F496396

General Info

Members Datasets Scaffolds Average Seq Length
2100 895 4200 250

Family's Representative Sequence

Representative Sequence 3300049575|Ga0501039_0172727|Ga0501039_0172727_437_1312
Length 291
Sequence MPGLVPGIHEFRRRSEVVDGRDKPGHDRREILEDQRNIVMLEIKNLHVNVDGREILKGLDLELPKGQVHAIMGPNGSGKSTLAYVLAGKQDYEVTAGSVTWNGQDLLAMDPSERAAAGVFLAFQYPMEIPGVATMTFLRTAANAVRKARGKPELSTPEFLRFVREKAAELKIDPEMLRRPLNVGFSGGEKKRNEILQMSLLDPSLCVLDETDSGLDIDAVRIVAEGVNALRSPDRAMLVITHYQRLLDYIVPDRVHVLSDGRVARSGGPELALELEESGYAEFEDAAGQAA

Samples

Sample ID Description Type Environment
1 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
7 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
8 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
9 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
10 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
11 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
12 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
13 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
14 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
15 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
16 3300003162 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
17 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
18 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
19 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
20 3300003308 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
21 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
22 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
23 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
24 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
25 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
26 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
27 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
28 3300003735 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_23 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
29 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
30 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
31 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
32 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
33 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
34 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
35 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
36 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
37 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
38 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
39 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
40 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
41 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
42 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
43 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
44 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
45 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
46 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
47 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
48 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
49 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
50 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
51 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
52 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
53 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
54 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
55 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
56 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
57 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
58 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
59 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
60 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
61 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
62 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
63 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
64 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
65 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
66 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
67 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
68 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
69 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
70 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
71 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
72 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
73 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
74 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
75 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
76 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
77 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
78 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
79 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
80 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
81 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
82 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
83 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
84 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
85 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
86 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
87 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
88 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
89 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
90 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
91 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
92 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
93 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
94 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
95 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
96 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
97 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
98 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
99 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
100 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
101 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
102 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
103 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
104 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
105 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
106 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
107 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
108 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
109 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
110 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
111 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
112 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
113 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
114 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
115 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
116 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
117 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
118 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
119 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
120 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
121 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
122 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
123 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
124 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
125 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
126 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
127 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
128 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
129 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
130 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
131 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
132 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
133 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
134 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
135 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
136 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
137 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
138 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
139 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
140 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
141 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
142 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
143 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
144 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
145 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
146 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
147 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
148 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
149 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
150 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
151 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
152 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
153 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
154 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
155 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
156 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
157 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
158 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
159 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
160 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
161 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
162 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
163 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
164 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
165 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
166 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
167 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
168 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
169 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
170 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
171 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
172 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
173 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
174 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
175 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
176 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
177 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
178 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
179 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
180 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
181 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
182 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
183 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
184 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
185 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
186 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
188 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
189 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
190 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
191 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
192 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
193 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
194 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
195 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
196 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
197 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
198 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
199 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
200 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
201 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
202 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
203 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
204 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
205 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
247 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
248 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
249 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
250 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
251 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
252 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
253 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
254 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
255 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
256 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
257 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
258 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
259 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
260 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
261 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
262 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
263 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
264 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
265 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
266 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
267 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
268 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
269 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
270 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
271 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
272 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
273 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
274 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
275 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
276 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
277 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
278 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
279 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
280 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
281 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
282 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
283 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
284 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
285 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
286 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
287 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
288 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
289 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
290 3300029277 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.ctcc.R1 Metatranscriptome Rhizosphere
291 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
292 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
293 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
294 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
295 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
296 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
297 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
298 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
299 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
300 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
301 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
302 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
303 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
304 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
305 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
306 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
307 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
308 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
309 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
310 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
311 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
312 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
313 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
314 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
315 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
316 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
317 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
318 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
319 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
320 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
321 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
322 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
323 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
324 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
325 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
326 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
327 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
328 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
329 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
330 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
331 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
332 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
333 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
334 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
335 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
336 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
337 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
338 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
339 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
340 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
341 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
342 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
343 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
344 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
345 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
346 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
347 3300039145 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 Metagenome Unclassified
348 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
349 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
350 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
351 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
352 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
353 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
354 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
355 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
356 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
357 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
358 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
359 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
360 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
361 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
362 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
363 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
364 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
365 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
366 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
367 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
368 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
369 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
370 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
371 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
372 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
373 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
374 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
375 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
376 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
377 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
378 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
379 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
380 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
381 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
382 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
383 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
384 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
385 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
386 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
387 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
388 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
389 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
390 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
391 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
392 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
393 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
394 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
395 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
396 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
397 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
398 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
399 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
400 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
401 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
402 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
403 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
404 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
405 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
406 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
407 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
408 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
409 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
410 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
411 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
412 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
413 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
414 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
415 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
416 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
417 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
418 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
419 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
420 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
421 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
422 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
423 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
424 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
425 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
426 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
427 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
428 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
429 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
430 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
431 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
432 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
433 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
434 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
435 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
436 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
437 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
438 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
439 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
440 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
441 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
442 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
443 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
444 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
445 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
446 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
447 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
448 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
449 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
450 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
451 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
452 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
453 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
454 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
455 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
456 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
457 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
458 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
459 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
460 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
461 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
462 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
463 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
464 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
465 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
466 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
467 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
468 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
469 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
470 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
471 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
472 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
473 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
474 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
475 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
476 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
477 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
478 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
479 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
480 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
481 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
482 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
483 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
484 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
485 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
486 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
487 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
488 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
489 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
490 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
491 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
492 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
493 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
494 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
495 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
496 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
497 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
498 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
499 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
500 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
501 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
502 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
503 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
504 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
505 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
506 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
507 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
508 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
509 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
510 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
511 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
512 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
513 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
514 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
515 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
516 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
517 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
518 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
519 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
520 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
521 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
522 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
523 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
524 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
525 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
526 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
527 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
528 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
529 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
530 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
531 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
532 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
533 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
534 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
535 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
536 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
537 2508501050 Microvirga lupini Lut6 Isolate Nodule
538 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
539 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
540 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
541 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
542 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
543 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
544 2512875024
545 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
546 2513237087 Azorhizobium doebereinerae UFLA1-100 Isolate Nodule
547 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
548 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
549 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
550 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
551 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
552 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
553 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
554 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
555 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
556 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
557 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
558 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
559 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
560 2643221550 Mesorhizobium sp. Root552 Isolate Unclassified
561 2643221551 Mesorhizobium sp. Root1471 Isolate Unclassified
562 2643221555 Mesorhizobium sp. Root554 Isolate Unclassified
563 2643221564 Mesorhizobium sp. Root157 Isolate Unclassified
564 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
565 2643221618 Ensifer sp. Root231 Isolate Unclassified
566 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
567 2643221626 Ensifer sp. Root31 Isolate Unclassified
568 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
569 2643221655 Ensifer sp. Root1252 Isolate Unclassified
570 2643221659 Ensifer sp. Root127 Isolate Unclassified
571 2643221698 Ensifer sp. Root142 Isolate Unclassified
572 2643221712 Ensifer sp. Root258 Isolate Unclassified
573 2643221723 Ensifer sp. Root278 Isolate Unclassified
574 2643221734 Bosea sp. Root670 Isolate Unclassified
575 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
576 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
577 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
578 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
579 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
580 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
581 2738543024 Aminobacter sp. AP02 Isolate Unclassified
582 2751185800 Brucella pituitosa AA2 Isolate Unclassified
583 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
584 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
585 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
586 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
587 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
588 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
589 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
590 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
591 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
592 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
593 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
594 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
595 2808606379 Pseudomonas sp. SJZ079 Isolate Rhizosphere
596 2818991467 Bosea vestrisii 3192 Isolate Unclassified
597 2828305725 Xanthobacter tagetidis DSM 11105 Isolate Unclassified
598 2837678835 Jiella endophytica CBS5Q-3 Isolate Unclassified
599 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
600 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
601 2841760612 Bosea sp. Tri-49 Isolate Nodule
602 2841911363 Bosea caraganae RCAM04685 Isolate Nodule
603 2841917233 Bosea caraganae RCAM04680 Isolate Nodule
604 2842333319 Skermanella aerolata SEMIA 4010 Isolate Nodule
605 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
606 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
607 2844104063 Bosea sp. Tri-39 Isolate Nodule
608 2844163670 Ensifer sp. 1H6 Isolate Unclassified
609 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
610 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
611 2851182111 Bosea sp. Tri-44 Isolate Nodule
612 2851246043 Bosea sp. Tri-54 Isolate Nodule
613 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
614 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
615 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
616 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
617 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
618 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
619 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
620 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
621 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
622 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
623 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
624 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
625 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
626 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
627 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
628 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
629 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
630 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
631 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
632 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
633 2871444079 Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 Isolate Nodule
634 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
635 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
636 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
637 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
638 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
639 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
640 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
641 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
642 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
643 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
644 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
645 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
646 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
647 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
648 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
649 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
650 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
651 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
652 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
653 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
654 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
655 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
656 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
657 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
658 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
659 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
660 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
661 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
662 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
663 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
664 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
665 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
666 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
667 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
668 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
669 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
670 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
671 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
672 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
673 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
674 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
675 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
676 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
677 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
678 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
679 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
680 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
681 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
682 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
683 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
684 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
685 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
686 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
687 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
688 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
689 2894817345 Aureimonas psammosilenae YIM DR1026 Isolate Unclassified
690 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
691 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
692 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
693 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
694 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
695 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
696 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
697 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
698 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
699 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
700 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
701 2906354277 Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 Isolate Nodule
702 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
703 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
704 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
705 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
706 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
707 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
708 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
709 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
710 2906427513 Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 Isolate Nodule
711 2915650412 Ochrobactrum sp. CM-21-5 Isolate Rhizosphere
712 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
713 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
714 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
715 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
716 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
717 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
718 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
719 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
720 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
721 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
722 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
723 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
724 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
725 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
726 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
727 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
728 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
729 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
730 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
731 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
732 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
733 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
734 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
735 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
736 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
737 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
738 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
739 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
740 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
741 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
742 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
743 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
744 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
745 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
746 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
747 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
748 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
749 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
750 2939669807 Kaistia defluvii 3207 Isolate Rhizosphere
751 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
752 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
753 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
754 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
755 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
756 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
757 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
758 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
759 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
760 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
761 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
762 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
763 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
764 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
765 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
766 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
767 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
768 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
769 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
770 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
771 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
772 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
773 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
774 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
775 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
776 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
777 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
778 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
779 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
780 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
781 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
782 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
783 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
784 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
785 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
786 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
787 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
788 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
789 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
790 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
791 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
792 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
793 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
794 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
795 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
796 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
797 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
798 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
799 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
800 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
801 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
802 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
803 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
804 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
805 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
806 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
807 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
808 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
809 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
810 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
811 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
812 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
813 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
814 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
815 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
816 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
817 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
818 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
819 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
820 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
821 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
822 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
823 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
824 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
825 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
826 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
827 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
828 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
829 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
830 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
831 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
832 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
833 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
834 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
835 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
836 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
837 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
838 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
839 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
840 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
841 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
842 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
843 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
844 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
845 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
846 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
847 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
848 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
849 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
850 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
851 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
852 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
853 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
854 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
855 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
856 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
857 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
858 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
859 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
860 3004167301 Mesorhizobium loti 582 Isolate Unclassified
861 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
862 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
863 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
864 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
865 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
866 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
867 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
868 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
869 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
870 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
871 3004289098 Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 Isolate Nodule
872 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
873 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
874 641228493 Gluconacetobacter diazotrophicus PA1 5 Isolate Unclassified
875 643348555 Gluconacetobacter diazotrophicus PA1 5 Isolate Unclassified
876 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
877 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
878 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
879 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
880 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
881 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
882 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
883 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
884 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
885 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
886 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
887 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
888 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
889 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
890 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
891 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
892 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
893 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
894 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule
895 8057529695 Bosea vestrisii A18/4-2 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 81.95
Metatranscriptomes 0.86
Isolates 17.19

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.38
Nodule 14.62
Rhizoplane 8.76
Rhizosphere 63.52
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501039_0172727 3300049575 Bacteria 1699
2 JGI24746J21847_1001085 3300001977 Bacteria 4268
3 JGI24740J21852_10006526 3300001979 Bacteria 4821
4 JGI24739J22299_10047854 3300001989 Bacteria 1393
5 JGI24737J22298_10051034 3300001990 Bacteria 1256
6 JGI24750J21931_1001195 3300002070 Bacteria 3311
7 JGI24750J21931_1002374 3300002070 Bacteria 2273
8 JGI24738J21930_10005970 3300002075 Bacteria 2891
9 JGI24738J21930_10007456 3300002075 Bacteria 2523
10 JGI24749J21850_1010571 3300002076 Bacteria 1295
11 JGI24749J21850_1016147 3300002076 Bacteria 1048
12 JGI24744J21845_10006218 3300002077 Bacteria 2479
13 JGI24744J21845_10011920 3300002077 Bacteria 1770
14 JGI24033J26618_1007281 3300002155 Bacteria 1255
15 JGI24742J22300_10002109 3300002244 Bacteria 3164
16 JGI24742J22300_10018212 3300002244 Bacteria 1190
17 JGI24751J29686_10003795 3300002459 Bacteria 3048
18 JGI24751J29686_10004371 3300002459 Bacteria 2867
19 JGI25156J39149_1006460 3300002705 Bacteria 3201
20 JGI25157J39369_1000310 3300002741 Bacteria 35193
21 JGI25159J45721_1000029 3300002987 Bacteria 105868
22 JGI25159J45721_1006446 3300002987 Bacteria 3510
23 Ga0006778J45830_1020520 3300003162 Bacteria 1802
24 Ga0006778J45830_1051547 3300003162 Bacteria 988
25 Ga0006759J45824_1031091 3300003163 Bacteria 1016
26 JGI25151J46595_10000044 3300003187 Bacteria 170418
27 JGI25153J46596_10000369 3300003215 Bacteria 30875
28 JGI25153J46596_10000379 3300003215 Bacteria 30351
29 JGI25153J46596_10002710 3300003215 Bacteria 10099
30 Ga0006777J48905_1021316 3300003308 Bacteria 3067
31 Ga0006777J48905_1034387 3300003308 Bacteria 2006
32 JGI25160J50197_1000011 3300003354 Bacteria 275577
33 JGI25161J50226_1000216 3300003374 Bacteria 36285
34 Ga0007410J51695_1020795 3300003574 Bacteria 1217
35 Ga0007409J51694_1049573 3300003575 Bacteria 1089
36 Ga0007416J51690_1033932 3300003577 Bacteria 990
37 Ga0007429J51699_1038745 3300003579 Bacteria 1167
38 Ga0007429J51699_1038746 3300003579 Bacteria 1118
39 Ga0032354_1047281 3300003693 Bacteria 2122
40 Ga0006780_1005821 3300003735 Bacteria 1480
41 Ga0006780_1019722 3300003735 Bacteria 1706
42 Ga0055542_1001387 3300003762 Bacteria 12276
43 Ga0055542_1002854 3300003762 Bacteria 5147
44 Ga0055526_1000091 3300003771 Bacteria 82891
45 Ga0055526_1003540 3300003771 Bacteria 9852
46 Ga0055526_1003634 3300003771 Bacteria 9659
47 Ga0055526_1034806 3300003771 Bacteria 1369
48 Ga0055524_1029369 3300003775 Bacteria 1626
49 Ga0055531_10030043 3300003794 Bacteria 1836
50 JGI25405J52794_10036305 3300003911 Bacteria 1034
51 Ga0055543_1000179 3300004625 Bacteria 52563
52 Ga0055543_1025677 3300004625 Bacteria 1051
53 Ga0058862_12598501 3300004803 Bacteria 2181
54 Ga0065165_1000018 3300005262 Bacteria 275082
55 Ga0065165_1000549 3300005262 Bacteria 56452
56 Ga0065165_1006672 3300005262 Bacteria 5952
57 Ga0065165_1007387 3300005262 Bacteria 5417
58 Ga0070658_10135240 3300005327 Bacteria 2056
59 Ga0070676_10033629 3300005328 Bacteria 2942
60 Ga0070683_100046149 3300005329 Bacteria 4024
61 Ga0070683_100130954 3300005329 Bacteria 2374
62 Ga0070683_100288797 3300005329 Bacteria 1560
63 Ga0070690_100000031 3300005330 Bacteria 64458
64 Ga0070670_100002795 3300005331 Bacteria 14432
65 Ga0070670_100010830 3300005331 Bacteria 7789
66 Ga0070670_100069841 3300005331 Bacteria 3016
67 Ga0068869_100101973 3300005334 Bacteria 2171
68 Ga0070666_10048602 3300005335 Bacteria 2851
69 Ga0070680_100013749 3300005336 Bacteria 6313
70 Ga0070680_100065124 3300005336 Bacteria 2987
71 Ga0070680_100102229 3300005336 Bacteria 2380
72 Ga0070680_100133539 3300005336 Bacteria 2078
73 Ga0070680_100269665 3300005336 Bacteria 1441
74 Ga0070680_100377506 3300005336 Bacteria 1207
75 Ga0070682_100000872 3300005337 Bacteria 17577
76 Ga0070682_100004641 3300005337 Bacteria 7629
77 Ga0070682_100281378 3300005337 Bacteria 1213
78 Ga0070682_100335008 3300005337 Bacteria 1123
79 Ga0068868_100007455 3300005338 Bacteria 7791
80 Ga0068868_100015186 3300005338 Bacteria 5689
81 Ga0068868_100380111 3300005338 Bacteria 1215
82 Ga0068868_100392547 3300005338 Bacteria 1196
83 Ga0070660_100000424 3300005339 Bacteria 28001
84 Ga0070660_100059342 3300005339 Bacteria 2967
85 Ga0070660_100135596 3300005339 Bacteria 1972
86 Ga0070660_100193622 3300005339 Bacteria 1647
87 Ga0070689_100012792 3300005340 Bacteria 6058
88 Ga0070689_100027324 3300005340 Bacteria 4302
89 Ga0070689_100073641 3300005340 Bacteria 2672
90 Ga0070691_10000305 3300005341 Bacteria 17240
91 Ga0070691_10123538 3300005341 Bacteria 1306
92 Ga0070687_100002671 3300005343 Bacteria 6745
93 Ga0070687_100025098 3300005343 Bacteria 2855
94 Ga0070661_100005997 3300005344 Bacteria 8364
95 Ga0070661_100053570 3300005344 Bacteria 2953
96 Ga0070661_100495726 3300005344 Bacteria 977
97 Ga0070692_10015981 3300005345 Bacteria 3562
98 Ga0070692_10045100 3300005345 Bacteria 2273
99 Ga0070668_100000547 3300005347 Bacteria 25148
100 Ga0070668_100373663 3300005347 Bacteria 1212
101 Ga0070669_100000573 3300005353 Bacteria 27336
102 Ga0070669_100062845 3300005353 Bacteria 2731
103 Ga0070669_100694753 3300005353 Bacteria 859
104 Ga0070675_100206460 3300005354 Bacteria 1706
105 Ga0070675_100526441 3300005354 Bacteria 1067
106 Ga0070671_100000381 3300005355 Bacteria 30589
107 Ga0070671_100153648 3300005355 Bacteria 1944
108 Ga0070671_100244960 3300005355 Bacteria 1522
109 Ga0070674_100000523 3300005356 Bacteria 19303
110 Ga0070674_100093334 3300005356 Bacteria 2177
111 Ga0070674_100401802 3300005356 Bacteria 1120
112 Ga0070673_100000111 3300005364 Bacteria 37570
113 Ga0070673_100054247 3300005364 Bacteria 3152
114 Ga0070673_100145227 3300005364 Bacteria 2005
115 Ga0070688_100000439 3300005365 Bacteria 21017
116 Ga0070688_100074540 3300005365 Bacteria 2180
117 Ga0070688_100427441 3300005365 Bacteria 986
118 Ga0070659_100001531 3300005366 Bacteria 16679
119 Ga0070659_100037122 3300005366 Bacteria 3798
120 Ga0070659_100200026 3300005366 Bacteria 1644
121 Ga0070667_100000742 3300005367 Bacteria 31206
122 Ga0070667_100268555 3300005367 Bacteria 1529
123 Ga0070667_100573012 3300005367 Bacteria 1039
124 Ga0070667_100719936 3300005367 Bacteria 924
125 Ga0070703_10021610 3300005406 Bacteria 1883
126 Ga0070703_10043166 3300005406 Bacteria 1413
127 Ga0070709_10001603 3300005434 Bacteria 12207
128 Ga0070709_10015446 3300005434 Bacteria 4345
129 Ga0070709_10189242 3300005434 Bacteria 1451
130 Ga0070714_100002925 3300005435 Bacteria 12640
131 Ga0070714_100324023 3300005435 Bacteria 1442
132 Ga0070714_100814590 3300005435 Bacteria 905
133 Ga0070713_100002679 3300005436 Bacteria 11615
134 Ga0070713_100036702 3300005436 Bacteria 3957
135 Ga0070713_100220937 3300005436 Bacteria 1719
136 Ga0070713_100781734 3300005436 Bacteria 914
137 Ga0070710_10052010 3300005437 Bacteria 2303
138 Ga0070701_10003309 3300005438 Bacteria 6353
139 Ga0070701_10008282 3300005438 Bacteria 4490
140 Ga0070701_10210661 3300005438 Bacteria 1154
141 Ga0070711_100000238 3300005439 Bacteria 28196
142 Ga0070711_100098052 3300005439 Bacteria 2127
143 Ga0070711_100187725 3300005439 Bacteria 1586
144 Ga0070705_100000568 3300005440 Bacteria 21393
145 Ga0070705_100007808 3300005440 Bacteria 5283
146 Ga0070705_100026017 3300005440 Bacteria 3181
147 Ga0070705_100071228 3300005440 Bacteria 2102
148 Ga0070705_100298660 3300005440 Bacteria 1153
149 Ga0070700_100000702 3300005441 Bacteria 16502
150 Ga0070700_100000905 3300005441 Bacteria 14646
151 Ga0070700_100012342 3300005441 Bacteria 4764
152 Ga0070700_100058428 3300005441 Bacteria 2423
153 Ga0070694_100002735 3300005444 Bacteria 10460
154 Ga0070694_100016938 3300005444 Bacteria 4596
155 Ga0070694_100025588 3300005444 Bacteria 3819
156 Ga0070694_100546628 3300005444 Bacteria 927
157 Ga0070708_100062984 3300005445 Bacteria 3319
158 Ga0070663_100002733 3300005455 Bacteria 9991
159 Ga0070663_100003287 3300005455 Bacteria 9304
160 Ga0070663_100021801 3300005455 Bacteria 4267
161 Ga0070663_100030693 3300005455 Bacteria 3687
162 Ga0070663_100073480 3300005455 Bacteria 2494
163 Ga0070663_100579500 3300005455 Bacteria 941
164 Ga0070678_100000328 3300005456 Bacteria 22182
165 Ga0070678_100003909 3300005456 Bacteria 8377
166 Ga0070678_100033247 3300005456 Bacteria 3578
167 Ga0070678_100094107 3300005456 Bacteria 2306
168 Ga0070678_100373546 3300005456 Bacteria 1232
169 Ga0070678_100658572 3300005456 Bacteria 940
170 Ga0070662_100001201 3300005457 Bacteria 15917
171 Ga0070662_100046829 3300005457 Bacteria 3108
172 Ga0070681_10002440 3300005458 Bacteria 17015
173 Ga0070681_10047892 3300005458 Bacteria 4272
174 Ga0070681_10049840 3300005458 Bacteria 4180
175 Ga0070681_10708582 3300005458 Bacteria 922
176 Ga0068867_100187633 3300005459 Bacteria 1648
177 Ga0070698_100108642 3300005471 Bacteria 2741
178 Ga0070699_100003865 3300005518 Bacteria 13242
179 Ga0070699_100245266 3300005518 Bacteria 1600
180 Ga0070679_100007780 3300005530 Bacteria 10040
181 Ga0070679_100012547 3300005530 Bacteria 8104
182 Ga0070679_100045074 3300005530 Bacteria 4394
183 Ga0070679_100109775 3300005530 Bacteria 2745
184 Ga0070679_100282828 3300005530 Bacteria 1611
185 Ga0070684_100549518 3300005535 Bacteria 1072
186 Ga0070697_100000372 3300005536 Bacteria 35015
187 Ga0070697_100003894 3300005536 Bacteria 11463
188 Ga0070697_100148486 3300005536 Bacteria 1975
189 Ga0070697_100368945 3300005536 Bacteria 1242
190 Ga0068853_100002908 3300005539 Bacteria 13013
191 Ga0068853_100008796 3300005539 Bacteria 8121
192 Ga0068853_100014575 3300005539 Bacteria 6444
193 Ga0068853_100019258 3300005539 Bacteria 5657
194 Ga0070672_100004025 3300005543 Bacteria 9587
195 Ga0070672_100004197 3300005543 Bacteria 9414
196 Ga0070672_100090017 3300005543 Bacteria 2474
197 Ga0070686_100023660 3300005544 Bacteria 3675
198 Ga0070686_100028163 3300005544 Bacteria 3405
199 Ga0070686_100095430 3300005544 Bacteria 1998
200 Ga0070686_100514606 3300005544 Bacteria 931
201 Ga0070695_100000379 3300005545 Bacteria 22911
202 Ga0070695_100002634 3300005545 Bacteria 10372
203 Ga0070695_100013831 3300005545 Bacteria 4855
204 Ga0070696_100002850 3300005546 Bacteria 11499
205 Ga0070696_100048951 3300005546 Bacteria 2934
206 Ga0070696_100240340 3300005546 Bacteria 1366
207 Ga0070693_100000366 3300005547 Bacteria 20481
208 Ga0070693_100037074 3300005547 Bacteria 2716
209 Ga0070665_100095453 3300005548 Bacteria 2979
210 Ga0070665_100183602 3300005548 Bacteria 2092
211 Ga0070665_100260233 3300005548 Bacteria 1736
212 Ga0070704_100000980 3300005549 Bacteria 14523
213 Ga0070704_100004175 3300005549 Bacteria 8337
214 Ga0070704_100049937 3300005549 Bacteria 2937
215 Ga0070704_100057515 3300005549 Bacteria 2765
216 Ga0070704_100116809 3300005549 Bacteria 2041
217 Ga0068855_100001286 3300005563 Bacteria 31105
218 Ga0068855_100297600 3300005563 Bacteria 1788
219 Ga0070664_100001736 3300005564 Bacteria 17436
220 Ga0070664_100232401 3300005564 Bacteria 1653
221 Ga0070664_100339109 3300005564 Bacteria 1365
222 Ga0068857_100000473 3300005577 Bacteria 28704
223 Ga0068854_100001023 3300005578 Bacteria 16772
224 Ga0068856_100005557 3300005614 Bacteria 12413
225 Ga0070702_100001480 3300005615 Bacteria 9641
226 Ga0070702_100002704 3300005615 Bacteria 7752
227 Ga0070702_100004009 3300005615 Bacteria 6682
228 Ga0070702_100244625 3300005615 Bacteria 1213
229 Ga0068852_100003530 3300005616 Bacteria 10943
230 Ga0068852_100022442 3300005616 Bacteria 5062
231 Ga0068852_100136450 3300005616 Bacteria 2265
232 Ga0068859_100009249 3300005617 Bacteria 9949
233 Ga0068859_100013367 3300005617 Bacteria 8231
234 Ga0068859_100120135 3300005617 Bacteria 2694
235 Ga0068864_100006233 3300005618 Bacteria 9782
236 Ga0068864_100017168 3300005618 Bacteria 6035
237 Ga0068864_100062473 3300005618 Bacteria 3227
238 Ga0068864_100082507 3300005618 Bacteria 2821
239 Ga0068866_10098286 3300005718 Bacteria 1609
240 Ga0068861_100000606 3300005719 Bacteria 21211
241 Ga0068861_100006956 3300005719 Bacteria 7728
242 Ga0068861_100086963 3300005719 Bacteria 2458
243 Ga0068861_100208872 3300005719 Bacteria 1643
244 Ga0068861_100211215 3300005719 Bacteria 1635
245 Ga0068861_100737912 3300005719 Bacteria 919
246 Ga0068851_10039572 3300005834 Bacteria 2368
247 Ga0068851_10145084 3300005834 Bacteria 1294
248 Ga0068870_10294129 3300005840 Bacteria 1023
249 Ga0068863_100013115 3300005841 Bacteria 7996
250 Ga0068863_100016333 3300005841 Bacteria 7123
251 Ga0068863_100099939 3300005841 Bacteria 2757
252 Ga0068858_100140808 3300005842 Bacteria 2264
253 Ga0068860_100001485 3300005843 Bacteria 25321
254 Ga0068860_100007864 3300005843 Bacteria 10644
255 Ga0068860_100045325 3300005843 Bacteria 4193
256 Ga0068860_100074806 3300005843 Bacteria 3221
257 Ga0068860_100111225 3300005843 Bacteria 2619
258 Ga0068860_100116590 3300005843 Bacteria 2555
259 Ga0068862_100000857 3300005844 Bacteria 29811
260 Ga0068862_100001067 3300005844 Bacteria 26267
261 Ga0068862_100006026 3300005844 Bacteria 10095
262 Ga0068862_100055915 3300005844 Bacteria 3380
263 Ga0081455_10002287 3300005937 Bacteria 22863
264 Ga0081455_10138082 3300005937 Bacteria 1897
265 Ga0081455_10138890 3300005937 Bacteria 1890
266 Ga0081455_10147356 3300005937 Bacteria 1819
267 Ga0081455_10186125 3300005937 Bacteria 1568
268 Ga0081538_10003767 3300005981 Bacteria 14200
269 Ga0081540_1000231 3300005983 Bacteria 58494
270 Ga0081540_1001706 3300005983 Bacteria 18603
271 Ga0081540_1021452 3300005983 Bacteria 3844
272 Ga0081540_1084098 3300005983 Bacteria 1421
273 Ga0081539_10090050 3300005985 Bacteria 1587
274 Ga0070717_10085658 3300006028 Bacteria 2652
275 Ga0070717_10098164 3300006028 Bacteria 2483
276 Ga0070717_10143793 3300006028 Bacteria 2059
277 Ga0070717_10220331 3300006028 Bacteria 1667
278 Ga0075365_10017184 3300006038 Bacteria 4419
279 Ga0075365_10019511 3300006038 Bacteria 4186
280 Ga0075365_10021047 3300006038 Bacteria 4059
281 Ga0075365_10022168 3300006038 Bacteria 3975
282 Ga0075365_10034507 3300006038 Bacteria 3267
283 Ga0075365_10143127 3300006038 Bacteria 1660
284 Ga0075365_10381409 3300006038 Bacteria 994
285 Ga0075368_10003347 3300006042 Bacteria 5339
286 Ga0075368_10010887 3300006042 Bacteria 3298
287 Ga0075368_10023608 3300006042 Bacteria 2350
288 Ga0075368_10029933 3300006042 Bacteria 2106
289 Ga0075363_100010851 3300006048 Bacteria 4345
290 Ga0075363_100025765 3300006048 Bacteria 3003
291 Ga0075363_100056976 3300006048 Bacteria 2096
292 Ga0075363_100068627 3300006048 Bacteria 1923
293 Ga0075364_10079176 3300006051 Bacteria 2171
294 Ga0075364_10099392 3300006051 Bacteria 1936
295 Ga0075364_10121603 3300006051 Bacteria 1747
296 Ga0070715_10066022 3300006163 Bacteria 1603
297 Ga0070716_100000193 3300006173 Bacteria 24029
298 Ga0070716_100093215 3300006173 Bacteria 1828
299 Ga0070712_100010654 3300006175 Bacteria 5807
300 Ga0070712_100080499 3300006175 Bacteria 2358
301 Ga0070712_100265559 3300006175 Bacteria 1377
302 Ga0070712_100321368 3300006175 Bacteria 1259
303 Ga0070712_100451244 3300006175 Bacteria 1071
304 Ga0075362_10005091 3300006177 Bacteria 4781
305 Ga0075362_10070214 3300006177 Bacteria 1598
306 Ga0075362_10120481 3300006177 Bacteria 1242
307 Ga0075367_10009820 3300006178 Bacteria 5015
308 Ga0075367_10036305 3300006178 Bacteria 2857
309 Ga0075367_10061047 3300006178 Bacteria 2249
310 Ga0075367_10077097 3300006178 Bacteria 2012
311 Ga0075367_10203029 3300006178 Bacteria 1238
312 Ga0075367_10299311 3300006178 Bacteria 1012
313 Ga0075369_10017607 3300006186 Bacteria 2899
314 Ga0075369_10028219 3300006186 Bacteria 2351
315 Ga0075366_10003079 3300006195 Bacteria 8705
316 Ga0075366_10056348 3300006195 Bacteria 2334
317 Ga0075366_10160634 3300006195 Bacteria 1362
318 Ga0075366_10212592 3300006195 Bacteria 1177
319 Ga0097621_100016072 3300006237 Bacteria 5649
320 Ga0097621_100113186 3300006237 Bacteria 2295
321 Ga0097621_100233297 3300006237 Bacteria 1607
322 Ga0075370_10063881 3300006353 Bacteria 2099
323 Ga0075370_10141546 3300006353 Bacteria 1406
324 Ga0068871_100236588 3300006358 Bacteria 1587
325 Ga0068871_100454877 3300006358 Bacteria 1148
326 Ga0075428_100002752 3300006844 Bacteria 19148
327 Ga0075428_100004009 3300006844 Bacteria 16165
328 Ga0075428_100028795 3300006844 Bacteria 6147
329 Ga0075428_100417594 3300006844 Bacteria 1437
330 Ga0075428_100537555 3300006844 Bacteria 1250
331 Ga0075428_100708019 3300006844 Bacteria 1073
332 Ga0075430_100071305 3300006846 Bacteria 2914
333 Ga0075430_100156559 3300006846 Bacteria 1896
334 Ga0075430_100600522 3300006846 Bacteria 908
335 Ga0075431_100001262 3300006847 Bacteria 23036
336 Ga0075431_100001307 3300006847 Bacteria 22785
337 Ga0075431_100032233 3300006847 Bacteria 5400
338 Ga0075431_100052804 3300006847 Bacteria 4190
339 Ga0075431_100172567 3300006847 Bacteria 2221
340 Ga0075431_100254623 3300006847 Bacteria 1783
341 Ga0075431_100435942 3300006847 Bacteria 1308
342 Ga0075431_100673543 3300006847 Bacteria 1013
343 Ga0075433_10027105 3300006852 Bacteria 4857
344 Ga0075434_100018862 3300006871 Bacteria 6667
345 Ga0075434_100034912 3300006871 Bacteria 4970
346 Ga0075434_100047718 3300006871 Bacteria 4249
347 Ga0075434_100160823 3300006871 Bacteria 2265
348 Ga0075434_100402772 3300006871 Bacteria 1389
349 Ga0075434_100456519 3300006871 Bacteria 1299
350 Ga0075429_100002424 3300006880 Bacteria 15702
351 Ga0075429_100022083 3300006880 Bacteria 5520
352 Ga0075429_100042256 3300006880 Bacteria 3968
353 Ga0068865_100069379 3300006881 Bacteria 2494
354 Ga0075436_100004853 3300006914 Bacteria 9238
355 Ga0075436_100004980 3300006914 Bacteria 9129
356 Ga0075436_100047313 3300006914 Bacteria 2967
357 Ga0075436_100066367 3300006914 Bacteria 2494
358 Ga0097620_100009249 3300006931 Bacteria 9949
359 Ga0097620_100013367 3300006931 Bacteria 8231
360 Ga0097620_100120143 3300006931 Bacteria 2694
361 Ga0079104_1004255 3300006946 Bacteria 6220
362 Ga0099826_10077084 3300006948 Bacteria 2092
363 Ga0075435_100044729 3300007076 Bacteria 3547
364 Ga0075435_100100777 3300007076 Bacteria 2393
365 Ga0075435_100116551 3300007076 Bacteria 2225
366 Ga0099795_10033345 3300007788 Bacteria 1788
367 Ga0105251_10051618 3300009011 Bacteria 1960
368 Ga0105250_10068692 3300009092 Bacteria 1430
369 Ga0105240_10048596 3300009093 Bacteria 5361
370 Ga0105240_10067454 3300009093 Bacteria 4434
371 Ga0105240_10220694 3300009093 Bacteria 2209
372 Ga0105240_10584168 3300009093 Bacteria 1232
373 Ga0111539_10001242 3300009094 Bacteria 33925
374 Ga0111539_10026961 3300009094 Bacteria 7019
375 Ga0111539_10063135 3300009094 Bacteria 4383
376 Ga0111539_10181896 3300009094 Bacteria 2455
377 Ga0111539_10226878 3300009094 Bacteria 2175
378 Ga0111539_10349014 3300009094 Bacteria 1722
379 Ga0105245_10004930 3300009098 Bacteria 11739
380 Ga0105245_10017425 3300009098 Bacteria 6267
381 Ga0105245_10059791 3300009098 Bacteria 3432
382 Ga0105245_10147155 3300009098 Bacteria 2223
383 Ga0105247_10000879 3300009101 Bacteria 22695
384 Ga0105247_10017227 3300009101 Bacteria 4336
385 Ga0105247_10061884 3300009101 Bacteria 2321
386 Ga0105247_10097310 3300009101 Bacteria 1877
387 Ga0105247_10237677 3300009101 Bacteria 1240
388 Ga0114129_10000485 3300009147 Bacteria 48038
389 Ga0114129_10009810 3300009147 Bacteria 13655
390 Ga0114129_10110544 3300009147 Bacteria 3793
391 Ga0114129_10385094 3300009147 Bacteria 1851
392 Ga0114129_10473597 3300009147 Bacteria 1639
393 Ga0114129_10492794 3300009147 Bacteria 1601
394 Ga0114129_11128352 3300009147 Bacteria 980
395 Ga0105243_10000542 3300009148 Bacteria 38308
396 Ga0105243_10020796 3300009148 Bacteria 4979
397 Ga0105243_10046042 3300009148 Bacteria 3429
398 Ga0105243_10187168 3300009148 Bacteria 1805
399 Ga0105243_10400458 3300009148 Bacteria 1275
400 Ga0105243_10503446 3300009148 Bacteria 1148
401 Ga0105243_11013988 3300009148 Bacteria 833
402 Ga0105241_10005203 3300009174 Bacteria 9603
403 Ga0105241_10006654 3300009174 Bacteria 8511
404 Ga0105241_10009459 3300009174 Bacteria 7158
405 Ga0105241_10023742 3300009174 Bacteria 4549
406 Ga0105241_10088976 3300009174 Bacteria 2432
407 Ga0105242_10009921 3300009176 Bacteria 7293
408 Ga0105248_10001122 3300009177 Bacteria 29802
409 Ga0105248_10028038 3300009177 Bacteria 6272
410 Ga0105248_10091706 3300009177 Bacteria 3421
411 Ga0105248_10115633 3300009177 Bacteria 3025
412 Ga0105237_10002679 3300009545 Bacteria 21844
413 Ga0105237_10039522 3300009545 Bacteria 4762
414 Ga0105237_10166816 3300009545 Bacteria 2201
415 Ga0105238_10038335 3300009551 Bacteria 4867
416 Ga0105238_10100546 3300009551 Bacteria 2875
417 Ga0105238_10104514 3300009551 Bacteria 2813
418 Ga0105249_10000689 3300009553 Bacteria 30748
419 Ga0105249_10002046 3300009553 Bacteria 17496
420 Ga0105249_10014308 3300009553 Bacteria 7016
421 Ga0105249_10345823 3300009553 Bacteria 1505
422 Ga0105249_10745264 3300009553 Bacteria 1041
423 Ga0099796_10003376 3300010159 Bacteria 3695
424 Ga0105239_10037767 3300010375 Bacteria 5293
425 Ga0105239_10100029 3300010375 Bacteria 3207
426 Ga0105239_10318952 3300010375 Bacteria 1752
427 Ga0105239_10397614 3300010375 Bacteria 1559
428 Ga0105239_10528237 3300010375 Bacteria 1343
429 Ga0105239_10564841 3300010375 Bacteria 1296
430 Ga0105246_10000180 3300011119 Bacteria 31022
431 Ga0105246_10039428 3300011119 Bacteria 3182
432 Ga0105246_10055527 3300011119 Bacteria 2733
433 Ga0105246_10131107 3300011119 Bacteria 1873
434 Ga0105246_10236438 3300011119 Bacteria 1442
435 Ga0105246_10277015 3300011119 Bacteria 1344
436 Ga0157373_10018836 3300013100 Bacteria 5023
437 Ga0157371_10001681 3300013102 Bacteria 22591
438 Ga0157370_10137728 3300013104 Bacteria 2274
439 Ga0157370_10185361 3300013104 Bacteria 1932
440 Ga0157370_10604171 3300013104 Bacteria 1004
441 Ga0157369_10003861 3300013105 Bacteria 17813
442 Ga0157369_10142128 3300013105 Bacteria 2539
443 Ga0171462_1028 3300013250 Bacteria 110760
444 Ga0157374_10006552 3300013296 Bacteria 9889
445 Ga0157374_10082150 3300013296 Bacteria 3059
446 Ga0157378_10001537 3300013297 Bacteria 20848
447 Ga0157378_10064448 3300013297 Bacteria 3278
448 Ga0157378_10567714 3300013297 Bacteria 1142
449 Ga0163162_10001513 3300013306 Bacteria 21645
450 Ga0163162_10031192 3300013306 Bacteria 5286
451 Ga0163162_10275774 3300013306 Bacteria 1814
452 Ga0163162_10618809 3300013306 Bacteria 1208
453 Ga0157372_10008591 3300013307 Bacteria 10854
454 Ga0157372_10008951 3300013307 Bacteria 10638
455 Ga0157372_10345374 3300013307 Bacteria 1734
456 Ga0157375_10001949 3300013308 Bacteria 17792
457 Ga0157375_10722129 3300013308 Bacteria 1149
458 Ga0163163_10032343 3300014325 Bacteria 5051
459 Ga0163163_10071104 3300014325 Bacteria 3466
460 Ga0163163_10113169 3300014325 Bacteria 2744
461 Ga0157380_10001442 3300014326 Bacteria 15562
462 Ga0157380_10011537 3300014326 Bacteria 6385
463 Ga0157380_10025674 3300014326 Bacteria 4469
464 Ga0157380_10073492 3300014326 Bacteria 2772
465 Ga0157380_10203036 3300014326 Bacteria 1760
466 Ga0157380_10226940 3300014326 Bacteria 1674
467 Ga0182008_10226534 3300014497 Bacteria 958
468 Ga0157377_10008396 3300014745 Bacteria 5035
469 Ga0157377_10013535 3300014745 Bacteria 4130
470 Ga0157377_10077333 3300014745 Bacteria 1937
471 Ga0157377_10376092 3300014745 Bacteria 960
472 Ga0157379_10006845 3300014968 Bacteria 9853
473 Ga0157379_10009632 3300014968 Bacteria 8410
474 Ga0157379_10029045 3300014968 Bacteria 4917
475 Ga0157379_10030444 3300014968 Bacteria 4804
476 Ga0157379_10143031 3300014968 Bacteria 2156
477 Ga0157376_10000456 3300014969 Bacteria 26374
478 Ga0157376_10047623 3300014969 Bacteria 3540
479 Ga0157376_10117584 3300014969 Bacteria 2351
480 Ga0157376_10509418 3300014969 Bacteria 1184
481 Ga0157376_10683581 3300014969 Bacteria 1030
482 Ga0182005_1014359 3300015265 Bacteria 2216
483 Ga0182005_1050499 3300015265 Bacteria 1131
484 Ga0163161_10019400 3300017792 Bacteria 4771
485 Ga0163161_10034769 3300017792 Bacteria 3605
486 Ga0206353_11139613 3300020082 Bacteria 2180
487 Ga0214544_1000129 3300021320 Bacteria 108948
488 Ga0214542_1000245 3300021321 Bacteria 90699
489 Ga0214543_1000010 3300021327 Bacteria 364844
490 Ga0213872_10133731 3300021361 Bacteria 1091
491 Ga0213874_10112506 3300021377 Bacteria 916
492 Ga0213876_10006894 3300021384 Bacteria 6193
493 Ga0213876_10011881 3300021384 Bacteria 4642
494 Ga0213876_10013939 3300021384 Bacteria 4260
495 Ga0213875_10000705 3300021388 Bacteria 25714
496 Ga0213875_10112025 3300021388 Bacteria 1274
497 Ga0228711_1000007 3300022739 Bacteria 202413
498 Ga0228710_1000007 3300022740 Bacteria 189104
499 Ga0209436_103537 3300025208 Bacteria 4115
500 Ga0207672_1002998 3300025223 Bacteria 978
501 Ga0207425_1018745 3300025245 Bacteria 1498
502 Ga0209026_1000002 3300025250 Bacteria 1136158
503 Ga0209677_111792 3300025253 Bacteria 1339
504 Ga0209148_1000038 3300025254 Bacteria 493744
505 Ga0209148_1004788 3300025254 Bacteria 3240
506 Ga0209759_1000062 3300025256 Bacteria 197996
507 Ga0209233_1000027 3300025261 Bacteria 652089
508 Ga0209233_1010583 3300025261 Bacteria 2756
509 Ga0209455_1000068 3300025272 Bacteria 310024
510 Ga0209673_1019323 3300025273 Bacteria 2450
511 Ga0209130_1000029 3300025284 Bacteria 323399
512 Ga0209130_1000062 3300025284 Bacteria 200367
513 Ga0209675_1000554 3300025291 Bacteria 27190
514 Ga0209676_1001711 3300025292 Bacteria 18937
515 Ga0209025_1000014 3300025294 Bacteria 865448
516 Ga0209025_1000033 3300025294 Bacteria 414511
517 Ga0209025_1000787 3300025294 Bacteria 52060
518 Ga0209025_1003796 3300025294 Bacteria 13816
519 Ga0209025_1063950 3300025294 Bacteria 1354
520 Ga0209564_1000017 3300025295 Bacteria 594063
521 Ga0209564_1000077 3300025295 Bacteria 281592
522 Ga0209564_1000275 3300025295 Bacteria 107884
523 Ga0209564_1028903 3300025295 Bacteria 1758
524 Ga0209758_1000024 3300025297 Bacteria 591966
525 Ga0209758_1000641 3300025297 Bacteria 53250
526 Ga0209758_1001779 3300025297 Bacteria 23875
527 Ga0209758_1009659 3300025297 Bacteria 5944
528 Ga0209758_1011523 3300025297 Bacteria 5105
529 Ga0209050_1001363 3300025298 Bacteria 26748
530 Ga0209256_1000057 3300025299 Bacteria 281592
531 Ga0209256_1000102 3300025299 Bacteria 199097
532 Ga0209256_1000649 3300025299 Bacteria 47340
533 Ga0209256_1011304 3300025299 Bacteria 3590
534 Ga0207426_1000074 3300025302 Bacteria 323399
535 Ga0207426_1005362 3300025302 Bacteria 5886
536 Ga0209257_1001606 3300025304 Bacteria 25871
537 Ga0209257_1002758 3300025304 Bacteria 16612
538 Ga0207697_10019433 3300025315 Bacteria 2783
539 Ga0207697_10080644 3300025315 Bacteria 1371
540 Ga0207656_10102101 3300025321 Bacteria 1316
541 Ga0207656_10152788 3300025321 Bacteria 1094
542 Ga0207696_1038406 3300025711 Bacteria 1413
543 Ga0207653_10001874 3300025885 Bacteria 6732
544 Ga0207682_10153648 3300025893 Bacteria 1039
545 Ga0207692_10075709 3300025898 Bacteria 1786
546 Ga0207642_10002234 3300025899 Bacteria 6015
547 Ga0207642_10005653 3300025899 Bacteria 4097
548 Ga0207710_10004276 3300025900 Bacteria 6251
549 Ga0207710_10023510 3300025900 Bacteria 2649
550 Ga0207688_10000758 3300025901 Bacteria 16064
551 Ga0207688_10025034 3300025901 Bacteria 3275
552 Ga0207688_10051576 3300025901 Bacteria 2304
553 Ga0207647_10003290 3300025904 Bacteria 12131
554 Ga0207647_10037505 3300025904 Bacteria 3072
555 Ga0207647_10051475 3300025904 Bacteria 2545
556 Ga0207685_10044057 3300025905 Bacteria 1685
557 Ga0207685_10045708 3300025905 Bacteria 1662
558 Ga0207699_10007735 3300025906 Bacteria 5261
559 Ga0207699_10095438 3300025906 Bacteria 1875
560 Ga0207699_10108838 3300025906 Bacteria 1772
561 Ga0207699_10437124 3300025906 Bacteria 937
562 Ga0207645_10003906 3300025907 Bacteria 11138
563 Ga0207643_10279642 3300025908 Bacteria 1035
564 Ga0207705_10083804 3300025909 Bacteria 2327
565 Ga0207705_10131147 3300025909 Bacteria 1866
566 Ga0207654_10016215 3300025911 Bacteria 3876
567 Ga0207654_10027426 3300025911 Bacteria 3095
568 Ga0207707_10031203 3300025912 Bacteria 4662
569 Ga0207707_10035167 3300025912 Bacteria 4381
570 Ga0207707_10195214 3300025912 Bacteria 1766
571 Ga0207707_10446812 3300025912 Bacteria 1106
572 Ga0207707_10495256 3300025912 Bacteria 1043
573 Ga0207695_10036226 3300025913 Bacteria 5336
574 Ga0207695_10066978 3300025913 Bacteria 3685
575 Ga0207695_10525352 3300025913 Bacteria 1065
576 Ga0207671_10092761 3300025914 Bacteria 2277
577 Ga0207693_10000072 3300025915 Bacteria 89637
578 Ga0207693_10132586 3300025915 Bacteria 1958
579 Ga0207693_10138548 3300025915 Bacteria 1913
580 Ga0207663_10002680 3300025916 Bacteria 8586
581 Ga0207663_10024904 3300025916 Bacteria 3452
582 Ga0207663_10078860 3300025916 Bacteria 2148
583 Ga0207663_10246005 3300025916 Bacteria 1314
584 Ga0207660_10091094 3300025917 Bacteria 2260
585 Ga0207660_10113833 3300025917 Bacteria 2040
586 Ga0207660_10473766 3300025917 Bacteria 1014
587 Ga0207660_10560694 3300025917 Bacteria 929
588 Ga0207662_10000313 3300025918 Bacteria 22248
589 Ga0207662_10041438 3300025918 Bacteria 2711
590 Ga0207662_10128287 3300025918 Bacteria 1597
591 Ga0207662_10311449 3300025918 Bacteria 1049
592 Ga0207657_10000027 3300025919 Bacteria 141750
593 Ga0207657_10014193 3300025919 Bacteria 7789
594 Ga0207657_10179129 3300025919 Bacteria 1714
595 Ga0207649_10001170 3300025920 Bacteria 15823
596 Ga0207652_10040020 3300025921 Bacteria 3980
597 Ga0207652_10092944 3300025921 Bacteria 2654
598 Ga0207652_10097708 3300025921 Bacteria 2589
599 Ga0207652_10176198 3300025921 Bacteria 1920
600 Ga0207652_10189606 3300025921 Bacteria 1849
601 Ga0207646_10657379 3300025922 Bacteria 939
602 Ga0207681_10004087 3300025923 Bacteria 9039
603 Ga0207681_10347388 3300025923 Bacteria 1187
604 Ga0207694_10412490 3300025924 Bacteria 1124
605 Ga0207650_10017887 3300025925 Bacteria 4966
606 Ga0207650_10049224 3300025925 Bacteria 3111
607 Ga0207650_10428809 3300025925 Bacteria 1098
608 Ga0207659_10025409 3300025926 Bacteria 3979
609 Ga0207659_10037274 3300025926 Bacteria 3374
610 Ga0207687_10018279 3300025927 Bacteria 4625
611 Ga0207687_10027057 3300025927 Bacteria 3845
612 Ga0207687_10060913 3300025927 Bacteria 2664
613 Ga0207687_10536755 3300025927 Bacteria 980
614 Ga0207700_10240244 3300025928 Bacteria 1543
615 Ga0207700_10490004 3300025928 Bacteria 1087
616 Ga0207664_10064083 3300025929 Bacteria 2938
617 Ga0207664_10216951 3300025929 Bacteria 1657
618 Ga0207664_10372458 3300025929 Bacteria 1267
619 Ga0207644_10095577 3300025931 Bacteria 2222
620 Ga0207644_10752778 3300025931 Bacteria 814
621 Ga0207690_10036854 3300025932 Bacteria 3170
622 Ga0207690_10079138 3300025932 Bacteria 2290
623 Ga0207706_10000039 3300025933 Bacteria 132584
624 Ga0207706_10006559 3300025933 Bacteria 10778
625 Ga0207706_10073665 3300025933 Bacteria 3003
626 Ga0207686_10002173 3300025934 Bacteria 10795
627 Ga0207686_10006573 3300025934 Bacteria 6261
628 Ga0207709_10008225 3300025935 Bacteria 5777
629 Ga0207709_10101691 3300025935 Bacteria 1901
630 Ga0207709_10109068 3300025935 Bacteria 1847
631 Ga0207709_10199474 3300025935 Bacteria 1428
632 Ga0207709_10209935 3300025935 Bacteria 1397
633 Ga0207709_10379048 3300025935 Bacteria 1076
634 Ga0207670_10004298 3300025936 Bacteria 7652
635 Ga0207670_10011443 3300025936 Bacteria 5153
636 Ga0207670_10027929 3300025936 Bacteria 3575
637 Ga0207669_10041228 3300025937 Bacteria 2685
638 Ga0207669_10071562 3300025937 Bacteria 2179
639 Ga0207704_10007409 3300025938 Bacteria 5182
640 Ga0207704_10046720 3300025938 Bacteria 2582
641 Ga0207665_10000076 3300025939 Bacteria 63143
642 Ga0207665_10073227 3300025939 Bacteria 2342
643 Ga0207665_10175730 3300025939 Bacteria 1549
644 Ga0207691_10001122 3300025940 Bacteria 26597
645 Ga0207691_10003280 3300025940 Bacteria 15760
646 Ga0207691_10028245 3300025940 Bacteria 5254
647 Ga0207691_10221540 3300025940 Bacteria 1640
648 Ga0207711_10010943 3300025941 Bacteria 7539
649 Ga0207711_10036519 3300025941 Bacteria 4169
650 Ga0207711_10308962 3300025941 Bacteria 1459
651 Ga0207689_10004525 3300025942 Bacteria 12586
652 Ga0207689_10020242 3300025942 Bacteria 5603
653 Ga0207679_10005429 3300025945 Bacteria 7985
654 Ga0207667_10305562 3300025949 Bacteria 1625
655 Ga0207667_10354707 3300025949 Bacteria 1495
656 Ga0207651_10021496 3300025960 Bacteria 3923
657 Ga0207651_10377593 3300025960 Bacteria 1200
658 Ga0207712_10174874 3300025961 Bacteria 1682
659 Ga0207712_10420817 3300025961 Bacteria 1127
660 Ga0207668_10000911 3300025972 Bacteria 17799
661 Ga0207668_10052938 3300025972 Bacteria 2811
662 Ga0207668_10130278 3300025972 Bacteria 1919
663 Ga0207668_10351041 3300025972 Bacteria 1233
664 Ga0207668_10534239 3300025972 Bacteria 1014
665 Ga0207640_10002505 3300025981 Bacteria 9841
666 Ga0207640_10008447 3300025981 Bacteria 5721
667 Ga0207658_10018968 3300025986 Bacteria 4756
668 Ga0207658_10075213 3300025986 Bacteria 2569
669 Ga0207658_10299397 3300025986 Bacteria 1385
670 Ga0207658_10468936 3300025986 Bacteria 1117
671 Ga0207677_10002744 3300026023 Bacteria 9289
672 Ga0207677_10063982 3300026023 Bacteria 2559
673 Ga0207677_10272482 3300026023 Bacteria 1385
674 Ga0207703_10014165 3300026035 Bacteria 6218
675 Ga0207703_10022449 3300026035 Bacteria 4950
676 Ga0207703_10024059 3300026035 Bacteria 4791
677 Ga0207703_10025864 3300026035 Bacteria 4618
678 Ga0207639_10018747 3300026041 Bacteria 4921
679 Ga0207639_10050625 3300026041 Bacteria 3155
680 Ga0207639_10093002 3300026041 Bacteria 2417
681 Ga0207639_10126557 3300026041 Bacteria 2108
682 Ga0207639_10181198 3300026041 Bacteria 1792
683 Ga0207639_10252540 3300026041 Bacteria 1538
684 Ga0207639_10691810 3300026041 Bacteria 946
685 Ga0207678_10000034 3300026067 Bacteria 104888
686 Ga0207678_10000098 3300026067 Bacteria 71425
687 Ga0207678_10012927 3300026067 Bacteria 7326
688 Ga0207678_10026827 3300026067 Bacteria 5024
689 Ga0207678_10062963 3300026067 Bacteria 3188
690 Ga0207678_10321104 3300026067 Bacteria 1332
691 Ga0207678_10379037 3300026067 Bacteria 1223
692 Ga0207678_10417385 3300026067 Bacteria 1163
693 Ga0207708_10000351 3300026075 Bacteria 36153
694 Ga0207708_10002109 3300026075 Bacteria 14648
695 Ga0207708_10008714 3300026075 Bacteria 7510
696 Ga0207708_10057680 3300026075 Bacteria 2963
697 Ga0207708_10267251 3300026075 Bacteria 1382
698 Ga0207708_10304078 3300026075 Bacteria 1298
699 Ga0207708_10329468 3300026075 Bacteria 1248
700 Ga0207708_10705305 3300026075 Bacteria 863
701 Ga0207702_10063631 3300026078 Bacteria 3155
702 Ga0207702_10829747 3300026078 Bacteria 914
703 Ga0207641_10014819 3300026088 Bacteria 6391
704 Ga0207641_10056855 3300026088 Bacteria 3326
705 Ga0207641_10121619 3300026088 Bacteria 2330
706 Ga0207641_10207084 3300026088 Bacteria 1812
707 Ga0207648_10023624 3300026089 Bacteria 5504
708 Ga0207648_10085717 3300026089 Bacteria 2748
709 Ga0207648_10462568 3300026089 Bacteria 1156
710 Ga0207648_10790025 3300026089 Bacteria 883
711 Ga0207648_10841251 3300026089 Bacteria 856
712 Ga0207676_10008149 3300026095 Bacteria 7451
713 Ga0207676_10013451 3300026095 Bacteria 5877
714 Ga0207676_10096940 3300026095 Bacteria 2435
715 Ga0207676_10134988 3300026095 Bacteria 2104
716 Ga0207676_10148084 3300026095 Bacteria 2018
717 Ga0207674_10000154 3300026116 Bacteria 80902
718 Ga0207674_10006620 3300026116 Bacteria 13615
719 Ga0207674_10122740 3300026116 Bacteria 2564
720 Ga0207674_10843174 3300026116 Bacteria 884
721 Ga0207675_100000968 3300026118 Bacteria 28574
722 Ga0207675_100002046 3300026118 Bacteria 20107
723 Ga0207675_100005541 3300026118 Bacteria 12077
724 Ga0207675_100118295 3300026118 Bacteria 2506
725 Ga0207675_100212798 3300026118 Bacteria 1860
726 Ga0207675_100257805 3300026118 Bacteria 1689
727 Ga0207675_100307605 3300026118 Bacteria 1545
728 Ga0207675_100409846 3300026118 Bacteria 1337
729 Ga0207675_100621576 3300026118 Bacteria 1085
730 Ga0207683_10000318 3300026121 Bacteria 43903
731 Ga0207683_10007512 3300026121 Bacteria 9345
732 Ga0207683_10013041 3300026121 Bacteria 7092
733 Ga0207683_10154726 3300026121 Bacteria 2071
734 Ga0207698_10048248 3300026142 Bacteria 3231
735 Ga0207698_10085915 3300026142 Bacteria 2556
736 Ga0207698_10201756 3300026142 Bacteria 1781
737 Ga0207698_10746327 3300026142 Bacteria 977
738 Ga0209281_1000128 3300027111 Bacteria 199265
739 Ga0209589_1000109 3300027357 Bacteria 83533
740 Ga0209489_100324 3300027361 Bacteria 83533
741 Ga0209700_100355 3300027363 Bacteria 83533
742 Ga0209282_1000034 3300027666 Bacteria 140100
743 Ga0209813_10004777 3300027866 Bacteria 3253
744 Ga0209813_10005909 3300027866 Bacteria 3001
745 Ga0209813_10013465 3300027866 Bacteria 2184
746 Ga0207428_10005134 3300027907 Bacteria 12265
747 Ga0207428_10024682 3300027907 Bacteria 5046
748 Ga0207428_10447232 3300027907 Bacteria 942
749 Ga0268266_10045688 3300028379 Bacteria 3747
750 Ga0268266_10046654 3300028379 Bacteria 3709
751 Ga0268266_10047527 3300028379 Bacteria 3677
752 Ga0268266_10174209 3300028379 Bacteria 1955
753 Ga0268266_10515280 3300028379 Bacteria 1143
754 Ga0268266_10558110 3300028379 Bacteria 1098
755 Ga0268266_10619889 3300028379 Bacteria 1040
756 Ga0268265_10000953 3300028380 Bacteria 26598
757 Ga0268265_10006463 3300028380 Bacteria 7944
758 Ga0268265_10055081 3300028380 Bacteria 3020
759 Ga0268264_10021041 3300028381 Bacteria 5331
760 Ga0268264_10023542 3300028381 Bacteria 5021
761 Ga0268264_10049360 3300028381 Bacteria 3501
762 Ga0268264_10053666 3300028381 Bacteria 3363
763 Ga0268264_10142210 3300028381 Bacteria 2141
764 Ga0268264_10211642 3300028381 Bacteria 1780
765 Ga0268264_10217171 3300028381 Bacteria 1758
766 Ga0268264_10274210 3300028381 Bacteria 1577
767 Ga0265337_1002458 3300028556 Bacteria 8480
768 Ga0265326_10002501 3300028558 Bacteria 6192
769 Ga0265319_1001332 3300028563 Bacteria 14906
770 Ga0265319_1052270 3300028563 Bacteria 1345
771 Ga0265334_10003334 3300028573 Bacteria 7323
772 Ga0265323_10001242 3300028653 Bacteria 12822
773 Ga0265322_10004943 3300028654 Bacteria 3954
774 Ga0265336_10000759 3300028666 Bacteria 17132
775 Ga0307517_10128077 3300028786 Bacteria 1842
776 Ga0265338_10000013 3300028800 Bacteria 379065
777 Ga0265338_10044403 3300028800 Bacteria 4104
778 Ga0311001_1005417 3300029277 Bacteria 1088
779 Ga0265324_10002070 3300029957 Bacteria 10639
780 Ga0265332_10001497 3300031238 Bacteria 13004
781 Ga0265332_10040356 3300031238 Bacteria 2021
782 Ga0265328_10038517 3300031239 Bacteria 1764
783 Ga0265320_10045755 3300031240 Bacteria 2148
784 Ga0265325_10002054 3300031241 Bacteria 13818
785 Ga0265325_10059310 3300031241 Bacteria 1946
786 Ga0265325_10067459 3300031241 Bacteria 1803
787 Ga0265325_10073588 3300031241 Bacteria 1710
788 Ga0265325_10076394 3300031241 Bacteria 1671
789 Ga0265329_10026525 3300031242 Bacteria 1908
790 Ga0265340_10000092 3300031247 Bacteria 42341
791 Ga0265340_10000387 3300031247 Bacteria 23480
792 Ga0265340_10007981 3300031247 Bacteria 5735
793 Ga0265340_10008859 3300031247 Bacteria 5421
794 Ga0265340_10012700 3300031247 Bacteria 4445
795 Ga0265339_10002236 3300031249 Bacteria 13993
796 Ga0265339_10003394 3300031249 Bacteria 11143
797 Ga0265339_10089342 3300031249 Bacteria 1617
798 Ga0265339_10119703 3300031249 Bacteria 1355
799 Ga0265331_10035492 3300031250 Bacteria 2453
800 Ga0265316_10003669 3300031344 Bacteria 15465
801 Ga0265316_10159731 3300031344 Bacteria 1685
802 Ga0265316_10175508 3300031344 Bacteria 1597
803 Ga0265316_10208821 3300031344 Bacteria 1445
804 Ga0307509_10008703 3300031507 Bacteria 12855
805 Ga0307508_10014226 3300031616 Bacteria 7256
806 Ga0316579_10033997 3300031691 Bacteria 2343
807 Ga0265314_10024931 3300031711 Bacteria 4522
808 Ga0265314_10070839 3300031711 Bacteria 2335
809 Ga0265314_10080214 3300031711 Bacteria 2155
810 Ga0265314_10243145 3300031711 Bacteria 1037
811 Ga0265314_10289955 3300031711 Bacteria 922
812 Ga0265342_10000110 3300031712 Bacteria 91145
813 Ga0265342_10024465 3300031712 Bacteria 3811
814 Ga0316576_10170912 3300031727 Bacteria 1640
815 Ga0316578_10089745 3300031728 Bacteria 1834
816 Ga0307516_10002008 3300031730 Bacteria 27759
817 Ga0307516_10037683 3300031730 Bacteria 4831
818 Ga0307516_10048488 3300031730 Bacteria 4179
819 Ga0315914_1000010 3300031967 Bacteria 171642
820 Ga0307415_100137250 3300032126 Bacteria 1862
821 Ga0307415_100653782 3300032126 Bacteria 943
822 Ga0315913_1000005 3300033430 Bacteria 171651
823 Ga0315915_1000012 3300033464 Bacteria 199284
824 Ga0316592_1002973 3300033524 Bacteria 2995
825 Ga0316588_1000463 3300033528 Bacteria 5464
826 Ga0373950_0027060 3300034818 Bacteria 1044
827 Ga0373944_0054736 3300035089 Bacteria 1266
828 Ga0373949_0032485 3300035090 Bacteria 1250
829 Ga0373952_0019312 3300035092 Bacteria 1417
830 Ga0373923_0000977 3300035111 Bacteria 7693
831 Ga0373932_0016593 3300035112 Bacteria 1881
832 Ga0373932_0048969 3300035112 Bacteria 1247
833 Ga0373932_0126676 3300035112 Bacteria 857
834 Ga0373936_0008424 3300035113 Bacteria 3882
835 Ga0373936_0038387 3300035113 Bacteria 1914
836 Ga0373936_0137465 3300035113 Bacteria 1053
837 Ga0373939_0028623 3300035114 Bacteria 1587
838 Ga0373939_0034687 3300035114 Bacteria 1482
839 Ga0373939_0077687 3300035114 Bacteria 1096
840 Ga0373941_0052552 3300035115 Bacteria 1300
841 Ga0373941_0117662 3300035115 Bacteria 944
842 Ga0373941_0121937 3300035115 Bacteria 930
843 Ga0373945_0037106 3300035116 Bacteria 1748
844 Ga0373953_0014188 3300035117 Bacteria 2861
845 Ga0373957_0044855 3300035120 Bacteria 1674
846 Ga0373943_0004711 3300035170 Bacteria 6168
847 Ga0373943_0011784 3300035170 Bacteria 3935
848 Ga0373943_0177040 3300035170 Bacteria 1170
849 Ga0373943_0206992 3300035170 Bacteria 1088
850 Ga0373946_0000291 3300035171 Bacteria 16138
851 Ga0373946_0022235 3300035171 Bacteria 2466
852 Ga0373955_0050928 3300035172 Bacteria 2254
853 Ga0373942_0018872 3300035207 Bacteria 1716
854 Ga0373942_0041948 3300035207 Bacteria 1253
855 Ga0373962_0004822 3300035242 Bacteria 3257
856 Ga0373962_0108324 3300035242 Bacteria 874
857 Ga0373924_0011374 3300035410 Bacteria 3304
858 Ga0373931_0001201 3300035691 Bacteria 11071
859 Ga0373931_0004184 3300035691 Bacteria 6565
860 Ga0373931_0010541 3300035691 Bacteria 4443
861 Ga0373931_0046697 3300035691 Bacteria 2290
862 Ga0373931_0051624 3300035691 Bacteria 2191
863 Ga0373935_0006219 3300035692 Bacteria 7106
864 Ga0373935_0023117 3300035692 Bacteria 3818
865 Ga0373927_0007441 3300035695 Bacteria 7414
866 Ga0373927_0008160 3300035695 Bacteria 7063
867 Ga0373927_0040539 3300035695 Bacteria 3020
868 Ga0373927_0314224 3300035695 Bacteria 1031
869 Ga0373933_0017826 3300035724 Bacteria 3986
870 Ga0373947_0001133 3300035725 Bacteria 16379
871 Ga0373947_0006846 3300035725 Bacteria 6610
872 Ga0373947_0093089 3300035725 Bacteria 1883
873 Ga0373947_0249626 3300035725 Bacteria 1173
874 Ga0373947_0267782 3300035725 Bacteria 1133
875 Ga0373937_0000031 3300036401 Bacteria 120533
876 Ga0373937_0058789 3300036401 Bacteria 3532
877 Ga0373937_0480412 3300036401 Bacteria 1180
878 Ga0373937_0529728 3300036401 Bacteria 1119
879 Ga0373925_0000063 3300037068 Bacteria 114809
880 Ga0373925_0016226 3300037068 Bacteria 5391
881 Ga0373925_0029499 3300037068 Bacteria 4025
882 Ga0373925_0030675 3300037068 Bacteria 3947
883 Ga0373925_0109804 3300037068 Bacteria 2129
884 Ga0373925_0200227 3300037068 Bacteria 1588
885 Ga0395899_0000059 3300037312 Bacteria 213004
886 Ga0395900_0000017 3300037418 Bacteria 369602
887 Ga0395900_0030214 3300037418 Bacteria 5562
888 Ga0395900_0155881 3300037418 Bacteria 2332
889 Ga0395900_0187810 3300037418 Bacteria 2097
890 Ga0395898_0000030 3300037466 Bacteria 369577
891 Ga0395898_0013945 3300037466 Bacteria 8260
892 Ga0395898_0014421 3300037466 Bacteria 8118
893 Ga0395898_0169502 3300037466 Bacteria 2087
894 Ga0395905_0000056 3300037471 Bacteria 209230
895 Ga0395905_0000553 3300037471 Bacteria 51124
896 Ga0395905_0048020 3300037471 Bacteria 4000
897 Ga0395905_0133490 3300037471 Bacteria 2335
898 Ga0395905_0212066 3300037471 Bacteria 1814
899 Ga0395905_0274356 3300037471 Bacteria 1572
900 Ga0395905_0431606 3300037471 Bacteria 1214
901 Ga0436364_0275973 3300037853 Bacteria 1033
902 Ga0436364_0499842 3300037853 Bacteria 4479
903 Ga0436364_0702728 3300037853 Bacteria 2719
904 Ga0436364_0821808 3300037853 Bacteria 934
905 Ga0436364_1163562 3300037853 Bacteria 1925
906 Ga0436364_1172199 3300037853 Bacteria 2840
907 Ga0436364_1338890 3300037853 Bacteria 1951
908 Ga0395901_0000015 3300038443 Bacteria 373388
909 Ga0395901_0055418 3300038443 Bacteria 4123
910 Ga0395901_0082529 3300038443 Bacteria 3358
911 Ga0395901_0105451 3300038443 Bacteria 2958
912 Ga0395901_0540556 3300038443 Bacteria 1182
913 Ga0242420_022981 3300038996 Bacteria 1124
914 Ga0237816_00384 3300039145 Bacteria 3773
915 Ga0436365_0125505 3300039437 Bacteria 2043
916 Ga0436365_0235359 3300039437 Bacteria 30074
917 Ga0436365_0247443 3300039437 Bacteria 7551
918 Ga0436365_0443046 3300039437 Bacteria 5941
919 Ga0436365_0876105 3300039437 Bacteria 4184
920 Ga0436365_1009793 3300039437 Bacteria 825
921 Ga0436365_1031004 3300039437 Bacteria 1058
922 Ga0436365_1620828 3300039437 Bacteria 1416
923 Ga0436360_0612193 3300039438 Bacteria 1375
924 Ga0436360_1365466 3300039438 Bacteria 1231
925 Ga0436361_0333837 3300039447 Bacteria 2443
926 Ga0436361_1169094 3300039447 Bacteria 2516
927 Ga0436361_1179362 3300039447 Bacteria 2202
928 Ga0436363_0745057 3300039450 Bacteria 909
929 Ga0436363_0845878 3300039450 Bacteria 2416
930 Ga0436363_1374215 3300039450 Bacteria 1691
931 Ga0436363_1425116 3300039450 Bacteria 5972
932 Ga0436363_1588421 3300039450 Bacteria 1430
933 Ga0436363_1691519 3300039450 Bacteria 6057
934 Ga0436362_0936835 3300039453 Bacteria 1589
935 Ga0436362_0983745 3300039453 Bacteria 3050
936 Ga0439433_0015502 3300041999 Bacteria 1683
937 Ga0439451_009314 3300042009 Bacteria 1987
938 Ga0450889_001635 3300042144 Bacteria 2282
939 Ga0439435_0013585 3300042436 Bacteria 1995
940 Ga0439444_0006155 3300042437 Bacteria 1805
941 Ga0439460_0038896 3300042461 Bacteria 1389
942 Ga0439440_0070336 3300042993 Bacteria 910
943 Ga0466966_0014115 3300044684 Bacteria 5288
944 Ga0466960_0226163 3300044901 Bacteria 1031
945 Ga0466959_0014113 3300045049 Bacteria 5797
946 Ga0466959_0286409 3300045049 Bacteria 1130
947 Ga0466958_0011243 3300045836 Bacteria 5039
948 Ga0466967_0349558 3300045976 Bacteria 1431
949 Ga0495592_0000072 3300046454 Bacteria 91917
950 Ga0495592_0035668 3300046454 Bacteria 3748
951 Ga0495603_0000872 3300046455 Bacteria 17316
952 Ga0495603_0030425 3300046455 Bacteria 3251
953 Ga0495603_0035030 3300046455 Bacteria 3017
954 Ga0495590_0129834 3300046457 Bacteria 906
955 Ga0495629_0013500 3300046459 Bacteria 5892
956 Ga0495629_0031933 3300046459 Bacteria 3728
957 Ga0495629_0129920 3300046459 Bacteria 1755
958 Ga0495629_0213149 3300046459 Bacteria 1333
959 Ga0495629_0255501 3300046459 Bacteria 1205
960 Ga0495641_0084465 3300046461 Bacteria 1421
961 Ga0495651_0000595 3300046462 Bacteria 28008
962 Ga0495651_0321323 3300046462 Bacteria 1032
963 Ga0495651_0341694 3300046462 Bacteria 992
964 Ga0495653_0000020 3300046463 Bacteria 175274
965 Ga0495653_0080502 3300046463 Bacteria 2410
966 Ga0495580_0002021 3300046472 Bacteria 17851
967 Ga0495580_0008232 3300046472 Bacteria 8297
968 Ga0495580_0040401 3300046472 Bacteria 3331
969 Ga0495580_0066496 3300046472 Bacteria 2523
970 Ga0495582_0009149 3300046473 Bacteria 5463
971 Ga0495582_0014054 3300046473 Bacteria 4407
972 Ga0495582_0043622 3300046473 Bacteria 2470
973 Ga0495605_0014755 3300046474 Bacteria 4267
974 Ga0495639_0001587 3300046475 Bacteria 10143
975 Ga0495639_0228104 3300046475 Bacteria 917
976 Ga0495662_0058783 3300046476 Bacteria 1857
977 Ga0495664_0000006 3300046477 Bacteria 407031
978 Ga0495664_0071738 3300046477 Bacteria 2069
979 Ga0495584_0012859 3300046491 Bacteria 4272
980 Ga0495584_0044716 3300046491 Bacteria 2234
981 Ga0495584_0110763 3300046491 Bacteria 1389
982 Ga0495594_0003039 3300046499 Bacteria 8692
983 Ga0495596_0085134 3300046500 Bacteria 1227
984 Ga0495583_0035766 3300046506 Bacteria 2367
985 Ga0495608_0000002 3300046511 Bacteria 376403
986 Ga0495616_0061849 3300046513 Bacteria 1835
987 Ga0495618_0000017 3300046514 Bacteria 143326
988 Ga0495628_0000004 3300046516 Bacteria 462184
989 Ga0495628_0058832 3300046516 Bacteria 3019
990 Ga0495628_0121517 3300046516 Bacteria 2003
991 Ga0495628_0462378 3300046516 Bacteria 920
992 Ga0495630_0001747 3300046517 Bacteria 15169
993 Ga0495630_0083557 3300046517 Bacteria 2411
994 Ga0495630_0359047 3300046517 Bacteria 1115
995 Ga0495631_0037033 3300046518 Bacteria 2175
996 Ga0495637_0032744 3300046520 Bacteria 2288
997 Ga0495648_0012530 3300046524 Bacteria 6318
998 Ga0495652_0000007 3300046529 Bacteria 418163
999 Ga0495652_0028570 3300046529 Bacteria 4906
1000 Ga0495652_0114470 3300046529 Bacteria 2164
1001 Ga0495665_0004975 3300046531 Bacteria 7159
1002 Ga0495665_0034806 3300046531 Bacteria 2694
1003 Ga0495640_0000004 3300046533 Bacteria 357515
1004 Ga0495587_0000002 3300046536 Bacteria 425485
1005 Ga0495609_0089866 3300046538 Bacteria 1336
1006 Ga0495645_0000008 3300046543 Bacteria 331530
1007 Ga0495622_0002253 3300046557 Bacteria 9380
1008 Ga0495622_0004419 3300046557 Bacteria 6529
1009 Ga0495622_0018640 3300046557 Bacteria 3233
1010 Ga0495622_0043283 3300046557 Bacteria 2094
1011 Ga0495622_0111601 3300046557 Bacteria 1252
1012 Ga0495667_0000010 3300046559 Bacteria 222698
1013 Ga0495667_0026144 3300046559 Bacteria 3932
1014 Ga0495656_0086783 3300046615 Bacteria 1424
1015 Ga0495656_0161507 3300046615 Bacteria 1089
1016 Ga0495656_0231568 3300046615 Bacteria 927
1017 Ga0495668_0064356 3300046616 Bacteria 2019
1018 Ga0495668_0265588 3300046616 Bacteria 940
1019 Ga0495634_0000001 3300046642 Bacteria 303746
1020 Ga0495634_0001869 3300046642 Bacteria 18118
1021 Ga0495634_0074172 3300046642 Bacteria 2236
1022 Ga0495634_0095237 3300046642 Bacteria 1929
1023 Ga0495611_0132880 3300046648 Bacteria 1161
1024 Ga0495625_0146735 3300046660 Bacteria 1588
1025 Ga0495635_0000004 3300046663 Bacteria 388068
1026 Ga0495635_0032326 3300046663 Bacteria 3630
1027 Ga0495661_0074097 3300046665 Bacteria 1982
1028 Ga0495661_0219838 3300046665 Bacteria 985
1029 Ga0495588_0002382 3300046674 Bacteria 8046
1030 Ga0495588_0065551 3300046674 Bacteria 1884
1031 Ga0495657_0000265 3300046675 Bacteria 47726
1032 Ga0495657_0027279 3300046675 Bacteria 4033
1033 Ga0495657_0073609 3300046675 Bacteria 2224
1034 Ga0495599_0000003 3300046678 Bacteria 319085
1035 Ga0495599_0061749 3300046678 Bacteria 2341
1036 Ga0495623_0000009 3300046679 Bacteria 127758
1037 Ga0495646_0000001 3300046680 Bacteria 403396
1038 Ga0495647_0062155 3300046681 Bacteria 1476
1039 Ga0495658_0001840 3300046683 Bacteria 10842
1040 Ga0495658_0031541 3300046683 Bacteria 2887
1041 Ga0495658_0048625 3300046683 Bacteria 2392
1042 Ga0495658_0098402 3300046683 Bacteria 1742
1043 Ga0495658_0118172 3300046683 Bacteria 1601
1044 Ga0495658_0206799 3300046683 Bacteria 1225
1045 Ga0495613_0006074 3300046689 Bacteria 9038
1046 Ga0495613_0041421 3300046689 Bacteria 3411
1047 Ga0495613_0260116 3300046689 Bacteria 1209
1048 Ga0495613_0276643 3300046689 Bacteria 1166
1049 Ga0495624_0030783 3300046690 Bacteria 3494
1050 Ga0495624_0077669 3300046690 Bacteria 2059
1051 Ga0495649_0044888 3300046694 Bacteria 2412
1052 Ga0495649_0069411 3300046694 Bacteria 1890
1053 Ga0495589_0067982 3300046794 Bacteria 1744
1054 Ga0495589_0104639 3300046794 Bacteria 1368
1055 Ga0495600_0000008 3300046809 Bacteria 147902
1056 Ga0495600_0010717 3300046809 Bacteria 5698
1057 Ga0495600_0041579 3300046809 Bacteria 2996
1058 Ga0495581_0005894 3300047315 Bacteria 7106
1059 Ga0495604_0000003 3300047317 Bacteria 464246
1060 Ga0495604_0013870 3300047317 Bacteria 6427
1061 Ga0495604_0029289 3300047317 Bacteria 4380
1062 Ga0495604_0069459 3300047317 Bacteria 2670
1063 Ga0495604_0235417 3300047317 Bacteria 1255
1064 Ga0495674_0000021 3300047319 Bacteria 174056
1065 Ga0495674_0024249 3300047319 Bacteria 5577
1066 Ga0495674_0048481 3300047319 Bacteria 3759
1067 Ga0495674_0085431 3300047319 Bacteria 2703
1068 Ga0495674_0405671 3300047319 Bacteria 1100
1069 Ga0495672_0026399 3300047320 Bacteria 3706
1070 Ga0495676_0034639 3300047321 Bacteria 4234
1071 Ga0495676_0070430 3300047321 Bacteria 2693
1072 Ga0495676_0107454 3300047321 Bacteria 2054
1073 Ga0495676_0244250 3300047321 Bacteria 1228
1074 Ga0495676_0307605 3300047321 Bacteria 1067
1075 Ga0495680_0000552 3300047322 Bacteria 42266
1076 Ga0495680_0078439 3300047322 Bacteria 2499
1077 Ga0495683_0012510 3300047323 Bacteria 4453
1078 Ga0495687_020145 3300047443 Bacteria 3256
1079 Ga0495675_0000581 3300047444 Bacteria 23541
1080 Ga0495673_0035805 3300047469 Bacteria 2283
1081 Ga0495684_0000003 3300047471 Bacteria 331335
1082 Ga0495684_0065541 3300047471 Bacteria 2761
1083 Ga0495686_0041614 3300047472 Bacteria 2925
1084 Ga0495686_0193035 3300047472 Bacteria 1173
1085 Ga0495686_0194100 3300047472 Bacteria 1169
1086 Ga0495593_0000179 3300047673 Bacteria 32839
1087 Ga0495593_0003265 3300047673 Bacteria 9726
1088 Ga0495593_0227661 3300047673 Bacteria 935
1089 Ga0495593_0234678 3300047673 Bacteria 919
1090 Ga0495602_0000012 3300048088 Bacteria 200520
1091 Ga0495602_0018907 3300048088 Bacteria 6860
1092 Ga0495602_0299980 3300048088 Bacteria 1176
1093 Ga0495602_0302882 3300048088 Bacteria 1169
1094 Ga0495615_0016519 3300048090 Bacteria 1594
1095 Ga0495626_0027147 3300048091 Bacteria 2785
1096 Ga0495626_0089816 3300048091 Bacteria 1353
1097 Ga0496100_0008478 3300048903 Bacteria 5734
1098 Ga0496100_0010401 3300048903 Bacteria 5264
1099 Ga0496100_0012941 3300048903 Bacteria 4797
1100 Ga0496100_0017404 3300048903 Bacteria 4242
1101 Ga0496100_0024025 3300048903 Bacteria 3711
1102 Ga0496100_0027348 3300048903 Bacteria 3507
1103 Ga0496100_0158517 3300048903 Bacteria 1620
1104 Ga0496100_0249214 3300048903 Bacteria 1313
1105 Ga0496100_0644846 3300048903 Bacteria 824
1106 Ga0496101_0010920 3300048904 Bacteria 6010
1107 Ga0496101_0027095 3300048904 Bacteria 3988
1108 Ga0496101_0033222 3300048904 Bacteria 3637
1109 Ga0496101_0046917 3300048904 Bacteria 3099
1110 Ga0496101_0086815 3300048904 Bacteria 2321
1111 Ga0496101_0090509 3300048904 Bacteria 2276
1112 Ga0496101_0109979 3300048904 Bacteria 2073
1113 Ga0496101_0126850 3300048904 Bacteria 1934
1114 Ga0496101_0169733 3300048904 Bacteria 1676
1115 Ga0496101_0530890 3300048904 Bacteria 930
1116 Ga0496102_0004821 3300048905 Bacteria 11403
1117 Ga0496102_0011587 3300048905 Bacteria 7607
1118 Ga0496102_0014879 3300048905 Bacteria 6767
1119 Ga0496102_0023806 3300048905 Bacteria 5441
1120 Ga0496102_0024872 3300048905 Bacteria 5325
1121 Ga0496102_0025489 3300048905 Bacteria 5265
1122 Ga0496102_0034651 3300048905 Bacteria 4541
1123 Ga0496102_0077614 3300048905 Bacteria 3056
1124 Ga0496102_0106937 3300048905 Bacteria 2604
1125 Ga0496102_0120995 3300048905 Bacteria 2445
1126 Ga0496102_0618109 3300048905 Bacteria 1007
1127 Ga0496103_0010759 3300048906 Bacteria 5413
1128 Ga0496103_0015362 3300048906 Bacteria 4554
1129 Ga0496103_0017250 3300048906 Bacteria 4318
1130 Ga0496103_0030461 3300048906 Bacteria 3283
1131 Ga0496103_0044726 3300048906 Bacteria 2729
1132 Ga0496103_0053127 3300048906 Bacteria 2510
1133 Ga0496103_0139030 3300048906 Bacteria 1553
1134 Ga0496104_0000080 3300048907 Bacteria 96918
1135 Ga0496104_0000149 3300048907 Bacteria 64732
1136 Ga0496104_0000279 3300048907 Bacteria 45192
1137 Ga0496104_0001052 3300048907 Bacteria 23550
1138 Ga0496104_0009332 3300048907 Bacteria 8725
1139 Ga0496104_0016854 3300048907 Bacteria 6642
1140 Ga0496104_0016989 3300048907 Bacteria 6620
1141 Ga0496104_0025519 3300048907 Bacteria 5448
1142 Ga0496104_0044083 3300048907 Bacteria 4191
1143 Ga0496104_0051156 3300048907 Bacteria 3898
1144 Ga0496104_0064234 3300048907 Bacteria 3482
1145 Ga0496104_0118303 3300048907 Bacteria 2543
1146 Ga0496104_0124202 3300048907 Bacteria 2478
1147 Ga0496104_0200303 3300048907 Bacteria 1908
1148 Ga0496105_0000052 3300048908 Bacteria 89771
1149 Ga0496105_0000272 3300048908 Bacteria 34322
1150 Ga0496105_0009202 3300048908 Bacteria 7710
1151 Ga0496105_0015532 3300048908 Bacteria 6069
1152 Ga0496105_0022029 3300048908 Bacteria 5159
1153 Ga0496105_0027606 3300048908 Bacteria 4639
1154 Ga0496105_0033734 3300048908 Bacteria 4206
1155 Ga0496105_0058309 3300048908 Bacteria 3187
1156 Ga0496105_0061825 3300048908 Bacteria 3090
1157 Ga0496105_0082323 3300048908 Bacteria 2658
1158 Ga0496105_0086293 3300048908 Bacteria 2593
1159 Ga0496105_0269455 3300048908 Bacteria 1375
1160 Ga0496105_0304496 3300048908 Bacteria 1280
1161 Ga0496105_0420974 3300048908 Bacteria 1057
1162 Ga0496106_0000854 3300048909 Bacteria 22100
1163 Ga0496106_0002017 3300048909 Bacteria 15276
1164 Ga0496106_0003517 3300048909 Bacteria 11676
1165 Ga0496106_0010756 3300048909 Bacteria 6761
1166 Ga0496106_0012358 3300048909 Bacteria 6303
1167 Ga0496106_0012742 3300048909 Bacteria 6209
1168 Ga0496106_0025337 3300048909 Bacteria 4413
1169 Ga0496106_0040891 3300048909 Bacteria 3473
1170 Ga0496106_0073437 3300048909 Bacteria 2617
1171 Ga0496106_0089094 3300048909 Bacteria 2379
1172 Ga0496106_0100196 3300048909 Bacteria 2246
1173 Ga0496106_0151879 3300048909 Bacteria 1827
1174 Ga0496106_0263565 3300048909 Bacteria 1379
1175 Ga0496106_0446107 3300048909 Bacteria 1039
1176 Ga0496107_0000548 3300048910 Bacteria 21012
1177 Ga0496107_0003678 3300048910 Bacteria 10308
1178 Ga0496107_0008310 3300048910 Bacteria 7179
1179 Ga0496107_0008765 3300048910 Bacteria 7007
1180 Ga0496107_0011962 3300048910 Bacteria 6056
1181 Ga0496107_0012866 3300048910 Bacteria 5848
1182 Ga0496107_0017790 3300048910 Bacteria 5001
1183 Ga0496107_0017891 3300048910 Bacteria 4989
1184 Ga0496107_0052669 3300048910 Bacteria 2935
1185 Ga0496107_0057487 3300048910 Bacteria 2812
1186 Ga0496107_0103731 3300048910 Bacteria 2086
1187 Ga0496107_0211317 3300048910 Bacteria 1443
1188 Ga0496107_0263517 3300048910 Bacteria 1282
1189 Ga0496107_0339092 3300048910 Bacteria 1118
1190 Ga0496107_0379097 3300048910 Bacteria 1052
1191 Ga0496108_0000625 3300048911 Bacteria 27651
1192 Ga0496108_0045486 3300048911 Bacteria 3666
1193 Ga0496108_0045705 3300048911 Bacteria 3657
1194 Ga0496108_0064682 3300048911 Bacteria 3081
1195 Ga0496108_0071113 3300048911 Bacteria 2935
1196 Ga0496108_0076414 3300048911 Bacteria 2831
1197 Ga0496108_0076676 3300048911 Bacteria 2826
1198 Ga0496108_0105961 3300048911 Bacteria 2401
1199 Ga0496108_0122073 3300048911 Bacteria 2235
1200 Ga0496108_0362267 3300048911 Bacteria 1266
1201 Ga0496109_0001375 3300048912 Bacteria 20176
1202 Ga0496109_0075473 3300048912 Bacteria 3099
1203 Ga0496109_0088197 3300048912 Bacteria 2867
1204 Ga0496109_0101494 3300048912 Bacteria 2670
1205 Ga0496109_0128441 3300048912 Bacteria 2365
1206 Ga0496109_0143356 3300048912 Bacteria 2234
1207 Ga0496109_0145078 3300048912 Bacteria 2220
1208 Ga0496109_0187784 3300048912 Bacteria 1942
1209 Ga0496109_0419893 3300048912 Bacteria 1263
1210 Ga0496109_0503483 3300048912 Bacteria 1143
1211 Ga0496110_0001079 3300048913 Bacteria 19218
1212 Ga0496110_0005932 3300048913 Bacteria 9614
1213 Ga0496110_0010159 3300048913 Bacteria 7646
1214 Ga0496110_0011880 3300048913 Bacteria 7151
1215 Ga0496110_0025085 3300048913 Bacteria 5090
1216 Ga0496110_0026794 3300048913 Bacteria 4935
1217 Ga0496110_0036438 3300048913 Bacteria 4272
1218 Ga0496110_0044969 3300048913 Bacteria 3857
1219 Ga0496110_0046494 3300048913 Bacteria 3797
1220 Ga0496110_0212192 3300048913 Bacteria 1760
1221 Ga0496110_0225184 3300048913 Bacteria 1705
1222 Ga0496110_0386129 3300048913 Bacteria 1276
1223 Ga0496110_0446990 3300048913 Bacteria 1178
1224 Ga0496110_0822528 3300048913 Bacteria 834
1225 Ga0496111_0001188 3300048914 Bacteria 14505
1226 Ga0496111_0001541 3300048914 Bacteria 13252
1227 Ga0496111_0011957 3300048914 Bacteria 5866
1228 Ga0496111_0014085 3300048914 Bacteria 5454
1229 Ga0496111_0015529 3300048914 Bacteria 5230
1230 Ga0496111_0130861 3300048914 Bacteria 1857
1231 Ga0496111_0171028 3300048914 Bacteria 1614
1232 Ga0496111_0258619 3300048914 Bacteria 1292
1233 Ga0496112_0002410 3300048915 Bacteria 15061
1234 Ga0496112_0010794 3300048915 Bacteria 8308
1235 Ga0496112_0039568 3300048915 Bacteria 4608
1236 Ga0496112_0050078 3300048915 Bacteria 4095
1237 Ga0496112_0057434 3300048915 Bacteria 3831
1238 Ga0496112_0068331 3300048915 Bacteria 3508
1239 Ga0496112_0076393 3300048915 Bacteria 3312
1240 Ga0496112_0090183 3300048915 Bacteria 3034
1241 Ga0496112_0106746 3300048915 Bacteria 2770
1242 Ga0496112_0118913 3300048915 Bacteria 2612
1243 Ga0496112_0141664 3300048915 Bacteria 2373
1244 Ga0496113_0000087 3300048916 Bacteria 40247
1245 Ga0496113_0001148 3300048916 Bacteria 14415
1246 Ga0496113_0008398 3300048916 Bacteria 6728
1247 Ga0496113_0011985 3300048916 Bacteria 5812
1248 Ga0496113_0015454 3300048916 Bacteria 5246
1249 Ga0496113_0020844 3300048916 Bacteria 4616
1250 Ga0496113_0030815 3300048916 Bacteria 3886
1251 Ga0496113_0103608 3300048916 Bacteria 2207
1252 Ga0496113_0283710 3300048916 Bacteria 1324
1253 Ga0496113_0404113 3300048916 Bacteria 1097
1254 Ga0496113_0658383 3300048916 Bacteria 837
1255 Ga0496114_0029790 3300048917 Bacteria 4487
1256 Ga0496114_0031434 3300048917 Bacteria 4369
1257 Ga0496114_0070514 3300048917 Bacteria 2935
1258 Ga0496114_0074061 3300048917 Bacteria 2866
1259 Ga0496114_0094884 3300048917 Bacteria 2538
1260 Ga0496114_0108867 3300048917 Bacteria 2372
1261 Ga0496114_0142382 3300048917 Bacteria 2077
1262 Ga0496114_0430736 3300048917 Bacteria 1168
1263 Ga0496114_0593412 3300048917 Bacteria 977
1264 Ga0496115_0006310 3300048918 Bacteria 8677
1265 Ga0496115_0011417 3300048918 Bacteria 6659
1266 Ga0496115_0022102 3300048918 Bacteria 4921
1267 Ga0496115_0032978 3300048918 Bacteria 4088
1268 Ga0496115_0072893 3300048918 Bacteria 2786
1269 Ga0496115_0118662 3300048918 Bacteria 2175
1270 Ga0496115_0127441 3300048918 Bacteria 2097
1271 Ga0496115_0179324 3300048918 Bacteria 1751
1272 Ga0496115_0249773 3300048918 Bacteria 1461
1273 Ga0496115_0266743 3300048918 Bacteria 1407
1274 Ga0496115_0269574 3300048918 Bacteria 1399
1275 Ga0496115_0316442 3300048918 Bacteria 1277
1276 Ga0496115_0362769 3300048918 Bacteria 1180
1277 Ga0496115_0453805 3300048918 Bacteria 1035
1278 Ga0496115_0470930 3300048918 Bacteria 1012
1279 Ga0496116_0227582 3300048919 Bacteria 949
1280 Ga0496118_0260937 3300048921 Bacteria 978
1281 Ga0496119_0000898 3300048922 Bacteria 38833
1282 Ga0496119_0009306 3300048922 Bacteria 8452
1283 Ga0496119_0012124 3300048922 Bacteria 7038
1284 Ga0496119_0014229 3300048922 Bacteria 6249
1285 Ga0496119_0139992 3300048922 Bacteria 1307
1286 Ga0496120_0011646 3300048923 Bacteria 6035
1287 Ga0496120_0057874 3300048923 Bacteria 2179
1288 Ga0496121_0006038 3300048924 Bacteria 15260
1289 Ga0496121_0067741 3300048924 Bacteria 2892
1290 Ga0496122_0000399 3300048925 Bacteria 92476
1291 Ga0496122_0218868 3300048925 Bacteria 1095
1292 Ga0496123_0003753 3300048926 Bacteria 16655
1293 Ga0496123_0057939 3300048926 Bacteria 2517
1294 Ga0496123_0069764 3300048926 Bacteria 2204
1295 Ga0496124_0030416 3300048927 Bacteria 4793
1296 Ga0496125_0065438 3300048928 Bacteria 2880
1297 Ga0496125_0072523 3300048928 Bacteria 2682
1298 Ga0496125_0162158 3300048928 Bacteria 1517
1299 Ga0496125_0252571 3300048928 Bacteria 1111
1300 Ga0496126_0003453 3300048929 Bacteria 19947
1301 Ga0496126_0024000 3300048929 Bacteria 5895
1302 Ga0496126_0038264 3300048929 Bacteria 4466
1303 Ga0496126_0043355 3300048929 Bacteria 4150
1304 Ga0496126_0105456 3300048929 Bacteria 2461
1305 Ga0501031_0000018 3300049568 Bacteria 106734
1306 Ga0501031_0046757 3300049568 Bacteria 2822
1307 Ga0501031_0053942 3300049568 Bacteria 2620
1308 Ga0501031_0078422 3300049568 Bacteria 2152
1309 Ga0501031_0091473 3300049568 Bacteria 1985
1310 Ga0501032_0000031 3300049569 Bacteria 130204
1311 Ga0501032_0000201 3300049569 Bacteria 49742
1312 Ga0501032_0013095 3300049569 Bacteria 5907
1313 Ga0501032_0101147 3300049569 Bacteria 1910
1314 Ga0501032_0114842 3300049569 Bacteria 1780
1315 Ga0501032_0255155 3300049569 Bacteria 1138
1316 Ga0501032_0264440 3300049569 Bacteria 1115
1317 Ga0501033_0000126 3300049570 Bacteria 74250
1318 Ga0501033_0000328 3300049570 Bacteria 45346
1319 Ga0501033_0006625 3300049570 Bacteria 9057
1320 Ga0501033_0009424 3300049570 Bacteria 7517
1321 Ga0501033_0018584 3300049570 Bacteria 5254
1322 Ga0501033_0019815 3300049570 Bacteria 5084
1323 Ga0501033_0025403 3300049570 Bacteria 4462
1324 Ga0501033_0052548 3300049570 Bacteria 3020
1325 Ga0501033_0105997 3300049570 Bacteria 2048
1326 Ga0501033_0316847 3300049570 Bacteria 1096
1327 Ga0501034_0000005 3300049571 Bacteria 367512
1328 Ga0501034_0000064 3300049571 Bacteria 189461
1329 Ga0501034_0000076 3300049571 Bacteria 174683
1330 Ga0501034_0009541 3300049571 Bacteria 10159
1331 Ga0501034_0021935 3300049571 Bacteria 6507
1332 Ga0501034_0054192 3300049571 Bacteria 4037
1333 Ga0501034_0147647 3300049571 Bacteria 2328
1334 Ga0501034_0284559 3300049571 Bacteria 1592
1335 Ga0501034_0346887 3300049571 Bacteria 1414
1336 Ga0501034_0489622 3300049571 Bacteria 1144
1337 Ga0501036_0000005 3300049572 Bacteria 246420
1338 Ga0501036_0005686 3300049572 Bacteria 10115
1339 Ga0501036_0005749 3300049572 Bacteria 10056
1340 Ga0501036_0070327 3300049572 Bacteria 2959
1341 Ga0501036_0079858 3300049572 Bacteria 2766
1342 Ga0501036_0154955 3300049572 Bacteria 1932
1343 Ga0501036_0262175 3300049572 Bacteria 1447
1344 Ga0501036_0297434 3300049572 Bacteria 1350
1345 Ga0501036_0517530 3300049572 Bacteria 992
1346 Ga0501037_0000045 3300049573 Bacteria 117148
1347 Ga0501037_0002164 3300049573 Bacteria 14212
1348 Ga0501037_0003332 3300049573 Bacteria 11677
1349 Ga0501037_0005389 3300049573 Bacteria 9312
1350 Ga0501037_0005524 3300049573 Bacteria 9221
1351 Ga0501037_0083410 3300049573 Bacteria 2315
1352 Ga0501037_0226391 3300049573 Bacteria 1314
1353 Ga0501037_0434533 3300049573 Bacteria 897
1354 Ga0501038_0000001 3300049574 Bacteria 375481
1355 Ga0501038_0000205 3300049574 Bacteria 50558
1356 Ga0501038_0015483 3300049574 Bacteria 6931
1357 Ga0501038_0053176 3300049574 Bacteria 3488
1358 Ga0501038_0062717 3300049574 Bacteria 3175
1359 Ga0501038_0071835 3300049574 Bacteria 2934
1360 Ga0501038_0139198 3300049574 Bacteria 1987
1361 Ga0501038_0149467 3300049574 Bacteria 1905
1362 Ga0501038_0175311 3300049574 Bacteria 1733
1363 Ga0501038_0289319 3300049574 Bacteria 1288
1364 Ga0501038_0307398 3300049574 Bacteria 1243
1365 Ga0501038_0388240 3300049574 Bacteria 1082
1366 Ga0501039_0000007 3300049575 Bacteria 277831
1367 Ga0501039_0000105 3300049575 Bacteria 56477
1368 Ga0501039_0002792 3300049575 Bacteria 13046
1369 Ga0501039_0008466 3300049575 Bacteria 7841
1370 Ga0501039_0012743 3300049575 Bacteria 6425
1371 Ga0501039_0060468 3300049575 Bacteria 2934
1372 Ga0501039_0113942 3300049575 Bacteria 2115
1373 Ga0501039_0160710 3300049575 Bacteria 1766
1374 Ga0501039_0188883 3300049575 Bacteria 1620
1375 Ga0501039_0398430 3300049575 Bacteria 1081
1376 Ga0501040_0026013 3300049576 Bacteria 3937
1377 Ga0501040_0029852 3300049576 Bacteria 3680
1378 Ga0501040_0052412 3300049576 Bacteria 2793
1379 Ga0501040_0098807 3300049576 Bacteria 2034
1380 Ga0501040_0128627 3300049576 Bacteria 1780
1381 Ga0501040_0132300 3300049576 Bacteria 1754
1382 Ga0501040_0148742 3300049576 Bacteria 1651
1383 Ga0501040_0282644 3300049576 Bacteria 1185
1384 Ga0501041_0024244 3300049577 Bacteria 3641
1385 Ga0501041_0055484 3300049577 Bacteria 2419
1386 Ga0501041_0063423 3300049577 Bacteria 2262
1387 Ga0501041_0074071 3300049577 Bacteria 2092
1388 Ga0501041_0187157 3300049577 Bacteria 1296
1389 Ga0501042_0007562 3300049578 Bacteria 7130
1390 Ga0501042_0042178 3300049578 Bacteria 3247
1391 Ga0501042_0049320 3300049578 Bacteria 3003
1392 Ga0501042_0057666 3300049578 Bacteria 2771
1393 Ga0501042_0206237 3300049578 Bacteria 1417
1394 Ga0501042_0298318 3300049578 Bacteria 1164
1395 Ga0501042_0438440 3300049578 Bacteria 947
1396 Ga0501043_0000015 3300049579 Bacteria 175932
1397 Ga0501043_0000107 3300049579 Bacteria 77469
1398 Ga0501043_0056281 3300049579 Bacteria 3089
1399 Ga0501043_0079453 3300049579 Bacteria 2577
1400 Ga0501043_0232884 3300049579 Bacteria 1422
1401 Ga0501043_0288373 3300049579 Bacteria 1257
1402 Ga0501043_0348444 3300049579 Bacteria 1125
1403 Ga0501043_0437769 3300049579 Bacteria 984
1404 Ga0501043_0485698 3300049579 Bacteria 924
1405 Ga0501046_0001416 3300049580 Bacteria 23066
1406 Ga0501046_0006723 3300049580 Bacteria 10156
1407 Ga0501046_0009778 3300049580 Bacteria 8269
1408 Ga0501046_0015459 3300049580 Bacteria 6410
1409 Ga0501046_0032371 3300049580 Bacteria 4234
1410 Ga0501046_0071334 3300049580 Bacteria 2699
1411 Ga0501046_0074334 3300049580 Bacteria 2637
1412 Ga0501046_0109985 3300049580 Bacteria 2106
1413 Ga0501046_0133453 3300049580 Bacteria 1882
1414 Ga0501046_0202364 3300049580 Bacteria 1477
1415 Ga0501046_0236924 3300049580 Bacteria 1347
1416 Ga0501047_0000749 3300049581 Bacteria 33852
1417 Ga0501047_0020996 3300049581 Bacteria 6273
1418 Ga0501047_0059969 3300049581 Bacteria 3673
1419 Ga0501047_0083424 3300049581 Bacteria 3071
1420 Ga0501047_0140646 3300049581 Bacteria 2292
1421 Ga0501047_0149101 3300049581 Bacteria 2215
1422 Ga0501047_0154243 3300049581 Bacteria 2171
1423 Ga0501047_0316422 3300049581 Bacteria 1401
1424 Ga0501047_0422943 3300049581 Bacteria 1163
1425 Ga0501048_0001563 3300049582 Bacteria 17396
1426 Ga0501048_0021329 3300049582 Bacteria 4742
1427 Ga0501048_0068570 3300049582 Bacteria 2505
1428 Ga0501048_0120298 3300049582 Bacteria 1855
1429 Ga0501048_0182528 3300049582 Bacteria 1487
1430 Ga0501048_0365788 3300049582 Bacteria 1029
1431 Ga0501067_0000091 3300049583 Bacteria 52819
1432 Ga0501067_0003300 3300049583 Bacteria 8875
1433 Ga0501067_0011645 3300049583 Bacteria 4871
1434 Ga0501067_0022295 3300049583 Bacteria 3504
1435 Ga0501067_0023338 3300049583 Bacteria 3428
1436 Ga0501067_0066765 3300049583 Bacteria 1991
1437 Ga0501067_0244369 3300049583 Bacteria 999
1438 Ga0501068_0002658 3300049584 Bacteria 9471
1439 Ga0501068_0111995 3300049584 Bacteria 1697
1440 Ga0501068_0149164 3300049584 Bacteria 1469
1441 Ga0501069_0000039 3300049585 Bacteria 82361
1442 Ga0501069_0006899 3300049585 Bacteria 5935
1443 Ga0501069_0011283 3300049585 Bacteria 4738
1444 Ga0501069_0121149 3300049585 Bacteria 1494
1445 Ga0501069_0143401 3300049585 Bacteria 1371
1446 Ga0501069_0154645 3300049585 Bacteria 1319
1447 Ga0501069_0167243 3300049585 Bacteria 1268
1448 Ga0501069_0344466 3300049585 Bacteria 878
1449 Ga0501070_0000132 3300049586 Bacteria 67092
1450 Ga0501070_0000299 3300049586 Bacteria 46014
1451 Ga0501070_0002117 3300049586 Bacteria 17410
1452 Ga0501070_0017763 3300049586 Bacteria 5972
1453 Ga0501070_0072038 3300049586 Bacteria 2860
1454 Ga0501070_0155983 3300049586 Bacteria 1882
1455 Ga0501070_0159579 3300049586 Bacteria 1859
1456 Ga0501070_0174991 3300049586 Bacteria 1767
1457 Ga0501070_0202340 3300049586 Bacteria 1630
1458 Ga0501070_0210840 3300049586 Bacteria 1594
1459 Ga0501070_0298993 3300049586 Bacteria 1311
1460 Ga0501070_0350415 3300049586 Bacteria 1198
1461 Ga0501071_0009502 3300049587 Bacteria 6481
1462 Ga0501071_0059576 3300049587 Bacteria 2762
1463 Ga0501071_0069731 3300049587 Bacteria 2560
1464 Ga0501071_0102429 3300049587 Bacteria 2111
1465 Ga0501071_0232297 3300049587 Bacteria 1390
1466 Ga0501071_0238034 3300049587 Bacteria 1372
1467 Ga0501071_0489398 3300049587 Bacteria 943
1468 Ga0501072_0042737 3300049588 Bacteria 3560
1469 Ga0501072_0050121 3300049588 Bacteria 3287
1470 Ga0501072_0101090 3300049588 Bacteria 2292
1471 Ga0501072_0204696 3300049588 Bacteria 1573
1472 Ga0501072_0269426 3300049588 Bacteria 1355
1473 Ga0501072_0324779 3300049588 Bacteria 1223
1474 Ga0501072_0425513 3300049588 Bacteria 1052
1475 Ga0501073_0000011 3300049589 Bacteria 161823
1476 Ga0501073_0023740 3300049589 Bacteria 4403
1477 Ga0501073_0042848 3300049589 Bacteria 3193
1478 Ga0501073_0074563 3300049589 Bacteria 2362
1479 Ga0501073_0129836 3300049589 Bacteria 1747
1480 Ga0501073_0165808 3300049589 Bacteria 1530
1481 Ga0501073_0246409 3300049589 Bacteria 1234
1482 Ga0501074_0029210 3300049590 Bacteria 3993
1483 Ga0501074_0105413 3300049590 Bacteria 2018
1484 Ga0501074_0153177 3300049590 Bacteria 1648
1485 Ga0501074_0195871 3300049590 Bacteria 1440
1486 Ga0501074_0209210 3300049590 Bacteria 1390
1487 Ga0501074_0367637 3300049590 Bacteria 1020
1488 Ga0501075_0011328 3300049591 Bacteria 6309
1489 Ga0501075_0071281 3300049591 Bacteria 2626
1490 Ga0501075_0114157 3300049591 Bacteria 2054
1491 Ga0501075_0129483 3300049591 Bacteria 1922
1492 Ga0501075_0147766 3300049591 Bacteria 1791
1493 Ga0501075_0182438 3300049591 Bacteria 1601
1494 Ga0501076_0020611 3300049592 Bacteria 5047
1495 Ga0501076_0025189 3300049592 Bacteria 4602
1496 Ga0501076_0031924 3300049592 Bacteria 4110
1497 Ga0501076_0047363 3300049592 Bacteria 3399
1498 Ga0501076_0076567 3300049592 Bacteria 2683
1499 Ga0501076_0077646 3300049592 Bacteria 2664
1500 Ga0501076_0084120 3300049592 Bacteria 2555
1501 Ga0501076_0132547 3300049592 Bacteria 2021
1502 Ga0501076_0272820 3300049592 Bacteria 1385
1503 Ga0501076_0465036 3300049592 Bacteria 1042
1504 Ga0501077_0000011 3300049593 Bacteria 96805
1505 Ga0501077_0007078 3300049593 Bacteria 6916
1506 Ga0501077_0007395 3300049593 Bacteria 6771
1507 Ga0501077_0010077 3300049593 Bacteria 5883
1508 Ga0501077_0013376 3300049593 Bacteria 5146
1509 Ga0501077_0032924 3300049593 Bacteria 3300
1510 Ga0501077_0032975 3300049593 Bacteria 3298
1511 Ga0501077_0075545 3300049593 Bacteria 2134
1512 Ga0501077_0113740 3300049593 Bacteria 1716
1513 Ga0501077_0114634 3300049593 Bacteria 1709
1514 Ga0501077_0282502 3300049593 Bacteria 1057
1515 Ga0501079_0024804 3300049741 Bacteria 4601
1516 Ga0501079_0046675 3300049741 Bacteria 3342
1517 Ga0501079_0051845 3300049741 Bacteria 3168
1518 Ga0501079_0070038 3300049741 Bacteria 2708
1519 Ga0501079_0152991 3300049741 Bacteria 1798
1520 Ga0501079_0202415 3300049741 Bacteria 1551
1521 Ga0501079_0269421 3300049741 Bacteria 1331
1522 Ga0501079_0312226 3300049741 Bacteria 1230
1523 Ga0501079_0318913 3300049741 Bacteria 1217
1524 Ga0501079_0378459 3300049741 Bacteria 1110
1525 Ga0501080_0000004 3300049742 Bacteria 180905
1526 Ga0501080_0001484 3300049742 Bacteria 19783
1527 Ga0501080_0003023 3300049742 Bacteria 14830
1528 Ga0501080_0013324 3300049742 Bacteria 7557
1529 Ga0501080_0055277 3300049742 Bacteria 3697
1530 Ga0501080_0125630 3300049742 Bacteria 2376
1531 Ga0501080_0128121 3300049742 Bacteria 2350
1532 Ga0501080_0212342 3300049742 Bacteria 1773
1533 Ga0501080_0221725 3300049742 Bacteria 1730
1534 Ga0501080_0254450 3300049742 Bacteria 1601
1535 Ga0501080_0287134 3300049742 Bacteria 1495
1536 Ga0501080_0443696 3300049742 Bacteria 1164
1537 Ga0501081_0004485 3300049743 Bacteria 8959
1538 Ga0501081_0007228 3300049743 Bacteria 7218
1539 Ga0501081_0180358 3300049743 Bacteria 1527
1540 Ga0501081_0186404 3300049743 Bacteria 1502
1541 Ga0501081_0219637 3300049743 Bacteria 1382
1542 Ga0501081_0387631 3300049743 Bacteria 1033
1543 Ga0501081_0572578 3300049743 Bacteria 844
1544 Ga0501083_0007222 3300049744 Bacteria 7888
1545 Ga0501083_0011832 3300049744 Bacteria 6114
1546 Ga0501083_0042437 3300049744 Bacteria 3084
1547 Ga0501083_0166039 3300049744 Bacteria 1443
1548 Ga0501083_0234010 3300049744 Bacteria 1196
1549 Ga0501035_0000008 3300049822 Bacteria 313425
1550 Ga0501035_0000055 3300049822 Bacteria 139471
1551 Ga0501035_0000272 3300049822 Bacteria 61461
1552 Ga0501035_0000436 3300049822 Bacteria 46832
1553 Ga0501035_0000807 3300049822 Bacteria 33393
1554 Ga0501035_0002108 3300049822 Bacteria 19783
1555 Ga0501035_0011205 3300049822 Bacteria 8304
1556 Ga0501035_0072735 3300049822 Bacteria 3042
1557 Ga0501035_0076459 3300049822 Bacteria 2961
1558 Ga0501035_0103199 3300049822 Bacteria 2501
1559 Ga0501035_0147493 3300049822 Bacteria 2042
1560 Ga0501035_0147623 3300049822 Bacteria 2042
1561 Ga0501035_0214906 3300049822 Bacteria 1644
1562 Ga0501035_0348481 3300049822 Bacteria 1239
1563 Ga0501035_0448309 3300049822 Bacteria 1068
1564 Ga0501035_0770353 3300049822 Bacteria 771
1565 Ga0501044_0000001 3300049823 Bacteria 418087
1566 Ga0501044_0000007 3300049823 Bacteria 283429
1567 Ga0501044_0000071 3300049823 Bacteria 124531
1568 Ga0501044_0004447 3300049823 Bacteria 15680
1569 Ga0501044_0005930 3300049823 Bacteria 13539
1570 Ga0501044_0015843 3300049823 Bacteria 8112
1571 Ga0501044_0024335 3300049823 Bacteria 6431
1572 Ga0501044_0077649 3300049823 Bacteria 3367
1573 Ga0501044_0089138 3300049823 Bacteria 3114
1574 Ga0501044_0089954 3300049823 Bacteria 3098
1575 Ga0501044_0094218 3300049823 Bacteria 3019
1576 Ga0501044_0119737 3300049823 Bacteria 2634
1577 Ga0501044_0134921 3300049823 Bacteria 2460
1578 Ga0501044_0164592 3300049823 Bacteria 2193
1579 Ga0501044_0209839 3300049823 Bacteria 1902
1580 Ga0501044_0465092 3300049823 Bacteria 1170
1581 Ga0501044_0531803 3300049823 Bacteria 1074
1582 Ga0501044_0549580 3300049823 Bacteria 1052
1583 Ga0501044_0818935 3300049823 Bacteria 809
1584 Ga0501045_0059098 3300049824 Bacteria 2808
1585 Ga0501045_0072997 3300049824 Bacteria 2526
1586 Ga0501045_0116382 3300049824 Bacteria 1983
1587 Ga0501045_0117374 3300049824 Bacteria 1975
1588 Ga0501045_0159776 3300049824 Bacteria 1677
1589 Ga0501045_0187914 3300049824 Bacteria 1539
1590 Ga0501045_0257986 3300049824 Bacteria 1297
1591 nmdc:mga03683_12592_c1 3300050489 Bacteria 3094
1592 nmdc:mga03683_12819_c1 3300050489 Bacteria 3070
1593 nmdc:mga03683_929_c1 3300050489 Bacteria 8471
1594 nmdc:mga03n38_168019_c1 3300050490 Bacteria 1115
1595 nmdc:mga03n38_696_c1 3300050490 Bacteria 8796
1596 nmdc:mga03n38_80019_c1 3300050490 Bacteria 1534
1597 nmdc:mga03n38_89094_c1 3300050490 Bacteria 1465
1598 nmdc:mga00v17_83626_c1 3300050491 Bacteria 1996
1599 nmdc:mga00v17_89517_c1 3300050491 Bacteria 967
1600 nmdc:mga00v17_9731_c1 3300050491 Bacteria 5217
1601 nmdc:mga0yw44_23765_c1 3300050492 Bacteria 3458
1602 nmdc:mga0yw44_25254_c1 3300050492 Bacteria 3375
1603 nmdc:mga0yw44_303901_c1 3300050492 Bacteria 1069
1604 nmdc:mga0yw44_386906_c1 3300050492 Bacteria 945
1605 nmdc:mga0yw44_6095_c1 3300050492 Bacteria 5784
1606 nmdc:mga0yw44_78671_c1 3300050492 Bacteria 2062
1607 nmdc:mga0yw44_80069_c1 3300050492 Bacteria 2045
1608 nmdc:mga0k408_1244_c1 3300050493 Bacteria 13918
1609 nmdc:mga0k408_13616_c1 3300050493 Bacteria 4465
1610 nmdc:mga06z11_122402_c1 3300050494 Bacteria 1453
1611 nmdc:mga06z11_1333_c1 3300050494 Bacteria 9125
1612 nmdc:mga06z11_2154_c1 3300050494 Bacteria 7477
1613 nmdc:mga06z11_312244_c1 3300050494 Bacteria 937
1614 nmdc:mga06z11_4896_c1 3300050494 Bacteria 5313
1615 nmdc:mga06z11_8900_c1 3300050494 Bacteria 4209
1616 nmdc:mga04h51_12706_c1 3300050495 Bacteria 2370
1617 nmdc:mga04h51_9040_c1 3300050495 Bacteria 2686
1618 nmdc:mga04h51_9274_c1 3300050495 Bacteria 2661
1619 nmdc:mga07m45_47150_c2 3300050496 Bacteria 1861
1620 nmdc:mga05p37_166313_c1 3300050507 Bacteria 2692
1621 nmdc:mga05p37_363778_c1 3300050507 Bacteria 1700
1622 nmdc:mga05p37_505050_c1 3300050507 Bacteria 1387
1623 nmdc:mga05p37_615_c1 3300050507 Bacteria 39336
1624 nmdc:mga09592_2442_c1 3300050508 Bacteria 14996
1625 nmdc:mga09592_41347_c1 3300050508 Bacteria 3876
1626 nmdc:mga09592_494138_c1 3300050508 Bacteria 1054
1627 nmdc:mga0qj67_204464_c1 3300050509 Bacteria 1604
1628 nmdc:mga0qj67_414859_c1 3300050509 Bacteria 1086
1629 nmdc:mga0qj67_54957_c1 3300050509 Bacteria 3153
1630 nmdc:mga0qj67_646139_c1 3300050509 Bacteria 844
1631 nmdc:mga0qj67_65917_c2 3300050509 Bacteria 2150
1632 nmdc:mga0qj67_85110_c1 3300050509 Bacteria 2536
1633 nmdc:mga06r32_111265_c1 3300050510 Bacteria 2695
1634 nmdc:mga06r32_25081_c1 3300050510 Bacteria 5541
1635 nmdc:mga06r32_2964_c1 3300050510 Bacteria 3965
1636 nmdc:mga06r32_489150_c1 3300050510 Bacteria 1208
1637 nmdc:mga06r32_54034_c1 3300050510 Bacteria 3851
1638 nmdc:mga06r32_67561_c1 3300050510 Bacteria 3451
1639 nmdc:mga06r32_95_c1 3300050510 Bacteria 61756
1640 nmdc:mga08y16_145341_c1 3300050511 Bacteria 2465
1641 nmdc:mga08y16_20535_c1 3300050511 Bacteria 6972
1642 nmdc:mga08y16_464415_c1 3300050511 Bacteria 1289
1643 nmdc:mga08y16_507_c1 3300050511 Bacteria 13292
1644 nmdc:mga08y16_573813_c1 3300050511 Bacteria 1140
1645 nmdc:mga08y16_680302_c1 3300050511 Bacteria 1030
1646 nmdc:mga0n895_178050_c1 3300050512 Bacteria 2157
1647 nmdc:mga0n895_44054_c1 3300050512 Bacteria 4352
1648 nmdc:mga0n895_80375_c1 3300050512 Bacteria 3248
1649 nmdc:mga0n895_8526_c1 3300050512 Bacteria 8882
1650 nmdc:mga0rr50_55543_c1 3300050513 Bacteria 2955
1651 nmdc:mga0rr50_563129_c1 3300050513 Bacteria 971
1652 nmdc:mga0rr50_610187_c1 3300050513 Bacteria 930
1653 nmdc:mga0rr50_8626_c1 3300050513 Bacteria 6353
1654 nmdc:mga08x19_10184_c1 3300050514 Bacteria 5642
1655 nmdc:mga08x19_4_c2 3300050514 Bacteria 202063
1656 nmdc:mga08x19_79452_c1 3300050514 Bacteria 2151
1657 nmdc:mga08x19_9189_c1 3300050514 Bacteria 5901
1658 nmdc:mga0a205_371719_c1 3300050515 Bacteria 1295
1659 nmdc:mga0a205_77637_c1 3300050515 Bacteria 3209
1660 nmdc:mga0sz30_26781_c1 3300050516 Bacteria 2365
1661 Ga0495601_0000004 3300053077 Bacteria 449178
1662 Ga0495601_0014727 3300053077 Bacteria 4718
1663 Ga0495601_0015682 3300053077 Bacteria 4581
1664 Ga0495601_0071357 3300053077 Bacteria 2218
1665 Ga0495601_0160204 3300053077 Bacteria 1470
1666 Ga0495601_0204695 3300053077 Bacteria 1289
1667 Ga0495612_0000013 3300053078 Bacteria 198142
1668 Ga0495655_0000576 3300053083 Bacteria 6044
1669 Ga0495655_0001905 3300053083 Bacteria 3254
1670 Ga0495595_0000057 3300053084 Bacteria 57746
1671 Ga0495595_0051362 3300053084 Bacteria 1911
1672 Ga0495619_0000005 3300053085 Bacteria 418061
1673 Ga0495619_0000852 3300053085 Bacteria 20006
1674 Ga0495619_0004963 3300053085 Bacteria 8454
1675 Ga0495619_0016894 3300053085 Bacteria 4622
1676 Ga0495619_0036371 3300053085 Bacteria 3206
1677 Ga0495619_0106040 3300053085 Bacteria 1916
1678 Ga0495619_0318658 3300053085 Bacteria 1076
1679 Ga0500566_0012676 3300053094 Bacteria 4958
1680 Ga0500566_0100630 3300053094 Bacteria 1585
1681 Ga0500556_0040318 3300053104 Bacteria 1641
1682 Ga0500593_002987 3300053117 Bacteria 6301
1683 Ga0500595_026436 3300053119 Bacteria 2000
1684 Ga0500595_029415 3300053119 Bacteria 1864
1685 Ga0500595_038229 3300053119 Bacteria 1561
1686 Ga0500595_059747 3300053119 Bacteria 1155
1687 Ga0500618_000106 3300053125 Bacteria 67801
1688 Ga0500652_000003 3300053131 Bacteria 221528
1689 Ga0500658_0182122 3300053134 Bacteria 957
1690 Ga0500559_0012340 3300053136 Bacteria 3634
1691 Ga0500559_0101671 3300053136 Bacteria 1325
1692 Ga0500568_0000118 3300053139 Bacteria 70929
1693 Ga0500577_0052068 3300053142 Bacteria 1542
1694 Ga0500604_0046995 3300053151 Bacteria 1322
1695 Ga0500616_0021703 3300053153 Bacteria 3595
1696 Ga0500616_0066140 3300053153 Bacteria 1857
1697 Ga0500616_0068405 3300053153 Bacteria 1819
1698 Ga0500616_0121611 3300053153 Bacteria 1246
1699 Ga0500620_089104 3300053155 Bacteria 1074
1700 Ga0500622_0020243 3300053156 Bacteria 3533
1701 Ga0500638_106305 3300053162 Bacteria 1302
1702 Ga0500639_065573 3300053163 Bacteria 1862
1703 Ga0500636_0017572 3300053177 Bacteria 4227
1704 Ga0500636_0040856 3300053177 Bacteria 2743
1705 Ga0500636_0176452 3300053177 Bacteria 1151
1706 Ga0500637_0100355 3300053178 Bacteria 1679
1707 Ga0500637_0116846 3300053178 Bacteria 1547
1708 Ga0501084_0011545 3300054114 Bacteria 7314
1709 Ga0501084_0035585 3300054114 Bacteria 4163
1710 Ga0501084_0046352 3300054114 Bacteria 3641
1711 Ga0501084_0048945 3300054114 Bacteria 3538
1712 Ga0501084_0058411 3300054114 Bacteria 3227
1713 Ga0501084_0135262 3300054114 Bacteria 2075
1714 Ga0501084_0144960 3300054114 Bacteria 2000
1715 Ga0501084_0199231 3300054114 Bacteria 1689
1716 Ga0590071_045141 3300059421 Bacteria 1063
1717 Ga0501082_0007486 3300060353 Bacteria 9421
1718 Ga0501082_0009497 3300060353 Bacteria 8373
1719 Ga0501082_0029330 3300060353 Bacteria 4739
1720 Ga0501082_0038675 3300060353 Bacteria 4115
1721 Ga0501082_0046340 3300060353 Bacteria 3748
1722 Ga0501082_0084979 3300060353 Bacteria 2729
1723 Ga0501082_0085974 3300060353 Bacteria 2712
1724 Ga0501082_0099623 3300060353 Bacteria 2513
1725 Ga0501082_0129782 3300060353 Bacteria 2187
1726 Ga0501082_0230082 3300060353 Bacteria 1613
1727 Ga0501082_0307887 3300060353 Bacteria 1379
1728 Ga0501082_0360340 3300060353 Bacteria 1268
1729 Ga0501082_0416936 3300060353 Bacteria 1172
1730 Ga0501082_0617704 3300060353 Bacteria 948
1731 Ga0530510_0009644 3300061734 Bacteria 6773
1732 Ga0530510_0049645 3300061734 Bacteria 3031
1733 Ga0530510_0072704 3300061734 Bacteria 2496
1734 Ga0530510_0088628 3300061734 Bacteria 2255
1735 Ga0530510_0090621 3300061734 Bacteria 2230
1736 Ga0530510_0090629 3300061734 Bacteria 2230
1737 Ga0530510_0255782 3300061734 Bacteria 1305
1738 Ga0530510_0266714 3300061734 Bacteria 1278
1739 Ga0530510_0279450 3300061734 Bacteria 1247
1740 2503202882 2503198000 Bacteria 6884444
1741 2508726744 2508501050 Bacteria 9633614
1742 2509115392 2508501123 Bacteria 6283661
1743 2509143731 2508501127 Bacteria 7037543
1744 2509372288 2509276018 Bacteria 6910194
1745 2509397373 2509276022 Bacteria 6200534
1746 2510317812 2510065059 Bacteria 6847884
1747 2512930344 2512875016 Bacteria 6529530
1748 2512958061 2512875024 Bacteria 7195110
1749 2512971345 2512875026 Bacteria 6861065
1750 2513590728 2513237087 Bacteria 5817514
1751 2513604055 2513237089 Bacteria 6553624
1752 2513610042 2513237090 Bacteria 7096802
1753 2513987397 2513237156 Bacteria 6402557
1754 2514006281 2513237160 Bacteria 6650282
1755 2514032800 2513237164 Bacteria 7563725
1756 2514422589 2513237305 Bacteria 7293571
1757 2514588760 2513237351 Bacteria 6968952
1758 2517569772 2517487022 Bacteria 7227575
1759 2563064599 2562617112 Bacteria 10918404
1760 2588515957 2588253730 Bacteria 6881675
1761 2597814513 2597489875 Bacteria 7010078
1762 2599938199 2599185301 Bacteria 6161860
1763 2600193305 2599185352 Bacteria 7228948
1764 2643770546 2643221550 Bacteria 4619371
1765 2643774975 2643221551 Bacteria 3750538
1766 2643793419 2643221555 Bacteria 3749717
1767 2643840650 2643221564 Bacteria 4193379
1768 2643989643 2643221595 Bacteria 6565519
1769 2644107916 2643221618 Bacteria 7717186
1770 2644130094 2643221623 Bacteria 5239945
1771 2644148411 2643221626 Bacteria 8069654
1772 2644157733 2643221627 Bacteria 6761570
1773 2644309310 2643221655 Bacteria 7722067
1774 2644333137 2643221659 Bacteria 7890716
1775 2644545691 2643221698 Bacteria 7756764
1776 2644615252 2643221712 Bacteria 7729434
1777 2644673557 2643221723 Bacteria 7095460
1778 2644735692 2643221734 Bacteria 5365412
1779 2657683880 2657244999 Bacteria 5946535
1780 2688599742 2687453392 Bacteria 6880454
1781 2694630586 2693429783 Bacteria 7019804
1782 2694639356 2693429784 Bacteria 7241525
1783 2713472907 2711768613 Bacteria 11048459
1784 2723576506 2721755686 Bacteria 7343952
1785 2739308867 2738543024 Bacteria 5603683
1786 2753359238 2751185800 Bacteria 5467370
1787 2756676066 2756170246 Bacteria 7451806
1788 2792582035 2791355082 Bacteria 5973319
1789 2792619934 2791355091 Bacteria 6135441
1790 2792639586 2791355094 Bacteria 7011481
1791 2792748730 2791355123 Bacteria 8049106
1792 2802719047 2802428858 Bacteria 6636079
1793 2802727278 2802428859 Bacteria 6667919
1794 2802732060 2802428860 Bacteria 6525526
1795 2802738990 2802428861 Bacteria 6534206
1796 2802744889 2802428862 Bacteria 6633353
1797 2802752165 2802428863 Bacteria 6410669
1798 2804752142 2802429268 Bacteria 6094027
1799 2808940714 2808606379 Bacteria 5022697
1800 2819718411 2818991467 Bacteria 5893227
1801 2828308083 2828305725 Bacteria 4916900
1802 2837680097 2837678835 Bacteria 5252418
1803 2838078805 2838074704 Bacteria 6785777
1804 2841740687 2841734538 Bacteria 6784580
1805 2841761744 2841760612 Bacteria 6454112
1806 2841912081 2841911363 Bacteria 6173697
1807 2841922975 2841917233 Bacteria 6173500
1808 2842339519 2842333319 Bacteria 8899485
1809 2844007035 2844002411 Bacteria 7168230
1810 2844015030 2844009547 Bacteria 6728125
1811 2844104769 2844104063 Bacteria 6440972
1812 2844167352 2844163670 Bacteria 7266046
1813 2847676187 2847670302 Bacteria 6165597
1814 2847692841 2847686936 Bacteria 6278406
1815 2851184761 2851182111 Bacteria 6047226
1816 2851247757 2851246043 Bacteria 6439203
1817 2856315973 2856314179 Bacteria 6477897
1818 2856324787 2856320880 Bacteria 7263508
1819 2856333019 2856328259 Bacteria 6528202
1820 2856339069 2856334872 Bacteria 7037011
1821 2856346470 2856342000 Bacteria 7176905
1822 2856356253 2856349417 Bacteria 6230045
1823 2856368706 2856364286 Bacteria 6939991
1824 2857350412 2857349434 Bacteria 7926032
1825 2857374224 2857367948 Bacteria 6965560
1826 2869167232 2869162929 Bacteria 6399702
1827 2869176972 2869169390 Bacteria 6659796
1828 2869237406 2869234852 Bacteria 6654993
1829 2869247851 2869242130 Bacteria 6609239
1830 2869251425 2869249662 Bacteria 6868783
1831 2869266939 2869264136 Bacteria 6880765
1832 2869272373 2869271264 Bacteria 6908218
1833 2869281222 2869278585 Bacteria 7077053
1834 2869291201 2869285874 Bacteria 6901219
1835 2871433481 2871429161 Bacteria 6547891
1836 2871440038 2871435913 Bacteria 6880295
1837 2871444491 2871444079 Bacteria 6423508
1838 2871455620 2871451962 Bacteria 7336357
1839 2871463217 2871459585 Bacteria 6866887
1840 2871472914 2871466892 Bacteria 6923287
1841 2871476090 2871474448 Bacteria 6806570
1842 2871487434 2871481445 Bacteria 6700002
1843 2871495899 2871488783 Bacteria 6929816
1844 2871503113 2871495908 Bacteria 6935695
1845 2874105963 2874102143 Bacteria 6342645
1846 2874114700 2874109183 Bacteria 6517025
1847 2874119345 2874116593 Bacteria 6674494
1848 2874126104 2874123672 Bacteria 7238285
1849 2874134267 2874131515 Bacteria 6820270
1850 2874141174 2874139085 Bacteria 7021506
1851 2874153082 2874146452 Bacteria 7533118
1852 2874160347 2874155637 Bacteria 6724144
1853 2874165252 2874162495 Bacteria 6174670
1854 2874170847 2874168670 Bacteria 8062617
1855 2876368314 2876363079 Bacteria 6544991
1856 2876371532 2876369609 Bacteria 6807521
1857 2876384050 2876377896 Bacteria 6565995
1858 2876392738 2876386047 Bacteria 6698674
1859 2876394853 2876392853 Bacteria 6660880
1860 2876400905 2876399893 Bacteria 6927900
1861 2876408639 2876406927 Bacteria 6191900
1862 2876419373 2876413966 Bacteria 6831344
1863 2876425701 2876420981 Bacteria 6687741
1864 2878040241 2878035449 Bacteria 6555736
1865 2878742895 2878738818 Bacteria 7136951
1866 2878751092 2878745973 Bacteria 6867388
1867 2878753303 2878753008 Bacteria 6922523
1868 2878767002 2878760144 Bacteria 6823465
1869 2878774200 2878767105 Bacteria 6898628
1870 2878776205 2878774303 Bacteria 6108671
1871 2881152210 2881147464 Bacteria 7779814
1872 2881156481 2881155292 Bacteria 6461656
1873 2881168183 2881161766 Bacteria 7127907
1874 2881847298 2881845957 Bacteria 6611900
1875 2881857020 2881853255 Bacteria 6698367
1876 2881864340 2881861095 Bacteria 7128710
1877 2882633306 2882632389 Bacteria 8154593
1878 2882915083 2882912400 Bacteria 6801539
1879 2885310062 2885305155 Bacteria 7348390
1880 2885316797 2885312484 Bacteria 6415165
1881 2885326074 2885318864 Bacteria 6729568
1882 2885329551 2885326080 Bacteria 7134805
1883 2885349031 2885342637 Bacteria 7011821
1884 2885352465 2885350715 Bacteria 6787678
1885 2888340921 2888337043 Bacteria 6629336
1886 2888348123 2888343758 Bacteria 6611049
1887 2888356423 2888350351 Bacteria 7372807
1888 2888393198 2888388044 Bacteria 7304136
1889 2889011335 2889010040 Bacteria 6749192
1890 2889016935 2889016732 Bacteria 6700763
1891 2889793687 2889790730 Bacteria 5689708
1892 2889919510 2889914905 Bacteria 5702301
1893 2894818350 2894817345 Bacteria 4892941
1894 2896390676 2896384573 Bacteria 7700774
1895 2903452332 2903448605 Bacteria 7357801
1896 2903495157 2903492973 Bacteria 13473544
1897 2903503148 2903492973 Bacteria 13473544
1898 2903513881 2903513507 Bacteria 6344008
1899 2903527310 2903521522 Bacteria 6525694
1900 2903531456 2903528002 Bacteria 6586099
1901 2903548302 2903540706 Bacteria 7062119
1902 2904661484 2904659560 Bacteria 6685615
1903 2906313033 2906308376 Bacteria 6841989
1904 2906325744 2906321335 Bacteria 6579571
1905 2906328914 2906328253 Bacteria 6585166
1906 2906356024 2906354277 Bacteria 6991324
1907 2906368308 2906363423 Bacteria 6856682
1908 2906374917 2906370794 Bacteria 6881062
1909 2906382228 2906378014 Bacteria 6911440
1910 2906391582 2906386501 Bacteria 5977019
1911 2906397343 2906393657 Bacteria 6790866
1912 2906406608 2906401398 Bacteria 6693206
1913 2906410874 2906408224 Bacteria 6162342
1914 2906416110 2906414383 Bacteria 6580790
1915 2906432426 2906427513 Bacteria 6375796
1916 2915651759 2915650412 Bacteria 4288180
1917 2915981529 2915980308 Bacteria 6624279
1918 2916066076 2916061851 Bacteria 6737736
1919 2920766277 2920760137 Bacteria 7427611
1920 2921255057 2921250672 Bacteria 6677771
1921 2921261288 2921257292 Bacteria 6808382
1922 2922136811 2922130491 Bacteria 7173936
1923 2922157915 2922151315 Bacteria 6902399
1924 2922165543 2922158528 Bacteria 6573167
1925 2922177286 2922172374 Bacteria 6167644
1926 2922183154 2922178524 Bacteria 6025201
1927 2922191461 2922185730 Bacteria 7113964
1928 2924715357 2924710171 Bacteria 6752351
1929 2924724603 2924718760 Bacteria 6331356
1930 2924732342 2924726620 Bacteria 6271473
1931 2924734983 2924733363 Bacteria 7574837
1932 2924741910 2924741084 Bacteria 6661321
1933 2924754266 2924748358 Bacteria 6154725
1934 2924757759 2924754689 Bacteria 6774424
1935 2924765175 2924762789 Bacteria 6561353
1936 2924780695 2924776078 Bacteria 7492003
1937 2924789787 2924784321 Bacteria 7416538
1938 2937025907 2937023124 Bacteria 6815156
1939 2937032632 2937029754 Bacteria 6424026
1940 2937038729 2937036028 Bacteria 6846469
1941 2937079200 2937078374 Bacteria 6610289
1942 2937086042 2937084907 Bacteria 6618516
1943 2937820815 2937813078 Bacteria 7783518
1944 2937827433 2937822353 Bacteria 7290551
1945 2937836861 2937836603 Bacteria 6811263
1946 2937854332 2937848649 Bacteria 6983481
1947 2937864475 2937861824 Bacteria 6660327
1948 2937873077 2937868953 Bacteria 6639878
1949 2937879801 2937877337 Bacteria 7246526
1950 2937893950 2937891427 Bacteria 6357007
1951 2937974689 2937972304 Bacteria 7532020
1952 2937988202 2937980651 Bacteria 6517427
1953 2938002126 2937994558 Bacteria 7036190
1954 2938021477 2938014810 Bacteria 6700592
1955 2939670292 2939669807 Bacteria 5028511
1956 2941503762 2941499720 Bacteria 7599444
1957 2957381594 2957375807 Bacteria 6425588
1958 2957400380 2957395598 Bacteria 6822399
1959 2957442484 2957437181 Bacteria 6568994
1960 2958037184 2958034702 Bacteria 6989922
1961 2958046896 2958041894 Bacteria 13082850
1962 2958067411 2958064165 Bacteria 7158582
1963 2958076956 2958071322 Bacteria 6815895
1964 2958086979 2958084443 Bacteria 7312792
1965 2958098107 2958092219 Bacteria 6861151
1966 2958106155 2958100919 Bacteria 6800575
1967 2958111845 2958108152 Bacteria 6681128
1968 2958122148 2958115193 Bacteria 6923548
1969 2958126554 2958122699 Bacteria 7280457
1970 2958135602 2958130278 Bacteria 6897202
1971 2958146942 2958144490 Bacteria 6677056
1972 2958160345 2958158011 Bacteria 6058449
1973 2958172180 2958165035 Bacteria 6906348
1974 2958185093 2958179912 Bacteria 6874908
1975 2960597198 2960591022 Bacteria 6622873
1976 2960631778 2960631154 Bacteria 6732508
1977 2960687150 2960680706 Bacteria 6624464
1978 2960699123 2960693952 Bacteria 6749742
1979 2961083360 2961077736 Bacteria 7079850
1980 2961116636 2961114664 Bacteria 6680456
1981 2961131898 2961127735 Bacteria 7196641
1982 2961138864 2961136820 Bacteria 6775228
1983 2961170628 2961163497 Bacteria 6901077
1984 2961177747 2961170736 Bacteria 7072258
1985 2961184517 2961183825 Bacteria 6688536
1986 2963648887 2963644680 Bacteria 6530403
1987 2964620548 2964615318 Bacteria 6809089
1988 2965025375 2965018300 Bacteria 6883036
1989 2965027985 2965025482 Bacteria 6532201
1990 2965032117 2965032056 Bacteria 6887443
1991 2965050090 2965047637 Bacteria 6623551
1992 2965065505 2965062239 Bacteria 7412989
1993 2965090402 2965089291 Bacteria 6866420
1994 2965103523 2965102966 Bacteria 6800987
1995 2965112136 2965110997 Bacteria 6693150
1996 2965121510 2965119406 Bacteria 6956431
1997 2967687486 2967686174 Bacteria 6678622
1998 2967729238 2967728569 Bacteria 6641507
1999 2967757145 2967755722 Bacteria 6814706
2000 2968003014 2967996073 Bacteria 6787468
2001 2968003839 2968003550 Bacteria 6929263
2002 2968019998 2968016561 Bacteria 7022047
2003 2968084112 2968083720 Bacteria 7351627
2004 2968095957 2968091066 Bacteria 6052692
2005 2968099726 2968097103 Bacteria 6107094
2006 2968112543 2968110612 Bacteria 6814636
2007 2968121318 2968117919 Bacteria 6536078
2008 2968130848 2968128360 Bacteria 6270294
2009 2968179014 2968171901 Bacteria 6894245
2010 2970029838 2970026789 Bacteria 6785236
2011 2970105126 2970102677 Bacteria 6812532
2012 2970125775 2970122695 Bacteria 6625855
2013 2970146894 2970143518 Bacteria 6446480
2014 2970473319 2970469710 Bacteria 6969209
2015 2970495441 2970489779 Bacteria 6517260
2016 2970510423 2970503327 Bacteria 7099517
2017 2970514124 2970510686 Bacteria 7006402
2018 2970532026 2970524798 Bacteria 6840927
2019 2970532649 2970532167 Bacteria 6553173
2020 2970545243 2970540015 Bacteria 6977556
2021 2970552114 2970547951 Bacteria 6931819
2022 2970561858 2970554993 Bacteria 6814252
2023 2970595826 2970593180 Bacteria 7073582
2024 2970620363 2970619444 Bacteria 6986144
2025 2970632140 2970627176 Bacteria 6680862
2026 2977532869 2977530762 Bacteria 6951399
2027 2977548462 2977544691 Bacteria 6875412
2028 2977822757 2977821940 Bacteria 6906439
2029 2977833224 2977828996 Bacteria 7007971
2030 2977849113 2977843712 Bacteria 6753583
2031 2977851368 2977851361 Bacteria 6694324
2032 2977864460 2977858184 Bacteria 6215359
2033 2977872395 2977864932 Bacteria 7534097
2034 2977874470 2977872689 Bacteria 7270173
2035 2977905740 2977898635 Bacteria 6675551
2036 2977909720 2977907340 Bacteria 6577984
2037 2977917204 2977915119 Bacteria 6829656
2038 2977926742 2977922695 Bacteria 6956781
2039 2977936273 2977935797 Bacteria 6252826
2040 2977948122 2977942078 Bacteria 7570577
2041 2977952319 2977950692 Bacteria 6893264
2042 2977961330 2977957713 Bacteria 6877875
2043 2977979635 2977971508 Bacteria 7472917
2044 2977992439 2977986579 Bacteria 6581278
2045 2979712218 2979710463 Bacteria 6785254
2046 2979750902 2979742915 Bacteria 7301278
2047 2979770727 2979764755 Bacteria 6610066
2048 2979777368 2979772303 Bacteria 6618277
2049 2979781438 2979779861 Bacteria 6219781
2050 2979794399 2979793036 Bacteria 6808957
2051 2979815297 2979808191 Bacteria 7179355
2052 2987637598 2987636660 Bacteria 8088555
2053 2987650676 2987645492 Bacteria 6117018
2054 2987653284 2987652177 Bacteria 6969023
2055 2987666867 2987659509 Bacteria 6966464
2056 2987667782 2987666974 Bacteria 6509233
2057 2987675637 2987673487 Bacteria 6884027
2058 2996310750 2996310559 Bacteria 6357320
2059 2996340694 2996336353 Bacteria 5511628
2060 2996348448 2996341866 Bacteria 6643098
2061 2996351490 2996348954 Bacteria 7239054
2062 2996389382 2996386984 Bacteria 6978667
2063 3000138864 3000135777 Bacteria 6891109
2064 3003933601 3003930520 Bacteria 5667563
2065 3004170452 3004167301 Bacteria 8330599
2066 3004195871 3004188549 Bacteria 6952365
2067 3004201846 3004195979 Bacteria 6776956
2068 3004206080 3004203850 Bacteria 7307914
2069 3004215043 3004211236 Bacteria 7417683
2070 3004222366 3004218560 Bacteria 7421728
2071 3004236832 3004232784 Bacteria 6662140
2072 3004241026 3004239961 Bacteria 6892290
2073 3004250036 3004248173 Bacteria 6563236
2074 3004274406 3004268573 Bacteria 7043476
2075 3004278190 3004275668 Bacteria 7114440
2076 3004295090 3004289098 Bacteria 6135450
2077 3004339926 3004334049 Bacteria 8449246
2078 637073339 637000159 Bacteria 7596297
2079 641337011 641228493 Bacteria 3999591
2080 643392821 643348555 Bacteria 3914947
2081 649874247 649633066 Bacteria 6690028
2082 8002285423 8002285264 Bacteria 6717907
2083 8004001136 8003999396 Bacteria 7063185
2084 8004302584 8004300914 Bacteria 6132239
2085 8004315347 8004312739 Bacteria 7444653
2086 8004364183 8004361976 Bacteria 6858373
2087 8004374875 8004374579 Bacteria 6898112
2088 8004394243 8004387939 Bacteria 7049250
2089 8004399852 8004395343 Bacteria 6620908
2090 8004446075 8004445564 Bacteria 6322258
2091 8004638216 8004633249 Bacteria 6723080
2092 8004642037 8004640170 Bacteria 6723001
2093 8004695664 8004695233 Bacteria 6731676
2094 8004713582 8004703790 Bacteria 8006957
2095 8004719291 8004714634 Bacteria 6776161
2096 8004729666 8004727605 Bacteria 6643904
2097 8049294690 8049293176 Bacteria 6128433
2098 8054558967 8054558443 Bacteria 5204801
2099 8055622238 8055617313 Bacteria 7548464
2100 8057530133 8057529695 Bacteria 6306553
2101 Ga0501039_0172727
2102 JGI24746J21847_1001085
2103 JGI24740J21852_10006526
2104 JGI24739J22299_10047854
2105 JGI24737J22298_10051034
2106 JGI24750J21931_1001195
2107 JGI24750J21931_1002374
2108 JGI24738J21930_10005970
2109 JGI24738J21930_10007456
2110 JGI24749J21850_1010571
2111 JGI24749J21850_1016147
2112 JGI24744J21845_10006218
2113 JGI24744J21845_10011920
2114 JGI24033J26618_1007281
2115 JGI24742J22300_10002109
2116 JGI24742J22300_10018212
2117 JGI24751J29686_10003795
2118 JGI24751J29686_10004371
2119 JGI25156J39149_1006460
2120 JGI25157J39369_1000310
2121 JGI25159J45721_1000029
2122 JGI25159J45721_1006446
2123 Ga0006778J45830_1020520
2124 Ga0006778J45830_1051547
2125 Ga0006759J45824_1031091
2126 JGI25151J46595_10000044
2127 JGI25153J46596_10000369
2128 JGI25153J46596_10000379
2129 JGI25153J46596_10002710
2130 Ga0006777J48905_1021316
2131 Ga0006777J48905_1034387
2132 JGI25160J50197_1000011
2133 JGI25161J50226_1000216
2134 Ga0007410J51695_1020795
2135 Ga0007409J51694_1049573
2136 Ga0007416J51690_1033932
2137 Ga0007429J51699_1038745
2138 Ga0007429J51699_1038746
2139 Ga0032354_1047281
2140 Ga0006780_1005821
2141 Ga0006780_1019722
2142 Ga0055542_1001387
2143 Ga0055542_1002854
2144 Ga0055526_1000091
2145 Ga0055526_1003540
2146 Ga0055526_1003634
2147 Ga0055526_1034806
2148 Ga0055524_1029369
2149 Ga0055531_10030043
2150 JGI25405J52794_10036305
2151 Ga0055543_1000179
2152 Ga0055543_1025677
2153 Ga0058862_12598501
2154 Ga0065165_1000018
2155 Ga0065165_1000549
2156 Ga0065165_1006672
2157 Ga0065165_1007387
2158 Ga0070658_10135240
2159 Ga0070676_10033629
2160 Ga0070683_100046149
2161 Ga0070683_100130954
2162 Ga0070683_100288797
2163 Ga0070690_100000031
2164 Ga0070670_100002795
2165 Ga0070670_100010830
2166 Ga0070670_100069841
2167 Ga0068869_100101973
2168 Ga0070666_10048602
2169 Ga0070680_100013749
2170 Ga0070680_100065124
2171 Ga0070680_100102229
2172 Ga0070680_100133539
2173 Ga0070680_100269665
2174 Ga0070680_100377506
2175 Ga0070682_100000872
2176 Ga0070682_100004641
2177 Ga0070682_100281378
2178 Ga0070682_100335008
2179 Ga0068868_100007455
2180 Ga0068868_100015186
2181 Ga0068868_100380111
2182 Ga0068868_100392547
2183 Ga0070660_100000424
2184 Ga0070660_100059342
2185 Ga0070660_100135596
2186 Ga0070660_100193622
2187 Ga0070689_100012792
2188 Ga0070689_100027324
2189 Ga0070689_100073641
2190 Ga0070691_10000305
2191 Ga0070691_10123538
2192 Ga0070687_100002671
2193 Ga0070687_100025098
2194 Ga0070661_100005997
2195 Ga0070661_100053570
2196 Ga0070661_100495726
2197 Ga0070692_10015981
2198 Ga0070692_10045100
2199 Ga0070668_100000547
2200 Ga0070668_100373663
2201 Ga0070669_100000573
2202 Ga0070669_100062845
2203 Ga0070669_100694753
2204 Ga0070675_100206460
2205 Ga0070675_100526441
2206 Ga0070671_100000381
2207 Ga0070671_100153648
2208 Ga0070671_100244960
2209 Ga0070674_100000523
2210 Ga0070674_100093334
2211 Ga0070674_100401802
2212 Ga0070673_100000111
2213 Ga0070673_100054247
2214 Ga0070673_100145227
2215 Ga0070688_100000439
2216 Ga0070688_100074540
2217 Ga0070688_100427441
2218 Ga0070659_100001531
2219 Ga0070659_100037122
2220 Ga0070659_100200026
2221 Ga0070667_100000742
2222 Ga0070667_100268555
2223 Ga0070667_100573012
2224 Ga0070667_100719936
2225 Ga0070703_10021610
2226 Ga0070703_10043166
2227 Ga0070709_10001603
2228 Ga0070709_10015446
2229 Ga0070709_10189242
2230 Ga0070714_100002925
2231 Ga0070714_100324023
2232 Ga0070714_100814590
2233 Ga0070713_100002679
2234 Ga0070713_100036702
2235 Ga0070713_100220937
2236 Ga0070713_100781734
2237 Ga0070710_10052010
2238 Ga0070701_10003309
2239 Ga0070701_10008282
2240 Ga0070701_10210661
2241 Ga0070711_100000238
2242 Ga0070711_100098052
2243 Ga0070711_100187725
2244 Ga0070705_100000568
2245 Ga0070705_100007808
2246 Ga0070705_100026017
2247 Ga0070705_100071228
2248 Ga0070705_100298660
2249 Ga0070700_100000702
2250 Ga0070700_100000905
2251 Ga0070700_100012342
2252 Ga0070700_100058428
2253 Ga0070694_100002735
2254 Ga0070694_100016938
2255 Ga0070694_100025588
2256 Ga0070694_100546628
2257 Ga0070708_100062984
2258 Ga0070663_100002733
2259 Ga0070663_100003287
2260 Ga0070663_100021801
2261 Ga0070663_100030693
2262 Ga0070663_100073480
2263 Ga0070663_100579500
2264 Ga0070678_100000328
2265 Ga0070678_100003909
2266 Ga0070678_100033247
2267 Ga0070678_100094107
2268 Ga0070678_100373546
2269 Ga0070678_100658572
2270 Ga0070662_100001201
2271 Ga0070662_100046829
2272 Ga0070681_10002440
2273 Ga0070681_10047892
2274 Ga0070681_10049840
2275 Ga0070681_10708582
2276 Ga0068867_100187633
2277 Ga0070698_100108642
2278 Ga0070699_100003865
2279 Ga0070699_100245266
2280 Ga0070679_100007780
2281 Ga0070679_100012547
2282 Ga0070679_100045074
2283 Ga0070679_100109775
2284 Ga0070679_100282828
2285 Ga0070684_100549518
2286 Ga0070697_100000372
2287 Ga0070697_100003894
2288 Ga0070697_100148486
2289 Ga0070697_100368945
2290 Ga0068853_100002908
2291 Ga0068853_100008796
2292 Ga0068853_100014575
2293 Ga0068853_100019258
2294 Ga0070672_100004025
2295 Ga0070672_100004197
2296 Ga0070672_100090017
2297 Ga0070686_100023660
2298 Ga0070686_100028163
2299 Ga0070686_100095430
2300 Ga0070686_100514606
2301 Ga0070695_100000379
2302 Ga0070695_100002634
2303 Ga0070695_100013831
2304 Ga0070696_100002850
2305 Ga0070696_100048951
2306 Ga0070696_100240340
2307 Ga0070693_100000366
2308 Ga0070693_100037074
2309 Ga0070665_100095453
2310 Ga0070665_100183602
2311 Ga0070665_100260233
2312 Ga0070704_100000980
2313 Ga0070704_100004175
2314 Ga0070704_100049937
2315 Ga0070704_100057515
2316 Ga0070704_100116809
2317 Ga0068855_100001286
2318 Ga0068855_100297600
2319 Ga0070664_100001736
2320 Ga0070664_100232401
2321 Ga0070664_100339109
2322 Ga0068857_100000473
2323 Ga0068854_100001023
2324 Ga0068856_100005557
2325 Ga0070702_100001480
2326 Ga0070702_100002704
2327 Ga0070702_100004009
2328 Ga0070702_100244625
2329 Ga0068852_100003530
2330 Ga0068852_100022442
2331 Ga0068852_100136450
2332 Ga0068859_100009249
2333 Ga0068859_100013367
2334 Ga0068859_100120135
2335 Ga0068864_100006233
2336 Ga0068864_100017168
2337 Ga0068864_100062473
2338 Ga0068864_100082507
2339 Ga0068866_10098286
2340 Ga0068861_100000606
2341 Ga0068861_100006956
2342 Ga0068861_100086963
2343 Ga0068861_100208872
2344 Ga0068861_100211215
2345 Ga0068861_100737912
2346 Ga0068851_10039572
2347 Ga0068851_10145084
2348 Ga0068870_10294129
2349 Ga0068863_100013115
2350 Ga0068863_100016333
2351 Ga0068863_100099939
2352 Ga0068858_100140808
2353 Ga0068860_100001485
2354 Ga0068860_100007864
2355 Ga0068860_100045325
2356 Ga0068860_100074806
2357 Ga0068860_100111225
2358 Ga0068860_100116590
2359 Ga0068862_100000857
2360 Ga0068862_100001067
2361 Ga0068862_100006026
2362 Ga0068862_100055915
2363 Ga0081455_10002287
2364 Ga0081455_10138082
2365 Ga0081455_10138890
2366 Ga0081455_10147356
2367 Ga0081455_10186125
2368 Ga0081538_10003767
2369 Ga0081540_1000231
2370 Ga0081540_1001706
2371 Ga0081540_1021452
2372 Ga0081540_1084098
2373 Ga0081539_10090050
2374 Ga0070717_10085658
2375 Ga0070717_10098164
2376 Ga0070717_10143793
2377 Ga0070717_10220331
2378 Ga0075365_10017184
2379 Ga0075365_10019511
2380 Ga0075365_10021047
2381 Ga0075365_10022168
2382 Ga0075365_10034507
2383 Ga0075365_10143127
2384 Ga0075365_10381409
2385 Ga0075368_10003347
2386 Ga0075368_10010887
2387 Ga0075368_10023608
2388 Ga0075368_10029933
2389 Ga0075363_100010851
2390 Ga0075363_100025765
2391 Ga0075363_100056976
2392 Ga0075363_100068627
2393 Ga0075364_10079176
2394 Ga0075364_10099392
2395 Ga0075364_10121603
2396 Ga0070715_10066022
2397 Ga0070716_100000193
2398 Ga0070716_100093215
2399 Ga0070712_100010654
2400 Ga0070712_100080499
2401 Ga0070712_100265559
2402 Ga0070712_100321368
2403 Ga0070712_100451244
2404 Ga0075362_10005091
2405 Ga0075362_10070214
2406 Ga0075362_10120481
2407 Ga0075367_10009820
2408 Ga0075367_10036305
2409 Ga0075367_10061047
2410 Ga0075367_10077097
2411 Ga0075367_10203029
2412 Ga0075367_10299311
2413 Ga0075369_10017607
2414 Ga0075369_10028219
2415 Ga0075366_10003079
2416 Ga0075366_10056348
2417 Ga0075366_10160634
2418 Ga0075366_10212592
2419 Ga0097621_100016072
2420 Ga0097621_100113186
2421 Ga0097621_100233297
2422 Ga0075370_10063881
2423 Ga0075370_10141546
2424 Ga0068871_100236588
2425 Ga0068871_100454877
2426 Ga0075428_100002752
2427 Ga0075428_100004009
2428 Ga0075428_100028795
2429 Ga0075428_100417594
2430 Ga0075428_100537555
2431 Ga0075428_100708019
2432 Ga0075430_100071305
2433 Ga0075430_100156559
2434 Ga0075430_100600522
2435 Ga0075431_100001262
2436 Ga0075431_100001307
2437 Ga0075431_100032233
2438 Ga0075431_100052804
2439 Ga0075431_100172567
2440 Ga0075431_100254623
2441 Ga0075431_100435942
2442 Ga0075431_100673543
2443 Ga0075433_10027105
2444 Ga0075434_100018862
2445 Ga0075434_100034912
2446 Ga0075434_100047718
2447 Ga0075434_100160823
2448 Ga0075434_100402772
2449 Ga0075434_100456519
2450 Ga0075429_100002424
2451 Ga0075429_100022083
2452 Ga0075429_100042256
2453 Ga0068865_100069379
2454 Ga0075436_100004853
2455 Ga0075436_100004980
2456 Ga0075436_100047313
2457 Ga0075436_100066367
2458 Ga0097620_100009249
2459 Ga0097620_100013367
2460 Ga0097620_100120143
2461 Ga0079104_1004255
2462 Ga0099826_10077084
2463 Ga0075435_100044729
2464 Ga0075435_100100777
2465 Ga0075435_100116551
2466 Ga0099795_10033345
2467 Ga0105251_10051618
2468 Ga0105250_10068692
2469 Ga0105240_10048596
2470 Ga0105240_10067454
2471 Ga0105240_10220694
2472 Ga0105240_10584168
2473 Ga0111539_10001242
2474 Ga0111539_10026961
2475 Ga0111539_10063135
2476 Ga0111539_10181896
2477 Ga0111539_10226878
2478 Ga0111539_10349014
2479 Ga0105245_10004930
2480 Ga0105245_10017425
2481 Ga0105245_10059791
2482 Ga0105245_10147155
2483 Ga0105247_10000879
2484 Ga0105247_10017227
2485 Ga0105247_10061884
2486 Ga0105247_10097310
2487 Ga0105247_10237677
2488 Ga0114129_10000485
2489 Ga0114129_10009810
2490 Ga0114129_10110544
2491 Ga0114129_10385094
2492 Ga0114129_10473597
2493 Ga0114129_10492794
2494 Ga0114129_11128352
2495 Ga0105243_10000542
2496 Ga0105243_10020796
2497 Ga0105243_10046042
2498 Ga0105243_10187168
2499 Ga0105243_10400458
2500 Ga0105243_10503446
2501 Ga0105243_11013988
2502 Ga0105241_10005203
2503 Ga0105241_10006654
2504 Ga0105241_10009459
2505 Ga0105241_10023742
2506 Ga0105241_10088976
2507 Ga0105242_10009921
2508 Ga0105248_10001122
2509 Ga0105248_10028038
2510 Ga0105248_10091706
2511 Ga0105248_10115633
2512 Ga0105237_10002679
2513 Ga0105237_10039522
2514 Ga0105237_10166816
2515 Ga0105238_10038335
2516 Ga0105238_10100546
2517 Ga0105238_10104514
2518 Ga0105249_10000689
2519 Ga0105249_10002046
2520 Ga0105249_10014308
2521 Ga0105249_10345823
2522 Ga0105249_10745264
2523 Ga0099796_10003376
2524 Ga0105239_10037767
2525 Ga0105239_10100029
2526 Ga0105239_10318952
2527 Ga0105239_10397614
2528 Ga0105239_10528237
2529 Ga0105239_10564841
2530 Ga0105246_10000180
2531 Ga0105246_10039428
2532 Ga0105246_10055527
2533 Ga0105246_10131107
2534 Ga0105246_10236438
2535 Ga0105246_10277015
2536 Ga0157373_10018836
2537 Ga0157371_10001681
2538 Ga0157370_10137728
2539 Ga0157370_10185361
2540 Ga0157370_10604171
2541 Ga0157369_10003861
2542 Ga0157369_10142128
2543 Ga0171462_1028
2544 Ga0157374_10006552
2545 Ga0157374_10082150
2546 Ga0157378_10001537
2547 Ga0157378_10064448
2548 Ga0157378_10567714
2549 Ga0163162_10001513
2550 Ga0163162_10031192
2551 Ga0163162_10275774
2552 Ga0163162_10618809
2553 Ga0157372_10008591
2554 Ga0157372_10008951
2555 Ga0157372_10345374
2556 Ga0157375_10001949
2557 Ga0157375_10722129
2558 Ga0163163_10032343
2559 Ga0163163_10071104
2560 Ga0163163_10113169
2561 Ga0157380_10001442
2562 Ga0157380_10011537
2563 Ga0157380_10025674
2564 Ga0157380_10073492
2565 Ga0157380_10203036
2566 Ga0157380_10226940
2567 Ga0182008_10226534
2568 Ga0157377_10008396
2569 Ga0157377_10013535
2570 Ga0157377_10077333
2571 Ga0157377_10376092
2572 Ga0157379_10006845
2573 Ga0157379_10009632
2574 Ga0157379_10029045
2575 Ga0157379_10030444
2576 Ga0157379_10143031
2577 Ga0157376_10000456
2578 Ga0157376_10047623
2579 Ga0157376_10117584
2580 Ga0157376_10509418
2581 Ga0157376_10683581
2582 Ga0182005_1014359
2583 Ga0182005_1050499
2584 Ga0163161_10019400
2585 Ga0163161_10034769
2586 Ga0206353_11139613
2587 Ga0214544_1000129
2588 Ga0214542_1000245
2589 Ga0214543_1000010
2590 Ga0213872_10133731
2591 Ga0213874_10112506
2592 Ga0213876_10006894
2593 Ga0213876_10011881
2594 Ga0213876_10013939
2595 Ga0213875_10000705
2596 Ga0213875_10112025
2597 Ga0228711_1000007
2598 Ga0228710_1000007
2599 Ga0209436_103537
2600 Ga0207672_1002998
2601 Ga0207425_1018745
2602 Ga0209026_1000002
2603 Ga0209677_111792
2604 Ga0209148_1000038
2605 Ga0209148_1004788
2606 Ga0209759_1000062
2607 Ga0209233_1000027
2608 Ga0209233_1010583
2609 Ga0209455_1000068
2610 Ga0209673_1019323
2611 Ga0209130_1000029
2612 Ga0209130_1000062
2613 Ga0209675_1000554
2614 Ga0209676_1001711
2615 Ga0209025_1000014
2616 Ga0209025_1000033
2617 Ga0209025_1000787
2618 Ga0209025_1003796
2619 Ga0209025_1063950
2620 Ga0209564_1000017
2621 Ga0209564_1000077
2622 Ga0209564_1000275
2623 Ga0209564_1028903
2624 Ga0209758_1000024
2625 Ga0209758_1000641
2626 Ga0209758_1001779
2627 Ga0209758_1009659
2628 Ga0209758_1011523
2629 Ga0209050_1001363
2630 Ga0209256_1000057
2631 Ga0209256_1000102
2632 Ga0209256_1000649
2633 Ga0209256_1011304
2634 Ga0207426_1000074
2635 Ga0207426_1005362
2636 Ga0209257_1001606
2637 Ga0209257_1002758
2638 Ga0207697_10019433
2639 Ga0207697_10080644
2640 Ga0207656_10102101
2641 Ga0207656_10152788
2642 Ga0207696_1038406
2643 Ga0207653_10001874
2644 Ga0207682_10153648
2645 Ga0207692_10075709
2646 Ga0207642_10002234
2647 Ga0207642_10005653
2648 Ga0207710_10004276
2649 Ga0207710_10023510
2650 Ga0207688_10000758
2651 Ga0207688_10025034
2652 Ga0207688_10051576
2653 Ga0207647_10003290
2654 Ga0207647_10037505
2655 Ga0207647_10051475
2656 Ga0207685_10044057
2657 Ga0207685_10045708
2658 Ga0207699_10007735
2659 Ga0207699_10095438
2660 Ga0207699_10108838
2661 Ga0207699_10437124
2662 Ga0207645_10003906
2663 Ga0207643_10279642
2664 Ga0207705_10083804
2665 Ga0207705_10131147
2666 Ga0207654_10016215
2667 Ga0207654_10027426
2668 Ga0207707_10031203
2669 Ga0207707_10035167
2670 Ga0207707_10195214
2671 Ga0207707_10446812
2672 Ga0207707_10495256
2673 Ga0207695_10036226
2674 Ga0207695_10066978
2675 Ga0207695_10525352
2676 Ga0207671_10092761
2677 Ga0207693_10000072
2678 Ga0207693_10132586
2679 Ga0207693_10138548
2680 Ga0207663_10002680
2681 Ga0207663_10024904
2682 Ga0207663_10078860
2683 Ga0207663_10246005
2684 Ga0207660_10091094
2685 Ga0207660_10113833
2686 Ga0207660_10473766
2687 Ga0207660_10560694
2688 Ga0207662_10000313
2689 Ga0207662_10041438
2690 Ga0207662_10128287
2691 Ga0207662_10311449
2692 Ga0207657_10000027
2693 Ga0207657_10014193
2694 Ga0207657_10179129
2695 Ga0207649_10001170
2696 Ga0207652_10040020
2697 Ga0207652_10092944
2698 Ga0207652_10097708
2699 Ga0207652_10176198
2700 Ga0207652_10189606
2701 Ga0207646_10657379
2702 Ga0207681_10004087
2703 Ga0207681_10347388
2704 Ga0207694_10412490
2705 Ga0207650_10017887
2706 Ga0207650_10049224
2707 Ga0207650_10428809
2708 Ga0207659_10025409
2709 Ga0207659_10037274
2710 Ga0207687_10018279
2711 Ga0207687_10027057
2712 Ga0207687_10060913
2713 Ga0207687_10536755
2714 Ga0207700_10240244
2715 Ga0207700_10490004
2716 Ga0207664_10064083
2717 Ga0207664_10216951
2718 Ga0207664_10372458
2719 Ga0207644_10095577
2720 Ga0207644_10752778
2721 Ga0207690_10036854
2722 Ga0207690_10079138
2723 Ga0207706_10000039
2724 Ga0207706_10006559
2725 Ga0207706_10073665
2726 Ga0207686_10002173
2727 Ga0207686_10006573
2728 Ga0207709_10008225
2729 Ga0207709_10101691
2730 Ga0207709_10109068
2731 Ga0207709_10199474
2732 Ga0207709_10209935
2733 Ga0207709_10379048
2734 Ga0207670_10004298
2735 Ga0207670_10011443
2736 Ga0207670_10027929
2737 Ga0207669_10041228
2738 Ga0207669_10071562
2739 Ga0207704_10007409
2740 Ga0207704_10046720
2741 Ga0207665_10000076
2742 Ga0207665_10073227
2743 Ga0207665_10175730
2744 Ga0207691_10001122
2745 Ga0207691_10003280
2746 Ga0207691_10028245
2747 Ga0207691_10221540
2748 Ga0207711_10010943
2749 Ga0207711_10036519
2750 Ga0207711_10308962
2751 Ga0207689_10004525
2752 Ga0207689_10020242
2753 Ga0207679_10005429
2754 Ga0207667_10305562
2755 Ga0207667_10354707
2756 Ga0207651_10021496
2757 Ga0207651_10377593
2758 Ga0207712_10174874
2759 Ga0207712_10420817
2760 Ga0207668_10000911
2761 Ga0207668_10052938
2762 Ga0207668_10130278
2763 Ga0207668_10351041
2764 Ga0207668_10534239
2765 Ga0207640_10002505
2766 Ga0207640_10008447
2767 Ga0207658_10018968
2768 Ga0207658_10075213
2769 Ga0207658_10299397
2770 Ga0207658_10468936
2771 Ga0207677_10002744
2772 Ga0207677_10063982
2773 Ga0207677_10272482
2774 Ga0207703_10014165
2775 Ga0207703_10022449
2776 Ga0207703_10024059
2777 Ga0207703_10025864
2778 Ga0207639_10018747
2779 Ga0207639_10050625
2780 Ga0207639_10093002
2781 Ga0207639_10126557
2782 Ga0207639_10181198
2783 Ga0207639_10252540
2784 Ga0207639_10691810
2785 Ga0207678_10000034
2786 Ga0207678_10000098
2787 Ga0207678_10012927
2788 Ga0207678_10026827
2789 Ga0207678_10062963
2790 Ga0207678_10321104
2791 Ga0207678_10379037
2792 Ga0207678_10417385
2793 Ga0207708_10000351
2794 Ga0207708_10002109
2795 Ga0207708_10008714
2796 Ga0207708_10057680
2797 Ga0207708_10267251
2798 Ga0207708_10304078
2799 Ga0207708_10329468
2800 Ga0207708_10705305
2801 Ga0207702_10063631
2802 Ga0207702_10829747
2803 Ga0207641_10014819
2804 Ga0207641_10056855
2805 Ga0207641_10121619
2806 Ga0207641_10207084
2807 Ga0207648_10023624
2808 Ga0207648_10085717
2809 Ga0207648_10462568
2810 Ga0207648_10790025
2811 Ga0207648_10841251
2812 Ga0207676_10008149
2813 Ga0207676_10013451
2814 Ga0207676_10096940
2815 Ga0207676_10134988
2816 Ga0207676_10148084
2817 Ga0207674_10000154
2818 Ga0207674_10006620
2819 Ga0207674_10122740
2820 Ga0207674_10843174
2821 Ga0207675_100000968
2822 Ga0207675_100002046
2823 Ga0207675_100005541
2824 Ga0207675_100118295
2825 Ga0207675_100212798
2826 Ga0207675_100257805
2827 Ga0207675_100307605
2828 Ga0207675_100409846
2829 Ga0207675_100621576
2830 Ga0207683_10000318
2831 Ga0207683_10007512
2832 Ga0207683_10013041
2833 Ga0207683_10154726
2834 Ga0207698_10048248
2835 Ga0207698_10085915
2836 Ga0207698_10201756
2837 Ga0207698_10746327
2838 Ga0209281_1000128
2839 Ga0209589_1000109
2840 Ga0209489_100324
2841 Ga0209700_100355
2842 Ga0209282_1000034
2843 Ga0209813_10004777
2844 Ga0209813_10005909
2845 Ga0209813_10013465
2846 Ga0207428_10005134
2847 Ga0207428_10024682
2848 Ga0207428_10447232
2849 Ga0268266_10045688
2850 Ga0268266_10046654
2851 Ga0268266_10047527
2852 Ga0268266_10174209
2853 Ga0268266_10515280
2854 Ga0268266_10558110
2855 Ga0268266_10619889
2856 Ga0268265_10000953
2857 Ga0268265_10006463
2858 Ga0268265_10055081
2859 Ga0268264_10021041
2860 Ga0268264_10023542
2861 Ga0268264_10049360
2862 Ga0268264_10053666
2863 Ga0268264_10142210
2864 Ga0268264_10211642
2865 Ga0268264_10217171
2866 Ga0268264_10274210
2867 Ga0265337_1002458
2868 Ga0265326_10002501
2869 Ga0265319_1001332
2870 Ga0265319_1052270
2871 Ga0265334_10003334
2872 Ga0265323_10001242
2873 Ga0265322_10004943
2874 Ga0265336_10000759
2875 Ga0307517_10128077
2876 Ga0265338_10000013
2877 Ga0265338_10044403
2878 Ga0311001_1005417
2879 Ga0265324_10002070
2880 Ga0265332_10001497
2881 Ga0265332_10040356
2882 Ga0265328_10038517
2883 Ga0265320_10045755
2884 Ga0265325_10002054
2885 Ga0265325_10059310
2886 Ga0265325_10067459
2887 Ga0265325_10073588
2888 Ga0265325_10076394
2889 Ga0265329_10026525
2890 Ga0265340_10000092
2891 Ga0265340_10000387
2892 Ga0265340_10007981
2893 Ga0265340_10008859
2894 Ga0265340_10012700
2895 Ga0265339_10002236
2896 Ga0265339_10003394
2897 Ga0265339_10089342
2898 Ga0265339_10119703
2899 Ga0265331_10035492
2900 Ga0265316_10003669
2901 Ga0265316_10159731
2902 Ga0265316_10175508
2903 Ga0265316_10208821
2904 Ga0307509_10008703
2905 Ga0307508_10014226
2906 Ga0316579_10033997
2907 Ga0265314_10024931
2908 Ga0265314_10070839
2909 Ga0265314_10080214
2910 Ga0265314_10243145
2911 Ga0265314_10289955
2912 Ga0265342_10000110
2913 Ga0265342_10024465
2914 Ga0316576_10170912
2915 Ga0316578_10089745
2916 Ga0307516_10002008
2917 Ga0307516_10037683
2918 Ga0307516_10048488
2919 Ga0315914_1000010
2920 Ga0307415_100137250
2921 Ga0307415_100653782
2922 Ga0315913_1000005
2923 Ga0315915_1000012
2924 Ga0316592_1002973
2925 Ga0316588_1000463
2926 Ga0373950_0027060
2927 Ga0373944_0054736
2928 Ga0373949_0032485
2929 Ga0373952_0019312
2930 Ga0373923_0000977
2931 Ga0373932_0016593
2932 Ga0373932_0048969
2933 Ga0373932_0126676
2934 Ga0373936_0008424
2935 Ga0373936_0038387
2936 Ga0373936_0137465
2937 Ga0373939_0028623
2938 Ga0373939_0034687
2939 Ga0373939_0077687
2940 Ga0373941_0052552
2941 Ga0373941_0117662
2942 Ga0373941_0121937
2943 Ga0373945_0037106
2944 Ga0373953_0014188
2945 Ga0373957_0044855
2946 Ga0373943_0004711
2947 Ga0373943_0011784
2948 Ga0373943_0177040
2949 Ga0373943_0206992
2950 Ga0373946_0000291
2951 Ga0373946_0022235
2952 Ga0373955_0050928
2953 Ga0373942_0018872
2954 Ga0373942_0041948
2955 Ga0373962_0004822
2956 Ga0373962_0108324
2957 Ga0373924_0011374
2958 Ga0373931_0001201
2959 Ga0373931_0004184
2960 Ga0373931_0010541
2961 Ga0373931_0046697
2962 Ga0373931_0051624
2963 Ga0373935_0006219
2964 Ga0373935_0023117
2965 Ga0373927_0007441
2966 Ga0373927_0008160
2967 Ga0373927_0040539
2968 Ga0373927_0314224
2969 Ga0373933_0017826
2970 Ga0373947_0001133
2971 Ga0373947_0006846
2972 Ga0373947_0093089
2973 Ga0373947_0249626
2974 Ga0373947_0267782
2975 Ga0373937_0000031
2976 Ga0373937_0058789
2977 Ga0373937_0480412
2978 Ga0373937_0529728
2979 Ga0373925_0000063
2980 Ga0373925_0016226
2981 Ga0373925_0029499
2982 Ga0373925_0030675
2983 Ga0373925_0109804
2984 Ga0373925_0200227
2985 Ga0395899_0000059
2986 Ga0395900_0000017
2987 Ga0395900_0030214
2988 Ga0395900_0155881
2989 Ga0395900_0187810
2990 Ga0395898_0000030
2991 Ga0395898_0013945
2992 Ga0395898_0014421
2993 Ga0395898_0169502
2994 Ga0395905_0000056
2995 Ga0395905_0000553
2996 Ga0395905_0048020
2997 Ga0395905_0133490
2998 Ga0395905_0212066
2999 Ga0395905_0274356
3000 Ga0395905_0431606
3001 Ga0436364_0275973
3002 Ga0436364_0499842
3003 Ga0436364_0702728
3004 Ga0436364_0821808
3005 Ga0436364_1163562
3006 Ga0436364_1172199
3007 Ga0436364_1338890
3008 Ga0395901_0000015
3009 Ga0395901_0055418
3010 Ga0395901_0082529
3011 Ga0395901_0105451
3012 Ga0395901_0540556
3013 Ga0242420_022981
3014 Ga0237816_00384
3015 Ga0436365_0125505
3016 Ga0436365_0235359
3017 Ga0436365_0247443
3018 Ga0436365_0443046
3019 Ga0436365_0876105
3020 Ga0436365_1009793
3021 Ga0436365_1031004
3022 Ga0436365_1620828
3023 Ga0436360_0612193
3024 Ga0436360_1365466
3025 Ga0436361_0333837
3026 Ga0436361_1169094
3027 Ga0436361_1179362
3028 Ga0436363_0745057
3029 Ga0436363_0845878
3030 Ga0436363_1374215
3031 Ga0436363_1425116
3032 Ga0436363_1588421
3033 Ga0436363_1691519
3034 Ga0436362_0936835
3035 Ga0436362_0983745
3036 Ga0439433_0015502
3037 Ga0439451_009314
3038 Ga0450889_001635
3039 Ga0439435_0013585
3040 Ga0439444_0006155
3041 Ga0439460_0038896
3042 Ga0439440_0070336
3043 Ga0466966_0014115
3044 Ga0466960_0226163
3045 Ga0466959_0014113
3046 Ga0466959_0286409
3047 Ga0466958_0011243
3048 Ga0466967_0349558
3049 Ga0495592_0000072
3050 Ga0495592_0035668
3051 Ga0495603_0000872
3052 Ga0495603_0030425
3053 Ga0495603_0035030
3054 Ga0495590_0129834
3055 Ga0495629_0013500
3056 Ga0495629_0031933
3057 Ga0495629_0129920
3058 Ga0495629_0213149
3059 Ga0495629_0255501
3060 Ga0495641_0084465
3061 Ga0495651_0000595
3062 Ga0495651_0321323
3063 Ga0495651_0341694
3064 Ga0495653_0000020
3065 Ga0495653_0080502
3066 Ga0495580_0002021
3067 Ga0495580_0008232
3068 Ga0495580_0040401
3069 Ga0495580_0066496
3070 Ga0495582_0009149
3071 Ga0495582_0014054
3072 Ga0495582_0043622
3073 Ga0495605_0014755
3074 Ga0495639_0001587
3075 Ga0495639_0228104
3076 Ga0495662_0058783
3077 Ga0495664_0000006
3078 Ga0495664_0071738
3079 Ga0495584_0012859
3080 Ga0495584_0044716
3081 Ga0495584_0110763
3082 Ga0495594_0003039
3083 Ga0495596_0085134
3084 Ga0495583_0035766
3085 Ga0495608_0000002
3086 Ga0495616_0061849
3087 Ga0495618_0000017
3088 Ga0495628_0000004
3089 Ga0495628_0058832
3090 Ga0495628_0121517
3091 Ga0495628_0462378
3092 Ga0495630_0001747
3093 Ga0495630_0083557
3094 Ga0495630_0359047
3095 Ga0495631_0037033
3096 Ga0495637_0032744
3097 Ga0495648_0012530
3098 Ga0495652_0000007
3099 Ga0495652_0028570
3100 Ga0495652_0114470
3101 Ga0495665_0004975
3102 Ga0495665_0034806
3103 Ga0495640_0000004
3104 Ga0495587_0000002
3105 Ga0495609_0089866
3106 Ga0495645_0000008
3107 Ga0495622_0002253
3108 Ga0495622_0004419
3109 Ga0495622_0018640
3110 Ga0495622_0043283
3111 Ga0495622_0111601
3112 Ga0495667_0000010
3113 Ga0495667_0026144
3114 Ga0495656_0086783
3115 Ga0495656_0161507
3116 Ga0495656_0231568
3117 Ga0495668_0064356
3118 Ga0495668_0265588
3119 Ga0495634_0000001
3120 Ga0495634_0001869
3121 Ga0495634_0074172
3122 Ga0495634_0095237
3123 Ga0495611_0132880
3124 Ga0495625_0146735
3125 Ga0495635_0000004
3126 Ga0495635_0032326
3127 Ga0495661_0074097
3128 Ga0495661_0219838
3129 Ga0495588_0002382
3130 Ga0495588_0065551
3131 Ga0495657_0000265
3132 Ga0495657_0027279
3133 Ga0495657_0073609
3134 Ga0495599_0000003
3135 Ga0495599_0061749
3136 Ga0495623_0000009
3137 Ga0495646_0000001
3138 Ga0495647_0062155
3139 Ga0495658_0001840
3140 Ga0495658_0031541
3141 Ga0495658_0048625
3142 Ga0495658_0098402
3143 Ga0495658_0118172
3144 Ga0495658_0206799
3145 Ga0495613_0006074
3146 Ga0495613_0041421
3147 Ga0495613_0260116
3148 Ga0495613_0276643
3149 Ga0495624_0030783
3150 Ga0495624_0077669
3151 Ga0495649_0044888
3152 Ga0495649_0069411
3153 Ga0495589_0067982
3154 Ga0495589_0104639
3155 Ga0495600_0000008
3156 Ga0495600_0010717
3157 Ga0495600_0041579
3158 Ga0495581_0005894
3159 Ga0495604_0000003
3160 Ga0495604_0013870
3161 Ga0495604_0029289
3162 Ga0495604_0069459
3163 Ga0495604_0235417
3164 Ga0495674_0000021
3165 Ga0495674_0024249
3166 Ga0495674_0048481
3167 Ga0495674_0085431
3168 Ga0495674_0405671
3169 Ga0495672_0026399
3170 Ga0495676_0034639
3171 Ga0495676_0070430
3172 Ga0495676_0107454
3173 Ga0495676_0244250
3174 Ga0495676_0307605
3175 Ga0495680_0000552
3176 Ga0495680_0078439
3177 Ga0495683_0012510
3178 Ga0495687_020145
3179 Ga0495675_0000581
3180 Ga0495673_0035805
3181 Ga0495684_0000003
3182 Ga0495684_0065541
3183 Ga0495686_0041614
3184 Ga0495686_0193035
3185 Ga0495686_0194100
3186 Ga0495593_0000179
3187 Ga0495593_0003265
3188 Ga0495593_0227661
3189 Ga0495593_0234678
3190 Ga0495602_0000012
3191 Ga0495602_0018907
3192 Ga0495602_0299980
3193 Ga0495602_0302882
3194 Ga0495615_0016519
3195 Ga0495626_0027147
3196 Ga0495626_0089816
3197 Ga0496100_0008478
3198 Ga0496100_0010401
3199 Ga0496100_0012941
3200 Ga0496100_0017404
3201 Ga0496100_0024025
3202 Ga0496100_0027348
3203 Ga0496100_0158517
3204 Ga0496100_0249214
3205 Ga0496100_0644846
3206 Ga0496101_0010920
3207 Ga0496101_0027095
3208 Ga0496101_0033222
3209 Ga0496101_0046917
3210 Ga0496101_0086815
3211 Ga0496101_0090509
3212 Ga0496101_0109979
3213 Ga0496101_0126850
3214 Ga0496101_0169733
3215 Ga0496101_0530890
3216 Ga0496102_0004821
3217 Ga0496102_0011587
3218 Ga0496102_0014879
3219 Ga0496102_0023806
3220 Ga0496102_0024872
3221 Ga0496102_0025489
3222 Ga0496102_0034651
3223 Ga0496102_0077614
3224 Ga0496102_0106937
3225 Ga0496102_0120995
3226 Ga0496102_0618109
3227 Ga0496103_0010759
3228 Ga0496103_0015362
3229 Ga0496103_0017250
3230 Ga0496103_0030461
3231 Ga0496103_0044726
3232 Ga0496103_0053127
3233 Ga0496103_0139030
3234 Ga0496104_0000080
3235 Ga0496104_0000149
3236 Ga0496104_0000279
3237 Ga0496104_0001052
3238 Ga0496104_0009332
3239 Ga0496104_0016854
3240 Ga0496104_0016989
3241 Ga0496104_0025519
3242 Ga0496104_0044083
3243 Ga0496104_0051156
3244 Ga0496104_0064234
3245 Ga0496104_0118303
3246 Ga0496104_0124202
3247 Ga0496104_0200303
3248 Ga0496105_0000052
3249 Ga0496105_0000272
3250 Ga0496105_0009202
3251 Ga0496105_0015532
3252 Ga0496105_0022029
3253 Ga0496105_0027606
3254 Ga0496105_0033734
3255 Ga0496105_0058309
3256 Ga0496105_0061825
3257 Ga0496105_0082323
3258 Ga0496105_0086293
3259 Ga0496105_0269455
3260 Ga0496105_0304496
3261 Ga0496105_0420974
3262 Ga0496106_0000854
3263 Ga0496106_0002017
3264 Ga0496106_0003517
3265 Ga0496106_0010756
3266 Ga0496106_0012358
3267 Ga0496106_0012742
3268 Ga0496106_0025337
3269 Ga0496106_0040891
3270 Ga0496106_0073437
3271 Ga0496106_0089094
3272 Ga0496106_0100196
3273 Ga0496106_0151879
3274 Ga0496106_0263565
3275 Ga0496106_0446107
3276 Ga0496107_0000548
3277 Ga0496107_0003678
3278 Ga0496107_0008310
3279 Ga0496107_0008765
3280 Ga0496107_0011962
3281 Ga0496107_0012866
3282 Ga0496107_0017790
3283 Ga0496107_0017891
3284 Ga0496107_0052669
3285 Ga0496107_0057487
3286 Ga0496107_0103731
3287 Ga0496107_0211317
3288 Ga0496107_0263517
3289 Ga0496107_0339092
3290 Ga0496107_0379097
3291 Ga0496108_0000625
3292 Ga0496108_0045486
3293 Ga0496108_0045705
3294 Ga0496108_0064682
3295 Ga0496108_0071113
3296 Ga0496108_0076414
3297 Ga0496108_0076676
3298 Ga0496108_0105961
3299 Ga0496108_0122073
3300 Ga0496108_0362267
3301 Ga0496109_0001375
3302 Ga0496109_0075473
3303 Ga0496109_0088197
3304 Ga0496109_0101494
3305 Ga0496109_0128441
3306 Ga0496109_0143356
3307 Ga0496109_0145078
3308 Ga0496109_0187784
3309 Ga0496109_0419893
3310 Ga0496109_0503483
3311 Ga0496110_0001079
3312 Ga0496110_0005932
3313 Ga0496110_0010159
3314 Ga0496110_0011880
3315 Ga0496110_0025085
3316 Ga0496110_0026794
3317 Ga0496110_0036438
3318 Ga0496110_0044969
3319 Ga0496110_0046494
3320 Ga0496110_0212192
3321 Ga0496110_0225184
3322 Ga0496110_0386129
3323 Ga0496110_0446990
3324 Ga0496110_0822528
3325 Ga0496111_0001188
3326 Ga0496111_0001541
3327 Ga0496111_0011957
3328 Ga0496111_0014085
3329 Ga0496111_0015529
3330 Ga0496111_0130861
3331 Ga0496111_0171028
3332 Ga0496111_0258619
3333 Ga0496112_0002410
3334 Ga0496112_0010794
3335 Ga0496112_0039568
3336 Ga0496112_0050078
3337 Ga0496112_0057434
3338 Ga0496112_0068331
3339 Ga0496112_0076393
3340 Ga0496112_0090183
3341 Ga0496112_0106746
3342 Ga0496112_0118913
3343 Ga0496112_0141664
3344 Ga0496113_0000087
3345 Ga0496113_0001148
3346 Ga0496113_0008398
3347 Ga0496113_0011985
3348 Ga0496113_0015454
3349 Ga0496113_0020844
3350 Ga0496113_0030815
3351 Ga0496113_0103608
3352 Ga0496113_0283710
3353 Ga0496113_0404113
3354 Ga0496113_0658383
3355 Ga0496114_0029790
3356 Ga0496114_0031434
3357 Ga0496114_0070514
3358 Ga0496114_0074061
3359 Ga0496114_0094884
3360 Ga0496114_0108867
3361 Ga0496114_0142382
3362 Ga0496114_0430736
3363 Ga0496114_0593412
3364 Ga0496115_0006310
3365 Ga0496115_0011417
3366 Ga0496115_0022102
3367 Ga0496115_0032978
3368 Ga0496115_0072893
3369 Ga0496115_0118662
3370 Ga0496115_0127441
3371 Ga0496115_0179324
3372 Ga0496115_0249773
3373 Ga0496115_0266743
3374 Ga0496115_0269574
3375 Ga0496115_0316442
3376 Ga0496115_0362769
3377 Ga0496115_0453805
3378 Ga0496115_0470930
3379 Ga0496116_0227582
3380 Ga0496118_0260937
3381 Ga0496119_0000898
3382 Ga0496119_0009306
3383 Ga0496119_0012124
3384 Ga0496119_0014229
3385 Ga0496119_0139992
3386 Ga0496120_0011646
3387 Ga0496120_0057874
3388 Ga0496121_0006038
3389 Ga0496121_0067741
3390 Ga0496122_0000399
3391 Ga0496122_0218868
3392 Ga0496123_0003753
3393 Ga0496123_0057939
3394 Ga0496123_0069764
3395 Ga0496124_0030416
3396 Ga0496125_0065438
3397 Ga0496125_0072523
3398 Ga0496125_0162158
3399 Ga0496125_0252571
3400 Ga0496126_0003453
3401 Ga0496126_0024000
3402 Ga0496126_0038264
3403 Ga0496126_0043355
3404 Ga0496126_0105456
3405 Ga0501031_0000018
3406 Ga0501031_0046757
3407 Ga0501031_0053942
3408 Ga0501031_0078422
3409 Ga0501031_0091473
3410 Ga0501032_0000031
3411 Ga0501032_0000201
3412 Ga0501032_0013095
3413 Ga0501032_0101147
3414 Ga0501032_0114842
3415 Ga0501032_0255155
3416 Ga0501032_0264440
3417 Ga0501033_0000126
3418 Ga0501033_0000328
3419 Ga0501033_0006625
3420 Ga0501033_0009424
3421 Ga0501033_0018584
3422 Ga0501033_0019815
3423 Ga0501033_0025403
3424 Ga0501033_0052548
3425 Ga0501033_0105997
3426 Ga0501033_0316847
3427 Ga0501034_0000005
3428 Ga0501034_0000064
3429 Ga0501034_0000076
3430 Ga0501034_0009541
3431 Ga0501034_0021935
3432 Ga0501034_0054192
3433 Ga0501034_0147647
3434 Ga0501034_0284559
3435 Ga0501034_0346887
3436 Ga0501034_0489622
3437 Ga0501036_0000005
3438 Ga0501036_0005686
3439 Ga0501036_0005749
3440 Ga0501036_0070327
3441 Ga0501036_0079858
3442 Ga0501036_0154955
3443 Ga0501036_0262175
3444 Ga0501036_0297434
3445 Ga0501036_0517530
3446 Ga0501037_0000045
3447 Ga0501037_0002164
3448 Ga0501037_0003332
3449 Ga0501037_0005389
3450 Ga0501037_0005524
3451 Ga0501037_0083410
3452 Ga0501037_0226391
3453 Ga0501037_0434533
3454 Ga0501038_0000001
3455 Ga0501038_0000205
3456 Ga0501038_0015483
3457 Ga0501038_0053176
3458 Ga0501038_0062717
3459 Ga0501038_0071835
3460 Ga0501038_0139198
3461 Ga0501038_0149467
3462 Ga0501038_0175311
3463 Ga0501038_0289319
3464 Ga0501038_0307398
3465 Ga0501038_0388240
3466 Ga0501039_0000007
3467 Ga0501039_0000105
3468 Ga0501039_0002792
3469 Ga0501039_0008466
3470 Ga0501039_0012743
3471 Ga0501039_0060468
3472 Ga0501039_0113942
3473 Ga0501039_0160710
3474 Ga0501039_0188883
3475 Ga0501039_0398430
3476 Ga0501040_0026013
3477 Ga0501040_0029852
3478 Ga0501040_0052412
3479 Ga0501040_0098807
3480 Ga0501040_0128627
3481 Ga0501040_0132300
3482 Ga0501040_0148742
3483 Ga0501040_0282644
3484 Ga0501041_0024244
3485 Ga0501041_0055484
3486 Ga0501041_0063423
3487 Ga0501041_0074071
3488 Ga0501041_0187157
3489 Ga0501042_0007562
3490 Ga0501042_0042178
3491 Ga0501042_0049320
3492 Ga0501042_0057666
3493 Ga0501042_0206237
3494 Ga0501042_0298318
3495 Ga0501042_0438440
3496 Ga0501043_0000015
3497 Ga0501043_0000107
3498 Ga0501043_0056281
3499 Ga0501043_0079453
3500 Ga0501043_0232884
3501 Ga0501043_0288373
3502 Ga0501043_0348444
3503 Ga0501043_0437769
3504 Ga0501043_0485698
3505 Ga0501046_0001416
3506 Ga0501046_0006723
3507 Ga0501046_0009778
3508 Ga0501046_0015459
3509 Ga0501046_0032371
3510 Ga0501046_0071334
3511 Ga0501046_0074334
3512 Ga0501046_0109985
3513 Ga0501046_0133453
3514 Ga0501046_0202364
3515 Ga0501046_0236924
3516 Ga0501047_0000749
3517 Ga0501047_0020996
3518 Ga0501047_0059969
3519 Ga0501047_0083424
3520 Ga0501047_0140646
3521 Ga0501047_0149101
3522 Ga0501047_0154243
3523 Ga0501047_0316422
3524 Ga0501047_0422943
3525 Ga0501048_0001563
3526 Ga0501048_0021329
3527 Ga0501048_0068570
3528 Ga0501048_0120298
3529 Ga0501048_0182528
3530 Ga0501048_0365788
3531 Ga0501067_0000091
3532 Ga0501067_0003300
3533 Ga0501067_0011645
3534 Ga0501067_0022295
3535 Ga0501067_0023338
3536 Ga0501067_0066765
3537 Ga0501067_0244369
3538 Ga0501068_0002658
3539 Ga0501068_0111995
3540 Ga0501068_0149164
3541 Ga0501069_0000039
3542 Ga0501069_0006899
3543 Ga0501069_0011283
3544 Ga0501069_0121149
3545 Ga0501069_0143401
3546 Ga0501069_0154645
3547 Ga0501069_0167243
3548 Ga0501069_0344466
3549 Ga0501070_0000132
3550 Ga0501070_0000299
3551 Ga0501070_0002117
3552 Ga0501070_0017763
3553 Ga0501070_0072038
3554 Ga0501070_0155983
3555 Ga0501070_0159579
3556 Ga0501070_0174991
3557 Ga0501070_0202340
3558 Ga0501070_0210840
3559 Ga0501070_0298993
3560 Ga0501070_0350415
3561 Ga0501071_0009502
3562 Ga0501071_0059576
3563 Ga0501071_0069731
3564 Ga0501071_0102429
3565 Ga0501071_0232297
3566 Ga0501071_0238034
3567 Ga0501071_0489398
3568 Ga0501072_0042737
3569 Ga0501072_0050121
3570 Ga0501072_0101090
3571 Ga0501072_0204696
3572 Ga0501072_0269426
3573 Ga0501072_0324779
3574 Ga0501072_0425513
3575 Ga0501073_0000011
3576 Ga0501073_0023740
3577 Ga0501073_0042848
3578 Ga0501073_0074563
3579 Ga0501073_0129836
3580 Ga0501073_0165808
3581 Ga0501073_0246409
3582 Ga0501074_0029210
3583 Ga0501074_0105413
3584 Ga0501074_0153177
3585 Ga0501074_0195871
3586 Ga0501074_0209210
3587 Ga0501074_0367637
3588 Ga0501075_0011328
3589 Ga0501075_0071281
3590 Ga0501075_0114157
3591 Ga0501075_0129483
3592 Ga0501075_0147766
3593 Ga0501075_0182438
3594 Ga0501076_0020611
3595 Ga0501076_0025189
3596 Ga0501076_0031924
3597 Ga0501076_0047363
3598 Ga0501076_0076567
3599 Ga0501076_0077646
3600 Ga0501076_0084120
3601 Ga0501076_0132547
3602 Ga0501076_0272820
3603 Ga0501076_0465036
3604 Ga0501077_0000011
3605 Ga0501077_0007078
3606 Ga0501077_0007395
3607 Ga0501077_0010077
3608 Ga0501077_0013376
3609 Ga0501077_0032924
3610 Ga0501077_0032975
3611 Ga0501077_0075545
3612 Ga0501077_0113740
3613 Ga0501077_0114634
3614 Ga0501077_0282502
3615 Ga0501079_0024804
3616 Ga0501079_0046675
3617 Ga0501079_0051845
3618 Ga0501079_0070038
3619 Ga0501079_0152991
3620 Ga0501079_0202415
3621 Ga0501079_0269421
3622 Ga0501079_0312226
3623 Ga0501079_0318913
3624 Ga0501079_0378459
3625 Ga0501080_0000004
3626 Ga0501080_0001484
3627 Ga0501080_0003023
3628 Ga0501080_0013324
3629 Ga0501080_0055277
3630 Ga0501080_0125630
3631 Ga0501080_0128121
3632 Ga0501080_0212342
3633 Ga0501080_0221725
3634 Ga0501080_0254450
3635 Ga0501080_0287134
3636 Ga0501080_0443696
3637 Ga0501081_0004485
3638 Ga0501081_0007228
3639 Ga0501081_0180358
3640 Ga0501081_0186404
3641 Ga0501081_0219637
3642 Ga0501081_0387631
3643 Ga0501081_0572578
3644 Ga0501083_0007222
3645 Ga0501083_0011832
3646 Ga0501083_0042437
3647 Ga0501083_0166039
3648 Ga0501083_0234010
3649 Ga0501035_0000008
3650 Ga0501035_0000055
3651 Ga0501035_0000272
3652 Ga0501035_0000436
3653 Ga0501035_0000807
3654 Ga0501035_0002108
3655 Ga0501035_0011205
3656 Ga0501035_0072735
3657 Ga0501035_0076459
3658 Ga0501035_0103199
3659 Ga0501035_0147493
3660 Ga0501035_0147623
3661 Ga0501035_0214906
3662 Ga0501035_0348481
3663 Ga0501035_0448309
3664 Ga0501035_0770353
3665 Ga0501044_0000001
3666 Ga0501044_0000007
3667 Ga0501044_0000071
3668 Ga0501044_0004447
3669 Ga0501044_0005930
3670 Ga0501044_0015843
3671 Ga0501044_0024335
3672 Ga0501044_0077649
3673 Ga0501044_0089138
3674 Ga0501044_0089954
3675 Ga0501044_0094218
3676 Ga0501044_0119737
3677 Ga0501044_0134921
3678 Ga0501044_0164592
3679 Ga0501044_0209839
3680 Ga0501044_0465092
3681 Ga0501044_0531803
3682 Ga0501044_0549580
3683 Ga0501044_0818935
3684 Ga0501045_0059098
3685 Ga0501045_0072997
3686 Ga0501045_0116382
3687 Ga0501045_0117374
3688 Ga0501045_0159776
3689 Ga0501045_0187914
3690 Ga0501045_0257986
3691 nmdc:mga03683_12592_c1
3692 nmdc:mga03683_12819_c1
3693 nmdc:mga03683_929_c1
3694 nmdc:mga03n38_168019_c1
3695 nmdc:mga03n38_696_c1
3696 nmdc:mga03n38_80019_c1
3697 nmdc:mga03n38_89094_c1
3698 nmdc:mga00v17_83626_c1
3699 nmdc:mga00v17_89517_c1
3700 nmdc:mga00v17_9731_c1
3701 nmdc:mga0yw44_23765_c1
3702 nmdc:mga0yw44_25254_c1
3703 nmdc:mga0yw44_303901_c1
3704 nmdc:mga0yw44_386906_c1
3705 nmdc:mga0yw44_6095_c1
3706 nmdc:mga0yw44_78671_c1
3707 nmdc:mga0yw44_80069_c1
3708 nmdc:mga0k408_1244_c1
3709 nmdc:mga0k408_13616_c1
3710 nmdc:mga06z11_122402_c1
3711 nmdc:mga06z11_1333_c1
3712 nmdc:mga06z11_2154_c1
3713 nmdc:mga06z11_312244_c1
3714 nmdc:mga06z11_4896_c1
3715 nmdc:mga06z11_8900_c1
3716 nmdc:mga04h51_12706_c1
3717 nmdc:mga04h51_9040_c1
3718 nmdc:mga04h51_9274_c1
3719 nmdc:mga07m45_47150_c2
3720 nmdc:mga05p37_166313_c1
3721 nmdc:mga05p37_363778_c1
3722 nmdc:mga05p37_505050_c1
3723 nmdc:mga05p37_615_c1
3724 nmdc:mga09592_2442_c1
3725 nmdc:mga09592_41347_c1
3726 nmdc:mga09592_494138_c1
3727 nmdc:mga0qj67_204464_c1
3728 nmdc:mga0qj67_414859_c1
3729 nmdc:mga0qj67_54957_c1
3730 nmdc:mga0qj67_646139_c1
3731 nmdc:mga0qj67_65917_c2
3732 nmdc:mga0qj67_85110_c1
3733 nmdc:mga06r32_111265_c1
3734 nmdc:mga06r32_25081_c1
3735 nmdc:mga06r32_2964_c1
3736 nmdc:mga06r32_489150_c1
3737 nmdc:mga06r32_54034_c1
3738 nmdc:mga06r32_67561_c1
3739 nmdc:mga06r32_95_c1
3740 nmdc:mga08y16_145341_c1
3741 nmdc:mga08y16_20535_c1
3742 nmdc:mga08y16_464415_c1
3743 nmdc:mga08y16_507_c1
3744 nmdc:mga08y16_573813_c1
3745 nmdc:mga08y16_680302_c1
3746 nmdc:mga0n895_178050_c1
3747 nmdc:mga0n895_44054_c1
3748 nmdc:mga0n895_80375_c1
3749 nmdc:mga0n895_8526_c1
3750 nmdc:mga0rr50_55543_c1
3751 nmdc:mga0rr50_563129_c1
3752 nmdc:mga0rr50_610187_c1
3753 nmdc:mga0rr50_8626_c1
3754 nmdc:mga08x19_10184_c1
3755 nmdc:mga08x19_4_c2
3756 nmdc:mga08x19_79452_c1
3757 nmdc:mga08x19_9189_c1
3758 nmdc:mga0a205_371719_c1
3759 nmdc:mga0a205_77637_c1
3760 nmdc:mga0sz30_26781_c1
3761 Ga0495601_0000004
3762 Ga0495601_0014727
3763 Ga0495601_0015682
3764 Ga0495601_0071357
3765 Ga0495601_0160204
3766 Ga0495601_0204695
3767 Ga0495612_0000013
3768 Ga0495655_0000576
3769 Ga0495655_0001905
3770 Ga0495595_0000057
3771 Ga0495595_0051362
3772 Ga0495619_0000005
3773 Ga0495619_0000852
3774 Ga0495619_0004963
3775 Ga0495619_0016894
3776 Ga0495619_0036371
3777 Ga0495619_0106040
3778 Ga0495619_0318658
3779 Ga0500566_0012676
3780 Ga0500566_0100630
3781 Ga0500556_0040318
3782 Ga0500593_002987
3783 Ga0500595_026436
3784 Ga0500595_029415
3785 Ga0500595_038229
3786 Ga0500595_059747
3787 Ga0500618_000106
3788 Ga0500652_000003
3789 Ga0500658_0182122
3790 Ga0500559_0012340
3791 Ga0500559_0101671
3792 Ga0500568_0000118
3793 Ga0500577_0052068
3794 Ga0500604_0046995
3795 Ga0500616_0021703
3796 Ga0500616_0066140
3797 Ga0500616_0068405
3798 Ga0500616_0121611
3799 Ga0500620_089104
3800 Ga0500622_0020243
3801 Ga0500638_106305
3802 Ga0500639_065573
3803 Ga0500636_0017572
3804 Ga0500636_0040856
3805 Ga0500636_0176452
3806 Ga0500637_0100355
3807 Ga0500637_0116846
3808 Ga0501084_0011545
3809 Ga0501084_0035585
3810 Ga0501084_0046352
3811 Ga0501084_0048945
3812 Ga0501084_0058411
3813 Ga0501084_0135262
3814 Ga0501084_0144960
3815 Ga0501084_0199231
3816 Ga0590071_045141
3817 Ga0501082_0007486
3818 Ga0501082_0009497
3819 Ga0501082_0029330
3820 Ga0501082_0038675
3821 Ga0501082_0046340
3822 Ga0501082_0084979
3823 Ga0501082_0085974
3824 Ga0501082_0099623
3825 Ga0501082_0129782
3826 Ga0501082_0230082
3827 Ga0501082_0307887
3828 Ga0501082_0360340
3829 Ga0501082_0416936
3830 Ga0501082_0617704
3831 Ga0530510_0009644
3832 Ga0530510_0049645
3833 Ga0530510_0072704
3834 Ga0530510_0088628
3835 Ga0530510_0090621
3836 Ga0530510_0090629
3837 Ga0530510_0255782
3838 Ga0530510_0266714
3839 Ga0530510_0279450
3840 2503202882
3841 2508726744
3842 2509115392
3843 2509143731
3844 2509372288
3845 2509397373
3846 2510317812
3847 2512930344
3848 2512958061
3849 2512971345
3850 2513590728
3851 2513604055
3852 2513610042
3853 2513987397
3854 2514006281
3855 2514032800
3856 2514422589
3857 2514588760
3858 2517569772
3859 2563064599
3860 2588515957
3861 2597814513
3862 2599938199
3863 2600193305
3864 2643770546
3865 2643774975
3866 2643793419
3867 2643840650
3868 2643989643
3869 2644107916
3870 2644130094
3871 2644148411
3872 2644157733
3873 2644309310
3874 2644333137
3875 2644545691
3876 2644615252
3877 2644673557
3878 2644735692
3879 2657683880
3880 2688599742
3881 2694630586
3882 2694639356
3883 2713472907
3884 2723576506
3885 2739308867
3886 2753359238
3887 2756676066
3888 2792582035
3889 2792619934
3890 2792639586
3891 2792748730
3892 2802719047
3893 2802727278
3894 2802732060
3895 2802738990
3896 2802744889
3897 2802752165
3898 2804752142
3899 2808940714
3900 2819718411
3901 2828308083
3902 2837680097
3903 2838078805
3904 2841740687
3905 2841761744
3906 2841912081
3907 2841922975
3908 2842339519
3909 2844007035
3910 2844015030
3911 2844104769
3912 2844167352
3913 2847676187
3914 2847692841
3915 2851184761
3916 2851247757
3917 2856315973
3918 2856324787
3919 2856333019
3920 2856339069
3921 2856346470
3922 2856356253
3923 2856368706
3924 2857350412
3925 2857374224
3926 2869167232
3927 2869176972
3928 2869237406
3929 2869247851
3930 2869251425
3931 2869266939
3932 2869272373
3933 2869281222
3934 2869291201
3935 2871433481
3936 2871440038
3937 2871444491
3938 2871455620
3939 2871463217
3940 2871472914
3941 2871476090
3942 2871487434
3943 2871495899
3944 2871503113
3945 2874105963
3946 2874114700
3947 2874119345
3948 2874126104
3949 2874134267
3950 2874141174
3951 2874153082
3952 2874160347
3953 2874165252
3954 2874170847
3955 2876368314
3956 2876371532
3957 2876384050
3958 2876392738
3959 2876394853
3960 2876400905
3961 2876408639
3962 2876419373
3963 2876425701
3964 2878040241
3965 2878742895
3966 2878751092
3967 2878753303
3968 2878767002
3969 2878774200
3970 2878776205
3971 2881152210
3972 2881156481
3973 2881168183
3974 2881847298
3975 2881857020
3976 2881864340
3977 2882633306
3978 2882915083
3979 2885310062
3980 2885316797
3981 2885326074
3982 2885329551
3983 2885349031
3984 2885352465
3985 2888340921
3986 2888348123
3987 2888356423
3988 2888393198
3989 2889011335
3990 2889016935
3991 2889793687
3992 2889919510
3993 2894818350
3994 2896390676
3995 2903452332
3996 2903495157
3997 2903503148
3998 2903513881
3999 2903527310
4000 2903531456
4001 2903548302
4002 2904661484
4003 2906313033
4004 2906325744
4005 2906328914
4006 2906356024
4007 2906368308
4008 2906374917
4009 2906382228
4010 2906391582
4011 2906397343
4012 2906406608
4013 2906410874
4014 2906416110
4015 2906432426
4016 2915651759
4017 2915981529
4018 2916066076
4019 2920766277
4020 2921255057
4021 2921261288
4022 2922136811
4023 2922157915
4024 2922165543
4025 2922177286
4026 2922183154
4027 2922191461
4028 2924715357
4029 2924724603
4030 2924732342
4031 2924734983
4032 2924741910
4033 2924754266
4034 2924757759
4035 2924765175
4036 2924780695
4037 2924789787
4038 2937025907
4039 2937032632
4040 2937038729
4041 2937079200
4042 2937086042
4043 2937820815
4044 2937827433
4045 2937836861
4046 2937854332
4047 2937864475
4048 2937873077
4049 2937879801
4050 2937893950
4051 2937974689
4052 2937988202
4053 2938002126
4054 2938021477
4055 2939670292
4056 2941503762
4057 2957381594
4058 2957400380
4059 2957442484
4060 2958037184
4061 2958046896
4062 2958067411
4063 2958076956
4064 2958086979
4065 2958098107
4066 2958106155
4067 2958111845
4068 2958122148
4069 2958126554
4070 2958135602
4071 2958146942
4072 2958160345
4073 2958172180
4074 2958185093
4075 2960597198
4076 2960631778
4077 2960687150
4078 2960699123
4079 2961083360
4080 2961116636
4081 2961131898
4082 2961138864
4083 2961170628
4084 2961177747
4085 2961184517
4086 2963648887
4087 2964620548
4088 2965025375
4089 2965027985
4090 2965032117
4091 2965050090
4092 2965065505
4093 2965090402
4094 2965103523
4095 2965112136
4096 2965121510
4097 2967687486
4098 2967729238
4099 2967757145
4100 2968003014
4101 2968003839
4102 2968019998
4103 2968084112
4104 2968095957
4105 2968099726
4106 2968112543
4107 2968121318
4108 2968130848
4109 2968179014
4110 2970029838
4111 2970105126
4112 2970125775
4113 2970146894
4114 2970473319
4115 2970495441
4116 2970510423
4117 2970514124
4118 2970532026
4119 2970532649
4120 2970545243
4121 2970552114
4122 2970561858
4123 2970595826
4124 2970620363
4125 2970632140
4126 2977532869
4127 2977548462
4128 2977822757
4129 2977833224
4130 2977849113
4131 2977851368
4132 2977864460
4133 2977872395
4134 2977874470
4135 2977905740
4136 2977909720
4137 2977917204
4138 2977926742
4139 2977936273
4140 2977948122
4141 2977952319
4142 2977961330
4143 2977979635
4144 2977992439
4145 2979712218
4146 2979750902
4147 2979770727
4148 2979777368
4149 2979781438
4150 2979794399
4151 2979815297
4152 2987637598
4153 2987650676
4154 2987653284
4155 2987666867
4156 2987667782
4157 2987675637
4158 2996310750
4159 2996340694
4160 2996348448
4161 2996351490
4162 2996389382
4163 3000138864
4164 3003933601
4165 3004170452
4166 3004195871
4167 3004201846
4168 3004206080
4169 3004215043
4170 3004222366
4171 3004236832
4172 3004241026
4173 3004250036
4174 3004274406
4175 3004278190
4176 3004295090
4177 3004339926
4178 637073339
4179 641337011
4180 643392821
4181 649874247
4182 8002285423
4183 8004001136
4184 8004302584
4185 8004315347
4186 8004364183
4187 8004374875
4188 8004394243
4189 8004399852
4190 8004446075
4191 8004638216
4192 8004642037
4193 8004695664
4194 8004713582
4195 8004719291
4196 8004729666
4197 8049294690
4198 8054558967
4199 8055622238
4200 8057530133

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

56

213

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
2zu0-assembly1.cif.gz_C crystal structure of sufc-sufd complex involved in the iron-sulfur cluster biosynthesis 0.9465 3 242
5awf-assembly1.cif.gz_D crystal structure of sufb-sufc-sufd complex from escherichia coli 0.9448 3 230
2zu0-assembly1.cif.gz_C crystal structure of sufc-sufd complex involved in the iron-sulfur cluster biosynthesis 0.9168 3 242
5awf-assembly1.cif.gz_D crystal structure of sufb-sufc-sufd complex from escherichia coli 0.9136 3 230
2d2f-assembly1.cif.gz_A crystal structure of atypical cytoplasmic abc-atpase sufc from thermus thermophilus hb8 0.8848 1 246
ID Description Score Start End Superfamily
af_Q2FZY7_2_252_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.963 2 251 3.40.50.300
af_Q8ILW0_99_346_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9236 3 240 3.40.50.300
af_Q60350_5_243_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8931 1 245 3.40.50.300
af_Q60350_5_243_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8862 1 245 3.40.50.300
af_P16676_2_258_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8854 3 231 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A838M3S9-F1-model_v4 deleted 0.8835 2 231
AF-A0A7K4CYQ9-F1-model_v4 Molybdate/tungstate import ATP-binding protein WtpC (EC 7.3.2.6) 0.88 2 231 GO:0005524
GO:0005886
GO:0015408
GO:0016887
AF-A0A2E7MAH5-F1-model_v4 ABC transporter ATP-binding protein 0.8717 3 231 GO:0005524
GO:0005886
GO:0015408
GO:0016887
AF-F0F0M3-F1-model_v4 ABC transporter, ATP-binding protein (EC 3.6.3.-) 0.8695 2 231 GO:0005524
GO:0005886
GO:0015408
GO:0016887
AF-A0A7X6Z633-F1-model_v4 Sulfate ABC transporter ATP-binding protein 0.8658 1 231 GO:0005524
GO:0015419
GO:0016887
GO:0043190

Map