0068857_1000225655 292
2035 3300005578 Ga0068854_100104826 Ga0068854_1001048262 292
2036 3300005578 Ga0068854_100180757 Ga0068854_1001807572 292
2037 3300005614 Ga0068856_100001185 Ga0068856_10000118512 292
2038 3300005618 Ga0068864_100098615 Ga0068864_1000986152 292
2039 3300005718 Ga0068866_10006508 Ga0068866_100065082 292
2040 3300005719 Ga0068861_100049597 Ga0068861_1000495972 292
2041 3300005834 Ga0068851_10011381 Ga0068851_100113814 292
2042 3300005843 Ga0068860_100242756 Ga0068860_1002427561 292
2043 3300009094 Ga0111539_10074229 Ga0111539_100742293 292
2044 3300009553 Ga0105249_10231362 Ga0105249_102313622 292
2045 3300013100 Ga0157373_10014696 Ga0157373_100146964 292
2046 3300013102 Ga0157371_10001965 Ga0157371_100019653 292
2047 3300013307 Ga0157372_10001631 Ga0157372_1000163113 292
2048 3300014325 Ga0163163_10112333 Ga0163163_101123332 292
2049 3300014745 Ga0157377_10029892 Ga0157377_100298922 292
2050 3300014968 Ga0157379_10014180 Ga0157379_100141805 292
2051 3300017792 Ga0163161_10173782 Ga0163161_101737822 292
2052 3300025315 Ga0207697_10004888 Ga0207697_100048885 292
2053 3300025321 Ga0207656_10073882 Ga0207656_100738822 292
2054 3300025893 Ga0207682_10000233 Ga0207682_1000023313 292
2055 3300025901 Ga0207688_10050276 Ga0207688_100502761 292
2056 3300025906 Ga0207699_10116909 Ga0207699_101169092 292
2057 3300025907 Ga0207645_10019420 Ga0207645_100194204 292
2058 3300025907 Ga0207645_10032640 Ga0207645_100326401 292
2059 3300025908 Ga0207643_10028396 Ga0207643_100283962 292
2060 3300025912 Ga0207707_10052281 Ga0207707_100522814 292
2061 3300025918 Ga0207662_10041918 Ga0207662_100419182 292
2062 3300025919 Ga0207657_10000371 Ga0207657_1000037124 292
2063 3300025925 Ga0207650_10036096 Ga0207650_100360963 292
2064 3300025926 Ga0207659_10003917 Ga0207659_100039176 292
2065 3300025926 Ga0207659_10017546 Ga0207659_100175464 292
2066 3300025931 Ga0207644_10014609 Ga0207644_100146093 292
2067 3300025931 Ga0207644_10049977 Ga0207644_100499772 292
2068 3300025932 Ga0207690_10065899 Ga0207690_100658992 292
2069 3300025932 Ga0207690_10109014 Ga0207690_101090142 292
2070 3300025932 Ga0207690_10225340 Ga0207690_102253401 292
2071 3300025933 Ga0207706_10000179 Ga0207706_1000017911 292
2072 3300025933 Ga0207706_10008198 Ga0207706_100081984 292
2073 3300025938 Ga0207704_10065340 Ga0207704_100653402 292
2074 3300025940 Ga0207691_10005440 Ga0207691_1000544011 292
2075 3300025942 Ga0207689_10011579 Ga0207689_100115796 292
2076 3300025945 Ga0207679_10017886 Ga0207679_100178865 292
2077 3300025945 Ga0207679_10020500 Ga0207679_100205003 292
2078 3300025949 Ga0207667_10026324 Ga0207667_100263243 292
2079 3300025960 Ga0207651_10085237 Ga0207651_100852372 292
2080 3300025981 Ga0207640_10079397 Ga0207640_100793972 292
2081 3300025981 Ga0207640_10082980 Ga0207640_100829802 292
2082 3300025986 Ga0207658_10020207 Ga0207658_100202072 292
2083 3300026023 Ga0207677_10104308 Ga0207677_101043082 292
2084 3300026041 Ga0207639_10030650 Ga0207639_100306502 292
2085 3300026067 Ga0207678_10006632 Ga0207678_100066323 292
2086 3300026075 Ga0207708_10068643 Ga0207708_100686432 292
2087 3300026078 Ga0207702_10000997 Ga0207702_100009973 292
2088 3300026089 Ga0207648_10003625 Ga0207648_1000362515 292
2089 3300026095 Ga0207676_10013792 Ga0207676_100137923 292
2090 3300026116 Ga0207674_10023874 Ga0207674_100238745 292
2091 3300026118 Ga0207675_100021301 Ga0207675_1000213016 292
2092 3300026121 Ga0207683_10030000 Ga0207683_100300004 292
2093 3300026142 Ga0207698_10045457 Ga0207698_100454571 292
2094 3300027682 Ga0209971_1003527 Ga0209971_10035272 292
2095 3300027876 Ga0209974_10007927 Ga0209974_100079272 292
2096 3300028379 Ga0268266_10042868 Ga0268266_100428682 292
2097 3300031548 Ga0307408_100044908 Ga0307408_1000449082 292
2098 3300031901 Ga0307406_10005358 Ga0307406_100053586 292
2099 3300032002 Ga0307416_100039425 Ga0307416_1000394254 292
2100 3300035691 Ga0373931_0052791 Ga0373931_0052791_728_1606 292
2101 3300048906 Ga0496103_0006318 Ga0496103_0006318_3294_4172 292
2102 3300048907 Ga0496104_0006365 Ga0496104_0006365_4072_4950 292
2103 3300048909 Ga0496106_0022766 Ga0496106_0022766_2391_3269 292
2104 3300048910 Ga0496107_0052544 Ga0496107_0052544_997_1875 292
2105 3300048912 Ga0496109_0094897 Ga0496109_0094897_65_943 292
2106 3300048917 Ga0496114_0011440 Ga0496114_0011440_3301_4179 292
2107 3300050511 nmdc:mga08y16_176140_c1 nmdc:mga08y16_176140_c1_508_1386 292

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02653

BPD_transp_2

Branched-chain amino acid transport system / permease component

15

113

0.87

PF02653

BPD_transp_2

Branched-chain amino acid transport system / permease component

102

336

0.71

Structural Annotation

Top 5 Hits

ID Description Score Start End
7lb8-assembly1.cif.gz_B structure of a ferrichrome importer fhucdb from e. coli 0.5468 2 281
4dbl-assembly1.cif.gz_B crystal structure of e159q mutant of btucdf 0.5419 7 280
7lb8-assembly1.cif.gz_B structure of a ferrichrome importer fhucdb from e. coli 0.5122 2 281
4dbl-assembly1.cif.gz_B crystal structure of e159q mutant of btucdf 0.4958 7 280
2nq2-assembly1.cif.gz_A an inward-facing conformation of a putative metal-chelate type abc transporter. 0.4901 7 280
ID Description Score Start End Superfamily
af_P0AEX7_11_292_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.9167 8 278 1.10.3470.10
af_P0AEX7_11_292_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.8795 8 278 1.10.3470.10
af_P32720_52_318_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.7952 10 280 1.10.3470.10
af_P23200_41_325_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.7944 11 277 1.10.3470.10
af_P37772_34_305_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.7913 9 280 1.10.3470.10
ID Description Score Start End GO Terms
AF-A0A1W6ZU73-F1-model_v4 Branched-chain amino acid ABC transporter permease 0.9887 2 290 GO:0005886
GO:0006865
GO:0022857
AF-A0A2G8MC90-F1-model_v4 deleted 0.9885 2 290
AF-B8IBR7-F1-model_v4 Inner-membrane translocator 0.9875 2 290 GO:0005886
GO:0006865
GO:0022857
AF-A0A1I3LPG1-F1-model_v4 Branched-chain amino acid transport system permease protein 0.986 2 290 GO:0005886
GO:0006865
GO:0022857
AF-A0A1P9YAH5-F1-model_v4 deleted 0.986 2 290

Feature Viewer

pLDDT pTM Quality
87.45 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map