F496396
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 2100 | 895 | 4200 | 250 |
Family's Representative Sequence
| Representative Sequence | 3300049575|Ga0501039_0172727|Ga0501039_0172727_437_1312 |
| Length | 291 |
| Sequence | MPGLVPGIHEFRRRSEVVDGRDKPGHDRREILEDQRNIVMLEIKNLHVNVDGREILKGLDLELPKGQVHAIMGPNGSGKSTLAYVLAGKQDYEVTAGSVTWNGQDLLAMDPSERAAAGVFLAFQYPMEIPGVATMTFLRTAANAVRKARGKPELSTPEFLRFVREKAAELKIDPEMLRRPLNVGFSGGEKKRNEILQMSLLDPSLCVLDETDSGLDIDAVRIVAEGVNALRSPDRAMLVITHYQRLLDYIVPDRVHVLSDGRVARSGGPELALELEESGYAEFEDAAGQAA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 2 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 3 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 4 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 5 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 6 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 7 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 8 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 9 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 10 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 11 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 12 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 13 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 14 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 15 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 16 | 3300003162 | Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 17 | 3300003163 | Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 18 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 19 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 20 | 3300003308 | Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 21 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 22 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 23 | 3300003574 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 24 | 3300003575 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 25 | 3300003577 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 26 | 3300003579 | Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 27 | 3300003693 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 28 | 3300003735 | Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_23 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 29 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 30 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 31 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 32 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 33 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 34 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 35 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 36 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 37 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 41 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 43 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 47 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 49 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 60 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 63 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 64 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 66 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 67 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 68 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 71 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 72 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 77 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 78 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 79 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 81 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 82 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 83 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 84 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 86 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 87 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 91 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 92 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 93 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 94 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 95 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 96 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 97 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 98 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 99 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 100 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 101 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 102 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 103 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 104 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 105 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 106 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 107 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 108 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 109 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 110 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 111 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 112 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 113 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 114 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 115 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 116 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 117 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 118 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 119 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 120 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 121 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 122 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 123 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 124 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 126 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 127 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 128 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 129 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 130 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 131 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 132 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 133 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 134 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 135 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 137 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 138 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 139 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 140 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 141 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 142 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 143 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 145 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 146 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 148 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 149 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 150 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 151 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 152 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 153 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 154 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 155 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 156 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 157 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 158 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 159 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 160 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 161 | 3300013250 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 | Metagenome | Rhizosphere |
| 162 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 163 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 164 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 165 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 166 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 167 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 168 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 169 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 170 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 171 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 172 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 173 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 174 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 175 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 176 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 177 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 178 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 179 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 180 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 181 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 182 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 183 | 3300022739 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules | Metagenome | Nodule |
| 184 | 3300022740 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules | Metagenome | Nodule |
| 185 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 186 | 3300025223 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 188 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 189 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 190 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 191 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 192 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 193 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 194 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 195 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 196 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 197 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 198 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 199 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 200 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 201 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 202 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 203 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 204 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 205 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 258 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 259 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 260 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 261 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 262 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 263 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 264 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 265 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 266 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 267 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 268 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 269 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 270 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 271 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 272 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 273 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 274 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 275 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 276 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 277 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 278 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 279 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 280 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 281 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 282 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 283 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 284 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 285 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 286 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 287 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 288 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 289 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 290 | 3300029277 | Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.ctcc.R1 | Metatranscriptome | Rhizosphere |
| 291 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 292 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 293 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 294 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 295 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 296 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 297 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 298 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 299 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 300 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 301 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 302 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 303 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 304 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 305 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 306 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 307 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 308 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 309 | 3300031967 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules | Metagenome | Nodule |
| 310 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 311 | 3300033430 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules | Metagenome | Nodule |
| 312 | 3300033464 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules | Metagenome | Nodule |
| 313 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 314 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 315 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 316 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 317 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 318 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 319 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 320 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 321 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 322 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 323 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 324 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 325 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 326 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 327 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 328 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 329 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 330 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 331 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 332 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 333 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 334 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 335 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 336 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 337 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 338 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 339 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 340 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 341 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 342 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 343 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 344 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 345 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 346 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 347 | 3300039145 | Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 | Metagenome | Unclassified |
| 348 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 349 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 350 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 351 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 352 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 353 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 354 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 355 | 3300042144 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 | Metagenome | Rhizosphere |
| 356 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 357 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 358 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 359 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 360 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 361 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 362 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 363 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 364 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 365 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 422 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 423 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 424 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 425 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 426 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 427 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 428 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 429 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 430 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 431 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 432 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 433 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 434 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 435 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 436 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 437 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 438 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 439 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 440 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 441 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 442 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 443 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 444 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 445 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 446 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 447 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 448 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 449 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 450 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 451 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 452 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 453 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 454 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 455 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 456 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 457 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 458 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 459 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 460 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 461 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 462 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 463 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 464 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 465 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 466 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 467 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 468 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 469 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 470 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 471 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 472 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 473 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 474 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 475 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 476 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 477 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 478 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 479 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 480 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 481 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 482 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 483 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 484 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 485 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 486 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 487 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 488 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 489 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 490 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 491 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 492 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 493 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 494 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 495 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 496 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 497 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 498 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 499 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 500 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 501 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 502 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 503 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 504 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 505 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 506 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 507 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 508 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 509 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 510 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 511 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 512 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 513 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 514 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 515 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 516 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 517 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 518 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 519 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 520 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 521 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 522 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 523 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 524 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 525 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 526 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 527 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 528 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 529 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 530 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 531 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 532 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 533 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 534 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 535 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 536 | 2503198000 | Mesorhizobium opportunistum WSM2075 | Isolate | Nodule |
| 537 | 2508501050 | Microvirga lupini Lut6 | Isolate | Nodule |
| 538 | 2508501123 | Mesorhizobium sp. WSM3626 | Isolate | Nodule |
| 539 | 2508501127 | Mesorhizobium sp. WSM2561 | Isolate | Nodule |
| 540 | 2509276018 | Mesorhizobium ciceri CMG6 | Isolate | Nodule |
| 541 | 2509276022 | Mesorhizobium australicum WSM2073 | Isolate | Nodule |
| 542 | 2510065059 | Mesorhizobium ciceri WSM4083 | Isolate | Nodule |
| 543 | 2512875016 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 544 | 2512875024 | |||
| 545 | 2512875026 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 546 | 2513237087 | Azorhizobium doebereinerae UFLA1-100 | Isolate | Nodule |
| 547 | 2513237089 | Sinorhizobium medicae DI28 | Isolate | Nodule |
| 548 | 2513237090 | Mesorhizobium sp. WSM3224 | Isolate | Nodule |
| 549 | 2513237156 | Sinorhizobium medicae WSM1369 | Isolate | Nodule |
| 550 | 2513237160 | Sinorhizobium medicae WSM244 | Isolate | Nodule |
| 551 | 2513237164 | Mesorhizobium loti CJ3sym | Isolate | Nodule |
| 552 | 2513237305 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 553 | 2513237351 | Mesorhizobium alhagi CCNWXJ12-2 | Isolate | Nodule |
| 554 | 2517487022 | Sinorhizobium medicae WSM4191 | Isolate | Nodule |
| 555 | 2562617112 | Burkholderia sp. BT03 | Isolate | Rhizosphere |
| 556 | 2588253730 | Mesorhizobium huakuii 7653R | Isolate | Rhizosphere |
| 557 | 2597489875 | Mesorhizobium ciceri ca181 | Isolate | Unclassified |
| 558 | 2599185301 | Mesorhizobium sp. NFR06 | Isolate | Rhizoplane |
| 559 | 2599185352 | Sinorhizobium sp. NFACC03 | Isolate | Rhizoplane |
| 560 | 2643221550 | Mesorhizobium sp. Root552 | Isolate | Unclassified |
| 561 | 2643221551 | Mesorhizobium sp. Root1471 | Isolate | Unclassified |
| 562 | 2643221555 | Mesorhizobium sp. Root554 | Isolate | Unclassified |
| 563 | 2643221564 | Mesorhizobium sp. Root157 | Isolate | Unclassified |
| 564 | 2643221595 | Mesorhizobium sp. Root695 | Isolate | Unclassified |
| 565 | 2643221618 | Ensifer sp. Root231 | Isolate | Unclassified |
| 566 | 2643221623 | Aminobacter sp. DSM 101952 Root100 | Isolate | Unclassified |
| 567 | 2643221626 | Ensifer sp. Root31 | Isolate | Unclassified |
| 568 | 2643221627 | Mesorhizobium sp. Root102 | Isolate | Unclassified |
| 569 | 2643221655 | Ensifer sp. Root1252 | Isolate | Unclassified |
| 570 | 2643221659 | Ensifer sp. Root127 | Isolate | Unclassified |
| 571 | 2643221698 | Ensifer sp. Root142 | Isolate | Unclassified |
| 572 | 2643221712 | Ensifer sp. Root258 | Isolate | Unclassified |
| 573 | 2643221723 | Ensifer sp. Root278 | Isolate | Unclassified |
| 574 | 2643221734 | Bosea sp. Root670 | Isolate | Unclassified |
| 575 | 2657244999 | Sinorhizobium sojae CCBAU 05684 | Isolate | Unclassified |
| 576 | 2687453392 | Mesorhizobium ciceri biserrulae WSM1284 | Isolate | Unclassified |
| 577 | 2693429783 | Mesorhizobium sp. LCM 4577 | Isolate | Rhizosphere |
| 578 | 2693429784 | Mesorhizobium sp. LCM 4576 | Isolate | Rhizosphere |
| 579 | 2711768613 | Burkholderia sp. BT03 | Isolate | Rhizosphere |
| 580 | 2721755686 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 581 | 2738543024 | Aminobacter sp. AP02 | Isolate | Unclassified |
| 582 | 2751185800 | Brucella pituitosa AA2 | Isolate | Unclassified |
| 583 | 2756170246 | Mesorhizobium loti DSM 2626 | Isolate | Nodule |
| 584 | 2791355082 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 585 | 2791355091 | Sinorhizobium sp. FG01 | Isolate | Nodule |
| 586 | 2791355094 | Sinorhizobium sp. BJ1 | Isolate | Nodule |
| 587 | 2791355123 | Mesorhizobium sophorae ICMP 19535 | Isolate | Unclassified |
| 588 | 2802428858 | Sinorhizobium medicae M14-1 | Isolate | Nodule |
| 589 | 2802428859 | Sinorhizobium medicae SF3.41 | Isolate | Nodule |
| 590 | 2802428860 | Sinorhizobium medicae M19-1 | Isolate | Nodule |
| 591 | 2802428861 | Sinorhizobium medicae USDA1037 | Isolate | Nodule |
| 592 | 2802428862 | Sinorhizobium medicae M7-4 | Isolate | Nodule |
| 593 | 2802428863 | Sinorhizobium medicae M26-2 | Isolate | Nodule |
| 594 | 2802429268 | Sinorhizobium sojae CCBAU 05684 | Isolate | Unclassified |
| 595 | 2808606379 | Pseudomonas sp. SJZ079 | Isolate | Rhizosphere |
| 596 | 2818991467 | Bosea vestrisii 3192 | Isolate | Unclassified |
| 597 | 2828305725 | Xanthobacter tagetidis DSM 11105 | Isolate | Unclassified |
| 598 | 2837678835 | Jiella endophytica CBS5Q-3 | Isolate | Unclassified |
| 599 | 2838074704 | Sinorhizobium terangae SEMIA 6460 | Isolate | Unclassified |
| 600 | 2841734538 | Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 | Isolate | Nodule |
| 601 | 2841760612 | Bosea sp. Tri-49 | Isolate | Nodule |
| 602 | 2841911363 | Bosea caraganae RCAM04685 | Isolate | Nodule |
| 603 | 2841917233 | Bosea caraganae RCAM04680 | Isolate | Nodule |
| 604 | 2842333319 | Skermanella aerolata SEMIA 4010 | Isolate | Nodule |
| 605 | 2844002411 | Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 | Isolate | Nodule |
| 606 | 2844009547 | Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 | Isolate | Nodule |
| 607 | 2844104063 | Bosea sp. Tri-39 | Isolate | Nodule |
| 608 | 2844163670 | Ensifer sp. 1H6 | Isolate | Unclassified |
| 609 | 2847670302 | Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 | Isolate | Nodule |
| 610 | 2847686936 | Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 | Isolate | Nodule |
| 611 | 2851182111 | Bosea sp. Tri-44 | Isolate | Nodule |
| 612 | 2851246043 | Bosea sp. Tri-54 | Isolate | Nodule |
| 613 | 2856314179 | Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 | Isolate | Nodule |
| 614 | 2856320880 | Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 | Isolate | Nodule |
| 615 | 2856328259 | Mesorhizobium sp. Primo-B | Isolate | Nodule |
| 616 | 2856334872 | Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 | Isolate | Nodule |
| 617 | 2856342000 | Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 | Isolate | Nodule |
| 618 | 2856349417 | Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 | Isolate | Nodule |
| 619 | 2856364286 | Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 | Isolate | Nodule |
| 620 | 2857349434 | Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 | Isolate | Nodule |
| 621 | 2857367948 | Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 | Isolate | Nodule |
| 622 | 2869162929 | Mesorhizobium sanjuanii BSA136 | Isolate | Nodule |
| 623 | 2869169390 | Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 | Isolate | Nodule |
| 624 | 2869234852 | Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 | Isolate | Nodule |
| 625 | 2869242130 | Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 | Isolate | Nodule |
| 626 | 2869249662 | Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 | Isolate | Nodule |
| 627 | 2869264136 | Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 | Isolate | Nodule |
| 628 | 2869271264 | Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 | Isolate | Nodule |
| 629 | 2869278585 | Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 | Isolate | Nodule |
| 630 | 2869285874 | Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 | Isolate | Nodule |
| 631 | 2871429161 | Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 | Isolate | Nodule |
| 632 | 2871435913 | Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 | Isolate | Nodule |
| 633 | 2871444079 | Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 | Isolate | Nodule |
| 634 | 2871451962 | Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 | Isolate | Nodule |
| 635 | 2871459585 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 | Isolate | Nodule |
| 636 | 2871466892 | Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 | Isolate | Nodule |
| 637 | 2871474448 | Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 | Isolate | Nodule |
| 638 | 2871481445 | Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 | Isolate | Nodule |
| 639 | 2871488783 | Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 | Isolate | Nodule |
| 640 | 2871495908 | Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 | Isolate | Nodule |
| 641 | 2874102143 | Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 | Isolate | Nodule |
| 642 | 2874109183 | Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 | Isolate | Nodule |
| 643 | 2874116593 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 | Isolate | Nodule |
| 644 | 2874123672 | Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 | Isolate | Nodule |
| 645 | 2874131515 | Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 | Isolate | Nodule |
| 646 | 2874139085 | Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 | Isolate | Nodule |
| 647 | 2874146452 | Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 | Isolate | Nodule |
| 648 | 2874155637 | Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 | Isolate | Nodule |
| 649 | 2874162495 | Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 | Isolate | Nodule |
| 650 | 2874168670 | Mesorhizobium kowhaii Ach-343 | Isolate | Nodule |
| 651 | 2876363079 | Mesorhizobium loti R7ANS::ICEMlSym2042 | Isolate | Nodule |
| 652 | 2876369609 | Mesorhizobium sp. USDA-HM6 | Isolate | Unclassified |
| 653 | 2876377896 | Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 | Isolate | Nodule |
| 654 | 2876386047 | Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 | Isolate | Nodule |
| 655 | 2876392853 | Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 | Isolate | Nodule |
| 656 | 2876399893 | Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 | Isolate | Nodule |
| 657 | 2876406927 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 | Isolate | Nodule |
| 658 | 2876413966 | Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 | Isolate | Nodule |
| 659 | 2876420981 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 | Isolate | Nodule |
| 660 | 2878035449 | Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 | Isolate | Nodule |
| 661 | 2878738818 | Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 | Isolate | Nodule |
| 662 | 2878745973 | Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 | Isolate | Nodule |
| 663 | 2878753008 | Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 | Isolate | Nodule |
| 664 | 2878760144 | Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 | Isolate | Nodule |
| 665 | 2878767105 | Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 | Isolate | Nodule |
| 666 | 2878774303 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 | Isolate | Nodule |
| 667 | 2881147464 | Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 | Isolate | Nodule |
| 668 | 2881155292 | Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 | Isolate | Nodule |
| 669 | 2881161766 | Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 | Isolate | Nodule |
| 670 | 2881845957 | Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 | Isolate | Nodule |
| 671 | 2881853255 | Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 | Isolate | Nodule |
| 672 | 2881861095 | Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 | Isolate | Nodule |
| 673 | 2882632389 | Mesorhizobium waimense ICMP19557 | Isolate | Unclassified |
| 674 | 2882912400 | Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 | Isolate | Nodule |
| 675 | 2885305155 | Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 | Isolate | Nodule |
| 676 | 2885312484 | Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 | Isolate | Nodule |
| 677 | 2885318864 | Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 | Isolate | Nodule |
| 678 | 2885326080 | Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 | Isolate | Nodule |
| 679 | 2885342637 | Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 | Isolate | Nodule |
| 680 | 2885350715 | Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 | Isolate | Nodule |
| 681 | 2888337043 | Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 | Isolate | Nodule |
| 682 | 2888343758 | Mesorhizobium sp. AA22 | Isolate | Unclassified |
| 683 | 2888350351 | Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 | Isolate | Nodule |
| 684 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 685 | 2889010040 | Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 | Isolate | Nodule |
| 686 | 2889016732 | Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 | Isolate | Nodule |
| 687 | 2889790730 | Chelativorans xinjiangense lm93 | Isolate | Rhizosphere |
| 688 | 2889914905 | Chelativorans alearense UJN715 | Isolate | Rhizosphere |
| 689 | 2894817345 | Aureimonas psammosilenae YIM DR1026 | Isolate | Unclassified |
| 690 | 2896384573 | Ensifer sp. MPMI2T | Isolate | Unclassified |
| 691 | 2903448605 | Mesorhizobium japonicum Opo-235 | Isolate | Nodule |
| 692 | 2903492973 | Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 | Isolate | Nodule |
| 693 | 2903513507 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 | Isolate | Nodule |
| 694 | 2903521522 | Mesorhizobium loti R7ANS::ICEMlSym2014 | Isolate | Nodule |
| 695 | 2903528002 | Mesorhizobium loti R7ANS::ICEMlSym2037 | Isolate | Nodule |
| 696 | 2903540706 | Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 | Isolate | Nodule |
| 697 | 2904659560 | Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 | Isolate | Nodule |
| 698 | 2906308376 | Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 | Isolate | Nodule |
| 699 | 2906321335 | Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 | Isolate | Nodule |
| 700 | 2906328253 | Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 | Isolate | Nodule |
| 701 | 2906354277 | Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 | Isolate | Nodule |
| 702 | 2906363423 | Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 | Isolate | Nodule |
| 703 | 2906370794 | Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 | Isolate | Nodule |
| 704 | 2906378014 | Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 | Isolate | Nodule |
| 705 | 2906386501 | Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 | Isolate | Nodule |
| 706 | 2906393657 | Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 | Isolate | Nodule |
| 707 | 2906401398 | Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 | Isolate | Nodule |
| 708 | 2906408224 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 | Isolate | Nodule |
| 709 | 2906414383 | Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 | Isolate | Nodule |
| 710 | 2906427513 | Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 | Isolate | Nodule |
| 711 | 2915650412 | Ochrobactrum sp. CM-21-5 | Isolate | Rhizosphere |
| 712 | 2915980308 | Sinorhizobium medicae USDA1149 | Isolate | Nodule |
| 713 | 2916061851 | Sinorhizobium medicae USDA1638 | Isolate | Nodule |
| 714 | 2920760137 | Ensifer psoraleae CCBAU 65732 | Isolate | Unclassified |
| 715 | 2921250672 | Sinorhizobium medicae USDA1169 | Isolate | Nodule |
| 716 | 2921257292 | Sinorhizobium meliloti USDA1320 | Isolate | Nodule |
| 717 | 2922130491 | Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 | Isolate | Nodule |
| 718 | 2922151315 | Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 | Isolate | Nodule |
| 719 | 2922158528 | Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 | Isolate | Nodule |
| 720 | 2922172374 | Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 | Isolate | Nodule |
| 721 | 2922178524 | Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 | Isolate | Nodule |
| 722 | 2922185730 | Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 | Isolate | Nodule |
| 723 | 2924710171 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 | Isolate | Nodule |
| 724 | 2924718760 | Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 | Isolate | Nodule |
| 725 | 2924726620 | Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 | Isolate | Nodule |
| 726 | 2924733363 | Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 | Isolate | Nodule |
| 727 | 2924741084 | Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 | Isolate | Nodule |
| 728 | 2924748358 | Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 | Isolate | Nodule |
| 729 | 2924754689 | Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 | Isolate | Nodule |
| 730 | 2924762789 | Mesorhizobium sp. WSM4303 | Isolate | Unclassified |
| 731 | 2924776078 | Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 | Isolate | Nodule |
| 732 | 2924784321 | Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 | Isolate | Nodule |
| 733 | 2937023124 | Sinorhizobium meliloti USDA1335 | Isolate | Nodule |
| 734 | 2937029754 | Sinorhizobium medicae USDA1624 | Isolate | Nodule |
| 735 | 2937036028 | Sinorhizobium medicae USDA1608 | Isolate | Nodule |
| 736 | 2937078374 | Sinorhizobium medicae USDA1004 | Isolate | Nodule |
| 737 | 2937084907 | Sinorhizobium medicae USDA1664 | Isolate | Nodule |
| 738 | 2937813078 | Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 | Isolate | Nodule |
| 739 | 2937822353 | Mesorhizobium neociceri CCANP35 | Isolate | Nodule |
| 740 | 2937836603 | Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 | Isolate | Nodule |
| 741 | 2937848649 | Mesorhizobium sp. WSM4310 | Isolate | Unclassified |
| 742 | 2937861824 | Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 | Isolate | Nodule |
| 743 | 2937868953 | Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 | Isolate | Nodule |
| 744 | 2937877337 | Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 | Isolate | Nodule |
| 745 | 2937891427 | Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 | Isolate | Nodule |
| 746 | 2937972304 | Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 | Isolate | Nodule |
| 747 | 2937980651 | Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 | Isolate | Nodule |
| 748 | 2937994558 | Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 | Isolate | Nodule |
| 749 | 2938014810 | Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 | Isolate | Nodule |
| 750 | 2939669807 | Kaistia defluvii 3207 | Isolate | Rhizosphere |
| 751 | 2941499720 | Ensifer sp. 4252 | Isolate | Rhizosphere |
| 752 | 2957375807 | Sinorhizobium medicae USDA1632 | Isolate | Nodule |
| 753 | 2957395598 | Sinorhizobium meliloti USDA1237 | Isolate | Nodule |
| 754 | 2957437181 | Sinorhizobium medicae USDA1694 | Isolate | Nodule |
| 755 | 2958034702 | Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 | Isolate | Nodule |
| 756 | 2958041894 | Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 | Isolate | Nodule |
| 757 | 2958064165 | Mesorhizobium sp. SARCC-RB16n | Isolate | Unclassified |
| 758 | 2958071322 | Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 | Isolate | Nodule |
| 759 | 2958084443 | Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 | Isolate | Nodule |
| 760 | 2958092219 | Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 | Isolate | Nodule |
| 761 | 2958100919 | Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 | Isolate | Nodule |
| 762 | 2958108152 | Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 | Isolate | Nodule |
| 763 | 2958115193 | Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 | Isolate | Nodule |
| 764 | 2958122699 | Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 | Isolate | Nodule |
| 765 | 2958130278 | Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 | Isolate | Nodule |
| 766 | 2958144490 | Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 | Isolate | Nodule |
| 767 | 2958158011 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 | Isolate | Nodule |
| 768 | 2958165035 | Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 | Isolate | Nodule |
| 769 | 2958179912 | Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 | Isolate | Nodule |
| 770 | 2960591022 | Sinorhizobium medicae USDA1066 | Isolate | Nodule |
| 771 | 2960631154 | Sinorhizobium medicae USDA1629 | Isolate | Nodule |
| 772 | 2960680706 | Sinorhizobium medicae USDA1150 | Isolate | Nodule |
| 773 | 2960693952 | Sinorhizobium medicae USDA1630 | Isolate | Nodule |
| 774 | 2961077736 | Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 | Isolate | Nodule |
| 775 | 2961114664 | Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 | Isolate | Nodule |
| 776 | 2961127735 | Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 | Isolate | Nodule |
| 777 | 2961136820 | Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 | Isolate | Nodule |
| 778 | 2961163497 | Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 | Isolate | Nodule |
| 779 | 2961170736 | Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 | Isolate | Nodule |
| 780 | 2961183825 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 | Isolate | Nodule |
| 781 | 2963644680 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 782 | 2964615318 | Sinorhizobium meliloti USDA1248 | Isolate | Nodule |
| 783 | 2965018300 | Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 | Isolate | Nodule |
| 784 | 2965025482 | Mesorhizobium sp. Primo-A | Isolate | Nodule |
| 785 | 2965032056 | Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 | Isolate | Nodule |
| 786 | 2965047637 | Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 | Isolate | Nodule |
| 787 | 2965062239 | Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 | Isolate | Nodule |
| 788 | 2965089291 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 | Isolate | Nodule |
| 789 | 2965102966 | Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 | Isolate | Nodule |
| 790 | 2965110997 | Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 | Isolate | Nodule |
| 791 | 2965119406 | Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 | Isolate | Nodule |
| 792 | 2967686174 | Sinorhizobium medicae USDA1641 | Isolate | Nodule |
| 793 | 2967728569 | Sinorhizobium medicae USDA1607 | Isolate | Nodule |
| 794 | 2967755722 | Sinorhizobium meliloti USDA1302 | Isolate | Nodule |
| 795 | 2967996073 | Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 | Isolate | Nodule |
| 796 | 2968003550 | Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 | Isolate | Nodule |
| 797 | 2968016561 | Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 | Isolate | Nodule |
| 798 | 2968083720 | Mesorhizobium erdmanii Opo-242 | Isolate | Unclassified |
| 799 | 2968091066 | Mesorhizobium sp. AA23 | Isolate | Unclassified |
| 800 | 2968097103 | Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 | Isolate | Nodule |
| 801 | 2968110612 | Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 | Isolate | Nodule |
| 802 | 2968117919 | Mesorhizobium atlanticum CNPSo 3140 | Isolate | Unclassified |
| 803 | 2968128360 | Mesorhizobium sp. WSM3873 | Isolate | Unclassified |
| 804 | 2968171901 | Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 | Isolate | Nodule |
| 805 | 2970026789 | Sinorhizobium medicae USDA1611 | Isolate | Nodule |
| 806 | 2970102677 | Sinorhizobium meliloti USDA1325 | Isolate | Nodule |
| 807 | 2970122695 | Sinorhizobium medicae 3082 | Isolate | Nodule |
| 808 | 2970143518 | Sinorhizobium medicae USDA1652 | Isolate | Nodule |
| 809 | 2970469710 | Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 | Isolate | Nodule |
| 810 | 2970489779 | Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 | Isolate | Nodule |
| 811 | 2970503327 | Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 | Isolate | Nodule |
| 812 | 2970510686 | Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 | Isolate | Nodule |
| 813 | 2970524798 | Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 | Isolate | Nodule |
| 814 | 2970532167 | Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 | Isolate | Nodule |
| 815 | 2970540015 | Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 | Isolate | Nodule |
| 816 | 2970547951 | Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 | Isolate | Nodule |
| 817 | 2970554993 | Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 | Isolate | Nodule |
| 818 | 2970593180 | Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 | Isolate | Nodule |
| 819 | 2970619444 | Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 | Isolate | Nodule |
| 820 | 2970627176 | Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 | Isolate | Nodule |
| 821 | 2977530762 | Sinorhizobium medicae USDA1606 | Isolate | Nodule |
| 822 | 2977544691 | Sinorhizobium medicae USDA1631 | Isolate | Nodule |
| 823 | 2977821940 | Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 | Isolate | Nodule |
| 824 | 2977828996 | Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 | Isolate | Nodule |
| 825 | 2977843712 | Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 | Isolate | Nodule |
| 826 | 2977851361 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 | Isolate | Nodule |
| 827 | 2977858184 | Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 | Isolate | Nodule |
| 828 | 2977864932 | Mesorhizobium tamadayense DSM 28320 | Isolate | Nodule |
| 829 | 2977872689 | Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 | Isolate | Nodule |
| 830 | 2977898635 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 | Isolate | Nodule |
| 831 | 2977907340 | Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 | Isolate | Nodule |
| 832 | 2977915119 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 | Isolate | Nodule |
| 833 | 2977922695 | Mesorhizobium sp. WSM4305 | Isolate | Unclassified |
| 834 | 2977935797 | Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 | Isolate | Nodule |
| 835 | 2977942078 | Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 | Isolate | Nodule |
| 836 | 2977950692 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 | Isolate | Nodule |
| 837 | 2977957713 | Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 | Isolate | Nodule |
| 838 | 2977971508 | Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 | Isolate | Nodule |
| 839 | 2977986579 | Mesorhizobium intechi BD68 | Isolate | Unclassified |
| 840 | 2979710463 | Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 | Isolate | Nodule |
| 841 | 2979742915 | Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 | Isolate | Nodule |
| 842 | 2979764755 | Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 | Isolate | Nodule |
| 843 | 2979772303 | Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 | Isolate | Nodule |
| 844 | 2979779861 | Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 | Isolate | Nodule |
| 845 | 2979793036 | Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 | Isolate | Nodule |
| 846 | 2979808191 | Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 | Isolate | Nodule |
| 847 | 2987636660 | Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 | Isolate | Nodule |
| 848 | 2987645492 | Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 | Isolate | Nodule |
| 849 | 2987652177 | Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 | Isolate | Nodule |
| 850 | 2987659509 | Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 | Isolate | Nodule |
| 851 | 2987666974 | Mesorhizobium sp. WSM4306 | Isolate | Unclassified |
| 852 | 2987673487 | Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 | Isolate | Nodule |
| 853 | 2996310559 | Mesorhizobium zhangyense CGMCC 1.15528 | Isolate | Unclassified |
| 854 | 2996336353 | Mesorhizobium sp. YM1C-6-2 | Isolate | Unclassified |
| 855 | 2996341866 | Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 | Isolate | Nodule |
| 856 | 2996348954 | Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 | Isolate | Nodule |
| 857 | 2996386984 | Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 | Isolate | Nodule |
| 858 | 3000135777 | Unclassified bacterium M00.F.Ca.ET.205.01.1.1 | Isolate | Unclassified |
| 859 | 3003930520 | Sinorhizobium sp. BG8 | Isolate | Unclassified |
| 860 | 3004167301 | Mesorhizobium loti 582 | Isolate | Unclassified |
| 861 | 3004188549 | Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 | Isolate | Nodule |
| 862 | 3004195979 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 | Isolate | Nodule |
| 863 | 3004203850 | Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 | Isolate | Nodule |
| 864 | 3004211236 | Mesorhizobium sp. WSM4307 | Isolate | Unclassified |
| 865 | 3004218560 | Mesorhizobium sp. WSM4315 | Isolate | Unclassified |
| 866 | 3004232784 | Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 | Isolate | Nodule |
| 867 | 3004239961 | Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 | Isolate | Nodule |
| 868 | 3004248173 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 | Isolate | Nodule |
| 869 | 3004268573 | Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 | Isolate | Nodule |
| 870 | 3004275668 | Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 | Isolate | Nodule |
| 871 | 3004289098 | Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 | Isolate | Nodule |
| 872 | 3004334049 | Mesorhizobium huakuii 583 | Isolate | Unclassified |
| 873 | 637000159 | Mesorhizobium japonicum MAFF 303099 | Isolate | Unclassified |
| 874 | 641228493 | Gluconacetobacter diazotrophicus PA1 5 | Isolate | Unclassified |
| 875 | 643348555 | Gluconacetobacter diazotrophicus PA1 5 | Isolate | Unclassified |
| 876 | 649633066 | Mesorhizobium ciceri bv. biserrulae WSM1271 | Isolate | Nodule |
| 877 | 8002285264 | Aminobacter anthyllidis LMG 26462 | Isolate | Nodule |
| 878 | 8003999396 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 879 | 8004300914 | Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 | Isolate | Nodule |
| 880 | 8004312739 | Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 | Isolate | Nodule |
| 881 | 8004361976 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 | Isolate | Nodule |
| 882 | 8004374579 | Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 | Isolate | Nodule |
| 883 | 8004387939 | Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 | Isolate | Nodule |
| 884 | 8004395343 | Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 | Isolate | Nodule |
| 885 | 8004445564 | Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 | Isolate | Nodule |
| 886 | 8004633249 | Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 | Isolate | Nodule |
| 887 | 8004640170 | Mesorhizobium sp. GbtcB19 | Isolate | Unclassified |
| 888 | 8004695233 | Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 | Isolate | Nodule |
| 889 | 8004703790 | Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 | Isolate | Nodule |
| 890 | 8004714634 | Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 | Isolate | Nodule |
| 891 | 8004727605 | Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 | Isolate | Nodule |
| 892 | 8049293176 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 893 | 8054558443 | Rhizobium alarense TRM95111 | Isolate | Nodule |
| 894 | 8055617313 | Mesorhizobium onobrychidis OM4 | Isolate | Nodule |
| 895 | 8057529695 | Bosea vestrisii A18/4-2 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 81.95 |
| Metatranscriptomes | 0.86 |
| Isolates | 17.19 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7.38 |
| Nodule | 14.62 |
| Rhizoplane | 8.76 |
| Rhizosphere | 63.52 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0501039_0172727 | 3300049575 | Bacteria | 1699 |
| 2 | JGI24746J21847_1001085 | 3300001977 | Bacteria | 4268 |
| 3 | JGI24740J21852_10006526 | 3300001979 | Bacteria | 4821 |
| 4 | JGI24739J22299_10047854 | 3300001989 | Bacteria | 1393 |
| 5 | JGI24737J22298_10051034 | 3300001990 | Bacteria | 1256 |
| 6 | JGI24750J21931_1001195 | 3300002070 | Bacteria | 3311 |
| 7 | JGI24750J21931_1002374 | 3300002070 | Bacteria | 2273 |
| 8 | JGI24738J21930_10005970 | 3300002075 | Bacteria | 2891 |
| 9 | JGI24738J21930_10007456 | 3300002075 | Bacteria | 2523 |
| 10 | JGI24749J21850_1010571 | 3300002076 | Bacteria | 1295 |
| 11 | JGI24749J21850_1016147 | 3300002076 | Bacteria | 1048 |
| 12 | JGI24744J21845_10006218 | 3300002077 | Bacteria | 2479 |
| 13 | JGI24744J21845_10011920 | 3300002077 | Bacteria | 1770 |
| 14 | JGI24033J26618_1007281 | 3300002155 | Bacteria | 1255 |
| 15 | JGI24742J22300_10002109 | 3300002244 | Bacteria | 3164 |
| 16 | JGI24742J22300_10018212 | 3300002244 | Bacteria | 1190 |
| 17 | JGI24751J29686_10003795 | 3300002459 | Bacteria | 3048 |
| 18 | JGI24751J29686_10004371 | 3300002459 | Bacteria | 2867 |
| 19 | JGI25156J39149_1006460 | 3300002705 | Bacteria | 3201 |
| 20 | JGI25157J39369_1000310 | 3300002741 | Bacteria | 35193 |
| 21 | JGI25159J45721_1000029 | 3300002987 | Bacteria | 105868 |
| 22 | JGI25159J45721_1006446 | 3300002987 | Bacteria | 3510 |
| 23 | Ga0006778J45830_1020520 | 3300003162 | Bacteria | 1802 |
| 24 | Ga0006778J45830_1051547 | 3300003162 | Bacteria | 988 |
| 25 | Ga0006759J45824_1031091 | 3300003163 | Bacteria | 1016 |
| 26 | JGI25151J46595_10000044 | 3300003187 | Bacteria | 170418 |
| 27 | JGI25153J46596_10000369 | 3300003215 | Bacteria | 30875 |
| 28 | JGI25153J46596_10000379 | 3300003215 | Bacteria | 30351 |
| 29 | JGI25153J46596_10002710 | 3300003215 | Bacteria | 10099 |
| 30 | Ga0006777J48905_1021316 | 3300003308 | Bacteria | 3067 |
| 31 | Ga0006777J48905_1034387 | 3300003308 | Bacteria | 2006 |
| 32 | JGI25160J50197_1000011 | 3300003354 | Bacteria | 275577 |
| 33 | JGI25161J50226_1000216 | 3300003374 | Bacteria | 36285 |
| 34 | Ga0007410J51695_1020795 | 3300003574 | Bacteria | 1217 |
| 35 | Ga0007409J51694_1049573 | 3300003575 | Bacteria | 1089 |
| 36 | Ga0007416J51690_1033932 | 3300003577 | Bacteria | 990 |
| 37 | Ga0007429J51699_1038745 | 3300003579 | Bacteria | 1167 |
| 38 | Ga0007429J51699_1038746 | 3300003579 | Bacteria | 1118 |
| 39 | Ga0032354_1047281 | 3300003693 | Bacteria | 2122 |
| 40 | Ga0006780_1005821 | 3300003735 | Bacteria | 1480 |
| 41 | Ga0006780_1019722 | 3300003735 | Bacteria | 1706 |
| 42 | Ga0055542_1001387 | 3300003762 | Bacteria | 12276 |
| 43 | Ga0055542_1002854 | 3300003762 | Bacteria | 5147 |
| 44 | Ga0055526_1000091 | 3300003771 | Bacteria | 82891 |
| 45 | Ga0055526_1003540 | 3300003771 | Bacteria | 9852 |
| 46 | Ga0055526_1003634 | 3300003771 | Bacteria | 9659 |
| 47 | Ga0055526_1034806 | 3300003771 | Bacteria | 1369 |
| 48 | Ga0055524_1029369 | 3300003775 | Bacteria | 1626 |
| 49 | Ga0055531_10030043 | 3300003794 | Bacteria | 1836 |
| 50 | JGI25405J52794_10036305 | 3300003911 | Bacteria | 1034 |
| 51 | Ga0055543_1000179 | 3300004625 | Bacteria | 52563 |
| 52 | Ga0055543_1025677 | 3300004625 | Bacteria | 1051 |
| 53 | Ga0058862_12598501 | 3300004803 | Bacteria | 2181 |
| 54 | Ga0065165_1000018 | 3300005262 | Bacteria | 275082 |
| 55 | Ga0065165_1000549 | 3300005262 | Bacteria | 56452 |
| 56 | Ga0065165_1006672 | 3300005262 | Bacteria | 5952 |
| 57 | Ga0065165_1007387 | 3300005262 | Bacteria | 5417 |
| 58 | Ga0070658_10135240 | 3300005327 | Bacteria | 2056 |
| 59 | Ga0070676_10033629 | 3300005328 | Bacteria | 2942 |
| 60 | Ga0070683_100046149 | 3300005329 | Bacteria | 4024 |
| 61 | Ga0070683_100130954 | 3300005329 | Bacteria | 2374 |
| 62 | Ga0070683_100288797 | 3300005329 | Bacteria | 1560 |
| 63 | Ga0070690_100000031 | 3300005330 | Bacteria | 64458 |
| 64 | Ga0070670_100002795 | 3300005331 | Bacteria | 14432 |
| 65 | Ga0070670_100010830 | 3300005331 | Bacteria | 7789 |
| 66 | Ga0070670_100069841 | 3300005331 | Bacteria | 3016 |
| 67 | Ga0068869_100101973 | 3300005334 | Bacteria | 2171 |
| 68 | Ga0070666_10048602 | 3300005335 | Bacteria | 2851 |
| 69 | Ga0070680_100013749 | 3300005336 | Bacteria | 6313 |
| 70 | Ga0070680_100065124 | 3300005336 | Bacteria | 2987 |
| 71 | Ga0070680_100102229 | 3300005336 | Bacteria | 2380 |
| 72 | Ga0070680_100133539 | 3300005336 | Bacteria | 2078 |
| 73 | Ga0070680_100269665 | 3300005336 | Bacteria | 1441 |
| 74 | Ga0070680_100377506 | 3300005336 | Bacteria | 1207 |
| 75 | Ga0070682_100000872 | 3300005337 | Bacteria | 17577 |
| 76 | Ga0070682_100004641 | 3300005337 | Bacteria | 7629 |
| 77 | Ga0070682_100281378 | 3300005337 | Bacteria | 1213 |
| 78 | Ga0070682_100335008 | 3300005337 | Bacteria | 1123 |
| 79 | Ga0068868_100007455 | 3300005338 | Bacteria | 7791 |
| 80 | Ga0068868_100015186 | 3300005338 | Bacteria | 5689 |
| 81 | Ga0068868_100380111 | 3300005338 | Bacteria | 1215 |
| 82 | Ga0068868_100392547 | 3300005338 | Bacteria | 1196 |
| 83 | Ga0070660_100000424 | 3300005339 | Bacteria | 28001 |
| 84 | Ga0070660_100059342 | 3300005339 | Bacteria | 2967 |
| 85 | Ga0070660_100135596 | 3300005339 | Bacteria | 1972 |
| 86 | Ga0070660_100193622 | 3300005339 | Bacteria | 1647 |
| 87 | Ga0070689_100012792 | 3300005340 | Bacteria | 6058 |
| 88 | Ga0070689_100027324 | 3300005340 | Bacteria | 4302 |
| 89 | Ga0070689_100073641 | 3300005340 | Bacteria | 2672 |
| 90 | Ga0070691_10000305 | 3300005341 | Bacteria | 17240 |
| 91 | Ga0070691_10123538 | 3300005341 | Bacteria | 1306 |
| 92 | Ga0070687_100002671 | 3300005343 | Bacteria | 6745 |
| 93 | Ga0070687_100025098 | 3300005343 | Bacteria | 2855 |
| 94 | Ga0070661_100005997 | 3300005344 | Bacteria | 8364 |
| 95 | Ga0070661_100053570 | 3300005344 | Bacteria | 2953 |
| 96 | Ga0070661_100495726 | 3300005344 | Bacteria | 977 |
| 97 | Ga0070692_10015981 | 3300005345 | Bacteria | 3562 |
| 98 | Ga0070692_10045100 | 3300005345 | Bacteria | 2273 |
| 99 | Ga0070668_100000547 | 3300005347 | Bacteria | 25148 |
| 100 | Ga0070668_100373663 | 3300005347 | Bacteria | 1212 |
| 101 | Ga0070669_100000573 | 3300005353 | Bacteria | 27336 |
| 102 | Ga0070669_100062845 | 3300005353 | Bacteria | 2731 |
| 103 | Ga0070669_100694753 | 3300005353 | Bacteria | 859 |
| 104 | Ga0070675_100206460 | 3300005354 | Bacteria | 1706 |
| 105 | Ga0070675_100526441 | 3300005354 | Bacteria | 1067 |
| 106 | Ga0070671_100000381 | 3300005355 | Bacteria | 30589 |
| 107 | Ga0070671_100153648 | 3300005355 | Bacteria | 1944 |
| 108 | Ga0070671_100244960 | 3300005355 | Bacteria | 1522 |
| 109 | Ga0070674_100000523 | 3300005356 | Bacteria | 19303 |
| 110 | Ga0070674_100093334 | 3300005356 | Bacteria | 2177 |
| 111 | Ga0070674_100401802 | 3300005356 | Bacteria | 1120 |
| 112 | Ga0070673_100000111 | 3300005364 | Bacteria | 37570 |
| 113 | Ga0070673_100054247 | 3300005364 | Bacteria | 3152 |
| 114 | Ga0070673_100145227 | 3300005364 | Bacteria | 2005 |
| 115 | Ga0070688_100000439 | 3300005365 | Bacteria | 21017 |
| 116 | Ga0070688_100074540 | 3300005365 | Bacteria | 2180 |
| 117 | Ga0070688_100427441 | 3300005365 | Bacteria | 986 |
| 118 | Ga0070659_100001531 | 3300005366 | Bacteria | 16679 |
| 119 | Ga0070659_100037122 | 3300005366 | Bacteria | 3798 |
| 120 | Ga0070659_100200026 | 3300005366 | Bacteria | 1644 |
| 121 | Ga0070667_100000742 | 3300005367 | Bacteria | 31206 |
| 122 | Ga0070667_100268555 | 3300005367 | Bacteria | 1529 |
| 123 | Ga0070667_100573012 | 3300005367 | Bacteria | 1039 |
| 124 | Ga0070667_100719936 | 3300005367 | Bacteria | 924 |
| 125 | Ga0070703_10021610 | 3300005406 | Bacteria | 1883 |
| 126 | Ga0070703_10043166 | 3300005406 | Bacteria | 1413 |
| 127 | Ga0070709_10001603 | 3300005434 | Bacteria | 12207 |
| 128 | Ga0070709_10015446 | 3300005434 | Bacteria | 4345 |
| 129 | Ga0070709_10189242 | 3300005434 | Bacteria | 1451 |
| 130 | Ga0070714_100002925 | 3300005435 | Bacteria | 12640 |
| 131 | Ga0070714_100324023 | 3300005435 | Bacteria | 1442 |
| 132 | Ga0070714_100814590 | 3300005435 | Bacteria | 905 |
| 133 | Ga0070713_100002679 | 3300005436 | Bacteria | 11615 |
| 134 | Ga0070713_100036702 | 3300005436 | Bacteria | 3957 |
| 135 | Ga0070713_100220937 | 3300005436 | Bacteria | 1719 |
| 136 | Ga0070713_100781734 | 3300005436 | Bacteria | 914 |
| 137 | Ga0070710_10052010 | 3300005437 | Bacteria | 2303 |
| 138 | Ga0070701_10003309 | 3300005438 | Bacteria | 6353 |
| 139 | Ga0070701_10008282 | 3300005438 | Bacteria | 4490 |
| 140 | Ga0070701_10210661 | 3300005438 | Bacteria | 1154 |
| 141 | Ga0070711_100000238 | 3300005439 | Bacteria | 28196 |
| 142 | Ga0070711_100098052 | 3300005439 | Bacteria | 2127 |
| 143 | Ga0070711_100187725 | 3300005439 | Bacteria | 1586 |
| 144 | Ga0070705_100000568 | 3300005440 | Bacteria | 21393 |
| 145 | Ga0070705_100007808 | 3300005440 | Bacteria | 5283 |
| 146 | Ga0070705_100026017 | 3300005440 | Bacteria | 3181 |
| 147 | Ga0070705_100071228 | 3300005440 | Bacteria | 2102 |
| 148 | Ga0070705_100298660 | 3300005440 | Bacteria | 1153 |
| 149 | Ga0070700_100000702 | 3300005441 | Bacteria | 16502 |
| 150 | Ga0070700_100000905 | 3300005441 | Bacteria | 14646 |
| 151 | Ga0070700_100012342 | 3300005441 | Bacteria | 4764 |
| 152 | Ga0070700_100058428 | 3300005441 | Bacteria | 2423 |
| 153 | Ga0070694_100002735 | 3300005444 | Bacteria | 10460 |
| 154 | Ga0070694_100016938 | 3300005444 | Bacteria | 4596 |
| 155 | Ga0070694_100025588 | 3300005444 | Bacteria | 3819 |
| 156 | Ga0070694_100546628 | 3300005444 | Bacteria | 927 |
| 157 | Ga0070708_100062984 | 3300005445 | Bacteria | 3319 |
| 158 | Ga0070663_100002733 | 3300005455 | Bacteria | 9991 |
| 159 | Ga0070663_100003287 | 3300005455 | Bacteria | 9304 |
| 160 | Ga0070663_100021801 | 3300005455 | Bacteria | 4267 |
| 161 | Ga0070663_100030693 | 3300005455 | Bacteria | 3687 |
| 162 | Ga0070663_100073480 | 3300005455 | Bacteria | 2494 |
| 163 | Ga0070663_100579500 | 3300005455 | Bacteria | 941 |
| 164 | Ga0070678_100000328 | 3300005456 | Bacteria | 22182 |
| 165 | Ga0070678_100003909 | 3300005456 | Bacteria | 8377 |
| 166 | Ga0070678_100033247 | 3300005456 | Bacteria | 3578 |
| 167 | Ga0070678_100094107 | 3300005456 | Bacteria | 2306 |
| 168 | Ga0070678_100373546 | 3300005456 | Bacteria | 1232 |
| 169 | Ga0070678_100658572 | 3300005456 | Bacteria | 940 |
| 170 | Ga0070662_100001201 | 3300005457 | Bacteria | 15917 |
| 171 | Ga0070662_100046829 | 3300005457 | Bacteria | 3108 |
| 172 | Ga0070681_10002440 | 3300005458 | Bacteria | 17015 |
| 173 | Ga0070681_10047892 | 3300005458 | Bacteria | 4272 |
| 174 | Ga0070681_10049840 | 3300005458 | Bacteria | 4180 |
| 175 | Ga0070681_10708582 | 3300005458 | Bacteria | 922 |
| 176 | Ga0068867_100187633 | 3300005459 | Bacteria | 1648 |
| 177 | Ga0070698_100108642 | 3300005471 | Bacteria | 2741 |
| 178 | Ga0070699_100003865 | 3300005518 | Bacteria | 13242 |
| 179 | Ga0070699_100245266 | 3300005518 | Bacteria | 1600 |
| 180 | Ga0070679_100007780 | 3300005530 | Bacteria | 10040 |
| 181 | Ga0070679_100012547 | 3300005530 | Bacteria | 8104 |
| 182 | Ga0070679_100045074 | 3300005530 | Bacteria | 4394 |
| 183 | Ga0070679_100109775 | 3300005530 | Bacteria | 2745 |
| 184 | Ga0070679_100282828 | 3300005530 | Bacteria | 1611 |
| 185 | Ga0070684_100549518 | 3300005535 | Bacteria | 1072 |
| 186 | Ga0070697_100000372 | 3300005536 | Bacteria | 35015 |
| 187 | Ga0070697_100003894 | 3300005536 | Bacteria | 11463 |
| 188 | Ga0070697_100148486 | 3300005536 | Bacteria | 1975 |
| 189 | Ga0070697_100368945 | 3300005536 | Bacteria | 1242 |
| 190 | Ga0068853_100002908 | 3300005539 | Bacteria | 13013 |
| 191 | Ga0068853_100008796 | 3300005539 | Bacteria | 8121 |
| 192 | Ga0068853_100014575 | 3300005539 | Bacteria | 6444 |
| 193 | Ga0068853_100019258 | 3300005539 | Bacteria | 5657 |
| 194 | Ga0070672_100004025 | 3300005543 | Bacteria | 9587 |
| 195 | Ga0070672_100004197 | 3300005543 | Bacteria | 9414 |
| 196 | Ga0070672_100090017 | 3300005543 | Bacteria | 2474 |
| 197 | Ga0070686_100023660 | 3300005544 | Bacteria | 3675 |
| 198 | Ga0070686_100028163 | 3300005544 | Bacteria | 3405 |
| 199 | Ga0070686_100095430 | 3300005544 | Bacteria | 1998 |
| 200 | Ga0070686_100514606 | 3300005544 | Bacteria | 931 |
| 201 | Ga0070695_100000379 | 3300005545 | Bacteria | 22911 |
| 202 | Ga0070695_100002634 | 3300005545 | Bacteria | 10372 |
| 203 | Ga0070695_100013831 | 3300005545 | Bacteria | 4855 |
| 204 | Ga0070696_100002850 | 3300005546 | Bacteria | 11499 |
| 205 | Ga0070696_100048951 | 3300005546 | Bacteria | 2934 |
| 206 | Ga0070696_100240340 | 3300005546 | Bacteria | 1366 |
| 207 | Ga0070693_100000366 | 3300005547 | Bacteria | 20481 |
| 208 | Ga0070693_100037074 | 3300005547 | Bacteria | 2716 |
| 209 | Ga0070665_100095453 | 3300005548 | Bacteria | 2979 |
| 210 | Ga0070665_100183602 | 3300005548 | Bacteria | 2092 |
| 211 | Ga0070665_100260233 | 3300005548 | Bacteria | 1736 |
| 212 | Ga0070704_100000980 | 3300005549 | Bacteria | 14523 |
| 213 | Ga0070704_100004175 | 3300005549 | Bacteria | 8337 |
| 214 | Ga0070704_100049937 | 3300005549 | Bacteria | 2937 |
| 215 | Ga0070704_100057515 | 3300005549 | Bacteria | 2765 |
| 216 | Ga0070704_100116809 | 3300005549 | Bacteria | 2041 |
| 217 | Ga0068855_100001286 | 3300005563 | Bacteria | 31105 |
| 218 | Ga0068855_100297600 | 3300005563 | Bacteria | 1788 |
| 219 | Ga0070664_100001736 | 3300005564 | Bacteria | 17436 |
| 220 | Ga0070664_100232401 | 3300005564 | Bacteria | 1653 |
| 221 | Ga0070664_100339109 | 3300005564 | Bacteria | 1365 |
| 222 | Ga0068857_100000473 | 3300005577 | Bacteria | 28704 |
| 223 | Ga0068854_100001023 | 3300005578 | Bacteria | 16772 |
| 224 | Ga0068856_100005557 | 3300005614 | Bacteria | 12413 |
| 225 | Ga0070702_100001480 | 3300005615 | Bacteria | 9641 |
| 226 | Ga0070702_100002704 | 3300005615 | Bacteria | 7752 |
| 227 | Ga0070702_100004009 | 3300005615 | Bacteria | 6682 |
| 228 | Ga0070702_100244625 | 3300005615 | Bacteria | 1213 |
| 229 | Ga0068852_100003530 | 3300005616 | Bacteria | 10943 |
| 230 | Ga0068852_100022442 | 3300005616 | Bacteria | 5062 |
| 231 | Ga0068852_100136450 | 3300005616 | Bacteria | 2265 |
| 232 | Ga0068859_100009249 | 3300005617 | Bacteria | 9949 |
| 233 | Ga0068859_100013367 | 3300005617 | Bacteria | 8231 |
| 234 | Ga0068859_100120135 | 3300005617 | Bacteria | 2694 |
| 235 | Ga0068864_100006233 | 3300005618 | Bacteria | 9782 |
| 236 | Ga0068864_100017168 | 3300005618 | Bacteria | 6035 |
| 237 | Ga0068864_100062473 | 3300005618 | Bacteria | 3227 |
| 238 | Ga0068864_100082507 | 3300005618 | Bacteria | 2821 |
| 239 | Ga0068866_10098286 | 3300005718 | Bacteria | 1609 |
| 240 | Ga0068861_100000606 | 3300005719 | Bacteria | 21211 |
| 241 | Ga0068861_100006956 | 3300005719 | Bacteria | 7728 |
| 242 | Ga0068861_100086963 | 3300005719 | Bacteria | 2458 |
| 243 | Ga0068861_100208872 | 3300005719 | Bacteria | 1643 |
| 244 | Ga0068861_100211215 | 3300005719 | Bacteria | 1635 |
| 245 | Ga0068861_100737912 | 3300005719 | Bacteria | 919 |
| 246 | Ga0068851_10039572 | 3300005834 | Bacteria | 2368 |
| 247 | Ga0068851_10145084 | 3300005834 | Bacteria | 1294 |
| 248 | Ga0068870_10294129 | 3300005840 | Bacteria | 1023 |
| 249 | Ga0068863_100013115 | 3300005841 | Bacteria | 7996 |
| 250 | Ga0068863_100016333 | 3300005841 | Bacteria | 7123 |
| 251 | Ga0068863_100099939 | 3300005841 | Bacteria | 2757 |
| 252 | Ga0068858_100140808 | 3300005842 | Bacteria | 2264 |
| 253 | Ga0068860_100001485 | 3300005843 | Bacteria | 25321 |
| 254 | Ga0068860_100007864 | 3300005843 | Bacteria | 10644 |
| 255 | Ga0068860_100045325 | 3300005843 | Bacteria | 4193 |
| 256 | Ga0068860_100074806 | 3300005843 | Bacteria | 3221 |
| 257 | Ga0068860_100111225 | 3300005843 | Bacteria | 2619 |
| 258 | Ga0068860_100116590 | 3300005843 | Bacteria | 2555 |
| 259 | Ga0068862_100000857 | 3300005844 | Bacteria | 29811 |
| 260 | Ga0068862_100001067 | 3300005844 | Bacteria | 26267 |
| 261 | Ga0068862_100006026 | 3300005844 | Bacteria | 10095 |
| 262 | Ga0068862_100055915 | 3300005844 | Bacteria | 3380 |
| 263 | Ga0081455_10002287 | 3300005937 | Bacteria | 22863 |
| 264 | Ga0081455_10138082 | 3300005937 | Bacteria | 1897 |
| 265 | Ga0081455_10138890 | 3300005937 | Bacteria | 1890 |
| 266 | Ga0081455_10147356 | 3300005937 | Bacteria | 1819 |
| 267 | Ga0081455_10186125 | 3300005937 | Bacteria | 1568 |
| 268 | Ga0081538_10003767 | 3300005981 | Bacteria | 14200 |
| 269 | Ga0081540_1000231 | 3300005983 | Bacteria | 58494 |
| 270 | Ga0081540_1001706 | 3300005983 | Bacteria | 18603 |
| 271 | Ga0081540_1021452 | 3300005983 | Bacteria | 3844 |
| 272 | Ga0081540_1084098 | 3300005983 | Bacteria | 1421 |
| 273 | Ga0081539_10090050 | 3300005985 | Bacteria | 1587 |
| 274 | Ga0070717_10085658 | 3300006028 | Bacteria | 2652 |
| 275 | Ga0070717_10098164 | 3300006028 | Bacteria | 2483 |
| 276 | Ga0070717_10143793 | 3300006028 | Bacteria | 2059 |
| 277 | Ga0070717_10220331 | 3300006028 | Bacteria | 1667 |
| 278 | Ga0075365_10017184 | 3300006038 | Bacteria | 4419 |
| 279 | Ga0075365_10019511 | 3300006038 | Bacteria | 4186 |
| 280 | Ga0075365_10021047 | 3300006038 | Bacteria | 4059 |
| 281 | Ga0075365_10022168 | 3300006038 | Bacteria | 3975 |
| 282 | Ga0075365_10034507 | 3300006038 | Bacteria | 3267 |
| 283 | Ga0075365_10143127 | 3300006038 | Bacteria | 1660 |
| 284 | Ga0075365_10381409 | 3300006038 | Bacteria | 994 |
| 285 | Ga0075368_10003347 | 3300006042 | Bacteria | 5339 |
| 286 | Ga0075368_10010887 | 3300006042 | Bacteria | 3298 |
| 287 | Ga0075368_10023608 | 3300006042 | Bacteria | 2350 |
| 288 | Ga0075368_10029933 | 3300006042 | Bacteria | 2106 |
| 289 | Ga0075363_100010851 | 3300006048 | Bacteria | 4345 |
| 290 | Ga0075363_100025765 | 3300006048 | Bacteria | 3003 |
| 291 | Ga0075363_100056976 | 3300006048 | Bacteria | 2096 |
| 292 | Ga0075363_100068627 | 3300006048 | Bacteria | 1923 |
| 293 | Ga0075364_10079176 | 3300006051 | Bacteria | 2171 |
| 294 | Ga0075364_10099392 | 3300006051 | Bacteria | 1936 |
| 295 | Ga0075364_10121603 | 3300006051 | Bacteria | 1747 |
| 296 | Ga0070715_10066022 | 3300006163 | Bacteria | 1603 |
| 297 | Ga0070716_100000193 | 3300006173 | Bacteria | 24029 |
| 298 | Ga0070716_100093215 | 3300006173 | Bacteria | 1828 |
| 299 | Ga0070712_100010654 | 3300006175 | Bacteria | 5807 |
| 300 | Ga0070712_100080499 | 3300006175 | Bacteria | 2358 |
| 301 | Ga0070712_100265559 | 3300006175 | Bacteria | 1377 |
| 302 | Ga0070712_100321368 | 3300006175 | Bacteria | 1259 |
| 303 | Ga0070712_100451244 | 3300006175 | Bacteria | 1071 |
| 304 | Ga0075362_10005091 | 3300006177 | Bacteria | 4781 |
| 305 | Ga0075362_10070214 | 3300006177 | Bacteria | 1598 |
| 306 | Ga0075362_10120481 | 3300006177 | Bacteria | 1242 |
| 307 | Ga0075367_10009820 | 3300006178 | Bacteria | 5015 |
| 308 | Ga0075367_10036305 | 3300006178 | Bacteria | 2857 |
| 309 | Ga0075367_10061047 | 3300006178 | Bacteria | 2249 |
| 310 | Ga0075367_10077097 | 3300006178 | Bacteria | 2012 |
| 311 | Ga0075367_10203029 | 3300006178 | Bacteria | 1238 |
| 312 | Ga0075367_10299311 | 3300006178 | Bacteria | 1012 |
| 313 | Ga0075369_10017607 | 3300006186 | Bacteria | 2899 |
| 314 | Ga0075369_10028219 | 3300006186 | Bacteria | 2351 |
| 315 | Ga0075366_10003079 | 3300006195 | Bacteria | 8705 |
| 316 | Ga0075366_10056348 | 3300006195 | Bacteria | 2334 |
| 317 | Ga0075366_10160634 | 3300006195 | Bacteria | 1362 |
| 318 | Ga0075366_10212592 | 3300006195 | Bacteria | 1177 |
| 319 | Ga0097621_100016072 | 3300006237 | Bacteria | 5649 |
| 320 | Ga0097621_100113186 | 3300006237 | Bacteria | 2295 |
| 321 | Ga0097621_100233297 | 3300006237 | Bacteria | 1607 |
| 322 | Ga0075370_10063881 | 3300006353 | Bacteria | 2099 |
| 323 | Ga0075370_10141546 | 3300006353 | Bacteria | 1406 |
| 324 | Ga0068871_100236588 | 3300006358 | Bacteria | 1587 |
| 325 | Ga0068871_100454877 | 3300006358 | Bacteria | 1148 |
| 326 | Ga0075428_100002752 | 3300006844 | Bacteria | 19148 |
| 327 | Ga0075428_100004009 | 3300006844 | Bacteria | 16165 |
| 328 | Ga0075428_100028795 | 3300006844 | Bacteria | 6147 |
| 329 | Ga0075428_100417594 | 3300006844 | Bacteria | 1437 |
| 330 | Ga0075428_100537555 | 3300006844 | Bacteria | 1250 |
| 331 | Ga0075428_100708019 | 3300006844 | Bacteria | 1073 |
| 332 | Ga0075430_100071305 | 3300006846 | Bacteria | 2914 |
| 333 | Ga0075430_100156559 | 3300006846 | Bacteria | 1896 |
| 334 | Ga0075430_100600522 | 3300006846 | Bacteria | 908 |
| 335 | Ga0075431_100001262 | 3300006847 | Bacteria | 23036 |
| 336 | Ga0075431_100001307 | 3300006847 | Bacteria | 22785 |
| 337 | Ga0075431_100032233 | 3300006847 | Bacteria | 5400 |
| 338 | Ga0075431_100052804 | 3300006847 | Bacteria | 4190 |
| 339 | Ga0075431_100172567 | 3300006847 | Bacteria | 2221 |
| 340 | Ga0075431_100254623 | 3300006847 | Bacteria | 1783 |
| 341 | Ga0075431_100435942 | 3300006847 | Bacteria | 1308 |
| 342 | Ga0075431_100673543 | 3300006847 | Bacteria | 1013 |
| 343 | Ga0075433_10027105 | 3300006852 | Bacteria | 4857 |
| 344 | Ga0075434_100018862 | 3300006871 | Bacteria | 6667 |
| 345 | Ga0075434_100034912 | 3300006871 | Bacteria | 4970 |
| 346 | Ga0075434_100047718 | 3300006871 | Bacteria | 4249 |
| 347 | Ga0075434_100160823 | 3300006871 | Bacteria | 2265 |
| 348 | Ga0075434_100402772 | 3300006871 | Bacteria | 1389 |
| 349 | Ga0075434_100456519 | 3300006871 | Bacteria | 1299 |
| 350 | Ga0075429_100002424 | 3300006880 | Bacteria | 15702 |
| 351 | Ga0075429_100022083 | 3300006880 | Bacteria | 5520 |
| 352 | Ga0075429_100042256 | 3300006880 | Bacteria | 3968 |
| 353 | Ga0068865_100069379 | 3300006881 | Bacteria | 2494 |
| 354 | Ga0075436_100004853 | 3300006914 | Bacteria | 9238 |
| 355 | Ga0075436_100004980 | 3300006914 | Bacteria | 9129 |
| 356 | Ga0075436_100047313 | 3300006914 | Bacteria | 2967 |
| 357 | Ga0075436_100066367 | 3300006914 | Bacteria | 2494 |
| 358 | Ga0097620_100009249 | 3300006931 | Bacteria | 9949 |
| 359 | Ga0097620_100013367 | 3300006931 | Bacteria | 8231 |
| 360 | Ga0097620_100120143 | 3300006931 | Bacteria | 2694 |
| 361 | Ga0079104_1004255 | 3300006946 | Bacteria | 6220 |
| 362 | Ga0099826_10077084 | 3300006948 | Bacteria | 2092 |
| 363 | Ga0075435_100044729 | 3300007076 | Bacteria | 3547 |
| 364 | Ga0075435_100100777 | 3300007076 | Bacteria | 2393 |
| 365 | Ga0075435_100116551 | 3300007076 | Bacteria | 2225 |
| 366 | Ga0099795_10033345 | 3300007788 | Bacteria | 1788 |
| 367 | Ga0105251_10051618 | 3300009011 | Bacteria | 1960 |
| 368 | Ga0105250_10068692 | 3300009092 | Bacteria | 1430 |
| 369 | Ga0105240_10048596 | 3300009093 | Bacteria | 5361 |
| 370 | Ga0105240_10067454 | 3300009093 | Bacteria | 4434 |
| 371 | Ga0105240_10220694 | 3300009093 | Bacteria | 2209 |
| 372 | Ga0105240_10584168 | 3300009093 | Bacteria | 1232 |
| 373 | Ga0111539_10001242 | 3300009094 | Bacteria | 33925 |
| 374 | Ga0111539_10026961 | 3300009094 | Bacteria | 7019 |
| 375 | Ga0111539_10063135 | 3300009094 | Bacteria | 4383 |
| 376 | Ga0111539_10181896 | 3300009094 | Bacteria | 2455 |
| 377 | Ga0111539_10226878 | 3300009094 | Bacteria | 2175 |
| 378 | Ga0111539_10349014 | 3300009094 | Bacteria | 1722 |
| 379 | Ga0105245_10004930 | 3300009098 | Bacteria | 11739 |
| 380 | Ga0105245_10017425 | 3300009098 | Bacteria | 6267 |
| 381 | Ga0105245_10059791 | 3300009098 | Bacteria | 3432 |
| 382 | Ga0105245_10147155 | 3300009098 | Bacteria | 2223 |
| 383 | Ga0105247_10000879 | 3300009101 | Bacteria | 22695 |
| 384 | Ga0105247_10017227 | 3300009101 | Bacteria | 4336 |
| 385 | Ga0105247_10061884 | 3300009101 | Bacteria | 2321 |
| 386 | Ga0105247_10097310 | 3300009101 | Bacteria | 1877 |
| 387 | Ga0105247_10237677 | 3300009101 | Bacteria | 1240 |
| 388 | Ga0114129_10000485 | 3300009147 | Bacteria | 48038 |
| 389 | Ga0114129_10009810 | 3300009147 | Bacteria | 13655 |
| 390 | Ga0114129_10110544 | 3300009147 | Bacteria | 3793 |
| 391 | Ga0114129_10385094 | 3300009147 | Bacteria | 1851 |
| 392 | Ga0114129_10473597 | 3300009147 | Bacteria | 1639 |
| 393 | Ga0114129_10492794 | 3300009147 | Bacteria | 1601 |
| 394 | Ga0114129_11128352 | 3300009147 | Bacteria | 980 |
| 395 | Ga0105243_10000542 | 3300009148 | Bacteria | 38308 |
| 396 | Ga0105243_10020796 | 3300009148 | Bacteria | 4979 |
| 397 | Ga0105243_10046042 | 3300009148 | Bacteria | 3429 |
| 398 | Ga0105243_10187168 | 3300009148 | Bacteria | 1805 |
| 399 | Ga0105243_10400458 | 3300009148 | Bacteria | 1275 |
| 400 | Ga0105243_10503446 | 3300009148 | Bacteria | 1148 |
| 401 | Ga0105243_11013988 | 3300009148 | Bacteria | 833 |
| 402 | Ga0105241_10005203 | 3300009174 | Bacteria | 9603 |
| 403 | Ga0105241_10006654 | 3300009174 | Bacteria | 8511 |
| 404 | Ga0105241_10009459 | 3300009174 | Bacteria | 7158 |
| 405 | Ga0105241_10023742 | 3300009174 | Bacteria | 4549 |
| 406 | Ga0105241_10088976 | 3300009174 | Bacteria | 2432 |
| 407 | Ga0105242_10009921 | 3300009176 | Bacteria | 7293 |
| 408 | Ga0105248_10001122 | 3300009177 | Bacteria | 29802 |
| 409 | Ga0105248_10028038 | 3300009177 | Bacteria | 6272 |
| 410 | Ga0105248_10091706 | 3300009177 | Bacteria | 3421 |
| 411 | Ga0105248_10115633 | 3300009177 | Bacteria | 3025 |
| 412 | Ga0105237_10002679 | 3300009545 | Bacteria | 21844 |
| 413 | Ga0105237_10039522 | 3300009545 | Bacteria | 4762 |
| 414 | Ga0105237_10166816 | 3300009545 | Bacteria | 2201 |
| 415 | Ga0105238_10038335 | 3300009551 | Bacteria | 4867 |
| 416 | Ga0105238_10100546 | 3300009551 | Bacteria | 2875 |
| 417 | Ga0105238_10104514 | 3300009551 | Bacteria | 2813 |
| 418 | Ga0105249_10000689 | 3300009553 | Bacteria | 30748 |
| 419 | Ga0105249_10002046 | 3300009553 | Bacteria | 17496 |
| 420 | Ga0105249_10014308 | 3300009553 | Bacteria | 7016 |
| 421 | Ga0105249_10345823 | 3300009553 | Bacteria | 1505 |
| 422 | Ga0105249_10745264 | 3300009553 | Bacteria | 1041 |
| 423 | Ga0099796_10003376 | 3300010159 | Bacteria | 3695 |
| 424 | Ga0105239_10037767 | 3300010375 | Bacteria | 5293 |
| 425 | Ga0105239_10100029 | 3300010375 | Bacteria | 3207 |
| 426 | Ga0105239_10318952 | 3300010375 | Bacteria | 1752 |
| 427 | Ga0105239_10397614 | 3300010375 | Bacteria | 1559 |
| 428 | Ga0105239_10528237 | 3300010375 | Bacteria | 1343 |
| 429 | Ga0105239_10564841 | 3300010375 | Bacteria | 1296 |
| 430 | Ga0105246_10000180 | 3300011119 | Bacteria | 31022 |
| 431 | Ga0105246_10039428 | 3300011119 | Bacteria | 3182 |
| 432 | Ga0105246_10055527 | 3300011119 | Bacteria | 2733 |
| 433 | Ga0105246_10131107 | 3300011119 | Bacteria | 1873 |
| 434 | Ga0105246_10236438 | 3300011119 | Bacteria | 1442 |
| 435 | Ga0105246_10277015 | 3300011119 | Bacteria | 1344 |
| 436 | Ga0157373_10018836 | 3300013100 | Bacteria | 5023 |
| 437 | Ga0157371_10001681 | 3300013102 | Bacteria | 22591 |
| 438 | Ga0157370_10137728 | 3300013104 | Bacteria | 2274 |
| 439 | Ga0157370_10185361 | 3300013104 | Bacteria | 1932 |
| 440 | Ga0157370_10604171 | 3300013104 | Bacteria | 1004 |
| 441 | Ga0157369_10003861 | 3300013105 | Bacteria | 17813 |
| 442 | Ga0157369_10142128 | 3300013105 | Bacteria | 2539 |
| 443 | Ga0171462_1028 | 3300013250 | Bacteria | 110760 |
| 444 | Ga0157374_10006552 | 3300013296 | Bacteria | 9889 |
| 445 | Ga0157374_10082150 | 3300013296 | Bacteria | 3059 |
| 446 | Ga0157378_10001537 | 3300013297 | Bacteria | 20848 |
| 447 | Ga0157378_10064448 | 3300013297 | Bacteria | 3278 |
| 448 | Ga0157378_10567714 | 3300013297 | Bacteria | 1142 |
| 449 | Ga0163162_10001513 | 3300013306 | Bacteria | 21645 |
| 450 | Ga0163162_10031192 | 3300013306 | Bacteria | 5286 |
| 451 | Ga0163162_10275774 | 3300013306 | Bacteria | 1814 |
| 452 | Ga0163162_10618809 | 3300013306 | Bacteria | 1208 |
| 453 | Ga0157372_10008591 | 3300013307 | Bacteria | 10854 |
| 454 | Ga0157372_10008951 | 3300013307 | Bacteria | 10638 |
| 455 | Ga0157372_10345374 | 3300013307 | Bacteria | 1734 |
| 456 | Ga0157375_10001949 | 3300013308 | Bacteria | 17792 |
| 457 | Ga0157375_10722129 | 3300013308 | Bacteria | 1149 |
| 458 | Ga0163163_10032343 | 3300014325 | Bacteria | 5051 |
| 459 | Ga0163163_10071104 | 3300014325 | Bacteria | 3466 |
| 460 | Ga0163163_10113169 | 3300014325 | Bacteria | 2744 |
| 461 | Ga0157380_10001442 | 3300014326 | Bacteria | 15562 |
| 462 | Ga0157380_10011537 | 3300014326 | Bacteria | 6385 |
| 463 | Ga0157380_10025674 | 3300014326 | Bacteria | 4469 |
| 464 | Ga0157380_10073492 | 3300014326 | Bacteria | 2772 |
| 465 | Ga0157380_10203036 | 3300014326 | Bacteria | 1760 |
| 466 | Ga0157380_10226940 | 3300014326 | Bacteria | 1674 |
| 467 | Ga0182008_10226534 | 3300014497 | Bacteria | 958 |
| 468 | Ga0157377_10008396 | 3300014745 | Bacteria | 5035 |
| 469 | Ga0157377_10013535 | 3300014745 | Bacteria | 4130 |
| 470 | Ga0157377_10077333 | 3300014745 | Bacteria | 1937 |
| 471 | Ga0157377_10376092 | 3300014745 | Bacteria | 960 |
| 472 | Ga0157379_10006845 | 3300014968 | Bacteria | 9853 |
| 473 | Ga0157379_10009632 | 3300014968 | Bacteria | 8410 |
| 474 | Ga0157379_10029045 | 3300014968 | Bacteria | 4917 |
| 475 | Ga0157379_10030444 | 3300014968 | Bacteria | 4804 |
| 476 | Ga0157379_10143031 | 3300014968 | Bacteria | 2156 |
| 477 | Ga0157376_10000456 | 3300014969 | Bacteria | 26374 |
| 478 | Ga0157376_10047623 | 3300014969 | Bacteria | 3540 |
| 479 | Ga0157376_10117584 | 3300014969 | Bacteria | 2351 |
| 480 | Ga0157376_10509418 | 3300014969 | Bacteria | 1184 |
| 481 | Ga0157376_10683581 | 3300014969 | Bacteria | 1030 |
| 482 | Ga0182005_1014359 | 3300015265 | Bacteria | 2216 |
| 483 | Ga0182005_1050499 | 3300015265 | Bacteria | 1131 |
| 484 | Ga0163161_10019400 | 3300017792 | Bacteria | 4771 |
| 485 | Ga0163161_10034769 | 3300017792 | Bacteria | 3605 |
| 486 | Ga0206353_11139613 | 3300020082 | Bacteria | 2180 |
| 487 | Ga0214544_1000129 | 3300021320 | Bacteria | 108948 |
| 488 | Ga0214542_1000245 | 3300021321 | Bacteria | 90699 |
| 489 | Ga0214543_1000010 | 3300021327 | Bacteria | 364844 |
| 490 | Ga0213872_10133731 | 3300021361 | Bacteria | 1091 |
| 491 | Ga0213874_10112506 | 3300021377 | Bacteria | 916 |
| 492 | Ga0213876_10006894 | 3300021384 | Bacteria | 6193 |
| 493 | Ga0213876_10011881 | 3300021384 | Bacteria | 4642 |
| 494 | Ga0213876_10013939 | 3300021384 | Bacteria | 4260 |
| 495 | Ga0213875_10000705 | 3300021388 | Bacteria | 25714 |
| 496 | Ga0213875_10112025 | 3300021388 | Bacteria | 1274 |
| 497 | Ga0228711_1000007 | 3300022739 | Bacteria | 202413 |
| 498 | Ga0228710_1000007 | 3300022740 | Bacteria | 189104 |
| 499 | Ga0209436_103537 | 3300025208 | Bacteria | 4115 |
| 500 | Ga0207672_1002998 | 3300025223 | Bacteria | 978 |
| 501 | Ga0207425_1018745 | 3300025245 | Bacteria | 1498 |
| 502 | Ga0209026_1000002 | 3300025250 | Bacteria | 1136158 |
| 503 | Ga0209677_111792 | 3300025253 | Bacteria | 1339 |
| 504 | Ga0209148_1000038 | 3300025254 | Bacteria | 493744 |
| 505 | Ga0209148_1004788 | 3300025254 | Bacteria | 3240 |
| 506 | Ga0209759_1000062 | 3300025256 | Bacteria | 197996 |
| 507 | Ga0209233_1000027 | 3300025261 | Bacteria | 652089 |
| 508 | Ga0209233_1010583 | 3300025261 | Bacteria | 2756 |
| 509 | Ga0209455_1000068 | 3300025272 | Bacteria | 310024 |
| 510 | Ga0209673_1019323 | 3300025273 | Bacteria | 2450 |
| 511 | Ga0209130_1000029 | 3300025284 | Bacteria | 323399 |
| 512 | Ga0209130_1000062 | 3300025284 | Bacteria | 200367 |
| 513 | Ga0209675_1000554 | 3300025291 | Bacteria | 27190 |
| 514 | Ga0209676_1001711 | 3300025292 | Bacteria | 18937 |
| 515 | Ga0209025_1000014 | 3300025294 | Bacteria | 865448 |
| 516 | Ga0209025_1000033 | 3300025294 | Bacteria | 414511 |
| 517 | Ga0209025_1000787 | 3300025294 | Bacteria | 52060 |
| 518 | Ga0209025_1003796 | 3300025294 | Bacteria | 13816 |
| 519 | Ga0209025_1063950 | 3300025294 | Bacteria | 1354 |
| 520 | Ga0209564_1000017 | 3300025295 | Bacteria | 594063 |
| 521 | Ga0209564_1000077 | 3300025295 | Bacteria | 281592 |
| 522 | Ga0209564_1000275 | 3300025295 | Bacteria | 107884 |
| 523 | Ga0209564_1028903 | 3300025295 | Bacteria | 1758 |
| 524 | Ga0209758_1000024 | 3300025297 | Bacteria | 591966 |
| 525 | Ga0209758_1000641 | 3300025297 | Bacteria | 53250 |
| 526 | Ga0209758_1001779 | 3300025297 | Bacteria | 23875 |
| 527 | Ga0209758_1009659 | 3300025297 | Bacteria | 5944 |
| 528 | Ga0209758_1011523 | 3300025297 | Bacteria | 5105 |
| 529 | Ga0209050_1001363 | 3300025298 | Bacteria | 26748 |
| 530 | Ga0209256_1000057 | 3300025299 | Bacteria | 281592 |
| 531 | Ga0209256_1000102 | 3300025299 | Bacteria | 199097 |
| 532 | Ga0209256_1000649 | 3300025299 | Bacteria | 47340 |
| 533 | Ga0209256_1011304 | 3300025299 | Bacteria | 3590 |
| 534 | Ga0207426_1000074 | 3300025302 | Bacteria | 323399 |
| 535 | Ga0207426_1005362 | 3300025302 | Bacteria | 5886 |
| 536 | Ga0209257_1001606 | 3300025304 | Bacteria | 25871 |
| 537 | Ga0209257_1002758 | 3300025304 | Bacteria | 16612 |
| 538 | Ga0207697_10019433 | 3300025315 | Bacteria | 2783 |
| 539 | Ga0207697_10080644 | 3300025315 | Bacteria | 1371 |
| 540 | Ga0207656_10102101 | 3300025321 | Bacteria | 1316 |
| 541 | Ga0207656_10152788 | 3300025321 | Bacteria | 1094 |
| 542 | Ga0207696_1038406 | 3300025711 | Bacteria | 1413 |
| 543 | Ga0207653_10001874 | 3300025885 | Bacteria | 6732 |
| 544 | Ga0207682_10153648 | 3300025893 | Bacteria | 1039 |
| 545 | Ga0207692_10075709 | 3300025898 | Bacteria | 1786 |
| 546 | Ga0207642_10002234 | 3300025899 | Bacteria | 6015 |
| 547 | Ga0207642_10005653 | 3300025899 | Bacteria | 4097 |
| 548 | Ga0207710_10004276 | 3300025900 | Bacteria | 6251 |
| 549 | Ga0207710_10023510 | 3300025900 | Bacteria | 2649 |
| 550 | Ga0207688_10000758 | 3300025901 | Bacteria | 16064 |
| 551 | Ga0207688_10025034 | 3300025901 | Bacteria | 3275 |
| 552 | Ga0207688_10051576 | 3300025901 | Bacteria | 2304 |
| 553 | Ga0207647_10003290 | 3300025904 | Bacteria | 12131 |
| 554 | Ga0207647_10037505 | 3300025904 | Bacteria | 3072 |
| 555 | Ga0207647_10051475 | 3300025904 | Bacteria | 2545 |
| 556 | Ga0207685_10044057 | 3300025905 | Bacteria | 1685 |
| 557 | Ga0207685_10045708 | 3300025905 | Bacteria | 1662 |
| 558 | Ga0207699_10007735 | 3300025906 | Bacteria | 5261 |
| 559 | Ga0207699_10095438 | 3300025906 | Bacteria | 1875 |
| 560 | Ga0207699_10108838 | 3300025906 | Bacteria | 1772 |
| 561 | Ga0207699_10437124 | 3300025906 | Bacteria | 937 |
| 562 | Ga0207645_10003906 | 3300025907 | Bacteria | 11138 |
| 563 | Ga0207643_10279642 | 3300025908 | Bacteria | 1035 |
| 564 | Ga0207705_10083804 | 3300025909 | Bacteria | 2327 |
| 565 | Ga0207705_10131147 | 3300025909 | Bacteria | 1866 |
| 566 | Ga0207654_10016215 | 3300025911 | Bacteria | 3876 |
| 567 | Ga0207654_10027426 | 3300025911 | Bacteria | 3095 |
| 568 | Ga0207707_10031203 | 3300025912 | Bacteria | 4662 |
| 569 | Ga0207707_10035167 | 3300025912 | Bacteria | 4381 |
| 570 | Ga0207707_10195214 | 3300025912 | Bacteria | 1766 |
| 571 | Ga0207707_10446812 | 3300025912 | Bacteria | 1106 |
| 572 | Ga0207707_10495256 | 3300025912 | Bacteria | 1043 |
| 573 | Ga0207695_10036226 | 3300025913 | Bacteria | 5336 |
| 574 | Ga0207695_10066978 | 3300025913 | Bacteria | 3685 |
| 575 | Ga0207695_10525352 | 3300025913 | Bacteria | 1065 |
| 576 | Ga0207671_10092761 | 3300025914 | Bacteria | 2277 |
| 577 | Ga0207693_10000072 | 3300025915 | Bacteria | 89637 |
| 578 | Ga0207693_10132586 | 3300025915 | Bacteria | 1958 |
| 579 | Ga0207693_10138548 | 3300025915 | Bacteria | 1913 |
| 580 | Ga0207663_10002680 | 3300025916 | Bacteria | 8586 |
| 581 | Ga0207663_10024904 | 3300025916 | Bacteria | 3452 |
| 582 | Ga0207663_10078860 | 3300025916 | Bacteria | 2148 |
| 583 | Ga0207663_10246005 | 3300025916 | Bacteria | 1314 |
| 584 | Ga0207660_10091094 | 3300025917 | Bacteria | 2260 |
| 585 | Ga0207660_10113833 | 3300025917 | Bacteria | 2040 |
| 586 | Ga0207660_10473766 | 3300025917 | Bacteria | 1014 |
| 587 | Ga0207660_10560694 | 3300025917 | Bacteria | 929 |
| 588 | Ga0207662_10000313 | 3300025918 | Bacteria | 22248 |
| 589 | Ga0207662_10041438 | 3300025918 | Bacteria | 2711 |
| 590 | Ga0207662_10128287 | 3300025918 | Bacteria | 1597 |
| 591 | Ga0207662_10311449 | 3300025918 | Bacteria | 1049 |
| 592 | Ga0207657_10000027 | 3300025919 | Bacteria | 141750 |
| 593 | Ga0207657_10014193 | 3300025919 | Bacteria | 7789 |
| 594 | Ga0207657_10179129 | 3300025919 | Bacteria | 1714 |
| 595 | Ga0207649_10001170 | 3300025920 | Bacteria | 15823 |
| 596 | Ga0207652_10040020 | 3300025921 | Bacteria | 3980 |
| 597 | Ga0207652_10092944 | 3300025921 | Bacteria | 2654 |
| 598 | Ga0207652_10097708 | 3300025921 | Bacteria | 2589 |
| 599 | Ga0207652_10176198 | 3300025921 | Bacteria | 1920 |
| 600 | Ga0207652_10189606 | 3300025921 | Bacteria | 1849 |
| 601 | Ga0207646_10657379 | 3300025922 | Bacteria | 939 |
| 602 | Ga0207681_10004087 | 3300025923 | Bacteria | 9039 |
| 603 | Ga0207681_10347388 | 3300025923 | Bacteria | 1187 |
| 604 | Ga0207694_10412490 | 3300025924 | Bacteria | 1124 |
| 605 | Ga0207650_10017887 | 3300025925 | Bacteria | 4966 |
| 606 | Ga0207650_10049224 | 3300025925 | Bacteria | 3111 |
| 607 | Ga0207650_10428809 | 3300025925 | Bacteria | 1098 |
| 608 | Ga0207659_10025409 | 3300025926 | Bacteria | 3979 |
| 609 | Ga0207659_10037274 | 3300025926 | Bacteria | 3374 |
| 610 | Ga0207687_10018279 | 3300025927 | Bacteria | 4625 |
| 611 | Ga0207687_10027057 | 3300025927 | Bacteria | 3845 |
| 612 | Ga0207687_10060913 | 3300025927 | Bacteria | 2664 |
| 613 | Ga0207687_10536755 | 3300025927 | Bacteria | 980 |
| 614 | Ga0207700_10240244 | 3300025928 | Bacteria | 1543 |
| 615 | Ga0207700_10490004 | 3300025928 | Bacteria | 1087 |
| 616 | Ga0207664_10064083 | 3300025929 | Bacteria | 2938 |
| 617 | Ga0207664_10216951 | 3300025929 | Bacteria | 1657 |
| 618 | Ga0207664_10372458 | 3300025929 | Bacteria | 1267 |
| 619 | Ga0207644_10095577 | 3300025931 | Bacteria | 2222 |
| 620 | Ga0207644_10752778 | 3300025931 | Bacteria | 814 |
| 621 | Ga0207690_10036854 | 3300025932 | Bacteria | 3170 |
| 622 | Ga0207690_10079138 | 3300025932 | Bacteria | 2290 |
| 623 | Ga0207706_10000039 | 3300025933 | Bacteria | 132584 |
| 624 | Ga0207706_10006559 | 3300025933 | Bacteria | 10778 |
| 625 | Ga0207706_10073665 | 3300025933 | Bacteria | 3003 |
| 626 | Ga0207686_10002173 | 3300025934 | Bacteria | 10795 |
| 627 | Ga0207686_10006573 | 3300025934 | Bacteria | 6261 |
| 628 | Ga0207709_10008225 | 3300025935 | Bacteria | 5777 |
| 629 | Ga0207709_10101691 | 3300025935 | Bacteria | 1901 |
| 630 | Ga0207709_10109068 | 3300025935 | Bacteria | 1847 |
| 631 | Ga0207709_10199474 | 3300025935 | Bacteria | 1428 |
| 632 | Ga0207709_10209935 | 3300025935 | Bacteria | 1397 |
| 633 | Ga0207709_10379048 | 3300025935 | Bacteria | 1076 |
| 634 | Ga0207670_10004298 | 3300025936 | Bacteria | 7652 |
| 635 | Ga0207670_10011443 | 3300025936 | Bacteria | 5153 |
| 636 | Ga0207670_10027929 | 3300025936 | Bacteria | 3575 |
| 637 | Ga0207669_10041228 | 3300025937 | Bacteria | 2685 |
| 638 | Ga0207669_10071562 | 3300025937 | Bacteria | 2179 |
| 639 | Ga0207704_10007409 | 3300025938 | Bacteria | 5182 |
| 640 | Ga0207704_10046720 | 3300025938 | Bacteria | 2582 |
| 641 | Ga0207665_10000076 | 3300025939 | Bacteria | 63143 |
| 642 | Ga0207665_10073227 | 3300025939 | Bacteria | 2342 |
| 643 | Ga0207665_10175730 | 3300025939 | Bacteria | 1549 |
| 644 | Ga0207691_10001122 | 3300025940 | Bacteria | 26597 |
| 645 | Ga0207691_10003280 | 3300025940 | Bacteria | 15760 |
| 646 | Ga0207691_10028245 | 3300025940 | Bacteria | 5254 |
| 647 | Ga0207691_10221540 | 3300025940 | Bacteria | 1640 |
| 648 | Ga0207711_10010943 | 3300025941 | Bacteria | 7539 |
| 649 | Ga0207711_10036519 | 3300025941 | Bacteria | 4169 |
| 650 | Ga0207711_10308962 | 3300025941 | Bacteria | 1459 |
| 651 | Ga0207689_10004525 | 3300025942 | Bacteria | 12586 |
| 652 | Ga0207689_10020242 | 3300025942 | Bacteria | 5603 |
| 653 | Ga0207679_10005429 | 3300025945 | Bacteria | 7985 |
| 654 | Ga0207667_10305562 | 3300025949 | Bacteria | 1625 |
| 655 | Ga0207667_10354707 | 3300025949 | Bacteria | 1495 |
| 656 | Ga0207651_10021496 | 3300025960 | Bacteria | 3923 |
| 657 | Ga0207651_10377593 | 3300025960 | Bacteria | 1200 |
| 658 | Ga0207712_10174874 | 3300025961 | Bacteria | 1682 |
| 659 | Ga0207712_10420817 | 3300025961 | Bacteria | 1127 |
| 660 | Ga0207668_10000911 | 3300025972 | Bacteria | 17799 |
| 661 | Ga0207668_10052938 | 3300025972 | Bacteria | 2811 |
| 662 | Ga0207668_10130278 | 3300025972 | Bacteria | 1919 |
| 663 | Ga0207668_10351041 | 3300025972 | Bacteria | 1233 |
| 664 | Ga0207668_10534239 | 3300025972 | Bacteria | 1014 |
| 665 | Ga0207640_10002505 | 3300025981 | Bacteria | 9841 |
| 666 | Ga0207640_10008447 | 3300025981 | Bacteria | 5721 |
| 667 | Ga0207658_10018968 | 3300025986 | Bacteria | 4756 |
| 668 | Ga0207658_10075213 | 3300025986 | Bacteria | 2569 |
| 669 | Ga0207658_10299397 | 3300025986 | Bacteria | 1385 |
| 670 | Ga0207658_10468936 | 3300025986 | Bacteria | 1117 |
| 671 | Ga0207677_10002744 | 3300026023 | Bacteria | 9289 |
| 672 | Ga0207677_10063982 | 3300026023 | Bacteria | 2559 |
| 673 | Ga0207677_10272482 | 3300026023 | Bacteria | 1385 |
| 674 | Ga0207703_10014165 | 3300026035 | Bacteria | 6218 |
| 675 | Ga0207703_10022449 | 3300026035 | Bacteria | 4950 |
| 676 | Ga0207703_10024059 | 3300026035 | Bacteria | 4791 |
| 677 | Ga0207703_10025864 | 3300026035 | Bacteria | 4618 |
| 678 | Ga0207639_10018747 | 3300026041 | Bacteria | 4921 |
| 679 | Ga0207639_10050625 | 3300026041 | Bacteria | 3155 |
| 680 | Ga0207639_10093002 | 3300026041 | Bacteria | 2417 |
| 681 | Ga0207639_10126557 | 3300026041 | Bacteria | 2108 |
| 682 | Ga0207639_10181198 | 3300026041 | Bacteria | 1792 |
| 683 | Ga0207639_10252540 | 3300026041 | Bacteria | 1538 |
| 684 | Ga0207639_10691810 | 3300026041 | Bacteria | 946 |
| 685 | Ga0207678_10000034 | 3300026067 | Bacteria | 104888 |
| 686 | Ga0207678_10000098 | 3300026067 | Bacteria | 71425 |
| 687 | Ga0207678_10012927 | 3300026067 | Bacteria | 7326 |
| 688 | Ga0207678_10026827 | 3300026067 | Bacteria | 5024 |
| 689 | Ga0207678_10062963 | 3300026067 | Bacteria | 3188 |
| 690 | Ga0207678_10321104 | 3300026067 | Bacteria | 1332 |
| 691 | Ga0207678_10379037 | 3300026067 | Bacteria | 1223 |
| 692 | Ga0207678_10417385 | 3300026067 | Bacteria | 1163 |
| 693 | Ga0207708_10000351 | 3300026075 | Bacteria | 36153 |
| 694 | Ga0207708_10002109 | 3300026075 | Bacteria | 14648 |
| 695 | Ga0207708_10008714 | 3300026075 | Bacteria | 7510 |
| 696 | Ga0207708_10057680 | 3300026075 | Bacteria | 2963 |
| 697 | Ga0207708_10267251 | 3300026075 | Bacteria | 1382 |
| 698 | Ga0207708_10304078 | 3300026075 | Bacteria | 1298 |
| 699 | Ga0207708_10329468 | 3300026075 | Bacteria | 1248 |
| 700 | Ga0207708_10705305 | 3300026075 | Bacteria | 863 |
| 701 | Ga0207702_10063631 | 3300026078 | Bacteria | 3155 |
| 702 | Ga0207702_10829747 | 3300026078 | Bacteria | 914 |
| 703 | Ga0207641_10014819 | 3300026088 | Bacteria | 6391 |
| 704 | Ga0207641_10056855 | 3300026088 | Bacteria | 3326 |
| 705 | Ga0207641_10121619 | 3300026088 | Bacteria | 2330 |
| 706 | Ga0207641_10207084 | 3300026088 | Bacteria | 1812 |
| 707 | Ga0207648_10023624 | 3300026089 | Bacteria | 5504 |
| 708 | Ga0207648_10085717 | 3300026089 | Bacteria | 2748 |
| 709 | Ga0207648_10462568 | 3300026089 | Bacteria | 1156 |
| 710 | Ga0207648_10790025 | 3300026089 | Bacteria | 883 |
| 711 | Ga0207648_10841251 | 3300026089 | Bacteria | 856 |
| 712 | Ga0207676_10008149 | 3300026095 | Bacteria | 7451 |
| 713 | Ga0207676_10013451 | 3300026095 | Bacteria | 5877 |
| 714 | Ga0207676_10096940 | 3300026095 | Bacteria | 2435 |
| 715 | Ga0207676_10134988 | 3300026095 | Bacteria | 2104 |
| 716 | Ga0207676_10148084 | 3300026095 | Bacteria | 2018 |
| 717 | Ga0207674_10000154 | 3300026116 | Bacteria | 80902 |
| 718 | Ga0207674_10006620 | 3300026116 | Bacteria | 13615 |
| 719 | Ga0207674_10122740 | 3300026116 | Bacteria | 2564 |
| 720 | Ga0207674_10843174 | 3300026116 | Bacteria | 884 |
| 721 | Ga0207675_100000968 | 3300026118 | Bacteria | 28574 |
| 722 | Ga0207675_100002046 | 3300026118 | Bacteria | 20107 |
| 723 | Ga0207675_100005541 | 3300026118 | Bacteria | 12077 |
| 724 | Ga0207675_100118295 | 3300026118 | Bacteria | 2506 |
| 725 | Ga0207675_100212798 | 3300026118 | Bacteria | 1860 |
| 726 | Ga0207675_100257805 | 3300026118 | Bacteria | 1689 |
| 727 | Ga0207675_100307605 | 3300026118 | Bacteria | 1545 |
| 728 | Ga0207675_100409846 | 3300026118 | Bacteria | 1337 |
| 729 | Ga0207675_100621576 | 3300026118 | Bacteria | 1085 |
| 730 | Ga0207683_10000318 | 3300026121 | Bacteria | 43903 |
| 731 | Ga0207683_10007512 | 3300026121 | Bacteria | 9345 |
| 732 | Ga0207683_10013041 | 3300026121 | Bacteria | 7092 |
| 733 | Ga0207683_10154726 | 3300026121 | Bacteria | 2071 |
| 734 | Ga0207698_10048248 | 3300026142 | Bacteria | 3231 |
| 735 | Ga0207698_10085915 | 3300026142 | Bacteria | 2556 |
| 736 | Ga0207698_10201756 | 3300026142 | Bacteria | 1781 |
| 737 | Ga0207698_10746327 | 3300026142 | Bacteria | 977 |
| 738 | Ga0209281_1000128 | 3300027111 | Bacteria | 199265 |
| 739 | Ga0209589_1000109 | 3300027357 | Bacteria | 83533 |
| 740 | Ga0209489_100324 | 3300027361 | Bacteria | 83533 |
| 741 | Ga0209700_100355 | 3300027363 | Bacteria | 83533 |
| 742 | Ga0209282_1000034 | 3300027666 | Bacteria | 140100 |
| 743 | Ga0209813_10004777 | 3300027866 | Bacteria | 3253 |
| 744 | Ga0209813_10005909 | 3300027866 | Bacteria | 3001 |
| 745 | Ga0209813_10013465 | 3300027866 | Bacteria | 2184 |
| 746 | Ga0207428_10005134 | 3300027907 | Bacteria | 12265 |
| 747 | Ga0207428_10024682 | 3300027907 | Bacteria | 5046 |
| 748 | Ga0207428_10447232 | 3300027907 | Bacteria | 942 |
| 749 | Ga0268266_10045688 | 3300028379 | Bacteria | 3747 |
| 750 | Ga0268266_10046654 | 3300028379 | Bacteria | 3709 |
| 751 | Ga0268266_10047527 | 3300028379 | Bacteria | 3677 |
| 752 | Ga0268266_10174209 | 3300028379 | Bacteria | 1955 |
| 753 | Ga0268266_10515280 | 3300028379 | Bacteria | 1143 |
| 754 | Ga0268266_10558110 | 3300028379 | Bacteria | 1098 |
| 755 | Ga0268266_10619889 | 3300028379 | Bacteria | 1040 |
| 756 | Ga0268265_10000953 | 3300028380 | Bacteria | 26598 |
| 757 | Ga0268265_10006463 | 3300028380 | Bacteria | 7944 |
| 758 | Ga0268265_10055081 | 3300028380 | Bacteria | 3020 |
| 759 | Ga0268264_10021041 | 3300028381 | Bacteria | 5331 |
| 760 | Ga0268264_10023542 | 3300028381 | Bacteria | 5021 |
| 761 | Ga0268264_10049360 | 3300028381 | Bacteria | 3501 |
| 762 | Ga0268264_10053666 | 3300028381 | Bacteria | 3363 |
| 763 | Ga0268264_10142210 | 3300028381 | Bacteria | 2141 |
| 764 | Ga0268264_10211642 | 3300028381 | Bacteria | 1780 |
| 765 | Ga0268264_10217171 | 3300028381 | Bacteria | 1758 |
| 766 | Ga0268264_10274210 | 3300028381 | Bacteria | 1577 |
| 767 | Ga0265337_1002458 | 3300028556 | Bacteria | 8480 |
| 768 | Ga0265326_10002501 | 3300028558 | Bacteria | 6192 |
| 769 | Ga0265319_1001332 | 3300028563 | Bacteria | 14906 |
| 770 | Ga0265319_1052270 | 3300028563 | Bacteria | 1345 |
| 771 | Ga0265334_10003334 | 3300028573 | Bacteria | 7323 |
| 772 | Ga0265323_10001242 | 3300028653 | Bacteria | 12822 |
| 773 | Ga0265322_10004943 | 3300028654 | Bacteria | 3954 |
| 774 | Ga0265336_10000759 | 3300028666 | Bacteria | 17132 |
| 775 | Ga0307517_10128077 | 3300028786 | Bacteria | 1842 |
| 776 | Ga0265338_10000013 | 3300028800 | Bacteria | 379065 |
| 777 | Ga0265338_10044403 | 3300028800 | Bacteria | 4104 |
| 778 | Ga0311001_1005417 | 3300029277 | Bacteria | 1088 |
| 779 | Ga0265324_10002070 | 3300029957 | Bacteria | 10639 |
| 780 | Ga0265332_10001497 | 3300031238 | Bacteria | 13004 |
| 781 | Ga0265332_10040356 | 3300031238 | Bacteria | 2021 |
| 782 | Ga0265328_10038517 | 3300031239 | Bacteria | 1764 |
| 783 | Ga0265320_10045755 | 3300031240 | Bacteria | 2148 |
| 784 | Ga0265325_10002054 | 3300031241 | Bacteria | 13818 |
| 785 | Ga0265325_10059310 | 3300031241 | Bacteria | 1946 |
| 786 | Ga0265325_10067459 | 3300031241 | Bacteria | 1803 |
| 787 | Ga0265325_10073588 | 3300031241 | Bacteria | 1710 |
| 788 | Ga0265325_10076394 | 3300031241 | Bacteria | 1671 |
| 789 | Ga0265329_10026525 | 3300031242 | Bacteria | 1908 |
| 790 | Ga0265340_10000092 | 3300031247 | Bacteria | 42341 |
| 791 | Ga0265340_10000387 | 3300031247 | Bacteria | 23480 |
| 792 | Ga0265340_10007981 | 3300031247 | Bacteria | 5735 |
| 793 | Ga0265340_10008859 | 3300031247 | Bacteria | 5421 |
| 794 | Ga0265340_10012700 | 3300031247 | Bacteria | 4445 |
| 795 | Ga0265339_10002236 | 3300031249 | Bacteria | 13993 |
| 796 | Ga0265339_10003394 | 3300031249 | Bacteria | 11143 |
| 797 | Ga0265339_10089342 | 3300031249 | Bacteria | 1617 |
| 798 | Ga0265339_10119703 | 3300031249 | Bacteria | 1355 |
| 799 | Ga0265331_10035492 | 3300031250 | Bacteria | 2453 |
| 800 | Ga0265316_10003669 | 3300031344 | Bacteria | 15465 |
| 801 | Ga0265316_10159731 | 3300031344 | Bacteria | 1685 |
| 802 | Ga0265316_10175508 | 3300031344 | Bacteria | 1597 |
| 803 | Ga0265316_10208821 | 3300031344 | Bacteria | 1445 |
| 804 | Ga0307509_10008703 | 3300031507 | Bacteria | 12855 |
| 805 | Ga0307508_10014226 | 3300031616 | Bacteria | 7256 |
| 806 | Ga0316579_10033997 | 3300031691 | Bacteria | 2343 |
| 807 | Ga0265314_10024931 | 3300031711 | Bacteria | 4522 |
| 808 | Ga0265314_10070839 | 3300031711 | Bacteria | 2335 |
| 809 | Ga0265314_10080214 | 3300031711 | Bacteria | 2155 |
| 810 | Ga0265314_10243145 | 3300031711 | Bacteria | 1037 |
| 811 | Ga0265314_10289955 | 3300031711 | Bacteria | 922 |
| 812 | Ga0265342_10000110 | 3300031712 | Bacteria | 91145 |
| 813 | Ga0265342_10024465 | 3300031712 | Bacteria | 3811 |
| 814 | Ga0316576_10170912 | 3300031727 | Bacteria | 1640 |
| 815 | Ga0316578_10089745 | 3300031728 | Bacteria | 1834 |
| 816 | Ga0307516_10002008 | 3300031730 | Bacteria | 27759 |
| 817 | Ga0307516_10037683 | 3300031730 | Bacteria | 4831 |
| 818 | Ga0307516_10048488 | 3300031730 | Bacteria | 4179 |
| 819 | Ga0315914_1000010 | 3300031967 | Bacteria | 171642 |
| 820 | Ga0307415_100137250 | 3300032126 | Bacteria | 1862 |
| 821 | Ga0307415_100653782 | 3300032126 | Bacteria | 943 |
| 822 | Ga0315913_1000005 | 3300033430 | Bacteria | 171651 |
| 823 | Ga0315915_1000012 | 3300033464 | Bacteria | 199284 |
| 824 | Ga0316592_1002973 | 3300033524 | Bacteria | 2995 |
| 825 | Ga0316588_1000463 | 3300033528 | Bacteria | 5464 |
| 826 | Ga0373950_0027060 | 3300034818 | Bacteria | 1044 |
| 827 | Ga0373944_0054736 | 3300035089 | Bacteria | 1266 |
| 828 | Ga0373949_0032485 | 3300035090 | Bacteria | 1250 |
| 829 | Ga0373952_0019312 | 3300035092 | Bacteria | 1417 |
| 830 | Ga0373923_0000977 | 3300035111 | Bacteria | 7693 |
| 831 | Ga0373932_0016593 | 3300035112 | Bacteria | 1881 |
| 832 | Ga0373932_0048969 | 3300035112 | Bacteria | 1247 |
| 833 | Ga0373932_0126676 | 3300035112 | Bacteria | 857 |
| 834 | Ga0373936_0008424 | 3300035113 | Bacteria | 3882 |
| 835 | Ga0373936_0038387 | 3300035113 | Bacteria | 1914 |
| 836 | Ga0373936_0137465 | 3300035113 | Bacteria | 1053 |
| 837 | Ga0373939_0028623 | 3300035114 | Bacteria | 1587 |
| 838 | Ga0373939_0034687 | 3300035114 | Bacteria | 1482 |
| 839 | Ga0373939_0077687 | 3300035114 | Bacteria | 1096 |
| 840 | Ga0373941_0052552 | 3300035115 | Bacteria | 1300 |
| 841 | Ga0373941_0117662 | 3300035115 | Bacteria | 944 |
| 842 | Ga0373941_0121937 | 3300035115 | Bacteria | 930 |
| 843 | Ga0373945_0037106 | 3300035116 | Bacteria | 1748 |
| 844 | Ga0373953_0014188 | 3300035117 | Bacteria | 2861 |
| 845 | Ga0373957_0044855 | 3300035120 | Bacteria | 1674 |
| 846 | Ga0373943_0004711 | 3300035170 | Bacteria | 6168 |
| 847 | Ga0373943_0011784 | 3300035170 | Bacteria | 3935 |
| 848 | Ga0373943_0177040 | 3300035170 | Bacteria | 1170 |
| 849 | Ga0373943_0206992 | 3300035170 | Bacteria | 1088 |
| 850 | Ga0373946_0000291 | 3300035171 | Bacteria | 16138 |
| 851 | Ga0373946_0022235 | 3300035171 | Bacteria | 2466 |
| 852 | Ga0373955_0050928 | 3300035172 | Bacteria | 2254 |
| 853 | Ga0373942_0018872 | 3300035207 | Bacteria | 1716 |
| 854 | Ga0373942_0041948 | 3300035207 | Bacteria | 1253 |
| 855 | Ga0373962_0004822 | 3300035242 | Bacteria | 3257 |
| 856 | Ga0373962_0108324 | 3300035242 | Bacteria | 874 |
| 857 | Ga0373924_0011374 | 3300035410 | Bacteria | 3304 |
| 858 | Ga0373931_0001201 | 3300035691 | Bacteria | 11071 |
| 859 | Ga0373931_0004184 | 3300035691 | Bacteria | 6565 |
| 860 | Ga0373931_0010541 | 3300035691 | Bacteria | 4443 |
| 861 | Ga0373931_0046697 | 3300035691 | Bacteria | 2290 |
| 862 | Ga0373931_0051624 | 3300035691 | Bacteria | 2191 |
| 863 | Ga0373935_0006219 | 3300035692 | Bacteria | 7106 |
| 864 | Ga0373935_0023117 | 3300035692 | Bacteria | 3818 |
| 865 | Ga0373927_0007441 | 3300035695 | Bacteria | 7414 |
| 866 | Ga0373927_0008160 | 3300035695 | Bacteria | 7063 |
| 867 | Ga0373927_0040539 | 3300035695 | Bacteria | 3020 |
| 868 | Ga0373927_0314224 | 3300035695 | Bacteria | 1031 |
| 869 | Ga0373933_0017826 | 3300035724 | Bacteria | 3986 |
| 870 | Ga0373947_0001133 | 3300035725 | Bacteria | 16379 |
| 871 | Ga0373947_0006846 | 3300035725 | Bacteria | 6610 |
| 872 | Ga0373947_0093089 | 3300035725 | Bacteria | 1883 |
| 873 | Ga0373947_0249626 | 3300035725 | Bacteria | 1173 |
| 874 | Ga0373947_0267782 | 3300035725 | Bacteria | 1133 |
| 875 | Ga0373937_0000031 | 3300036401 | Bacteria | 120533 |
| 876 | Ga0373937_0058789 | 3300036401 | Bacteria | 3532 |
| 877 | Ga0373937_0480412 | 3300036401 | Bacteria | 1180 |
| 878 | Ga0373937_0529728 | 3300036401 | Bacteria | 1119 |
| 879 | Ga0373925_0000063 | 3300037068 | Bacteria | 114809 |
| 880 | Ga0373925_0016226 | 3300037068 | Bacteria | 5391 |
| 881 | Ga0373925_0029499 | 3300037068 | Bacteria | 4025 |
| 882 | Ga0373925_0030675 | 3300037068 | Bacteria | 3947 |
| 883 | Ga0373925_0109804 | 3300037068 | Bacteria | 2129 |
| 884 | Ga0373925_0200227 | 3300037068 | Bacteria | 1588 |
| 885 | Ga0395899_0000059 | 3300037312 | Bacteria | 213004 |
| 886 | Ga0395900_0000017 | 3300037418 | Bacteria | 369602 |
| 887 | Ga0395900_0030214 | 3300037418 | Bacteria | 5562 |
| 888 | Ga0395900_0155881 | 3300037418 | Bacteria | 2332 |
| 889 | Ga0395900_0187810 | 3300037418 | Bacteria | 2097 |
| 890 | Ga0395898_0000030 | 3300037466 | Bacteria | 369577 |
| 891 | Ga0395898_0013945 | 3300037466 | Bacteria | 8260 |
| 892 | Ga0395898_0014421 | 3300037466 | Bacteria | 8118 |
| 893 | Ga0395898_0169502 | 3300037466 | Bacteria | 2087 |
| 894 | Ga0395905_0000056 | 3300037471 | Bacteria | 209230 |
| 895 | Ga0395905_0000553 | 3300037471 | Bacteria | 51124 |
| 896 | Ga0395905_0048020 | 3300037471 | Bacteria | 4000 |
| 897 | Ga0395905_0133490 | 3300037471 | Bacteria | 2335 |
| 898 | Ga0395905_0212066 | 3300037471 | Bacteria | 1814 |
| 899 | Ga0395905_0274356 | 3300037471 | Bacteria | 1572 |
| 900 | Ga0395905_0431606 | 3300037471 | Bacteria | 1214 |
| 901 | Ga0436364_0275973 | 3300037853 | Bacteria | 1033 |
| 902 | Ga0436364_0499842 | 3300037853 | Bacteria | 4479 |
| 903 | Ga0436364_0702728 | 3300037853 | Bacteria | 2719 |
| 904 | Ga0436364_0821808 | 3300037853 | Bacteria | 934 |
| 905 | Ga0436364_1163562 | 3300037853 | Bacteria | 1925 |
| 906 | Ga0436364_1172199 | 3300037853 | Bacteria | 2840 |
| 907 | Ga0436364_1338890 | 3300037853 | Bacteria | 1951 |
| 908 | Ga0395901_0000015 | 3300038443 | Bacteria | 373388 |
| 909 | Ga0395901_0055418 | 3300038443 | Bacteria | 4123 |
| 910 | Ga0395901_0082529 | 3300038443 | Bacteria | 3358 |
| 911 | Ga0395901_0105451 | 3300038443 | Bacteria | 2958 |
| 912 | Ga0395901_0540556 | 3300038443 | Bacteria | 1182 |
| 913 | Ga0242420_022981 | 3300038996 | Bacteria | 1124 |
| 914 | Ga0237816_00384 | 3300039145 | Bacteria | 3773 |
| 915 | Ga0436365_0125505 | 3300039437 | Bacteria | 2043 |
| 916 | Ga0436365_0235359 | 3300039437 | Bacteria | 30074 |
| 917 | Ga0436365_0247443 | 3300039437 | Bacteria | 7551 |
| 918 | Ga0436365_0443046 | 3300039437 | Bacteria | 5941 |
| 919 | Ga0436365_0876105 | 3300039437 | Bacteria | 4184 |
| 920 | Ga0436365_1009793 | 3300039437 | Bacteria | 825 |
| 921 | Ga0436365_1031004 | 3300039437 | Bacteria | 1058 |
| 922 | Ga0436365_1620828 | 3300039437 | Bacteria | 1416 |
| 923 | Ga0436360_0612193 | 3300039438 | Bacteria | 1375 |
| 924 | Ga0436360_1365466 | 3300039438 | Bacteria | 1231 |
| 925 | Ga0436361_0333837 | 3300039447 | Bacteria | 2443 |
| 926 | Ga0436361_1169094 | 3300039447 | Bacteria | 2516 |
| 927 | Ga0436361_1179362 | 3300039447 | Bacteria | 2202 |
| 928 | Ga0436363_0745057 | 3300039450 | Bacteria | 909 |
| 929 | Ga0436363_0845878 | 3300039450 | Bacteria | 2416 |
| 930 | Ga0436363_1374215 | 3300039450 | Bacteria | 1691 |
| 931 | Ga0436363_1425116 | 3300039450 | Bacteria | 5972 |
| 932 | Ga0436363_1588421 | 3300039450 | Bacteria | 1430 |
| 933 | Ga0436363_1691519 | 3300039450 | Bacteria | 6057 |
| 934 | Ga0436362_0936835 | 3300039453 | Bacteria | 1589 |
| 935 | Ga0436362_0983745 | 3300039453 | Bacteria | 3050 |
| 936 | Ga0439433_0015502 | 3300041999 | Bacteria | 1683 |
| 937 | Ga0439451_009314 | 3300042009 | Bacteria | 1987 |
| 938 | Ga0450889_001635 | 3300042144 | Bacteria | 2282 |
| 939 | Ga0439435_0013585 | 3300042436 | Bacteria | 1995 |
| 940 | Ga0439444_0006155 | 3300042437 | Bacteria | 1805 |
| 941 | Ga0439460_0038896 | 3300042461 | Bacteria | 1389 |
| 942 | Ga0439440_0070336 | 3300042993 | Bacteria | 910 |
| 943 | Ga0466966_0014115 | 3300044684 | Bacteria | 5288 |
| 944 | Ga0466960_0226163 | 3300044901 | Bacteria | 1031 |
| 945 | Ga0466959_0014113 | 3300045049 | Bacteria | 5797 |
| 946 | Ga0466959_0286409 | 3300045049 | Bacteria | 1130 |
| 947 | Ga0466958_0011243 | 3300045836 | Bacteria | 5039 |
| 948 | Ga0466967_0349558 | 3300045976 | Bacteria | 1431 |
| 949 | Ga0495592_0000072 | 3300046454 | Bacteria | 91917 |
| 950 | Ga0495592_0035668 | 3300046454 | Bacteria | 3748 |
| 951 | Ga0495603_0000872 | 3300046455 | Bacteria | 17316 |
| 952 | Ga0495603_0030425 | 3300046455 | Bacteria | 3251 |
| 953 | Ga0495603_0035030 | 3300046455 | Bacteria | 3017 |
| 954 | Ga0495590_0129834 | 3300046457 | Bacteria | 906 |
| 955 | Ga0495629_0013500 | 3300046459 | Bacteria | 5892 |
| 956 | Ga0495629_0031933 | 3300046459 | Bacteria | 3728 |
| 957 | Ga0495629_0129920 | 3300046459 | Bacteria | 1755 |
| 958 | Ga0495629_0213149 | 3300046459 | Bacteria | 1333 |
| 959 | Ga0495629_0255501 | 3300046459 | Bacteria | 1205 |
| 960 | Ga0495641_0084465 | 3300046461 | Bacteria | 1421 |
| 961 | Ga0495651_0000595 | 3300046462 | Bacteria | 28008 |
| 962 | Ga0495651_0321323 | 3300046462 | Bacteria | 1032 |
| 963 | Ga0495651_0341694 | 3300046462 | Bacteria | 992 |
| 964 | Ga0495653_0000020 | 3300046463 | Bacteria | 175274 |
| 965 | Ga0495653_0080502 | 3300046463 | Bacteria | 2410 |
| 966 | Ga0495580_0002021 | 3300046472 | Bacteria | 17851 |
| 967 | Ga0495580_0008232 | 3300046472 | Bacteria | 8297 |
| 968 | Ga0495580_0040401 | 3300046472 | Bacteria | 3331 |
| 969 | Ga0495580_0066496 | 3300046472 | Bacteria | 2523 |
| 970 | Ga0495582_0009149 | 3300046473 | Bacteria | 5463 |
| 971 | Ga0495582_0014054 | 3300046473 | Bacteria | 4407 |
| 972 | Ga0495582_0043622 | 3300046473 | Bacteria | 2470 |
| 973 | Ga0495605_0014755 | 3300046474 | Bacteria | 4267 |
| 974 | Ga0495639_0001587 | 3300046475 | Bacteria | 10143 |
| 975 | Ga0495639_0228104 | 3300046475 | Bacteria | 917 |
| 976 | Ga0495662_0058783 | 3300046476 | Bacteria | 1857 |
| 977 | Ga0495664_0000006 | 3300046477 | Bacteria | 407031 |
| 978 | Ga0495664_0071738 | 3300046477 | Bacteria | 2069 |
| 979 | Ga0495584_0012859 | 3300046491 | Bacteria | 4272 |
| 980 | Ga0495584_0044716 | 3300046491 | Bacteria | 2234 |
| 981 | Ga0495584_0110763 | 3300046491 | Bacteria | 1389 |
| 982 | Ga0495594_0003039 | 3300046499 | Bacteria | 8692 |
| 983 | Ga0495596_0085134 | 3300046500 | Bacteria | 1227 |
| 984 | Ga0495583_0035766 | 3300046506 | Bacteria | 2367 |
| 985 | Ga0495608_0000002 | 3300046511 | Bacteria | 376403 |
| 986 | Ga0495616_0061849 | 3300046513 | Bacteria | 1835 |
| 987 | Ga0495618_0000017 | 3300046514 | Bacteria | 143326 |
| 988 | Ga0495628_0000004 | 3300046516 | Bacteria | 462184 |
| 989 | Ga0495628_0058832 | 3300046516 | Bacteria | 3019 |
| 990 | Ga0495628_0121517 | 3300046516 | Bacteria | 2003 |
| 991 | Ga0495628_0462378 | 3300046516 | Bacteria | 920 |
| 992 | Ga0495630_0001747 | 3300046517 | Bacteria | 15169 |
| 993 | Ga0495630_0083557 | 3300046517 | Bacteria | 2411 |
| 994 | Ga0495630_0359047 | 3300046517 | Bacteria | 1115 |
| 995 | Ga0495631_0037033 | 3300046518 | Bacteria | 2175 |
| 996 | Ga0495637_0032744 | 3300046520 | Bacteria | 2288 |
| 997 | Ga0495648_0012530 | 3300046524 | Bacteria | 6318 |
| 998 | Ga0495652_0000007 | 3300046529 | Bacteria | 418163 |
| 999 | Ga0495652_0028570 | 3300046529 | Bacteria | 4906 |
| 1000 | Ga0495652_0114470 | 3300046529 | Bacteria | 2164 |
| 1001 | Ga0495665_0004975 | 3300046531 | Bacteria | 7159 |
| 1002 | Ga0495665_0034806 | 3300046531 | Bacteria | 2694 |
| 1003 | Ga0495640_0000004 | 3300046533 | Bacteria | 357515 |
| 1004 | Ga0495587_0000002 | 3300046536 | Bacteria | 425485 |
| 1005 | Ga0495609_0089866 | 3300046538 | Bacteria | 1336 |
| 1006 | Ga0495645_0000008 | 3300046543 | Bacteria | 331530 |
| 1007 | Ga0495622_0002253 | 3300046557 | Bacteria | 9380 |
| 1008 | Ga0495622_0004419 | 3300046557 | Bacteria | 6529 |
| 1009 | Ga0495622_0018640 | 3300046557 | Bacteria | 3233 |
| 1010 | Ga0495622_0043283 | 3300046557 | Bacteria | 2094 |
| 1011 | Ga0495622_0111601 | 3300046557 | Bacteria | 1252 |
| 1012 | Ga0495667_0000010 | 3300046559 | Bacteria | 222698 |
| 1013 | Ga0495667_0026144 | 3300046559 | Bacteria | 3932 |
| 1014 | Ga0495656_0086783 | 3300046615 | Bacteria | 1424 |
| 1015 | Ga0495656_0161507 | 3300046615 | Bacteria | 1089 |
| 1016 | Ga0495656_0231568 | 3300046615 | Bacteria | 927 |
| 1017 | Ga0495668_0064356 | 3300046616 | Bacteria | 2019 |
| 1018 | Ga0495668_0265588 | 3300046616 | Bacteria | 940 |
| 1019 | Ga0495634_0000001 | 3300046642 | Bacteria | 303746 |
| 1020 | Ga0495634_0001869 | 3300046642 | Bacteria | 18118 |
| 1021 | Ga0495634_0074172 | 3300046642 | Bacteria | 2236 |
| 1022 | Ga0495634_0095237 | 3300046642 | Bacteria | 1929 |
| 1023 | Ga0495611_0132880 | 3300046648 | Bacteria | 1161 |
| 1024 | Ga0495625_0146735 | 3300046660 | Bacteria | 1588 |
| 1025 | Ga0495635_0000004 | 3300046663 | Bacteria | 388068 |
| 1026 | Ga0495635_0032326 | 3300046663 | Bacteria | 3630 |
| 1027 | Ga0495661_0074097 | 3300046665 | Bacteria | 1982 |
| 1028 | Ga0495661_0219838 | 3300046665 | Bacteria | 985 |
| 1029 | Ga0495588_0002382 | 3300046674 | Bacteria | 8046 |
| 1030 | Ga0495588_0065551 | 3300046674 | Bacteria | 1884 |
| 1031 | Ga0495657_0000265 | 3300046675 | Bacteria | 47726 |
| 1032 | Ga0495657_0027279 | 3300046675 | Bacteria | 4033 |
| 1033 | Ga0495657_0073609 | 3300046675 | Bacteria | 2224 |
| 1034 | Ga0495599_0000003 | 3300046678 | Bacteria | 319085 |
| 1035 | Ga0495599_0061749 | 3300046678 | Bacteria | 2341 |
| 1036 | Ga0495623_0000009 | 3300046679 | Bacteria | 127758 |
| 1037 | Ga0495646_0000001 | 3300046680 | Bacteria | 403396 |
| 1038 | Ga0495647_0062155 | 3300046681 | Bacteria | 1476 |
| 1039 | Ga0495658_0001840 | 3300046683 | Bacteria | 10842 |
| 1040 | Ga0495658_0031541 | 3300046683 | Bacteria | 2887 |
| 1041 | Ga0495658_0048625 | 3300046683 | Bacteria | 2392 |
| 1042 | Ga0495658_0098402 | 3300046683 | Bacteria | 1742 |
| 1043 | Ga0495658_0118172 | 3300046683 | Bacteria | 1601 |
| 1044 | Ga0495658_0206799 | 3300046683 | Bacteria | 1225 |
| 1045 | Ga0495613_0006074 | 3300046689 | Bacteria | 9038 |
| 1046 | Ga0495613_0041421 | 3300046689 | Bacteria | 3411 |
| 1047 | Ga0495613_0260116 | 3300046689 | Bacteria | 1209 |
| 1048 | Ga0495613_0276643 | 3300046689 | Bacteria | 1166 |
| 1049 | Ga0495624_0030783 | 3300046690 | Bacteria | 3494 |
| 1050 | Ga0495624_0077669 | 3300046690 | Bacteria | 2059 |
| 1051 | Ga0495649_0044888 | 3300046694 | Bacteria | 2412 |
| 1052 | Ga0495649_0069411 | 3300046694 | Bacteria | 1890 |
| 1053 | Ga0495589_0067982 | 3300046794 | Bacteria | 1744 |
| 1054 | Ga0495589_0104639 | 3300046794 | Bacteria | 1368 |
| 1055 | Ga0495600_0000008 | 3300046809 | Bacteria | 147902 |
| 1056 | Ga0495600_0010717 | 3300046809 | Bacteria | 5698 |
| 1057 | Ga0495600_0041579 | 3300046809 | Bacteria | 2996 |
| 1058 | Ga0495581_0005894 | 3300047315 | Bacteria | 7106 |
| 1059 | Ga0495604_0000003 | 3300047317 | Bacteria | 464246 |
| 1060 | Ga0495604_0013870 | 3300047317 | Bacteria | 6427 |
| 1061 | Ga0495604_0029289 | 3300047317 | Bacteria | 4380 |
| 1062 | Ga0495604_0069459 | 3300047317 | Bacteria | 2670 |
| 1063 | Ga0495604_0235417 | 3300047317 | Bacteria | 1255 |
| 1064 | Ga0495674_0000021 | 3300047319 | Bacteria | 174056 |
| 1065 | Ga0495674_0024249 | 3300047319 | Bacteria | 5577 |
| 1066 | Ga0495674_0048481 | 3300047319 | Bacteria | 3759 |
| 1067 | Ga0495674_0085431 | 3300047319 | Bacteria | 2703 |
| 1068 | Ga0495674_0405671 | 3300047319 | Bacteria | 1100 |
| 1069 | Ga0495672_0026399 | 3300047320 | Bacteria | 3706 |
| 1070 | Ga0495676_0034639 | 3300047321 | Bacteria | 4234 |
| 1071 | Ga0495676_0070430 | 3300047321 | Bacteria | 2693 |
| 1072 | Ga0495676_0107454 | 3300047321 | Bacteria | 2054 |
| 1073 | Ga0495676_0244250 | 3300047321 | Bacteria | 1228 |
| 1074 | Ga0495676_0307605 | 3300047321 | Bacteria | 1067 |
| 1075 | Ga0495680_0000552 | 3300047322 | Bacteria | 42266 |
| 1076 | Ga0495680_0078439 | 3300047322 | Bacteria | 2499 |
| 1077 | Ga0495683_0012510 | 3300047323 | Bacteria | 4453 |
| 1078 | Ga0495687_020145 | 3300047443 | Bacteria | 3256 |
| 1079 | Ga0495675_0000581 | 3300047444 | Bacteria | 23541 |
| 1080 | Ga0495673_0035805 | 3300047469 | Bacteria | 2283 |
| 1081 | Ga0495684_0000003 | 3300047471 | Bacteria | 331335 |
| 1082 | Ga0495684_0065541 | 3300047471 | Bacteria | 2761 |
| 1083 | Ga0495686_0041614 | 3300047472 | Bacteria | 2925 |
| 1084 | Ga0495686_0193035 | 3300047472 | Bacteria | 1173 |
| 1085 | Ga0495686_0194100 | 3300047472 | Bacteria | 1169 |
| 1086 | Ga0495593_0000179 | 3300047673 | Bacteria | 32839 |
| 1087 | Ga0495593_0003265 | 3300047673 | Bacteria | 9726 |
| 1088 | Ga0495593_0227661 | 3300047673 | Bacteria | 935 |
| 1089 | Ga0495593_0234678 | 3300047673 | Bacteria | 919 |
| 1090 | Ga0495602_0000012 | 3300048088 | Bacteria | 200520 |
| 1091 | Ga0495602_0018907 | 3300048088 | Bacteria | 6860 |
| 1092 | Ga0495602_0299980 | 3300048088 | Bacteria | 1176 |
| 1093 | Ga0495602_0302882 | 3300048088 | Bacteria | 1169 |
| 1094 | Ga0495615_0016519 | 3300048090 | Bacteria | 1594 |
| 1095 | Ga0495626_0027147 | 3300048091 | Bacteria | 2785 |
| 1096 | Ga0495626_0089816 | 3300048091 | Bacteria | 1353 |
| 1097 | Ga0496100_0008478 | 3300048903 | Bacteria | 5734 |
| 1098 | Ga0496100_0010401 | 3300048903 | Bacteria | 5264 |
| 1099 | Ga0496100_0012941 | 3300048903 | Bacteria | 4797 |
| 1100 | Ga0496100_0017404 | 3300048903 | Bacteria | 4242 |
| 1101 | Ga0496100_0024025 | 3300048903 | Bacteria | 3711 |
| 1102 | Ga0496100_0027348 | 3300048903 | Bacteria | 3507 |
| 1103 | Ga0496100_0158517 | 3300048903 | Bacteria | 1620 |
| 1104 | Ga0496100_0249214 | 3300048903 | Bacteria | 1313 |
| 1105 | Ga0496100_0644846 | 3300048903 | Bacteria | 824 |
| 1106 | Ga0496101_0010920 | 3300048904 | Bacteria | 6010 |
| 1107 | Ga0496101_0027095 | 3300048904 | Bacteria | 3988 |
| 1108 | Ga0496101_0033222 | 3300048904 | Bacteria | 3637 |
| 1109 | Ga0496101_0046917 | 3300048904 | Bacteria | 3099 |
| 1110 | Ga0496101_0086815 | 3300048904 | Bacteria | 2321 |
| 1111 | Ga0496101_0090509 | 3300048904 | Bacteria | 2276 |
| 1112 | Ga0496101_0109979 | 3300048904 | Bacteria | 2073 |
| 1113 | Ga0496101_0126850 | 3300048904 | Bacteria | 1934 |
| 1114 | Ga0496101_0169733 | 3300048904 | Bacteria | 1676 |
| 1115 | Ga0496101_0530890 | 3300048904 | Bacteria | 930 |
| 1116 | Ga0496102_0004821 | 3300048905 | Bacteria | 11403 |
| 1117 | Ga0496102_0011587 | 3300048905 | Bacteria | 7607 |
| 1118 | Ga0496102_0014879 | 3300048905 | Bacteria | 6767 |
| 1119 | Ga0496102_0023806 | 3300048905 | Bacteria | 5441 |
| 1120 | Ga0496102_0024872 | 3300048905 | Bacteria | 5325 |
| 1121 | Ga0496102_0025489 | 3300048905 | Bacteria | 5265 |
| 1122 | Ga0496102_0034651 | 3300048905 | Bacteria | 4541 |
| 1123 | Ga0496102_0077614 | 3300048905 | Bacteria | 3056 |
| 1124 | Ga0496102_0106937 | 3300048905 | Bacteria | 2604 |
| 1125 | Ga0496102_0120995 | 3300048905 | Bacteria | 2445 |
| 1126 | Ga0496102_0618109 | 3300048905 | Bacteria | 1007 |
| 1127 | Ga0496103_0010759 | 3300048906 | Bacteria | 5413 |
| 1128 | Ga0496103_0015362 | 3300048906 | Bacteria | 4554 |
| 1129 | Ga0496103_0017250 | 3300048906 | Bacteria | 4318 |
| 1130 | Ga0496103_0030461 | 3300048906 | Bacteria | 3283 |
| 1131 | Ga0496103_0044726 | 3300048906 | Bacteria | 2729 |
| 1132 | Ga0496103_0053127 | 3300048906 | Bacteria | 2510 |
| 1133 | Ga0496103_0139030 | 3300048906 | Bacteria | 1553 |
| 1134 | Ga0496104_0000080 | 3300048907 | Bacteria | 96918 |
| 1135 | Ga0496104_0000149 | 3300048907 | Bacteria | 64732 |
| 1136 | Ga0496104_0000279 | 3300048907 | Bacteria | 45192 |
| 1137 | Ga0496104_0001052 | 3300048907 | Bacteria | 23550 |
| 1138 | Ga0496104_0009332 | 3300048907 | Bacteria | 8725 |
| 1139 | Ga0496104_0016854 | 3300048907 | Bacteria | 6642 |
| 1140 | Ga0496104_0016989 | 3300048907 | Bacteria | 6620 |
| 1141 | Ga0496104_0025519 | 3300048907 | Bacteria | 5448 |
| 1142 | Ga0496104_0044083 | 3300048907 | Bacteria | 4191 |
| 1143 | Ga0496104_0051156 | 3300048907 | Bacteria | 3898 |
| 1144 | Ga0496104_0064234 | 3300048907 | Bacteria | 3482 |
| 1145 | Ga0496104_0118303 | 3300048907 | Bacteria | 2543 |
| 1146 | Ga0496104_0124202 | 3300048907 | Bacteria | 2478 |
| 1147 | Ga0496104_0200303 | 3300048907 | Bacteria | 1908 |
| 1148 | Ga0496105_0000052 | 3300048908 | Bacteria | 89771 |
| 1149 | Ga0496105_0000272 | 3300048908 | Bacteria | 34322 |
| 1150 | Ga0496105_0009202 | 3300048908 | Bacteria | 7710 |
| 1151 | Ga0496105_0015532 | 3300048908 | Bacteria | 6069 |
| 1152 | Ga0496105_0022029 | 3300048908 | Bacteria | 5159 |
| 1153 | Ga0496105_0027606 | 3300048908 | Bacteria | 4639 |
| 1154 | Ga0496105_0033734 | 3300048908 | Bacteria | 4206 |
| 1155 | Ga0496105_0058309 | 3300048908 | Bacteria | 3187 |
| 1156 | Ga0496105_0061825 | 3300048908 | Bacteria | 3090 |
| 1157 | Ga0496105_0082323 | 3300048908 | Bacteria | 2658 |
| 1158 | Ga0496105_0086293 | 3300048908 | Bacteria | 2593 |
| 1159 | Ga0496105_0269455 | 3300048908 | Bacteria | 1375 |
| 1160 | Ga0496105_0304496 | 3300048908 | Bacteria | 1280 |
| 1161 | Ga0496105_0420974 | 3300048908 | Bacteria | 1057 |
| 1162 | Ga0496106_0000854 | 3300048909 | Bacteria | 22100 |
| 1163 | Ga0496106_0002017 | 3300048909 | Bacteria | 15276 |
| 1164 | Ga0496106_0003517 | 3300048909 | Bacteria | 11676 |
| 1165 | Ga0496106_0010756 | 3300048909 | Bacteria | 6761 |
| 1166 | Ga0496106_0012358 | 3300048909 | Bacteria | 6303 |
| 1167 | Ga0496106_0012742 | 3300048909 | Bacteria | 6209 |
| 1168 | Ga0496106_0025337 | 3300048909 | Bacteria | 4413 |
| 1169 | Ga0496106_0040891 | 3300048909 | Bacteria | 3473 |
| 1170 | Ga0496106_0073437 | 3300048909 | Bacteria | 2617 |
| 1171 | Ga0496106_0089094 | 3300048909 | Bacteria | 2379 |
| 1172 | Ga0496106_0100196 | 3300048909 | Bacteria | 2246 |
| 1173 | Ga0496106_0151879 | 3300048909 | Bacteria | 1827 |
| 1174 | Ga0496106_0263565 | 3300048909 | Bacteria | 1379 |
| 1175 | Ga0496106_0446107 | 3300048909 | Bacteria | 1039 |
| 1176 | Ga0496107_0000548 | 3300048910 | Bacteria | 21012 |
| 1177 | Ga0496107_0003678 | 3300048910 | Bacteria | 10308 |
| 1178 | Ga0496107_0008310 | 3300048910 | Bacteria | 7179 |
| 1179 | Ga0496107_0008765 | 3300048910 | Bacteria | 7007 |
| 1180 | Ga0496107_0011962 | 3300048910 | Bacteria | 6056 |
| 1181 | Ga0496107_0012866 | 3300048910 | Bacteria | 5848 |
| 1182 | Ga0496107_0017790 | 3300048910 | Bacteria | 5001 |
| 1183 | Ga0496107_0017891 | 3300048910 | Bacteria | 4989 |
| 1184 | Ga0496107_0052669 | 3300048910 | Bacteria | 2935 |
| 1185 | Ga0496107_0057487 | 3300048910 | Bacteria | 2812 |
| 1186 | Ga0496107_0103731 | 3300048910 | Bacteria | 2086 |
| 1187 | Ga0496107_0211317 | 3300048910 | Bacteria | 1443 |
| 1188 | Ga0496107_0263517 | 3300048910 | Bacteria | 1282 |
| 1189 | Ga0496107_0339092 | 3300048910 | Bacteria | 1118 |
| 1190 | Ga0496107_0379097 | 3300048910 | Bacteria | 1052 |
| 1191 | Ga0496108_0000625 | 3300048911 | Bacteria | 27651 |
| 1192 | Ga0496108_0045486 | 3300048911 | Bacteria | 3666 |
| 1193 | Ga0496108_0045705 | 3300048911 | Bacteria | 3657 |
| 1194 | Ga0496108_0064682 | 3300048911 | Bacteria | 3081 |
| 1195 | Ga0496108_0071113 | 3300048911 | Bacteria | 2935 |
| 1196 | Ga0496108_0076414 | 3300048911 | Bacteria | 2831 |
| 1197 | Ga0496108_0076676 | 3300048911 | Bacteria | 2826 |
| 1198 | Ga0496108_0105961 | 3300048911 | Bacteria | 2401 |
| 1199 | Ga0496108_0122073 | 3300048911 | Bacteria | 2235 |
| 1200 | Ga0496108_0362267 | 3300048911 | Bacteria | 1266 |
| 1201 | Ga0496109_0001375 | 3300048912 | Bacteria | 20176 |
| 1202 | Ga0496109_0075473 | 3300048912 | Bacteria | 3099 |
| 1203 | Ga0496109_0088197 | 3300048912 | Bacteria | 2867 |
| 1204 | Ga0496109_0101494 | 3300048912 | Bacteria | 2670 |
| 1205 | Ga0496109_0128441 | 3300048912 | Bacteria | 2365 |
| 1206 | Ga0496109_0143356 | 3300048912 | Bacteria | 2234 |
| 1207 | Ga0496109_0145078 | 3300048912 | Bacteria | 2220 |
| 1208 | Ga0496109_0187784 | 3300048912 | Bacteria | 1942 |
| 1209 | Ga0496109_0419893 | 3300048912 | Bacteria | 1263 |
| 1210 | Ga0496109_0503483 | 3300048912 | Bacteria | 1143 |
| 1211 | Ga0496110_0001079 | 3300048913 | Bacteria | 19218 |
| 1212 | Ga0496110_0005932 | 3300048913 | Bacteria | 9614 |
| 1213 | Ga0496110_0010159 | 3300048913 | Bacteria | 7646 |
| 1214 | Ga0496110_0011880 | 3300048913 | Bacteria | 7151 |
| 1215 | Ga0496110_0025085 | 3300048913 | Bacteria | 5090 |
| 1216 | Ga0496110_0026794 | 3300048913 | Bacteria | 4935 |
| 1217 | Ga0496110_0036438 | 3300048913 | Bacteria | 4272 |
| 1218 | Ga0496110_0044969 | 3300048913 | Bacteria | 3857 |
| 1219 | Ga0496110_0046494 | 3300048913 | Bacteria | 3797 |
| 1220 | Ga0496110_0212192 | 3300048913 | Bacteria | 1760 |
| 1221 | Ga0496110_0225184 | 3300048913 | Bacteria | 1705 |
| 1222 | Ga0496110_0386129 | 3300048913 | Bacteria | 1276 |
| 1223 | Ga0496110_0446990 | 3300048913 | Bacteria | 1178 |
| 1224 | Ga0496110_0822528 | 3300048913 | Bacteria | 834 |
| 1225 | Ga0496111_0001188 | 3300048914 | Bacteria | 14505 |
| 1226 | Ga0496111_0001541 | 3300048914 | Bacteria | 13252 |
| 1227 | Ga0496111_0011957 | 3300048914 | Bacteria | 5866 |
| 1228 | Ga0496111_0014085 | 3300048914 | Bacteria | 5454 |
| 1229 | Ga0496111_0015529 | 3300048914 | Bacteria | 5230 |
| 1230 | Ga0496111_0130861 | 3300048914 | Bacteria | 1857 |
| 1231 | Ga0496111_0171028 | 3300048914 | Bacteria | 1614 |
| 1232 | Ga0496111_0258619 | 3300048914 | Bacteria | 1292 |
| 1233 | Ga0496112_0002410 | 3300048915 | Bacteria | 15061 |
| 1234 | Ga0496112_0010794 | 3300048915 | Bacteria | 8308 |
| 1235 | Ga0496112_0039568 | 3300048915 | Bacteria | 4608 |
| 1236 | Ga0496112_0050078 | 3300048915 | Bacteria | 4095 |
| 1237 | Ga0496112_0057434 | 3300048915 | Bacteria | 3831 |
| 1238 | Ga0496112_0068331 | 3300048915 | Bacteria | 3508 |
| 1239 | Ga0496112_0076393 | 3300048915 | Bacteria | 3312 |
| 1240 | Ga0496112_0090183 | 3300048915 | Bacteria | 3034 |
| 1241 | Ga0496112_0106746 | 3300048915 | Bacteria | 2770 |
| 1242 | Ga0496112_0118913 | 3300048915 | Bacteria | 2612 |
| 1243 | Ga0496112_0141664 | 3300048915 | Bacteria | 2373 |
| 1244 | Ga0496113_0000087 | 3300048916 | Bacteria | 40247 |
| 1245 | Ga0496113_0001148 | 3300048916 | Bacteria | 14415 |
| 1246 | Ga0496113_0008398 | 3300048916 | Bacteria | 6728 |
| 1247 | Ga0496113_0011985 | 3300048916 | Bacteria | 5812 |
| 1248 | Ga0496113_0015454 | 3300048916 | Bacteria | 5246 |
| 1249 | Ga0496113_0020844 | 3300048916 | Bacteria | 4616 |
| 1250 | Ga0496113_0030815 | 3300048916 | Bacteria | 3886 |
| 1251 | Ga0496113_0103608 | 3300048916 | Bacteria | 2207 |
| 1252 | Ga0496113_0283710 | 3300048916 | Bacteria | 1324 |
| 1253 | Ga0496113_0404113 | 3300048916 | Bacteria | 1097 |
| 1254 | Ga0496113_0658383 | 3300048916 | Bacteria | 837 |
| 1255 | Ga0496114_0029790 | 3300048917 | Bacteria | 4487 |
| 1256 | Ga0496114_0031434 | 3300048917 | Bacteria | 4369 |
| 1257 | Ga0496114_0070514 | 3300048917 | Bacteria | 2935 |
| 1258 | Ga0496114_0074061 | 3300048917 | Bacteria | 2866 |
| 1259 | Ga0496114_0094884 | 3300048917 | Bacteria | 2538 |
| 1260 | Ga0496114_0108867 | 3300048917 | Bacteria | 2372 |
| 1261 | Ga0496114_0142382 | 3300048917 | Bacteria | 2077 |
| 1262 | Ga0496114_0430736 | 3300048917 | Bacteria | 1168 |
| 1263 | Ga0496114_0593412 | 3300048917 | Bacteria | 977 |
| 1264 | Ga0496115_0006310 | 3300048918 | Bacteria | 8677 |
| 1265 | Ga0496115_0011417 | 3300048918 | Bacteria | 6659 |
| 1266 | Ga0496115_0022102 | 3300048918 | Bacteria | 4921 |
| 1267 | Ga0496115_0032978 | 3300048918 | Bacteria | 4088 |
| 1268 | Ga0496115_0072893 | 3300048918 | Bacteria | 2786 |
| 1269 | Ga0496115_0118662 | 3300048918 | Bacteria | 2175 |
| 1270 | Ga0496115_0127441 | 3300048918 | Bacteria | 2097 |
| 1271 | Ga0496115_0179324 | 3300048918 | Bacteria | 1751 |
| 1272 | Ga0496115_0249773 | 3300048918 | Bacteria | 1461 |
| 1273 | Ga0496115_0266743 | 3300048918 | Bacteria | 1407 |
| 1274 | Ga0496115_0269574 | 3300048918 | Bacteria | 1399 |
| 1275 | Ga0496115_0316442 | 3300048918 | Bacteria | 1277 |
| 1276 | Ga0496115_0362769 | 3300048918 | Bacteria | 1180 |
| 1277 | Ga0496115_0453805 | 3300048918 | Bacteria | 1035 |
| 1278 | Ga0496115_0470930 | 3300048918 | Bacteria | 1012 |
| 1279 | Ga0496116_0227582 | 3300048919 | Bacteria | 949 |
| 1280 | Ga0496118_0260937 | 3300048921 | Bacteria | 978 |
| 1281 | Ga0496119_0000898 | 3300048922 | Bacteria | 38833 |
| 1282 | Ga0496119_0009306 | 3300048922 | Bacteria | 8452 |
| 1283 | Ga0496119_0012124 | 3300048922 | Bacteria | 7038 |
| 1284 | Ga0496119_0014229 | 3300048922 | Bacteria | 6249 |
| 1285 | Ga0496119_0139992 | 3300048922 | Bacteria | 1307 |
| 1286 | Ga0496120_0011646 | 3300048923 | Bacteria | 6035 |
| 1287 | Ga0496120_0057874 | 3300048923 | Bacteria | 2179 |
| 1288 | Ga0496121_0006038 | 3300048924 | Bacteria | 15260 |
| 1289 | Ga0496121_0067741 | 3300048924 | Bacteria | 2892 |
| 1290 | Ga0496122_0000399 | 3300048925 | Bacteria | 92476 |
| 1291 | Ga0496122_0218868 | 3300048925 | Bacteria | 1095 |
| 1292 | Ga0496123_0003753 | 3300048926 | Bacteria | 16655 |
| 1293 | Ga0496123_0057939 | 3300048926 | Bacteria | 2517 |
| 1294 | Ga0496123_0069764 | 3300048926 | Bacteria | 2204 |
| 1295 | Ga0496124_0030416 | 3300048927 | Bacteria | 4793 |
| 1296 | Ga0496125_0065438 | 3300048928 | Bacteria | 2880 |
| 1297 | Ga0496125_0072523 | 3300048928 | Bacteria | 2682 |
| 1298 | Ga0496125_0162158 | 3300048928 | Bacteria | 1517 |
| 1299 | Ga0496125_0252571 | 3300048928 | Bacteria | 1111 |
| 1300 | Ga0496126_0003453 | 3300048929 | Bacteria | 19947 |
| 1301 | Ga0496126_0024000 | 3300048929 | Bacteria | 5895 |
| 1302 | Ga0496126_0038264 | 3300048929 | Bacteria | 4466 |
| 1303 | Ga0496126_0043355 | 3300048929 | Bacteria | 4150 |
| 1304 | Ga0496126_0105456 | 3300048929 | Bacteria | 2461 |
| 1305 | Ga0501031_0000018 | 3300049568 | Bacteria | 106734 |
| 1306 | Ga0501031_0046757 | 3300049568 | Bacteria | 2822 |
| 1307 | Ga0501031_0053942 | 3300049568 | Bacteria | 2620 |
| 1308 | Ga0501031_0078422 | 3300049568 | Bacteria | 2152 |
| 1309 | Ga0501031_0091473 | 3300049568 | Bacteria | 1985 |
| 1310 | Ga0501032_0000031 | 3300049569 | Bacteria | 130204 |
| 1311 | Ga0501032_0000201 | 3300049569 | Bacteria | 49742 |
| 1312 | Ga0501032_0013095 | 3300049569 | Bacteria | 5907 |
| 1313 | Ga0501032_0101147 | 3300049569 | Bacteria | 1910 |
| 1314 | Ga0501032_0114842 | 3300049569 | Bacteria | 1780 |
| 1315 | Ga0501032_0255155 | 3300049569 | Bacteria | 1138 |
| 1316 | Ga0501032_0264440 | 3300049569 | Bacteria | 1115 |
| 1317 | Ga0501033_0000126 | 3300049570 | Bacteria | 74250 |
| 1318 | Ga0501033_0000328 | 3300049570 | Bacteria | 45346 |
| 1319 | Ga0501033_0006625 | 3300049570 | Bacteria | 9057 |
| 1320 | Ga0501033_0009424 | 3300049570 | Bacteria | 7517 |
| 1321 | Ga0501033_0018584 | 3300049570 | Bacteria | 5254 |
| 1322 | Ga0501033_0019815 | 3300049570 | Bacteria | 5084 |
| 1323 | Ga0501033_0025403 | 3300049570 | Bacteria | 4462 |
| 1324 | Ga0501033_0052548 | 3300049570 | Bacteria | 3020 |
| 1325 | Ga0501033_0105997 | 3300049570 | Bacteria | 2048 |
| 1326 | Ga0501033_0316847 | 3300049570 | Bacteria | 1096 |
| 1327 | Ga0501034_0000005 | 3300049571 | Bacteria | 367512 |
| 1328 | Ga0501034_0000064 | 3300049571 | Bacteria | 189461 |
| 1329 | Ga0501034_0000076 | 3300049571 | Bacteria | 174683 |
| 1330 | Ga0501034_0009541 | 3300049571 | Bacteria | 10159 |
| 1331 | Ga0501034_0021935 | 3300049571 | Bacteria | 6507 |
| 1332 | Ga0501034_0054192 | 3300049571 | Bacteria | 4037 |
| 1333 | Ga0501034_0147647 | 3300049571 | Bacteria | 2328 |
| 1334 | Ga0501034_0284559 | 3300049571 | Bacteria | 1592 |
| 1335 | Ga0501034_0346887 | 3300049571 | Bacteria | 1414 |
| 1336 | Ga0501034_0489622 | 3300049571 | Bacteria | 1144 |
| 1337 | Ga0501036_0000005 | 3300049572 | Bacteria | 246420 |
| 1338 | Ga0501036_0005686 | 3300049572 | Bacteria | 10115 |
| 1339 | Ga0501036_0005749 | 3300049572 | Bacteria | 10056 |
| 1340 | Ga0501036_0070327 | 3300049572 | Bacteria | 2959 |
| 1341 | Ga0501036_0079858 | 3300049572 | Bacteria | 2766 |
| 1342 | Ga0501036_0154955 | 3300049572 | Bacteria | 1932 |
| 1343 | Ga0501036_0262175 | 3300049572 | Bacteria | 1447 |
| 1344 | Ga0501036_0297434 | 3300049572 | Bacteria | 1350 |
| 1345 | Ga0501036_0517530 | 3300049572 | Bacteria | 992 |
| 1346 | Ga0501037_0000045 | 3300049573 | Bacteria | 117148 |
| 1347 | Ga0501037_0002164 | 3300049573 | Bacteria | 14212 |
| 1348 | Ga0501037_0003332 | 3300049573 | Bacteria | 11677 |
| 1349 | Ga0501037_0005389 | 3300049573 | Bacteria | 9312 |
| 1350 | Ga0501037_0005524 | 3300049573 | Bacteria | 9221 |
| 1351 | Ga0501037_0083410 | 3300049573 | Bacteria | 2315 |
| 1352 | Ga0501037_0226391 | 3300049573 | Bacteria | 1314 |
| 1353 | Ga0501037_0434533 | 3300049573 | Bacteria | 897 |
| 1354 | Ga0501038_0000001 | 3300049574 | Bacteria | 375481 |
| 1355 | Ga0501038_0000205 | 3300049574 | Bacteria | 50558 |
| 1356 | Ga0501038_0015483 | 3300049574 | Bacteria | 6931 |
| 1357 | Ga0501038_0053176 | 3300049574 | Bacteria | 3488 |
| 1358 | Ga0501038_0062717 | 3300049574 | Bacteria | 3175 |
| 1359 | Ga0501038_0071835 | 3300049574 | Bacteria | 2934 |
| 1360 | Ga0501038_0139198 | 3300049574 | Bacteria | 1987 |
| 1361 | Ga0501038_0149467 | 3300049574 | Bacteria | 1905 |
| 1362 | Ga0501038_0175311 | 3300049574 | Bacteria | 1733 |
| 1363 | Ga0501038_0289319 | 3300049574 | Bacteria | 1288 |
| 1364 | Ga0501038_0307398 | 3300049574 | Bacteria | 1243 |
| 1365 | Ga0501038_0388240 | 3300049574 | Bacteria | 1082 |
| 1366 | Ga0501039_0000007 | 3300049575 | Bacteria | 277831 |
| 1367 | Ga0501039_0000105 | 3300049575 | Bacteria | 56477 |
| 1368 | Ga0501039_0002792 | 3300049575 | Bacteria | 13046 |
| 1369 | Ga0501039_0008466 | 3300049575 | Bacteria | 7841 |
| 1370 | Ga0501039_0012743 | 3300049575 | Bacteria | 6425 |
| 1371 | Ga0501039_0060468 | 3300049575 | Bacteria | 2934 |
| 1372 | Ga0501039_0113942 | 3300049575 | Bacteria | 2115 |
| 1373 | Ga0501039_0160710 | 3300049575 | Bacteria | 1766 |
| 1374 | Ga0501039_0188883 | 3300049575 | Bacteria | 1620 |
| 1375 | Ga0501039_0398430 | 3300049575 | Bacteria | 1081 |
| 1376 | Ga0501040_0026013 | 3300049576 | Bacteria | 3937 |
| 1377 | Ga0501040_0029852 | 3300049576 | Bacteria | 3680 |
| 1378 | Ga0501040_0052412 | 3300049576 | Bacteria | 2793 |
| 1379 | Ga0501040_0098807 | 3300049576 | Bacteria | 2034 |
| 1380 | Ga0501040_0128627 | 3300049576 | Bacteria | 1780 |
| 1381 | Ga0501040_0132300 | 3300049576 | Bacteria | 1754 |
| 1382 | Ga0501040_0148742 | 3300049576 | Bacteria | 1651 |
| 1383 | Ga0501040_0282644 | 3300049576 | Bacteria | 1185 |
| 1384 | Ga0501041_0024244 | 3300049577 | Bacteria | 3641 |
| 1385 | Ga0501041_0055484 | 3300049577 | Bacteria | 2419 |
| 1386 | Ga0501041_0063423 | 3300049577 | Bacteria | 2262 |
| 1387 | Ga0501041_0074071 | 3300049577 | Bacteria | 2092 |
| 1388 | Ga0501041_0187157 | 3300049577 | Bacteria | 1296 |
| 1389 | Ga0501042_0007562 | 3300049578 | Bacteria | 7130 |
| 1390 | Ga0501042_0042178 | 3300049578 | Bacteria | 3247 |
| 1391 | Ga0501042_0049320 | 3300049578 | Bacteria | 3003 |
| 1392 | Ga0501042_0057666 | 3300049578 | Bacteria | 2771 |
| 1393 | Ga0501042_0206237 | 3300049578 | Bacteria | 1417 |
| 1394 | Ga0501042_0298318 | 3300049578 | Bacteria | 1164 |
| 1395 | Ga0501042_0438440 | 3300049578 | Bacteria | 947 |
| 1396 | Ga0501043_0000015 | 3300049579 | Bacteria | 175932 |
| 1397 | Ga0501043_0000107 | 3300049579 | Bacteria | 77469 |
| 1398 | Ga0501043_0056281 | 3300049579 | Bacteria | 3089 |
| 1399 | Ga0501043_0079453 | 3300049579 | Bacteria | 2577 |
| 1400 | Ga0501043_0232884 | 3300049579 | Bacteria | 1422 |
| 1401 | Ga0501043_0288373 | 3300049579 | Bacteria | 1257 |
| 1402 | Ga0501043_0348444 | 3300049579 | Bacteria | 1125 |
| 1403 | Ga0501043_0437769 | 3300049579 | Bacteria | 984 |
| 1404 | Ga0501043_0485698 | 3300049579 | Bacteria | 924 |
| 1405 | Ga0501046_0001416 | 3300049580 | Bacteria | 23066 |
| 1406 | Ga0501046_0006723 | 3300049580 | Bacteria | 10156 |
| 1407 | Ga0501046_0009778 | 3300049580 | Bacteria | 8269 |
| 1408 | Ga0501046_0015459 | 3300049580 | Bacteria | 6410 |
| 1409 | Ga0501046_0032371 | 3300049580 | Bacteria | 4234 |
| 1410 | Ga0501046_0071334 | 3300049580 | Bacteria | 2699 |
| 1411 | Ga0501046_0074334 | 3300049580 | Bacteria | 2637 |
| 1412 | Ga0501046_0109985 | 3300049580 | Bacteria | 2106 |
| 1413 | Ga0501046_0133453 | 3300049580 | Bacteria | 1882 |
| 1414 | Ga0501046_0202364 | 3300049580 | Bacteria | 1477 |
| 1415 | Ga0501046_0236924 | 3300049580 | Bacteria | 1347 |
| 1416 | Ga0501047_0000749 | 3300049581 | Bacteria | 33852 |
| 1417 | Ga0501047_0020996 | 3300049581 | Bacteria | 6273 |
| 1418 | Ga0501047_0059969 | 3300049581 | Bacteria | 3673 |
| 1419 | Ga0501047_0083424 | 3300049581 | Bacteria | 3071 |
| 1420 | Ga0501047_0140646 | 3300049581 | Bacteria | 2292 |
| 1421 | Ga0501047_0149101 | 3300049581 | Bacteria | 2215 |
| 1422 | Ga0501047_0154243 | 3300049581 | Bacteria | 2171 |
| 1423 | Ga0501047_0316422 | 3300049581 | Bacteria | 1401 |
| 1424 | Ga0501047_0422943 | 3300049581 | Bacteria | 1163 |
| 1425 | Ga0501048_0001563 | 3300049582 | Bacteria | 17396 |
| 1426 | Ga0501048_0021329 | 3300049582 | Bacteria | 4742 |
| 1427 | Ga0501048_0068570 | 3300049582 | Bacteria | 2505 |
| 1428 | Ga0501048_0120298 | 3300049582 | Bacteria | 1855 |
| 1429 | Ga0501048_0182528 | 3300049582 | Bacteria | 1487 |
| 1430 | Ga0501048_0365788 | 3300049582 | Bacteria | 1029 |
| 1431 | Ga0501067_0000091 | 3300049583 | Bacteria | 52819 |
| 1432 | Ga0501067_0003300 | 3300049583 | Bacteria | 8875 |
| 1433 | Ga0501067_0011645 | 3300049583 | Bacteria | 4871 |
| 1434 | Ga0501067_0022295 | 3300049583 | Bacteria | 3504 |
| 1435 | Ga0501067_0023338 | 3300049583 | Bacteria | 3428 |
| 1436 | Ga0501067_0066765 | 3300049583 | Bacteria | 1991 |
| 1437 | Ga0501067_0244369 | 3300049583 | Bacteria | 999 |
| 1438 | Ga0501068_0002658 | 3300049584 | Bacteria | 9471 |
| 1439 | Ga0501068_0111995 | 3300049584 | Bacteria | 1697 |
| 1440 | Ga0501068_0149164 | 3300049584 | Bacteria | 1469 |
| 1441 | Ga0501069_0000039 | 3300049585 | Bacteria | 82361 |
| 1442 | Ga0501069_0006899 | 3300049585 | Bacteria | 5935 |
| 1443 | Ga0501069_0011283 | 3300049585 | Bacteria | 4738 |
| 1444 | Ga0501069_0121149 | 3300049585 | Bacteria | 1494 |
| 1445 | Ga0501069_0143401 | 3300049585 | Bacteria | 1371 |
| 1446 | Ga0501069_0154645 | 3300049585 | Bacteria | 1319 |
| 1447 | Ga0501069_0167243 | 3300049585 | Bacteria | 1268 |
| 1448 | Ga0501069_0344466 | 3300049585 | Bacteria | 878 |
| 1449 | Ga0501070_0000132 | 3300049586 | Bacteria | 67092 |
| 1450 | Ga0501070_0000299 | 3300049586 | Bacteria | 46014 |
| 1451 | Ga0501070_0002117 | 3300049586 | Bacteria | 17410 |
| 1452 | Ga0501070_0017763 | 3300049586 | Bacteria | 5972 |
| 1453 | Ga0501070_0072038 | 3300049586 | Bacteria | 2860 |
| 1454 | Ga0501070_0155983 | 3300049586 | Bacteria | 1882 |
| 1455 | Ga0501070_0159579 | 3300049586 | Bacteria | 1859 |
| 1456 | Ga0501070_0174991 | 3300049586 | Bacteria | 1767 |
| 1457 | Ga0501070_0202340 | 3300049586 | Bacteria | 1630 |
| 1458 | Ga0501070_0210840 | 3300049586 | Bacteria | 1594 |
| 1459 | Ga0501070_0298993 | 3300049586 | Bacteria | 1311 |
| 1460 | Ga0501070_0350415 | 3300049586 | Bacteria | 1198 |
| 1461 | Ga0501071_0009502 | 3300049587 | Bacteria | 6481 |
| 1462 | Ga0501071_0059576 | 3300049587 | Bacteria | 2762 |
| 1463 | Ga0501071_0069731 | 3300049587 | Bacteria | 2560 |
| 1464 | Ga0501071_0102429 | 3300049587 | Bacteria | 2111 |
| 1465 | Ga0501071_0232297 | 3300049587 | Bacteria | 1390 |
| 1466 | Ga0501071_0238034 | 3300049587 | Bacteria | 1372 |
| 1467 | Ga0501071_0489398 | 3300049587 | Bacteria | 943 |
| 1468 | Ga0501072_0042737 | 3300049588 | Bacteria | 3560 |
| 1469 | Ga0501072_0050121 | 3300049588 | Bacteria | 3287 |
| 1470 | Ga0501072_0101090 | 3300049588 | Bacteria | 2292 |
| 1471 | Ga0501072_0204696 | 3300049588 | Bacteria | 1573 |
| 1472 | Ga0501072_0269426 | 3300049588 | Bacteria | 1355 |
| 1473 | Ga0501072_0324779 | 3300049588 | Bacteria | 1223 |
| 1474 | Ga0501072_0425513 | 3300049588 | Bacteria | 1052 |
| 1475 | Ga0501073_0000011 | 3300049589 | Bacteria | 161823 |
| 1476 | Ga0501073_0023740 | 3300049589 | Bacteria | 4403 |
| 1477 | Ga0501073_0042848 | 3300049589 | Bacteria | 3193 |
| 1478 | Ga0501073_0074563 | 3300049589 | Bacteria | 2362 |
| 1479 | Ga0501073_0129836 | 3300049589 | Bacteria | 1747 |
| 1480 | Ga0501073_0165808 | 3300049589 | Bacteria | 1530 |
| 1481 | Ga0501073_0246409 | 3300049589 | Bacteria | 1234 |
| 1482 | Ga0501074_0029210 | 3300049590 | Bacteria | 3993 |
| 1483 | Ga0501074_0105413 | 3300049590 | Bacteria | 2018 |
| 1484 | Ga0501074_0153177 | 3300049590 | Bacteria | 1648 |
| 1485 | Ga0501074_0195871 | 3300049590 | Bacteria | 1440 |
| 1486 | Ga0501074_0209210 | 3300049590 | Bacteria | 1390 |
| 1487 | Ga0501074_0367637 | 3300049590 | Bacteria | 1020 |
| 1488 | Ga0501075_0011328 | 3300049591 | Bacteria | 6309 |
| 1489 | Ga0501075_0071281 | 3300049591 | Bacteria | 2626 |
| 1490 | Ga0501075_0114157 | 3300049591 | Bacteria | 2054 |
| 1491 | Ga0501075_0129483 | 3300049591 | Bacteria | 1922 |
| 1492 | Ga0501075_0147766 | 3300049591 | Bacteria | 1791 |
| 1493 | Ga0501075_0182438 | 3300049591 | Bacteria | 1601 |
| 1494 | Ga0501076_0020611 | 3300049592 | Bacteria | 5047 |
| 1495 | Ga0501076_0025189 | 3300049592 | Bacteria | 4602 |
| 1496 | Ga0501076_0031924 | 3300049592 | Bacteria | 4110 |
| 1497 | Ga0501076_0047363 | 3300049592 | Bacteria | 3399 |
| 1498 | Ga0501076_0076567 | 3300049592 | Bacteria | 2683 |
| 1499 | Ga0501076_0077646 | 3300049592 | Bacteria | 2664 |
| 1500 | Ga0501076_0084120 | 3300049592 | Bacteria | 2555 |
| 1501 | Ga0501076_0132547 | 3300049592 | Bacteria | 2021 |
| 1502 | Ga0501076_0272820 | 3300049592 | Bacteria | 1385 |
| 1503 | Ga0501076_0465036 | 3300049592 | Bacteria | 1042 |
| 1504 | Ga0501077_0000011 | 3300049593 | Bacteria | 96805 |
| 1505 | Ga0501077_0007078 | 3300049593 | Bacteria | 6916 |
| 1506 | Ga0501077_0007395 | 3300049593 | Bacteria | 6771 |
| 1507 | Ga0501077_0010077 | 3300049593 | Bacteria | 5883 |
| 1508 | Ga0501077_0013376 | 3300049593 | Bacteria | 5146 |
| 1509 | Ga0501077_0032924 | 3300049593 | Bacteria | 3300 |
| 1510 | Ga0501077_0032975 | 3300049593 | Bacteria | 3298 |
| 1511 | Ga0501077_0075545 | 3300049593 | Bacteria | 2134 |
| 1512 | Ga0501077_0113740 | 3300049593 | Bacteria | 1716 |
| 1513 | Ga0501077_0114634 | 3300049593 | Bacteria | 1709 |
| 1514 | Ga0501077_0282502 | 3300049593 | Bacteria | 1057 |
| 1515 | Ga0501079_0024804 | 3300049741 | Bacteria | 4601 |
| 1516 | Ga0501079_0046675 | 3300049741 | Bacteria | 3342 |
| 1517 | Ga0501079_0051845 | 3300049741 | Bacteria | 3168 |
| 1518 | Ga0501079_0070038 | 3300049741 | Bacteria | 2708 |
| 1519 | Ga0501079_0152991 | 3300049741 | Bacteria | 1798 |
| 1520 | Ga0501079_0202415 | 3300049741 | Bacteria | 1551 |
| 1521 | Ga0501079_0269421 | 3300049741 | Bacteria | 1331 |
| 1522 | Ga0501079_0312226 | 3300049741 | Bacteria | 1230 |
| 1523 | Ga0501079_0318913 | 3300049741 | Bacteria | 1217 |
| 1524 | Ga0501079_0378459 | 3300049741 | Bacteria | 1110 |
| 1525 | Ga0501080_0000004 | 3300049742 | Bacteria | 180905 |
| 1526 | Ga0501080_0001484 | 3300049742 | Bacteria | 19783 |
| 1527 | Ga0501080_0003023 | 3300049742 | Bacteria | 14830 |
| 1528 | Ga0501080_0013324 | 3300049742 | Bacteria | 7557 |
| 1529 | Ga0501080_0055277 | 3300049742 | Bacteria | 3697 |
| 1530 | Ga0501080_0125630 | 3300049742 | Bacteria | 2376 |
| 1531 | Ga0501080_0128121 | 3300049742 | Bacteria | 2350 |
| 1532 | Ga0501080_0212342 | 3300049742 | Bacteria | 1773 |
| 1533 | Ga0501080_0221725 | 3300049742 | Bacteria | 1730 |
| 1534 | Ga0501080_0254450 | 3300049742 | Bacteria | 1601 |
| 1535 | Ga0501080_0287134 | 3300049742 | Bacteria | 1495 |
| 1536 | Ga0501080_0443696 | 3300049742 | Bacteria | 1164 |
| 1537 | Ga0501081_0004485 | 3300049743 | Bacteria | 8959 |
| 1538 | Ga0501081_0007228 | 3300049743 | Bacteria | 7218 |
| 1539 | Ga0501081_0180358 | 3300049743 | Bacteria | 1527 |
| 1540 | Ga0501081_0186404 | 3300049743 | Bacteria | 1502 |
| 1541 | Ga0501081_0219637 | 3300049743 | Bacteria | 1382 |
| 1542 | Ga0501081_0387631 | 3300049743 | Bacteria | 1033 |
| 1543 | Ga0501081_0572578 | 3300049743 | Bacteria | 844 |
| 1544 | Ga0501083_0007222 | 3300049744 | Bacteria | 7888 |
| 1545 | Ga0501083_0011832 | 3300049744 | Bacteria | 6114 |
| 1546 | Ga0501083_0042437 | 3300049744 | Bacteria | 3084 |
| 1547 | Ga0501083_0166039 | 3300049744 | Bacteria | 1443 |
| 1548 | Ga0501083_0234010 | 3300049744 | Bacteria | 1196 |
| 1549 | Ga0501035_0000008 | 3300049822 | Bacteria | 313425 |
| 1550 | Ga0501035_0000055 | 3300049822 | Bacteria | 139471 |
| 1551 | Ga0501035_0000272 | 3300049822 | Bacteria | 61461 |
| 1552 | Ga0501035_0000436 | 3300049822 | Bacteria | 46832 |
| 1553 | Ga0501035_0000807 | 3300049822 | Bacteria | 33393 |
| 1554 | Ga0501035_0002108 | 3300049822 | Bacteria | 19783 |
| 1555 | Ga0501035_0011205 | 3300049822 | Bacteria | 8304 |
| 1556 | Ga0501035_0072735 | 3300049822 | Bacteria | 3042 |
| 1557 | Ga0501035_0076459 | 3300049822 | Bacteria | 2961 |
| 1558 | Ga0501035_0103199 | 3300049822 | Bacteria | 2501 |
| 1559 | Ga0501035_0147493 | 3300049822 | Bacteria | 2042 |
| 1560 | Ga0501035_0147623 | 3300049822 | Bacteria | 2042 |
| 1561 | Ga0501035_0214906 | 3300049822 | Bacteria | 1644 |
| 1562 | Ga0501035_0348481 | 3300049822 | Bacteria | 1239 |
| 1563 | Ga0501035_0448309 | 3300049822 | Bacteria | 1068 |
| 1564 | Ga0501035_0770353 | 3300049822 | Bacteria | 771 |
| 1565 | Ga0501044_0000001 | 3300049823 | Bacteria | 418087 |
| 1566 | Ga0501044_0000007 | 3300049823 | Bacteria | 283429 |
| 1567 | Ga0501044_0000071 | 3300049823 | Bacteria | 124531 |
| 1568 | Ga0501044_0004447 | 3300049823 | Bacteria | 15680 |
| 1569 | Ga0501044_0005930 | 3300049823 | Bacteria | 13539 |
| 1570 | Ga0501044_0015843 | 3300049823 | Bacteria | 8112 |
| 1571 | Ga0501044_0024335 | 3300049823 | Bacteria | 6431 |
| 1572 | Ga0501044_0077649 | 3300049823 | Bacteria | 3367 |
| 1573 | Ga0501044_0089138 | 3300049823 | Bacteria | 3114 |
| 1574 | Ga0501044_0089954 | 3300049823 | Bacteria | 3098 |
| 1575 | Ga0501044_0094218 | 3300049823 | Bacteria | 3019 |
| 1576 | Ga0501044_0119737 | 3300049823 | Bacteria | 2634 |
| 1577 | Ga0501044_0134921 | 3300049823 | Bacteria | 2460 |
| 1578 | Ga0501044_0164592 | 3300049823 | Bacteria | 2193 |
| 1579 | Ga0501044_0209839 | 3300049823 | Bacteria | 1902 |
| 1580 | Ga0501044_0465092 | 3300049823 | Bacteria | 1170 |
| 1581 | Ga0501044_0531803 | 3300049823 | Bacteria | 1074 |
| 1582 | Ga0501044_0549580 | 3300049823 | Bacteria | 1052 |
| 1583 | Ga0501044_0818935 | 3300049823 | Bacteria | 809 |
| 1584 | Ga0501045_0059098 | 3300049824 | Bacteria | 2808 |
| 1585 | Ga0501045_0072997 | 3300049824 | Bacteria | 2526 |
| 1586 | Ga0501045_0116382 | 3300049824 | Bacteria | 1983 |
| 1587 | Ga0501045_0117374 | 3300049824 | Bacteria | 1975 |
| 1588 | Ga0501045_0159776 | 3300049824 | Bacteria | 1677 |
| 1589 | Ga0501045_0187914 | 3300049824 | Bacteria | 1539 |
| 1590 | Ga0501045_0257986 | 3300049824 | Bacteria | 1297 |
| 1591 | nmdc:mga03683_12592_c1 | 3300050489 | Bacteria | 3094 |
| 1592 | nmdc:mga03683_12819_c1 | 3300050489 | Bacteria | 3070 |
| 1593 | nmdc:mga03683_929_c1 | 3300050489 | Bacteria | 8471 |
| 1594 | nmdc:mga03n38_168019_c1 | 3300050490 | Bacteria | 1115 |
| 1595 | nmdc:mga03n38_696_c1 | 3300050490 | Bacteria | 8796 |
| 1596 | nmdc:mga03n38_80019_c1 | 3300050490 | Bacteria | 1534 |
| 1597 | nmdc:mga03n38_89094_c1 | 3300050490 | Bacteria | 1465 |
| 1598 | nmdc:mga00v17_83626_c1 | 3300050491 | Bacteria | 1996 |
| 1599 | nmdc:mga00v17_89517_c1 | 3300050491 | Bacteria | 967 |
| 1600 | nmdc:mga00v17_9731_c1 | 3300050491 | Bacteria | 5217 |
| 1601 | nmdc:mga0yw44_23765_c1 | 3300050492 | Bacteria | 3458 |
| 1602 | nmdc:mga0yw44_25254_c1 | 3300050492 | Bacteria | 3375 |
| 1603 | nmdc:mga0yw44_303901_c1 | 3300050492 | Bacteria | 1069 |
| 1604 | nmdc:mga0yw44_386906_c1 | 3300050492 | Bacteria | 945 |
| 1605 | nmdc:mga0yw44_6095_c1 | 3300050492 | Bacteria | 5784 |
| 1606 | nmdc:mga0yw44_78671_c1 | 3300050492 | Bacteria | 2062 |
| 1607 | nmdc:mga0yw44_80069_c1 | 3300050492 | Bacteria | 2045 |
| 1608 | nmdc:mga0k408_1244_c1 | 3300050493 | Bacteria | 13918 |
| 1609 | nmdc:mga0k408_13616_c1 | 3300050493 | Bacteria | 4465 |
| 1610 | nmdc:mga06z11_122402_c1 | 3300050494 | Bacteria | 1453 |
| 1611 | nmdc:mga06z11_1333_c1 | 3300050494 | Bacteria | 9125 |
| 1612 | nmdc:mga06z11_2154_c1 | 3300050494 | Bacteria | 7477 |
| 1613 | nmdc:mga06z11_312244_c1 | 3300050494 | Bacteria | 937 |
| 1614 | nmdc:mga06z11_4896_c1 | 3300050494 | Bacteria | 5313 |
| 1615 | nmdc:mga06z11_8900_c1 | 3300050494 | Bacteria | 4209 |
| 1616 | nmdc:mga04h51_12706_c1 | 3300050495 | Bacteria | 2370 |
| 1617 | nmdc:mga04h51_9040_c1 | 3300050495 | Bacteria | 2686 |
| 1618 | nmdc:mga04h51_9274_c1 | 3300050495 | Bacteria | 2661 |
| 1619 | nmdc:mga07m45_47150_c2 | 3300050496 | Bacteria | 1861 |
| 1620 | nmdc:mga05p37_166313_c1 | 3300050507 | Bacteria | 2692 |
| 1621 | nmdc:mga05p37_363778_c1 | 3300050507 | Bacteria | 1700 |
| 1622 | nmdc:mga05p37_505050_c1 | 3300050507 | Bacteria | 1387 |
| 1623 | nmdc:mga05p37_615_c1 | 3300050507 | Bacteria | 39336 |
| 1624 | nmdc:mga09592_2442_c1 | 3300050508 | Bacteria | 14996 |
| 1625 | nmdc:mga09592_41347_c1 | 3300050508 | Bacteria | 3876 |
| 1626 | nmdc:mga09592_494138_c1 | 3300050508 | Bacteria | 1054 |
| 1627 | nmdc:mga0qj67_204464_c1 | 3300050509 | Bacteria | 1604 |
| 1628 | nmdc:mga0qj67_414859_c1 | 3300050509 | Bacteria | 1086 |
| 1629 | nmdc:mga0qj67_54957_c1 | 3300050509 | Bacteria | 3153 |
| 1630 | nmdc:mga0qj67_646139_c1 | 3300050509 | Bacteria | 844 |
| 1631 | nmdc:mga0qj67_65917_c2 | 3300050509 | Bacteria | 2150 |
| 1632 | nmdc:mga0qj67_85110_c1 | 3300050509 | Bacteria | 2536 |
| 1633 | nmdc:mga06r32_111265_c1 | 3300050510 | Bacteria | 2695 |
| 1634 | nmdc:mga06r32_25081_c1 | 3300050510 | Bacteria | 5541 |
| 1635 | nmdc:mga06r32_2964_c1 | 3300050510 | Bacteria | 3965 |
| 1636 | nmdc:mga06r32_489150_c1 | 3300050510 | Bacteria | 1208 |
| 1637 | nmdc:mga06r32_54034_c1 | 3300050510 | Bacteria | 3851 |
| 1638 | nmdc:mga06r32_67561_c1 | 3300050510 | Bacteria | 3451 |
| 1639 | nmdc:mga06r32_95_c1 | 3300050510 | Bacteria | 61756 |
| 1640 | nmdc:mga08y16_145341_c1 | 3300050511 | Bacteria | 2465 |
| 1641 | nmdc:mga08y16_20535_c1 | 3300050511 | Bacteria | 6972 |
| 1642 | nmdc:mga08y16_464415_c1 | 3300050511 | Bacteria | 1289 |
| 1643 | nmdc:mga08y16_507_c1 | 3300050511 | Bacteria | 13292 |
| 1644 | nmdc:mga08y16_573813_c1 | 3300050511 | Bacteria | 1140 |
| 1645 | nmdc:mga08y16_680302_c1 | 3300050511 | Bacteria | 1030 |
| 1646 | nmdc:mga0n895_178050_c1 | 3300050512 | Bacteria | 2157 |
| 1647 | nmdc:mga0n895_44054_c1 | 3300050512 | Bacteria | 4352 |
| 1648 | nmdc:mga0n895_80375_c1 | 3300050512 | Bacteria | 3248 |
| 1649 | nmdc:mga0n895_8526_c1 | 3300050512 | Bacteria | 8882 |
| 1650 | nmdc:mga0rr50_55543_c1 | 3300050513 | Bacteria | 2955 |
| 1651 | nmdc:mga0rr50_563129_c1 | 3300050513 | Bacteria | 971 |
| 1652 | nmdc:mga0rr50_610187_c1 | 3300050513 | Bacteria | 930 |
| 1653 | nmdc:mga0rr50_8626_c1 | 3300050513 | Bacteria | 6353 |
| 1654 | nmdc:mga08x19_10184_c1 | 3300050514 | Bacteria | 5642 |
| 1655 | nmdc:mga08x19_4_c2 | 3300050514 | Bacteria | 202063 |
| 1656 | nmdc:mga08x19_79452_c1 | 3300050514 | Bacteria | 2151 |
| 1657 | nmdc:mga08x19_9189_c1 | 3300050514 | Bacteria | 5901 |
| 1658 | nmdc:mga0a205_371719_c1 | 3300050515 | Bacteria | 1295 |
| 1659 | nmdc:mga0a205_77637_c1 | 3300050515 | Bacteria | 3209 |
| 1660 | nmdc:mga0sz30_26781_c1 | 3300050516 | Bacteria | 2365 |
| 1661 | Ga0495601_0000004 | 3300053077 | Bacteria | 449178 |
| 1662 | Ga0495601_0014727 | 3300053077 | Bacteria | 4718 |
| 1663 | Ga0495601_0015682 | 3300053077 | Bacteria | 4581 |
| 1664 | Ga0495601_0071357 | 3300053077 | Bacteria | 2218 |
| 1665 | Ga0495601_0160204 | 3300053077 | Bacteria | 1470 |
| 1666 | Ga0495601_0204695 | 3300053077 | Bacteria | 1289 |
| 1667 | Ga0495612_0000013 | 3300053078 | Bacteria | 198142 |
| 1668 | Ga0495655_0000576 | 3300053083 | Bacteria | 6044 |
| 1669 | Ga0495655_0001905 | 3300053083 | Bacteria | 3254 |
| 1670 | Ga0495595_0000057 | 3300053084 | Bacteria | 57746 |
| 1671 | Ga0495595_0051362 | 3300053084 | Bacteria | 1911 |
| 1672 | Ga0495619_0000005 | 3300053085 | Bacteria | 418061 |
| 1673 | Ga0495619_0000852 | 3300053085 | Bacteria | 20006 |
| 1674 | Ga0495619_0004963 | 3300053085 | Bacteria | 8454 |
| 1675 | Ga0495619_0016894 | 3300053085 | Bacteria | 4622 |
| 1676 | Ga0495619_0036371 | 3300053085 | Bacteria | 3206 |
| 1677 | Ga0495619_0106040 | 3300053085 | Bacteria | 1916 |
| 1678 | Ga0495619_0318658 | 3300053085 | Bacteria | 1076 |
| 1679 | Ga0500566_0012676 | 3300053094 | Bacteria | 4958 |
| 1680 | Ga0500566_0100630 | 3300053094 | Bacteria | 1585 |
| 1681 | Ga0500556_0040318 | 3300053104 | Bacteria | 1641 |
| 1682 | Ga0500593_002987 | 3300053117 | Bacteria | 6301 |
| 1683 | Ga0500595_026436 | 3300053119 | Bacteria | 2000 |
| 1684 | Ga0500595_029415 | 3300053119 | Bacteria | 1864 |
| 1685 | Ga0500595_038229 | 3300053119 | Bacteria | 1561 |
| 1686 | Ga0500595_059747 | 3300053119 | Bacteria | 1155 |
| 1687 | Ga0500618_000106 | 3300053125 | Bacteria | 67801 |
| 1688 | Ga0500652_000003 | 3300053131 | Bacteria | 221528 |
| 1689 | Ga0500658_0182122 | 3300053134 | Bacteria | 957 |
| 1690 | Ga0500559_0012340 | 3300053136 | Bacteria | 3634 |
| 1691 | Ga0500559_0101671 | 3300053136 | Bacteria | 1325 |
| 1692 | Ga0500568_0000118 | 3300053139 | Bacteria | 70929 |
| 1693 | Ga0500577_0052068 | 3300053142 | Bacteria | 1542 |
| 1694 | Ga0500604_0046995 | 3300053151 | Bacteria | 1322 |
| 1695 | Ga0500616_0021703 | 3300053153 | Bacteria | 3595 |
| 1696 | Ga0500616_0066140 | 3300053153 | Bacteria | 1857 |
| 1697 | Ga0500616_0068405 | 3300053153 | Bacteria | 1819 |
| 1698 | Ga0500616_0121611 | 3300053153 | Bacteria | 1246 |
| 1699 | Ga0500620_089104 | 3300053155 | Bacteria | 1074 |
| 1700 | Ga0500622_0020243 | 3300053156 | Bacteria | 3533 |
| 1701 | Ga0500638_106305 | 3300053162 | Bacteria | 1302 |
| 1702 | Ga0500639_065573 | 3300053163 | Bacteria | 1862 |
| 1703 | Ga0500636_0017572 | 3300053177 | Bacteria | 4227 |
| 1704 | Ga0500636_0040856 | 3300053177 | Bacteria | 2743 |
| 1705 | Ga0500636_0176452 | 3300053177 | Bacteria | 1151 |
| 1706 | Ga0500637_0100355 | 3300053178 | Bacteria | 1679 |
| 1707 | Ga0500637_0116846 | 3300053178 | Bacteria | 1547 |
| 1708 | Ga0501084_0011545 | 3300054114 | Bacteria | 7314 |
| 1709 | Ga0501084_0035585 | 3300054114 | Bacteria | 4163 |
| 1710 | Ga0501084_0046352 | 3300054114 | Bacteria | 3641 |
| 1711 | Ga0501084_0048945 | 3300054114 | Bacteria | 3538 |
| 1712 | Ga0501084_0058411 | 3300054114 | Bacteria | 3227 |
| 1713 | Ga0501084_0135262 | 3300054114 | Bacteria | 2075 |
| 1714 | Ga0501084_0144960 | 3300054114 | Bacteria | 2000 |
| 1715 | Ga0501084_0199231 | 3300054114 | Bacteria | 1689 |
| 1716 | Ga0590071_045141 | 3300059421 | Bacteria | 1063 |
| 1717 | Ga0501082_0007486 | 3300060353 | Bacteria | 9421 |
| 1718 | Ga0501082_0009497 | 3300060353 | Bacteria | 8373 |
| 1719 | Ga0501082_0029330 | 3300060353 | Bacteria | 4739 |
| 1720 | Ga0501082_0038675 | 3300060353 | Bacteria | 4115 |
| 1721 | Ga0501082_0046340 | 3300060353 | Bacteria | 3748 |
| 1722 | Ga0501082_0084979 | 3300060353 | Bacteria | 2729 |
| 1723 | Ga0501082_0085974 | 3300060353 | Bacteria | 2712 |
| 1724 | Ga0501082_0099623 | 3300060353 | Bacteria | 2513 |
| 1725 | Ga0501082_0129782 | 3300060353 | Bacteria | 2187 |
| 1726 | Ga0501082_0230082 | 3300060353 | Bacteria | 1613 |
| 1727 | Ga0501082_0307887 | 3300060353 | Bacteria | 1379 |
| 1728 | Ga0501082_0360340 | 3300060353 | Bacteria | 1268 |
| 1729 | Ga0501082_0416936 | 3300060353 | Bacteria | 1172 |
| 1730 | Ga0501082_0617704 | 3300060353 | Bacteria | 948 |
| 1731 | Ga0530510_0009644 | 3300061734 | Bacteria | 6773 |
| 1732 | Ga0530510_0049645 | 3300061734 | Bacteria | 3031 |
| 1733 | Ga0530510_0072704 | 3300061734 | Bacteria | 2496 |
| 1734 | Ga0530510_0088628 | 3300061734 | Bacteria | 2255 |
| 1735 | Ga0530510_0090621 | 3300061734 | Bacteria | 2230 |
| 1736 | Ga0530510_0090629 | 3300061734 | Bacteria | 2230 |
| 1737 | Ga0530510_0255782 | 3300061734 | Bacteria | 1305 |
| 1738 | Ga0530510_0266714 | 3300061734 | Bacteria | 1278 |
| 1739 | Ga0530510_0279450 | 3300061734 | Bacteria | 1247 |
| 1740 | 2503202882 | 2503198000 | Bacteria | 6884444 |
| 1741 | 2508726744 | 2508501050 | Bacteria | 9633614 |
| 1742 | 2509115392 | 2508501123 | Bacteria | 6283661 |
| 1743 | 2509143731 | 2508501127 | Bacteria | 7037543 |
| 1744 | 2509372288 | 2509276018 | Bacteria | 6910194 |
| 1745 | 2509397373 | 2509276022 | Bacteria | 6200534 |
| 1746 | 2510317812 | 2510065059 | Bacteria | 6847884 |
| 1747 | 2512930344 | 2512875016 | Bacteria | 6529530 |
| 1748 | 2512958061 | 2512875024 | Bacteria | 7195110 |
| 1749 | 2512971345 | 2512875026 | Bacteria | 6861065 |
| 1750 | 2513590728 | 2513237087 | Bacteria | 5817514 |
| 1751 | 2513604055 | 2513237089 | Bacteria | 6553624 |
| 1752 | 2513610042 | 2513237090 | Bacteria | 7096802 |
| 1753 | 2513987397 | 2513237156 | Bacteria | 6402557 |
| 1754 | 2514006281 | 2513237160 | Bacteria | 6650282 |
| 1755 | 2514032800 | 2513237164 | Bacteria | 7563725 |
| 1756 | 2514422589 | 2513237305 | Bacteria | 7293571 |
| 1757 | 2514588760 | 2513237351 | Bacteria | 6968952 |
| 1758 | 2517569772 | 2517487022 | Bacteria | 7227575 |
| 1759 | 2563064599 | 2562617112 | Bacteria | 10918404 |
| 1760 | 2588515957 | 2588253730 | Bacteria | 6881675 |
| 1761 | 2597814513 | 2597489875 | Bacteria | 7010078 |
| 1762 | 2599938199 | 2599185301 | Bacteria | 6161860 |
| 1763 | 2600193305 | 2599185352 | Bacteria | 7228948 |
| 1764 | 2643770546 | 2643221550 | Bacteria | 4619371 |
| 1765 | 2643774975 | 2643221551 | Bacteria | 3750538 |
| 1766 | 2643793419 | 2643221555 | Bacteria | 3749717 |
| 1767 | 2643840650 | 2643221564 | Bacteria | 4193379 |
| 1768 | 2643989643 | 2643221595 | Bacteria | 6565519 |
| 1769 | 2644107916 | 2643221618 | Bacteria | 7717186 |
| 1770 | 2644130094 | 2643221623 | Bacteria | 5239945 |
| 1771 | 2644148411 | 2643221626 | Bacteria | 8069654 |
| 1772 | 2644157733 | 2643221627 | Bacteria | 6761570 |
| 1773 | 2644309310 | 2643221655 | Bacteria | 7722067 |
| 1774 | 2644333137 | 2643221659 | Bacteria | 7890716 |
| 1775 | 2644545691 | 2643221698 | Bacteria | 7756764 |
| 1776 | 2644615252 | 2643221712 | Bacteria | 7729434 |
| 1777 | 2644673557 | 2643221723 | Bacteria | 7095460 |
| 1778 | 2644735692 | 2643221734 | Bacteria | 5365412 |
| 1779 | 2657683880 | 2657244999 | Bacteria | 5946535 |
| 1780 | 2688599742 | 2687453392 | Bacteria | 6880454 |
| 1781 | 2694630586 | 2693429783 | Bacteria | 7019804 |
| 1782 | 2694639356 | 2693429784 | Bacteria | 7241525 |
| 1783 | 2713472907 | 2711768613 | Bacteria | 11048459 |
| 1784 | 2723576506 | 2721755686 | Bacteria | 7343952 |
| 1785 | 2739308867 | 2738543024 | Bacteria | 5603683 |
| 1786 | 2753359238 | 2751185800 | Bacteria | 5467370 |
| 1787 | 2756676066 | 2756170246 | Bacteria | 7451806 |
| 1788 | 2792582035 | 2791355082 | Bacteria | 5973319 |
| 1789 | 2792619934 | 2791355091 | Bacteria | 6135441 |
| 1790 | 2792639586 | 2791355094 | Bacteria | 7011481 |
| 1791 | 2792748730 | 2791355123 | Bacteria | 8049106 |
| 1792 | 2802719047 | 2802428858 | Bacteria | 6636079 |
| 1793 | 2802727278 | 2802428859 | Bacteria | 6667919 |
| 1794 | 2802732060 | 2802428860 | Bacteria | 6525526 |
| 1795 | 2802738990 | 2802428861 | Bacteria | 6534206 |
| 1796 | 2802744889 | 2802428862 | Bacteria | 6633353 |
| 1797 | 2802752165 | 2802428863 | Bacteria | 6410669 |
| 1798 | 2804752142 | 2802429268 | Bacteria | 6094027 |
| 1799 | 2808940714 | 2808606379 | Bacteria | 5022697 |
| 1800 | 2819718411 | 2818991467 | Bacteria | 5893227 |
| 1801 | 2828308083 | 2828305725 | Bacteria | 4916900 |
| 1802 | 2837680097 | 2837678835 | Bacteria | 5252418 |
| 1803 | 2838078805 | 2838074704 | Bacteria | 6785777 |
| 1804 | 2841740687 | 2841734538 | Bacteria | 6784580 |
| 1805 | 2841761744 | 2841760612 | Bacteria | 6454112 |
| 1806 | 2841912081 | 2841911363 | Bacteria | 6173697 |
| 1807 | 2841922975 | 2841917233 | Bacteria | 6173500 |
| 1808 | 2842339519 | 2842333319 | Bacteria | 8899485 |
| 1809 | 2844007035 | 2844002411 | Bacteria | 7168230 |
| 1810 | 2844015030 | 2844009547 | Bacteria | 6728125 |
| 1811 | 2844104769 | 2844104063 | Bacteria | 6440972 |
| 1812 | 2844167352 | 2844163670 | Bacteria | 7266046 |
| 1813 | 2847676187 | 2847670302 | Bacteria | 6165597 |
| 1814 | 2847692841 | 2847686936 | Bacteria | 6278406 |
| 1815 | 2851184761 | 2851182111 | Bacteria | 6047226 |
| 1816 | 2851247757 | 2851246043 | Bacteria | 6439203 |
| 1817 | 2856315973 | 2856314179 | Bacteria | 6477897 |
| 1818 | 2856324787 | 2856320880 | Bacteria | 7263508 |
| 1819 | 2856333019 | 2856328259 | Bacteria | 6528202 |
| 1820 | 2856339069 | 2856334872 | Bacteria | 7037011 |
| 1821 | 2856346470 | 2856342000 | Bacteria | 7176905 |
| 1822 | 2856356253 | 2856349417 | Bacteria | 6230045 |
| 1823 | 2856368706 | 2856364286 | Bacteria | 6939991 |
| 1824 | 2857350412 | 2857349434 | Bacteria | 7926032 |
| 1825 | 2857374224 | 2857367948 | Bacteria | 6965560 |
| 1826 | 2869167232 | 2869162929 | Bacteria | 6399702 |
| 1827 | 2869176972 | 2869169390 | Bacteria | 6659796 |
| 1828 | 2869237406 | 2869234852 | Bacteria | 6654993 |
| 1829 | 2869247851 | 2869242130 | Bacteria | 6609239 |
| 1830 | 2869251425 | 2869249662 | Bacteria | 6868783 |
| 1831 | 2869266939 | 2869264136 | Bacteria | 6880765 |
| 1832 | 2869272373 | 2869271264 | Bacteria | 6908218 |
| 1833 | 2869281222 | 2869278585 | Bacteria | 7077053 |
| 1834 | 2869291201 | 2869285874 | Bacteria | 6901219 |
| 1835 | 2871433481 | 2871429161 | Bacteria | 6547891 |
| 1836 | 2871440038 | 2871435913 | Bacteria | 6880295 |
| 1837 | 2871444491 | 2871444079 | Bacteria | 6423508 |
| 1838 | 2871455620 | 2871451962 | Bacteria | 7336357 |
| 1839 | 2871463217 | 2871459585 | Bacteria | 6866887 |
| 1840 | 2871472914 | 2871466892 | Bacteria | 6923287 |
| 1841 | 2871476090 | 2871474448 | Bacteria | 6806570 |
| 1842 | 2871487434 | 2871481445 | Bacteria | 6700002 |
| 1843 | 2871495899 | 2871488783 | Bacteria | 6929816 |
| 1844 | 2871503113 | 2871495908 | Bacteria | 6935695 |
| 1845 | 2874105963 | 2874102143 | Bacteria | 6342645 |
| 1846 | 2874114700 | 2874109183 | Bacteria | 6517025 |
| 1847 | 2874119345 | 2874116593 | Bacteria | 6674494 |
| 1848 | 2874126104 | 2874123672 | Bacteria | 7238285 |
| 1849 | 2874134267 | 2874131515 | Bacteria | 6820270 |
| 1850 | 2874141174 | 2874139085 | Bacteria | 7021506 |
| 1851 | 2874153082 | 2874146452 | Bacteria | 7533118 |
| 1852 | 2874160347 | 2874155637 | Bacteria | 6724144 |
| 1853 | 2874165252 | 2874162495 | Bacteria | 6174670 |
| 1854 | 2874170847 | 2874168670 | Bacteria | 8062617 |
| 1855 | 2876368314 | 2876363079 | Bacteria | 6544991 |
| 1856 | 2876371532 | 2876369609 | Bacteria | 6807521 |
| 1857 | 2876384050 | 2876377896 | Bacteria | 6565995 |
| 1858 | 2876392738 | 2876386047 | Bacteria | 6698674 |
| 1859 | 2876394853 | 2876392853 | Bacteria | 6660880 |
| 1860 | 2876400905 | 2876399893 | Bacteria | 6927900 |
| 1861 | 2876408639 | 2876406927 | Bacteria | 6191900 |
| 1862 | 2876419373 | 2876413966 | Bacteria | 6831344 |
| 1863 | 2876425701 | 2876420981 | Bacteria | 6687741 |
| 1864 | 2878040241 | 2878035449 | Bacteria | 6555736 |
| 1865 | 2878742895 | 2878738818 | Bacteria | 7136951 |
| 1866 | 2878751092 | 2878745973 | Bacteria | 6867388 |
| 1867 | 2878753303 | 2878753008 | Bacteria | 6922523 |
| 1868 | 2878767002 | 2878760144 | Bacteria | 6823465 |
| 1869 | 2878774200 | 2878767105 | Bacteria | 6898628 |
| 1870 | 2878776205 | 2878774303 | Bacteria | 6108671 |
| 1871 | 2881152210 | 2881147464 | Bacteria | 7779814 |
| 1872 | 2881156481 | 2881155292 | Bacteria | 6461656 |
| 1873 | 2881168183 | 2881161766 | Bacteria | 7127907 |
| 1874 | 2881847298 | 2881845957 | Bacteria | 6611900 |
| 1875 | 2881857020 | 2881853255 | Bacteria | 6698367 |
| 1876 | 2881864340 | 2881861095 | Bacteria | 7128710 |
| 1877 | 2882633306 | 2882632389 | Bacteria | 8154593 |
| 1878 | 2882915083 | 2882912400 | Bacteria | 6801539 |
| 1879 | 2885310062 | 2885305155 | Bacteria | 7348390 |
| 1880 | 2885316797 | 2885312484 | Bacteria | 6415165 |
| 1881 | 2885326074 | 2885318864 | Bacteria | 6729568 |
| 1882 | 2885329551 | 2885326080 | Bacteria | 7134805 |
| 1883 | 2885349031 | 2885342637 | Bacteria | 7011821 |
| 1884 | 2885352465 | 2885350715 | Bacteria | 6787678 |
| 1885 | 2888340921 | 2888337043 | Bacteria | 6629336 |
| 1886 | 2888348123 | 2888343758 | Bacteria | 6611049 |
| 1887 | 2888356423 | 2888350351 | Bacteria | 7372807 |
| 1888 | 2888393198 | 2888388044 | Bacteria | 7304136 |
| 1889 | 2889011335 | 2889010040 | Bacteria | 6749192 |
| 1890 | 2889016935 | 2889016732 | Bacteria | 6700763 |
| 1891 | 2889793687 | 2889790730 | Bacteria | 5689708 |
| 1892 | 2889919510 | 2889914905 | Bacteria | 5702301 |
| 1893 | 2894818350 | 2894817345 | Bacteria | 4892941 |
| 1894 | 2896390676 | 2896384573 | Bacteria | 7700774 |
| 1895 | 2903452332 | 2903448605 | Bacteria | 7357801 |
| 1896 | 2903495157 | 2903492973 | Bacteria | 13473544 |
| 1897 | 2903503148 | 2903492973 | Bacteria | 13473544 |
| 1898 | 2903513881 | 2903513507 | Bacteria | 6344008 |
| 1899 | 2903527310 | 2903521522 | Bacteria | 6525694 |
| 1900 | 2903531456 | 2903528002 | Bacteria | 6586099 |
| 1901 | 2903548302 | 2903540706 | Bacteria | 7062119 |
| 1902 | 2904661484 | 2904659560 | Bacteria | 6685615 |
| 1903 | 2906313033 | 2906308376 | Bacteria | 6841989 |
| 1904 | 2906325744 | 2906321335 | Bacteria | 6579571 |
| 1905 | 2906328914 | 2906328253 | Bacteria | 6585166 |
| 1906 | 2906356024 | 2906354277 | Bacteria | 6991324 |
| 1907 | 2906368308 | 2906363423 | Bacteria | 6856682 |
| 1908 | 2906374917 | 2906370794 | Bacteria | 6881062 |
| 1909 | 2906382228 | 2906378014 | Bacteria | 6911440 |
| 1910 | 2906391582 | 2906386501 | Bacteria | 5977019 |
| 1911 | 2906397343 | 2906393657 | Bacteria | 6790866 |
| 1912 | 2906406608 | 2906401398 | Bacteria | 6693206 |
| 1913 | 2906410874 | 2906408224 | Bacteria | 6162342 |
| 1914 | 2906416110 | 2906414383 | Bacteria | 6580790 |
| 1915 | 2906432426 | 2906427513 | Bacteria | 6375796 |
| 1916 | 2915651759 | 2915650412 | Bacteria | 4288180 |
| 1917 | 2915981529 | 2915980308 | Bacteria | 6624279 |
| 1918 | 2916066076 | 2916061851 | Bacteria | 6737736 |
| 1919 | 2920766277 | 2920760137 | Bacteria | 7427611 |
| 1920 | 2921255057 | 2921250672 | Bacteria | 6677771 |
| 1921 | 2921261288 | 2921257292 | Bacteria | 6808382 |
| 1922 | 2922136811 | 2922130491 | Bacteria | 7173936 |
| 1923 | 2922157915 | 2922151315 | Bacteria | 6902399 |
| 1924 | 2922165543 | 2922158528 | Bacteria | 6573167 |
| 1925 | 2922177286 | 2922172374 | Bacteria | 6167644 |
| 1926 | 2922183154 | 2922178524 | Bacteria | 6025201 |
| 1927 | 2922191461 | 2922185730 | Bacteria | 7113964 |
| 1928 | 2924715357 | 2924710171 | Bacteria | 6752351 |
| 1929 | 2924724603 | 2924718760 | Bacteria | 6331356 |
| 1930 | 2924732342 | 2924726620 | Bacteria | 6271473 |
| 1931 | 2924734983 | 2924733363 | Bacteria | 7574837 |
| 1932 | 2924741910 | 2924741084 | Bacteria | 6661321 |
| 1933 | 2924754266 | 2924748358 | Bacteria | 6154725 |
| 1934 | 2924757759 | 2924754689 | Bacteria | 6774424 |
| 1935 | 2924765175 | 2924762789 | Bacteria | 6561353 |
| 1936 | 2924780695 | 2924776078 | Bacteria | 7492003 |
| 1937 | 2924789787 | 2924784321 | Bacteria | 7416538 |
| 1938 | 2937025907 | 2937023124 | Bacteria | 6815156 |
| 1939 | 2937032632 | 2937029754 | Bacteria | 6424026 |
| 1940 | 2937038729 | 2937036028 | Bacteria | 6846469 |
| 1941 | 2937079200 | 2937078374 | Bacteria | 6610289 |
| 1942 | 2937086042 | 2937084907 | Bacteria | 6618516 |
| 1943 | 2937820815 | 2937813078 | Bacteria | 7783518 |
| 1944 | 2937827433 | 2937822353 | Bacteria | 7290551 |
| 1945 | 2937836861 | 2937836603 | Bacteria | 6811263 |
| 1946 | 2937854332 | 2937848649 | Bacteria | 6983481 |
| 1947 | 2937864475 | 2937861824 | Bacteria | 6660327 |
| 1948 | 2937873077 | 2937868953 | Bacteria | 6639878 |
| 1949 | 2937879801 | 2937877337 | Bacteria | 7246526 |
| 1950 | 2937893950 | 2937891427 | Bacteria | 6357007 |
| 1951 | 2937974689 | 2937972304 | Bacteria | 7532020 |
| 1952 | 2937988202 | 2937980651 | Bacteria | 6517427 |
| 1953 | 2938002126 | 2937994558 | Bacteria | 7036190 |
| 1954 | 2938021477 | 2938014810 | Bacteria | 6700592 |
| 1955 | 2939670292 | 2939669807 | Bacteria | 5028511 |
| 1956 | 2941503762 | 2941499720 | Bacteria | 7599444 |
| 1957 | 2957381594 | 2957375807 | Bacteria | 6425588 |
| 1958 | 2957400380 | 2957395598 | Bacteria | 6822399 |
| 1959 | 2957442484 | 2957437181 | Bacteria | 6568994 |
| 1960 | 2958037184 | 2958034702 | Bacteria | 6989922 |
| 1961 | 2958046896 | 2958041894 | Bacteria | 13082850 |
| 1962 | 2958067411 | 2958064165 | Bacteria | 7158582 |
| 1963 | 2958076956 | 2958071322 | Bacteria | 6815895 |
| 1964 | 2958086979 | 2958084443 | Bacteria | 7312792 |
| 1965 | 2958098107 | 2958092219 | Bacteria | 6861151 |
| 1966 | 2958106155 | 2958100919 | Bacteria | 6800575 |
| 1967 | 2958111845 | 2958108152 | Bacteria | 6681128 |
| 1968 | 2958122148 | 2958115193 | Bacteria | 6923548 |
| 1969 | 2958126554 | 2958122699 | Bacteria | 7280457 |
| 1970 | 2958135602 | 2958130278 | Bacteria | 6897202 |
| 1971 | 2958146942 | 2958144490 | Bacteria | 6677056 |
| 1972 | 2958160345 | 2958158011 | Bacteria | 6058449 |
| 1973 | 2958172180 | 2958165035 | Bacteria | 6906348 |
| 1974 | 2958185093 | 2958179912 | Bacteria | 6874908 |
| 1975 | 2960597198 | 2960591022 | Bacteria | 6622873 |
| 1976 | 2960631778 | 2960631154 | Bacteria | 6732508 |
| 1977 | 2960687150 | 2960680706 | Bacteria | 6624464 |
| 1978 | 2960699123 | 2960693952 | Bacteria | 6749742 |
| 1979 | 2961083360 | 2961077736 | Bacteria | 7079850 |
| 1980 | 2961116636 | 2961114664 | Bacteria | 6680456 |
| 1981 | 2961131898 | 2961127735 | Bacteria | 7196641 |
| 1982 | 2961138864 | 2961136820 | Bacteria | 6775228 |
| 1983 | 2961170628 | 2961163497 | Bacteria | 6901077 |
| 1984 | 2961177747 | 2961170736 | Bacteria | 7072258 |
| 1985 | 2961184517 | 2961183825 | Bacteria | 6688536 |
| 1986 | 2963648887 | 2963644680 | Bacteria | 6530403 |
| 1987 | 2964620548 | 2964615318 | Bacteria | 6809089 |
| 1988 | 2965025375 | 2965018300 | Bacteria | 6883036 |
| 1989 | 2965027985 | 2965025482 | Bacteria | 6532201 |
| 1990 | 2965032117 | 2965032056 | Bacteria | 6887443 |
| 1991 | 2965050090 | 2965047637 | Bacteria | 6623551 |
| 1992 | 2965065505 | 2965062239 | Bacteria | 7412989 |
| 1993 | 2965090402 | 2965089291 | Bacteria | 6866420 |
| 1994 | 2965103523 | 2965102966 | Bacteria | 6800987 |
| 1995 | 2965112136 | 2965110997 | Bacteria | 6693150 |
| 1996 | 2965121510 | 2965119406 | Bacteria | 6956431 |
| 1997 | 2967687486 | 2967686174 | Bacteria | 6678622 |
| 1998 | 2967729238 | 2967728569 | Bacteria | 6641507 |
| 1999 | 2967757145 | 2967755722 | Bacteria | 6814706 |
| 2000 | 2968003014 | 2967996073 | Bacteria | 6787468 |
| 2001 | 2968003839 | 2968003550 | Bacteria | 6929263 |
| 2002 | 2968019998 | 2968016561 | Bacteria | 7022047 |
| 2003 | 2968084112 | 2968083720 | Bacteria | 7351627 |
| 2004 | 2968095957 | 2968091066 | Bacteria | 6052692 |
| 2005 | 2968099726 | 2968097103 | Bacteria | 6107094 |
| 2006 | 2968112543 | 2968110612 | Bacteria | 6814636 |
| 2007 | 2968121318 | 2968117919 | Bacteria | 6536078 |
| 2008 | 2968130848 | 2968128360 | Bacteria | 6270294 |
| 2009 | 2968179014 | 2968171901 | Bacteria | 6894245 |
| 2010 | 2970029838 | 2970026789 | Bacteria | 6785236 |
| 2011 | 2970105126 | 2970102677 | Bacteria | 6812532 |
| 2012 | 2970125775 | 2970122695 | Bacteria | 6625855 |
| 2013 | 2970146894 | 2970143518 | Bacteria | 6446480 |
| 2014 | 2970473319 | 2970469710 | Bacteria | 6969209 |
| 2015 | 2970495441 | 2970489779 | Bacteria | 6517260 |
| 2016 | 2970510423 | 2970503327 | Bacteria | 7099517 |
| 2017 | 2970514124 | 2970510686 | Bacteria | 7006402 |
| 2018 | 2970532026 | 2970524798 | Bacteria | 6840927 |
| 2019 | 2970532649 | 2970532167 | Bacteria | 6553173 |
| 2020 | 2970545243 | 2970540015 | Bacteria | 6977556 |
| 2021 | 2970552114 | 2970547951 | Bacteria | 6931819 |
| 2022 | 2970561858 | 2970554993 | Bacteria | 6814252 |
| 2023 | 2970595826 | 2970593180 | Bacteria | 7073582 |
| 2024 | 2970620363 | 2970619444 | Bacteria | 6986144 |
| 2025 | 2970632140 | 2970627176 | Bacteria | 6680862 |
| 2026 | 2977532869 | 2977530762 | Bacteria | 6951399 |
| 2027 | 2977548462 | 2977544691 | Bacteria | 6875412 |
| 2028 | 2977822757 | 2977821940 | Bacteria | 6906439 |
| 2029 | 2977833224 | 2977828996 | Bacteria | 7007971 |
| 2030 | 2977849113 | 2977843712 | Bacteria | 6753583 |
| 2031 | 2977851368 | 2977851361 | Bacteria | 6694324 |
| 2032 | 2977864460 | 2977858184 | Bacteria | 6215359 |
| 2033 | 2977872395 | 2977864932 | Bacteria | 7534097 |
| 2034 | 2977874470 | 2977872689 | Bacteria | 7270173 |
| 2035 | 2977905740 | 2977898635 | Bacteria | 6675551 |
| 2036 | 2977909720 | 2977907340 | Bacteria | 6577984 |
| 2037 | 2977917204 | 2977915119 | Bacteria | 6829656 |
| 2038 | 2977926742 | 2977922695 | Bacteria | 6956781 |
| 2039 | 2977936273 | 2977935797 | Bacteria | 6252826 |
| 2040 | 2977948122 | 2977942078 | Bacteria | 7570577 |
| 2041 | 2977952319 | 2977950692 | Bacteria | 6893264 |
| 2042 | 2977961330 | 2977957713 | Bacteria | 6877875 |
| 2043 | 2977979635 | 2977971508 | Bacteria | 7472917 |
| 2044 | 2977992439 | 2977986579 | Bacteria | 6581278 |
| 2045 | 2979712218 | 2979710463 | Bacteria | 6785254 |
| 2046 | 2979750902 | 2979742915 | Bacteria | 7301278 |
| 2047 | 2979770727 | 2979764755 | Bacteria | 6610066 |
| 2048 | 2979777368 | 2979772303 | Bacteria | 6618277 |
| 2049 | 2979781438 | 2979779861 | Bacteria | 6219781 |
| 2050 | 2979794399 | 2979793036 | Bacteria | 6808957 |
| 2051 | 2979815297 | 2979808191 | Bacteria | 7179355 |
| 2052 | 2987637598 | 2987636660 | Bacteria | 8088555 |
| 2053 | 2987650676 | 2987645492 | Bacteria | 6117018 |
| 2054 | 2987653284 | 2987652177 | Bacteria | 6969023 |
| 2055 | 2987666867 | 2987659509 | Bacteria | 6966464 |
| 2056 | 2987667782 | 2987666974 | Bacteria | 6509233 |
| 2057 | 2987675637 | 2987673487 | Bacteria | 6884027 |
| 2058 | 2996310750 | 2996310559 | Bacteria | 6357320 |
| 2059 | 2996340694 | 2996336353 | Bacteria | 5511628 |
| 2060 | 2996348448 | 2996341866 | Bacteria | 6643098 |
| 2061 | 2996351490 | 2996348954 | Bacteria | 7239054 |
| 2062 | 2996389382 | 2996386984 | Bacteria | 6978667 |
| 2063 | 3000138864 | 3000135777 | Bacteria | 6891109 |
| 2064 | 3003933601 | 3003930520 | Bacteria | 5667563 |
| 2065 | 3004170452 | 3004167301 | Bacteria | 8330599 |
| 2066 | 3004195871 | 3004188549 | Bacteria | 6952365 |
| 2067 | 3004201846 | 3004195979 | Bacteria | 6776956 |
| 2068 | 3004206080 | 3004203850 | Bacteria | 7307914 |
| 2069 | 3004215043 | 3004211236 | Bacteria | 7417683 |
| 2070 | 3004222366 | 3004218560 | Bacteria | 7421728 |
| 2071 | 3004236832 | 3004232784 | Bacteria | 6662140 |
| 2072 | 3004241026 | 3004239961 | Bacteria | 6892290 |
| 2073 | 3004250036 | 3004248173 | Bacteria | 6563236 |
| 2074 | 3004274406 | 3004268573 | Bacteria | 7043476 |
| 2075 | 3004278190 | 3004275668 | Bacteria | 7114440 |
| 2076 | 3004295090 | 3004289098 | Bacteria | 6135450 |
| 2077 | 3004339926 | 3004334049 | Bacteria | 8449246 |
| 2078 | 637073339 | 637000159 | Bacteria | 7596297 |
| 2079 | 641337011 | 641228493 | Bacteria | 3999591 |
| 2080 | 643392821 | 643348555 | Bacteria | 3914947 |
| 2081 | 649874247 | 649633066 | Bacteria | 6690028 |
| 2082 | 8002285423 | 8002285264 | Bacteria | 6717907 |
| 2083 | 8004001136 | 8003999396 | Bacteria | 7063185 |
| 2084 | 8004302584 | 8004300914 | Bacteria | 6132239 |
| 2085 | 8004315347 | 8004312739 | Bacteria | 7444653 |
| 2086 | 8004364183 | 8004361976 | Bacteria | 6858373 |
| 2087 | 8004374875 | 8004374579 | Bacteria | 6898112 |
| 2088 | 8004394243 | 8004387939 | Bacteria | 7049250 |
| 2089 | 8004399852 | 8004395343 | Bacteria | 6620908 |
| 2090 | 8004446075 | 8004445564 | Bacteria | 6322258 |
| 2091 | 8004638216 | 8004633249 | Bacteria | 6723080 |
| 2092 | 8004642037 | 8004640170 | Bacteria | 6723001 |
| 2093 | 8004695664 | 8004695233 | Bacteria | 6731676 |
| 2094 | 8004713582 | 8004703790 | Bacteria | 8006957 |
| 2095 | 8004719291 | 8004714634 | Bacteria | 6776161 |
| 2096 | 8004729666 | 8004727605 | Bacteria | 6643904 |
| 2097 | 8049294690 | 8049293176 | Bacteria | 6128433 |
| 2098 | 8054558967 | 8054558443 | Bacteria | 5204801 |
| 2099 | 8055622238 | 8055617313 | Bacteria | 7548464 |
| 2100 | 8057530133 | 8057529695 | Bacteria | 6306553 |
| 2101 | Ga0501039_0172727 | |||
| 2102 | JGI24746J21847_1001085 | |||
| 2103 | JGI24740J21852_10006526 | |||
| 2104 | JGI24739J22299_10047854 | |||
| 2105 | JGI24737J22298_10051034 | |||
| 2106 | JGI24750J21931_1001195 | |||
| 2107 | JGI24750J21931_1002374 | |||
| 2108 | JGI24738J21930_10005970 | |||
| 2109 | JGI24738J21930_10007456 | |||
| 2110 | JGI24749J21850_1010571 | |||
| 2111 | JGI24749J21850_1016147 | |||
| 2112 | JGI24744J21845_10006218 | |||
| 2113 | JGI24744J21845_10011920 | |||
| 2114 | JGI24033J26618_1007281 | |||
| 2115 | JGI24742J22300_10002109 | |||
| 2116 | JGI24742J22300_10018212 | |||
| 2117 | JGI24751J29686_10003795 | |||
| 2118 | JGI24751J29686_10004371 | |||
| 2119 | JGI25156J39149_1006460 | |||
| 2120 | JGI25157J39369_1000310 | |||
| 2121 | JGI25159J45721_1000029 | |||
| 2122 | JGI25159J45721_1006446 | |||
| 2123 | Ga0006778J45830_1020520 | |||
| 2124 | Ga0006778J45830_1051547 | |||
| 2125 | Ga0006759J45824_1031091 | |||
| 2126 | JGI25151J46595_10000044 | |||
| 2127 | JGI25153J46596_10000369 | |||
| 2128 | JGI25153J46596_10000379 | |||
| 2129 | JGI25153J46596_10002710 | |||
| 2130 | Ga0006777J48905_1021316 | |||
| 2131 | Ga0006777J48905_1034387 | |||
| 2132 | JGI25160J50197_1000011 | |||
| 2133 | JGI25161J50226_1000216 | |||
| 2134 | Ga0007410J51695_1020795 | |||
| 2135 | Ga0007409J51694_1049573 | |||
| 2136 | Ga0007416J51690_1033932 | |||
| 2137 | Ga0007429J51699_1038745 | |||
| 2138 | Ga0007429J51699_1038746 | |||
| 2139 | Ga0032354_1047281 | |||
| 2140 | Ga0006780_1005821 | |||
| 2141 | Ga0006780_1019722 | |||
| 2142 | Ga0055542_1001387 | |||
| 2143 | Ga0055542_1002854 | |||
| 2144 | Ga0055526_1000091 | |||
| 2145 | Ga0055526_1003540 | |||
| 2146 | Ga0055526_1003634 | |||
| 2147 | Ga0055526_1034806 | |||
| 2148 | Ga0055524_1029369 | |||
| 2149 | Ga0055531_10030043 | |||
| 2150 | JGI25405J52794_10036305 | |||
| 2151 | Ga0055543_1000179 | |||
| 2152 | Ga0055543_1025677 | |||
| 2153 | Ga0058862_12598501 | |||
| 2154 | Ga0065165_1000018 | |||
| 2155 | Ga0065165_1000549 | |||
| 2156 | Ga0065165_1006672 | |||
| 2157 | Ga0065165_1007387 | |||
| 2158 | Ga0070658_10135240 | |||
| 2159 | Ga0070676_10033629 | |||
| 2160 | Ga0070683_100046149 | |||
| 2161 | Ga0070683_100130954 | |||
| 2162 | Ga0070683_100288797 | |||
| 2163 | Ga0070690_100000031 | |||
| 2164 | Ga0070670_100002795 | |||
| 2165 | Ga0070670_100010830 | |||
| 2166 | Ga0070670_100069841 | |||
| 2167 | Ga0068869_100101973 | |||
| 2168 | Ga0070666_10048602 | |||
| 2169 | Ga0070680_100013749 | |||
| 2170 | Ga0070680_100065124 | |||
| 2171 | Ga0070680_100102229 | |||
| 2172 | Ga0070680_100133539 | |||
| 2173 | Ga0070680_100269665 | |||
| 2174 | Ga0070680_100377506 | |||
| 2175 | Ga0070682_100000872 | |||
| 2176 | Ga0070682_100004641 | |||
| 2177 | Ga0070682_100281378 | |||
| 2178 | Ga0070682_100335008 | |||
| 2179 | Ga0068868_100007455 | |||
| 2180 | Ga0068868_100015186 | |||
| 2181 | Ga0068868_100380111 | |||
| 2182 | Ga0068868_100392547 | |||
| 2183 | Ga0070660_100000424 | |||
| 2184 | Ga0070660_100059342 | |||
| 2185 | Ga0070660_100135596 | |||
| 2186 | Ga0070660_100193622 | |||
| 2187 | Ga0070689_100012792 | |||
| 2188 | Ga0070689_100027324 | |||
| 2189 | Ga0070689_100073641 | |||
| 2190 | Ga0070691_10000305 | |||
| 2191 | Ga0070691_10123538 | |||
| 2192 | Ga0070687_100002671 | |||
| 2193 | Ga0070687_100025098 | |||
| 2194 | Ga0070661_100005997 | |||
| 2195 | Ga0070661_100053570 | |||
| 2196 | Ga0070661_100495726 | |||
| 2197 | Ga0070692_10015981 | |||
| 2198 | Ga0070692_10045100 | |||
| 2199 | Ga0070668_100000547 | |||
| 2200 | Ga0070668_100373663 | |||
| 2201 | Ga0070669_100000573 | |||
| 2202 | Ga0070669_100062845 | |||
| 2203 | Ga0070669_100694753 | |||
| 2204 | Ga0070675_100206460 | |||
| 2205 | Ga0070675_100526441 | |||
| 2206 | Ga0070671_100000381 | |||
| 2207 | Ga0070671_100153648 | |||
| 2208 | Ga0070671_100244960 | |||
| 2209 | Ga0070674_100000523 | |||
| 2210 | Ga0070674_100093334 | |||
| 2211 | Ga0070674_100401802 | |||
| 2212 | Ga0070673_100000111 | |||
| 2213 | Ga0070673_100054247 | |||
| 2214 | Ga0070673_100145227 | |||
| 2215 | Ga0070688_100000439 | |||
| 2216 | Ga0070688_100074540 | |||
| 2217 | Ga0070688_100427441 | |||
| 2218 | Ga0070659_100001531 | |||
| 2219 | Ga0070659_100037122 | |||
| 2220 | Ga0070659_100200026 | |||
| 2221 | Ga0070667_100000742 | |||
| 2222 | Ga0070667_100268555 | |||
| 2223 | Ga0070667_100573012 | |||
| 2224 | Ga0070667_100719936 | |||
| 2225 | Ga0070703_10021610 | |||
| 2226 | Ga0070703_10043166 | |||
| 2227 | Ga0070709_10001603 | |||
| 2228 | Ga0070709_10015446 | |||
| 2229 | Ga0070709_10189242 | |||
| 2230 | Ga0070714_100002925 | |||
| 2231 | Ga0070714_100324023 | |||
| 2232 | Ga0070714_100814590 | |||
| 2233 | Ga0070713_100002679 | |||
| 2234 | Ga0070713_100036702 | |||
| 2235 | Ga0070713_100220937 | |||
| 2236 | Ga0070713_100781734 | |||
| 2237 | Ga0070710_10052010 | |||
| 2238 | Ga0070701_10003309 | |||
| 2239 | Ga0070701_10008282 | |||
| 2240 | Ga0070701_10210661 | |||
| 2241 | Ga0070711_100000238 | |||
| 2242 | Ga0070711_100098052 | |||
| 2243 | Ga0070711_100187725 | |||
| 2244 | Ga0070705_100000568 | |||
| 2245 | Ga0070705_100007808 | |||
| 2246 | Ga0070705_100026017 | |||
| 2247 | Ga0070705_100071228 | |||
| 2248 | Ga0070705_100298660 | |||
| 2249 | Ga0070700_100000702 | |||
| 2250 | Ga0070700_100000905 | |||
| 2251 | Ga0070700_100012342 | |||
| 2252 | Ga0070700_100058428 | |||
| 2253 | Ga0070694_100002735 | |||
| 2254 | Ga0070694_100016938 | |||
| 2255 | Ga0070694_100025588 | |||
| 2256 | Ga0070694_100546628 | |||
| 2257 | Ga0070708_100062984 | |||
| 2258 | Ga0070663_100002733 | |||
| 2259 | Ga0070663_100003287 | |||
| 2260 | Ga0070663_100021801 | |||
| 2261 | Ga0070663_100030693 | |||
| 2262 | Ga0070663_100073480 | |||
| 2263 | Ga0070663_100579500 | |||
| 2264 | Ga0070678_100000328 | |||
| 2265 | Ga0070678_100003909 | |||
| 2266 | Ga0070678_100033247 | |||
| 2267 | Ga0070678_100094107 | |||
| 2268 | Ga0070678_100373546 | |||
| 2269 | Ga0070678_100658572 | |||
| 2270 | Ga0070662_100001201 | |||
| 2271 | Ga0070662_100046829 | |||
| 2272 | Ga0070681_10002440 | |||
| 2273 | Ga0070681_10047892 | |||
| 2274 | Ga0070681_10049840 | |||
| 2275 | Ga0070681_10708582 | |||
| 2276 | Ga0068867_100187633 | |||
| 2277 | Ga0070698_100108642 | |||
| 2278 | Ga0070699_100003865 | |||
| 2279 | Ga0070699_100245266 | |||
| 2280 | Ga0070679_100007780 | |||
| 2281 | Ga0070679_100012547 | |||
| 2282 | Ga0070679_100045074 | |||
| 2283 | Ga0070679_100109775 | |||
| 2284 | Ga0070679_100282828 | |||
| 2285 | Ga0070684_100549518 | |||
| 2286 | Ga0070697_100000372 | |||
| 2287 | Ga0070697_100003894 | |||
| 2288 | Ga0070697_100148486 | |||
| 2289 | Ga0070697_100368945 | |||
| 2290 | Ga0068853_100002908 | |||
| 2291 | Ga0068853_100008796 | |||
| 2292 | Ga0068853_100014575 | |||
| 2293 | Ga0068853_100019258 | |||
| 2294 | Ga0070672_100004025 | |||
| 2295 | Ga0070672_100004197 | |||
| 2296 | Ga0070672_100090017 | |||
| 2297 | Ga0070686_100023660 | |||
| 2298 | Ga0070686_100028163 | |||
| 2299 | Ga0070686_100095430 | |||
| 2300 | Ga0070686_100514606 | |||
| 2301 | Ga0070695_100000379 | |||
| 2302 | Ga0070695_100002634 | |||
| 2303 | Ga0070695_100013831 | |||
| 2304 | Ga0070696_100002850 | |||
| 2305 | Ga0070696_100048951 | |||
| 2306 | Ga0070696_100240340 | |||
| 2307 | Ga0070693_100000366 | |||
| 2308 | Ga0070693_100037074 | |||
| 2309 | Ga0070665_100095453 | |||
| 2310 | Ga0070665_100183602 | |||
| 2311 | Ga0070665_100260233 | |||
| 2312 | Ga0070704_100000980 | |||
| 2313 | Ga0070704_100004175 | |||
| 2314 | Ga0070704_100049937 | |||
| 2315 | Ga0070704_100057515 | |||
| 2316 | Ga0070704_100116809 | |||
| 2317 | Ga0068855_100001286 | |||
| 2318 | Ga0068855_100297600 | |||
| 2319 | Ga0070664_100001736 | |||
| 2320 | Ga0070664_100232401 | |||
| 2321 | Ga0070664_100339109 | |||
| 2322 | Ga0068857_100000473 | |||
| 2323 | Ga0068854_100001023 | |||
| 2324 | Ga0068856_100005557 | |||
| 2325 | Ga0070702_100001480 | |||
| 2326 | Ga0070702_100002704 | |||
| 2327 | Ga0070702_100004009 | |||
| 2328 | Ga0070702_100244625 | |||
| 2329 | Ga0068852_100003530 | |||
| 2330 | Ga0068852_100022442 | |||
| 2331 | Ga0068852_100136450 | |||
| 2332 | Ga0068859_100009249 | |||
| 2333 | Ga0068859_100013367 | |||
| 2334 | Ga0068859_100120135 | |||
| 2335 | Ga0068864_100006233 | |||
| 2336 | Ga0068864_100017168 | |||
| 2337 | Ga0068864_100062473 | |||
| 2338 | Ga0068864_100082507 | |||
| 2339 | Ga0068866_10098286 | |||
| 2340 | Ga0068861_100000606 | |||
| 2341 | Ga0068861_100006956 | |||
| 2342 | Ga0068861_100086963 | |||
| 2343 | Ga0068861_100208872 | |||
| 2344 | Ga0068861_100211215 | |||
| 2345 | Ga0068861_100737912 | |||
| 2346 | Ga0068851_10039572 | |||
| 2347 | Ga0068851_10145084 | |||
| 2348 | Ga0068870_10294129 | |||
| 2349 | Ga0068863_100013115 | |||
| 2350 | Ga0068863_100016333 | |||
| 2351 | Ga0068863_100099939 | |||
| 2352 | Ga0068858_100140808 | |||
| 2353 | Ga0068860_100001485 | |||
| 2354 | Ga0068860_100007864 | |||
| 2355 | Ga0068860_100045325 | |||
| 2356 | Ga0068860_100074806 | |||
| 2357 | Ga0068860_100111225 | |||
| 2358 | Ga0068860_100116590 | |||
| 2359 | Ga0068862_100000857 | |||
| 2360 | Ga0068862_100001067 | |||
| 2361 | Ga0068862_100006026 | |||
| 2362 | Ga0068862_100055915 | |||
| 2363 | Ga0081455_10002287 | |||
| 2364 | Ga0081455_10138082 | |||
| 2365 | Ga0081455_10138890 | |||
| 2366 | Ga0081455_10147356 | |||
| 2367 | Ga0081455_10186125 | |||
| 2368 | Ga0081538_10003767 | |||
| 2369 | Ga0081540_1000231 | |||
| 2370 | Ga0081540_1001706 | |||
| 2371 | Ga0081540_1021452 | |||
| 2372 | Ga0081540_1084098 | |||
| 2373 | Ga0081539_10090050 | |||
| 2374 | Ga0070717_10085658 | |||
| 2375 | Ga0070717_10098164 | |||
| 2376 | Ga0070717_10143793 | |||
| 2377 | Ga0070717_10220331 | |||
| 2378 | Ga0075365_10017184 | |||
| 2379 | Ga0075365_10019511 | |||
| 2380 | Ga0075365_10021047 | |||
| 2381 | Ga0075365_10022168 | |||
| 2382 | Ga0075365_10034507 | |||
| 2383 | Ga0075365_10143127 | |||
| 2384 | Ga0075365_10381409 | |||
| 2385 | Ga0075368_10003347 | |||
| 2386 | Ga0075368_10010887 | |||
| 2387 | Ga0075368_10023608 | |||
| 2388 | Ga0075368_10029933 | |||
| 2389 | Ga0075363_100010851 | |||
| 2390 | Ga0075363_100025765 | |||
| 2391 | Ga0075363_100056976 | |||
| 2392 | Ga0075363_100068627 | |||
| 2393 | Ga0075364_10079176 | |||
| 2394 | Ga0075364_10099392 | |||
| 2395 | Ga0075364_10121603 | |||
| 2396 | Ga0070715_10066022 | |||
| 2397 | Ga0070716_100000193 | |||
| 2398 | Ga0070716_100093215 | |||
| 2399 | Ga0070712_100010654 | |||
| 2400 | Ga0070712_100080499 | |||
| 2401 | Ga0070712_100265559 | |||
| 2402 | Ga0070712_100321368 | |||
| 2403 | Ga0070712_100451244 | |||
| 2404 | Ga0075362_10005091 | |||
| 2405 | Ga0075362_10070214 | |||
| 2406 | Ga0075362_10120481 | |||
| 2407 | Ga0075367_10009820 | |||
| 2408 | Ga0075367_10036305 | |||
| 2409 | Ga0075367_10061047 | |||
| 2410 | Ga0075367_10077097 | |||
| 2411 | Ga0075367_10203029 | |||
| 2412 | Ga0075367_10299311 | |||
| 2413 | Ga0075369_10017607 | |||
| 2414 | Ga0075369_10028219 | |||
| 2415 | Ga0075366_10003079 | |||
| 2416 | Ga0075366_10056348 | |||
| 2417 | Ga0075366_10160634 | |||
| 2418 | Ga0075366_10212592 | |||
| 2419 | Ga0097621_100016072 | |||
| 2420 | Ga0097621_100113186 | |||
| 2421 | Ga0097621_100233297 | |||
| 2422 | Ga0075370_10063881 | |||
| 2423 | Ga0075370_10141546 | |||
| 2424 | Ga0068871_100236588 | |||
| 2425 | Ga0068871_100454877 | |||
| 2426 | Ga0075428_100002752 | |||
| 2427 | Ga0075428_100004009 | |||
| 2428 | Ga0075428_100028795 | |||
| 2429 | Ga0075428_100417594 | |||
| 2430 | Ga0075428_100537555 | |||
| 2431 | Ga0075428_100708019 | |||
| 2432 | Ga0075430_100071305 | |||
| 2433 | Ga0075430_100156559 | |||
| 2434 | Ga0075430_100600522 | |||
| 2435 | Ga0075431_100001262 | |||
| 2436 | Ga0075431_100001307 | |||
| 2437 | Ga0075431_100032233 | |||
| 2438 | Ga0075431_100052804 | |||
| 2439 | Ga0075431_100172567 | |||
| 2440 | Ga0075431_100254623 | |||
| 2441 | Ga0075431_100435942 | |||
| 2442 | Ga0075431_100673543 | |||
| 2443 | Ga0075433_10027105 | |||
| 2444 | Ga0075434_100018862 | |||
| 2445 | Ga0075434_100034912 | |||
| 2446 | Ga0075434_100047718 | |||
| 2447 | Ga0075434_100160823 | |||
| 2448 | Ga0075434_100402772 | |||
| 2449 | Ga0075434_100456519 | |||
| 2450 | Ga0075429_100002424 | |||
| 2451 | Ga0075429_100022083 | |||
| 2452 | Ga0075429_100042256 | |||
| 2453 | Ga0068865_100069379 | |||
| 2454 | Ga0075436_100004853 | |||
| 2455 | Ga0075436_100004980 | |||
| 2456 | Ga0075436_100047313 | |||
| 2457 | Ga0075436_100066367 | |||
| 2458 | Ga0097620_100009249 | |||
| 2459 | Ga0097620_100013367 | |||
| 2460 | Ga0097620_100120143 | |||
| 2461 | Ga0079104_1004255 | |||
| 2462 | Ga0099826_10077084 | |||
| 2463 | Ga0075435_100044729 | |||
| 2464 | Ga0075435_100100777 | |||
| 2465 | Ga0075435_100116551 | |||
| 2466 | Ga0099795_10033345 | |||
| 2467 | Ga0105251_10051618 | |||
| 2468 | Ga0105250_10068692 | |||
| 2469 | Ga0105240_10048596 | |||
| 2470 | Ga0105240_10067454 | |||
| 2471 | Ga0105240_10220694 | |||
| 2472 | Ga0105240_10584168 | |||
| 2473 | Ga0111539_10001242 | |||
| 2474 | Ga0111539_10026961 | |||
| 2475 | Ga0111539_10063135 | |||
| 2476 | Ga0111539_10181896 | |||
| 2477 | Ga0111539_10226878 | |||
| 2478 | Ga0111539_10349014 | |||
| 2479 | Ga0105245_10004930 | |||
| 2480 | Ga0105245_10017425 | |||
| 2481 | Ga0105245_10059791 | |||
| 2482 | Ga0105245_10147155 | |||
| 2483 | Ga0105247_10000879 | |||
| 2484 | Ga0105247_10017227 | |||
| 2485 | Ga0105247_10061884 | |||
| 2486 | Ga0105247_10097310 | |||
| 2487 | Ga0105247_10237677 | |||
| 2488 | Ga0114129_10000485 | |||
| 2489 | Ga0114129_10009810 | |||
| 2490 | Ga0114129_10110544 | |||
| 2491 | Ga0114129_10385094 | |||
| 2492 | Ga0114129_10473597 | |||
| 2493 | Ga0114129_10492794 | |||
| 2494 | Ga0114129_11128352 | |||
| 2495 | Ga0105243_10000542 | |||
| 2496 | Ga0105243_10020796 | |||
| 2497 | Ga0105243_10046042 | |||
| 2498 | Ga0105243_10187168 | |||
| 2499 | Ga0105243_10400458 | |||
| 2500 | Ga0105243_10503446 | |||
| 2501 | Ga0105243_11013988 | |||
| 2502 | Ga0105241_10005203 | |||
| 2503 | Ga0105241_10006654 | |||
| 2504 | Ga0105241_10009459 | |||
| 2505 | Ga0105241_10023742 | |||
| 2506 | Ga0105241_10088976 | |||
| 2507 | Ga0105242_10009921 | |||
| 2508 | Ga0105248_10001122 | |||
| 2509 | Ga0105248_10028038 | |||
| 2510 | Ga0105248_10091706 | |||
| 2511 | Ga0105248_10115633 | |||
| 2512 | Ga0105237_10002679 | |||
| 2513 | Ga0105237_10039522 | |||
| 2514 | Ga0105237_10166816 | |||
| 2515 | Ga0105238_10038335 | |||
| 2516 | Ga0105238_10100546 | |||
| 2517 | Ga0105238_10104514 | |||
| 2518 | Ga0105249_10000689 | |||
| 2519 | Ga0105249_10002046 | |||
| 2520 | Ga0105249_10014308 | |||
| 2521 | Ga0105249_10345823 | |||
| 2522 | Ga0105249_10745264 | |||
| 2523 | Ga0099796_10003376 | |||
| 2524 | Ga0105239_10037767 | |||
| 2525 | Ga0105239_10100029 | |||
| 2526 | Ga0105239_10318952 | |||
| 2527 | Ga0105239_10397614 | |||
| 2528 | Ga0105239_10528237 | |||
| 2529 | Ga0105239_10564841 | |||
| 2530 | Ga0105246_10000180 | |||
| 2531 | Ga0105246_10039428 | |||
| 2532 | Ga0105246_10055527 | |||
| 2533 | Ga0105246_10131107 | |||
| 2534 | Ga0105246_10236438 | |||
| 2535 | Ga0105246_10277015 | |||
| 2536 | Ga0157373_10018836 | |||
| 2537 | Ga0157371_10001681 | |||
| 2538 | Ga0157370_10137728 | |||
| 2539 | Ga0157370_10185361 | |||
| 2540 | Ga0157370_10604171 | |||
| 2541 | Ga0157369_10003861 | |||
| 2542 | Ga0157369_10142128 | |||
| 2543 | Ga0171462_1028 | |||
| 2544 | Ga0157374_10006552 | |||
| 2545 | Ga0157374_10082150 | |||
| 2546 | Ga0157378_10001537 | |||
| 2547 | Ga0157378_10064448 | |||
| 2548 | Ga0157378_10567714 | |||
| 2549 | Ga0163162_10001513 | |||
| 2550 | Ga0163162_10031192 | |||
| 2551 | Ga0163162_10275774 | |||
| 2552 | Ga0163162_10618809 | |||
| 2553 | Ga0157372_10008591 | |||
| 2554 | Ga0157372_10008951 | |||
| 2555 | Ga0157372_10345374 | |||
| 2556 | Ga0157375_10001949 | |||
| 2557 | Ga0157375_10722129 | |||
| 2558 | Ga0163163_10032343 | |||
| 2559 | Ga0163163_10071104 | |||
| 2560 | Ga0163163_10113169 | |||
| 2561 | Ga0157380_10001442 | |||
| 2562 | Ga0157380_10011537 | |||
| 2563 | Ga0157380_10025674 | |||
| 2564 | Ga0157380_10073492 | |||
| 2565 | Ga0157380_10203036 | |||
| 2566 | Ga0157380_10226940 | |||
| 2567 | Ga0182008_10226534 | |||
| 2568 | Ga0157377_10008396 | |||
| 2569 | Ga0157377_10013535 | |||
| 2570 | Ga0157377_10077333 | |||
| 2571 | Ga0157377_10376092 | |||
| 2572 | Ga0157379_10006845 | |||
| 2573 | Ga0157379_10009632 | |||
| 2574 | Ga0157379_10029045 | |||
| 2575 | Ga0157379_10030444 | |||
| 2576 | Ga0157379_10143031 | |||
| 2577 | Ga0157376_10000456 | |||
| 2578 | Ga0157376_10047623 | |||
| 2579 | Ga0157376_10117584 | |||
| 2580 | Ga0157376_10509418 | |||
| 2581 | Ga0157376_10683581 | |||
| 2582 | Ga0182005_1014359 | |||
| 2583 | Ga0182005_1050499 | |||
| 2584 | Ga0163161_10019400 | |||
| 2585 | Ga0163161_10034769 | |||
| 2586 | Ga0206353_11139613 | |||
| 2587 | Ga0214544_1000129 | |||
| 2588 | Ga0214542_1000245 | |||
| 2589 | Ga0214543_1000010 | |||
| 2590 | Ga0213872_10133731 | |||
| 2591 | Ga0213874_10112506 | |||
| 2592 | Ga0213876_10006894 | |||
| 2593 | Ga0213876_10011881 | |||
| 2594 | Ga0213876_10013939 | |||
| 2595 | Ga0213875_10000705 | |||
| 2596 | Ga0213875_10112025 | |||
| 2597 | Ga0228711_1000007 | |||
| 2598 | Ga0228710_1000007 | |||
| 2599 | Ga0209436_103537 | |||
| 2600 | Ga0207672_1002998 | |||
| 2601 | Ga0207425_1018745 | |||
| 2602 | Ga0209026_1000002 | |||
| 2603 | Ga0209677_111792 | |||
| 2604 | Ga0209148_1000038 | |||
| 2605 | Ga0209148_1004788 | |||
| 2606 | Ga0209759_1000062 | |||
| 2607 | Ga0209233_1000027 | |||
| 2608 | Ga0209233_1010583 | |||
| 2609 | Ga0209455_1000068 | |||
| 2610 | Ga0209673_1019323 | |||
| 2611 | Ga0209130_1000029 | |||
| 2612 | Ga0209130_1000062 | |||
| 2613 | Ga0209675_1000554 | |||
| 2614 | Ga0209676_1001711 | |||
| 2615 | Ga0209025_1000014 | |||
| 2616 | Ga0209025_1000033 | |||
| 2617 | Ga0209025_1000787 | |||
| 2618 | Ga0209025_1003796 | |||
| 2619 | Ga0209025_1063950 | |||
| 2620 | Ga0209564_1000017 | |||
| 2621 | Ga0209564_1000077 | |||
| 2622 | Ga0209564_1000275 | |||
| 2623 | Ga0209564_1028903 | |||
| 2624 | Ga0209758_1000024 | |||
| 2625 | Ga0209758_1000641 | |||
| 2626 | Ga0209758_1001779 | |||
| 2627 | Ga0209758_1009659 | |||
| 2628 | Ga0209758_1011523 | |||
| 2629 | Ga0209050_1001363 | |||
| 2630 | Ga0209256_1000057 | |||
| 2631 | Ga0209256_1000102 | |||
| 2632 | Ga0209256_1000649 | |||
| 2633 | Ga0209256_1011304 | |||
| 2634 | Ga0207426_1000074 | |||
| 2635 | Ga0207426_1005362 | |||
| 2636 | Ga0209257_1001606 | |||
| 2637 | Ga0209257_1002758 | |||
| 2638 | Ga0207697_10019433 | |||
| 2639 | Ga0207697_10080644 | |||
| 2640 | Ga0207656_10102101 | |||
| 2641 | Ga0207656_10152788 | |||
| 2642 | Ga0207696_1038406 | |||
| 2643 | Ga0207653_10001874 | |||
| 2644 | Ga0207682_10153648 | |||
| 2645 | Ga0207692_10075709 | |||
| 2646 | Ga0207642_10002234 | |||
| 2647 | Ga0207642_10005653 | |||
| 2648 | Ga0207710_10004276 | |||
| 2649 | Ga0207710_10023510 | |||
| 2650 | Ga0207688_10000758 | |||
| 2651 | Ga0207688_10025034 | |||
| 2652 | Ga0207688_10051576 | |||
| 2653 | Ga0207647_10003290 | |||
| 2654 | Ga0207647_10037505 | |||
| 2655 | Ga0207647_10051475 | |||
| 2656 | Ga0207685_10044057 | |||
| 2657 | Ga0207685_10045708 | |||
| 2658 | Ga0207699_10007735 | |||
| 2659 | Ga0207699_10095438 | |||
| 2660 | Ga0207699_10108838 | |||
| 2661 | Ga0207699_10437124 | |||
| 2662 | Ga0207645_10003906 | |||
| 2663 | Ga0207643_10279642 | |||
| 2664 | Ga0207705_10083804 | |||
| 2665 | Ga0207705_10131147 | |||
| 2666 | Ga0207654_10016215 | |||
| 2667 | Ga0207654_10027426 | |||
| 2668 | Ga0207707_10031203 | |||
| 2669 | Ga0207707_10035167 | |||
| 2670 | Ga0207707_10195214 | |||
| 2671 | Ga0207707_10446812 | |||
| 2672 | Ga0207707_10495256 | |||
| 2673 | Ga0207695_10036226 | |||
| 2674 | Ga0207695_10066978 | |||
| 2675 | Ga0207695_10525352 | |||
| 2676 | Ga0207671_10092761 | |||
| 2677 | Ga0207693_10000072 | |||
| 2678 | Ga0207693_10132586 | |||
| 2679 | Ga0207693_10138548 | |||
| 2680 | Ga0207663_10002680 | |||
| 2681 | Ga0207663_10024904 | |||
| 2682 | Ga0207663_10078860 | |||
| 2683 | Ga0207663_10246005 | |||
| 2684 | Ga0207660_10091094 | |||
| 2685 | Ga0207660_10113833 | |||
| 2686 | Ga0207660_10473766 | |||
| 2687 | Ga0207660_10560694 | |||
| 2688 | Ga0207662_10000313 | |||
| 2689 | Ga0207662_10041438 | |||
| 2690 | Ga0207662_10128287 | |||
| 2691 | Ga0207662_10311449 | |||
| 2692 | Ga0207657_10000027 | |||
| 2693 | Ga0207657_10014193 | |||
| 2694 | Ga0207657_10179129 | |||
| 2695 | Ga0207649_10001170 | |||
| 2696 | Ga0207652_10040020 | |||
| 2697 | Ga0207652_10092944 | |||
| 2698 | Ga0207652_10097708 | |||
| 2699 | Ga0207652_10176198 | |||
| 2700 | Ga0207652_10189606 | |||
| 2701 | Ga0207646_10657379 | |||
| 2702 | Ga0207681_10004087 | |||
| 2703 | Ga0207681_10347388 | |||
| 2704 | Ga0207694_10412490 | |||
| 2705 | Ga0207650_10017887 | |||
| 2706 | Ga0207650_10049224 | |||
| 2707 | Ga0207650_10428809 | |||
| 2708 | Ga0207659_10025409 | |||
| 2709 | Ga0207659_10037274 | |||
| 2710 | Ga0207687_10018279 | |||
| 2711 | Ga0207687_10027057 | |||
| 2712 | Ga0207687_10060913 | |||
| 2713 | Ga0207687_10536755 | |||
| 2714 | Ga0207700_10240244 | |||
| 2715 | Ga0207700_10490004 | |||
| 2716 | Ga0207664_10064083 | |||
| 2717 | Ga0207664_10216951 | |||
| 2718 | Ga0207664_10372458 | |||
| 2719 | Ga0207644_10095577 | |||
| 2720 | Ga0207644_10752778 | |||
| 2721 | Ga0207690_10036854 | |||
| 2722 | Ga0207690_10079138 | |||
| 2723 | Ga0207706_10000039 | |||
| 2724 | Ga0207706_10006559 | |||
| 2725 | Ga0207706_10073665 | |||
| 2726 | Ga0207686_10002173 | |||
| 2727 | Ga0207686_10006573 | |||
| 2728 | Ga0207709_10008225 | |||
| 2729 | Ga0207709_10101691 | |||
| 2730 | Ga0207709_10109068 | |||
| 2731 | Ga0207709_10199474 | |||
| 2732 | Ga0207709_10209935 | |||
| 2733 | Ga0207709_10379048 | |||
| 2734 | Ga0207670_10004298 | |||
| 2735 | Ga0207670_10011443 | |||
| 2736 | Ga0207670_10027929 | |||
| 2737 | Ga0207669_10041228 | |||
| 2738 | Ga0207669_10071562 | |||
| 2739 | Ga0207704_10007409 | |||
| 2740 | Ga0207704_10046720 | |||
| 2741 | Ga0207665_10000076 | |||
| 2742 | Ga0207665_10073227 | |||
| 2743 | Ga0207665_10175730 | |||
| 2744 | Ga0207691_10001122 | |||
| 2745 | Ga0207691_10003280 | |||
| 2746 | Ga0207691_10028245 | |||
| 2747 | Ga0207691_10221540 | |||
| 2748 | Ga0207711_10010943 | |||
| 2749 | Ga0207711_10036519 | |||
| 2750 | Ga0207711_10308962 | |||
| 2751 | Ga0207689_10004525 | |||
| 2752 | Ga0207689_10020242 | |||
| 2753 | Ga0207679_10005429 | |||
| 2754 | Ga0207667_10305562 | |||
| 2755 | Ga0207667_10354707 | |||
| 2756 | Ga0207651_10021496 | |||
| 2757 | Ga0207651_10377593 | |||
| 2758 | Ga0207712_10174874 | |||
| 2759 | Ga0207712_10420817 | |||
| 2760 | Ga0207668_10000911 | |||
| 2761 | Ga0207668_10052938 | |||
| 2762 | Ga0207668_10130278 | |||
| 2763 | Ga0207668_10351041 | |||
| 2764 | Ga0207668_10534239 | |||
| 2765 | Ga0207640_10002505 | |||
| 2766 | Ga0207640_10008447 | |||
| 2767 | Ga0207658_10018968 | |||
| 2768 | Ga0207658_10075213 | |||
| 2769 | Ga0207658_10299397 | |||
| 2770 | Ga0207658_10468936 | |||
| 2771 | Ga0207677_10002744 | |||
| 2772 | Ga0207677_10063982 | |||
| 2773 | Ga0207677_10272482 | |||
| 2774 | Ga0207703_10014165 | |||
| 2775 | Ga0207703_10022449 | |||
| 2776 | Ga0207703_10024059 | |||
| 2777 | Ga0207703_10025864 | |||
| 2778 | Ga0207639_10018747 | |||
| 2779 | Ga0207639_10050625 | |||
| 2780 | Ga0207639_10093002 | |||
| 2781 | Ga0207639_10126557 | |||
| 2782 | Ga0207639_10181198 | |||
| 2783 | Ga0207639_10252540 | |||
| 2784 | Ga0207639_10691810 | |||
| 2785 | Ga0207678_10000034 | |||
| 2786 | Ga0207678_10000098 | |||
| 2787 | Ga0207678_10012927 | |||
| 2788 | Ga0207678_10026827 | |||
| 2789 | Ga0207678_10062963 | |||
| 2790 | Ga0207678_10321104 | |||
| 2791 | Ga0207678_10379037 | |||
| 2792 | Ga0207678_10417385 | |||
| 2793 | Ga0207708_10000351 | |||
| 2794 | Ga0207708_10002109 | |||
| 2795 | Ga0207708_10008714 | |||
| 2796 | Ga0207708_10057680 | |||
| 2797 | Ga0207708_10267251 | |||
| 2798 | Ga0207708_10304078 | |||
| 2799 | Ga0207708_10329468 | |||
| 2800 | Ga0207708_10705305 | |||
| 2801 | Ga0207702_10063631 | |||
| 2802 | Ga0207702_10829747 | |||
| 2803 | Ga0207641_10014819 | |||
| 2804 | Ga0207641_10056855 | |||
| 2805 | Ga0207641_10121619 | |||
| 2806 | Ga0207641_10207084 | |||
| 2807 | Ga0207648_10023624 | |||
| 2808 | Ga0207648_10085717 | |||
| 2809 | Ga0207648_10462568 | |||
| 2810 | Ga0207648_10790025 | |||
| 2811 | Ga0207648_10841251 | |||
| 2812 | Ga0207676_10008149 | |||
| 2813 | Ga0207676_10013451 | |||
| 2814 | Ga0207676_10096940 | |||
| 2815 | Ga0207676_10134988 | |||
| 2816 | Ga0207676_10148084 | |||
| 2817 | Ga0207674_10000154 | |||
| 2818 | Ga0207674_10006620 | |||
| 2819 | Ga0207674_10122740 | |||
| 2820 | Ga0207674_10843174 | |||
| 2821 | Ga0207675_100000968 | |||
| 2822 | Ga0207675_100002046 | |||
| 2823 | Ga0207675_100005541 | |||
| 2824 | Ga0207675_100118295 | |||
| 2825 | Ga0207675_100212798 | |||
| 2826 | Ga0207675_100257805 | |||
| 2827 | Ga0207675_100307605 | |||
| 2828 | Ga0207675_100409846 | |||
| 2829 | Ga0207675_100621576 | |||
| 2830 | Ga0207683_10000318 | |||
| 2831 | Ga0207683_10007512 | |||
| 2832 | Ga0207683_10013041 | |||
| 2833 | Ga0207683_10154726 | |||
| 2834 | Ga0207698_10048248 | |||
| 2835 | Ga0207698_10085915 | |||
| 2836 | Ga0207698_10201756 | |||
| 2837 | Ga0207698_10746327 | |||
| 2838 | Ga0209281_1000128 | |||
| 2839 | Ga0209589_1000109 | |||
| 2840 | Ga0209489_100324 | |||
| 2841 | Ga0209700_100355 | |||
| 2842 | Ga0209282_1000034 | |||
| 2843 | Ga0209813_10004777 | |||
| 2844 | Ga0209813_10005909 | |||
| 2845 | Ga0209813_10013465 | |||
| 2846 | Ga0207428_10005134 | |||
| 2847 | Ga0207428_10024682 | |||
| 2848 | Ga0207428_10447232 | |||
| 2849 | Ga0268266_10045688 | |||
| 2850 | Ga0268266_10046654 | |||
| 2851 | Ga0268266_10047527 | |||
| 2852 | Ga0268266_10174209 | |||
| 2853 | Ga0268266_10515280 | |||
| 2854 | Ga0268266_10558110 | |||
| 2855 | Ga0268266_10619889 | |||
| 2856 | Ga0268265_10000953 | |||
| 2857 | Ga0268265_10006463 | |||
| 2858 | Ga0268265_10055081 | |||
| 2859 | Ga0268264_10021041 | |||
| 2860 | Ga0268264_10023542 | |||
| 2861 | Ga0268264_10049360 | |||
| 2862 | Ga0268264_10053666 | |||
| 2863 | Ga0268264_10142210 | |||
| 2864 | Ga0268264_10211642 | |||
| 2865 | Ga0268264_10217171 | |||
| 2866 | Ga0268264_10274210 | |||
| 2867 | Ga0265337_1002458 | |||
| 2868 | Ga0265326_10002501 | |||
| 2869 | Ga0265319_1001332 | |||
| 2870 | Ga0265319_1052270 | |||
| 2871 | Ga0265334_10003334 | |||
| 2872 | Ga0265323_10001242 | |||
| 2873 | Ga0265322_10004943 | |||
| 2874 | Ga0265336_10000759 | |||
| 2875 | Ga0307517_10128077 | |||
| 2876 | Ga0265338_10000013 | |||
| 2877 | Ga0265338_10044403 | |||
| 2878 | Ga0311001_1005417 | |||
| 2879 | Ga0265324_10002070 | |||
| 2880 | Ga0265332_10001497 | |||
| 2881 | Ga0265332_10040356 | |||
| 2882 | Ga0265328_10038517 | |||
| 2883 | Ga0265320_10045755 | |||
| 2884 | Ga0265325_10002054 | |||
| 2885 | Ga0265325_10059310 | |||
| 2886 | Ga0265325_10067459 | |||
| 2887 | Ga0265325_10073588 | |||
| 2888 | Ga0265325_10076394 | |||
| 2889 | Ga0265329_10026525 | |||
| 2890 | Ga0265340_10000092 | |||
| 2891 | Ga0265340_10000387 | |||
| 2892 | Ga0265340_10007981 | |||
| 2893 | Ga0265340_10008859 | |||
| 2894 | Ga0265340_10012700 | |||
| 2895 | Ga0265339_10002236 | |||
| 2896 | Ga0265339_10003394 | |||
| 2897 | Ga0265339_10089342 | |||
| 2898 | Ga0265339_10119703 | |||
| 2899 | Ga0265331_10035492 | |||
| 2900 | Ga0265316_10003669 | |||
| 2901 | Ga0265316_10159731 | |||
| 2902 | Ga0265316_10175508 | |||
| 2903 | Ga0265316_10208821 | |||
| 2904 | Ga0307509_10008703 | |||
| 2905 | Ga0307508_10014226 | |||
| 2906 | Ga0316579_10033997 | |||
| 2907 | Ga0265314_10024931 | |||
| 2908 | Ga0265314_10070839 | |||
| 2909 | Ga0265314_10080214 | |||
| 2910 | Ga0265314_10243145 | |||
| 2911 | Ga0265314_10289955 | |||
| 2912 | Ga0265342_10000110 | |||
| 2913 | Ga0265342_10024465 | |||
| 2914 | Ga0316576_10170912 | |||
| 2915 | Ga0316578_10089745 | |||
| 2916 | Ga0307516_10002008 | |||
| 2917 | Ga0307516_10037683 | |||
| 2918 | Ga0307516_10048488 | |||
| 2919 | Ga0315914_1000010 | |||
| 2920 | Ga0307415_100137250 | |||
| 2921 | Ga0307415_100653782 | |||
| 2922 | Ga0315913_1000005 | |||
| 2923 | Ga0315915_1000012 | |||
| 2924 | Ga0316592_1002973 | |||
| 2925 | Ga0316588_1000463 | |||
| 2926 | Ga0373950_0027060 | |||
| 2927 | Ga0373944_0054736 | |||
| 2928 | Ga0373949_0032485 | |||
| 2929 | Ga0373952_0019312 | |||
| 2930 | Ga0373923_0000977 | |||
| 2931 | Ga0373932_0016593 | |||
| 2932 | Ga0373932_0048969 | |||
| 2933 | Ga0373932_0126676 | |||
| 2934 | Ga0373936_0008424 | |||
| 2935 | Ga0373936_0038387 | |||
| 2936 | Ga0373936_0137465 | |||
| 2937 | Ga0373939_0028623 | |||
| 2938 | Ga0373939_0034687 | |||
| 2939 | Ga0373939_0077687 | |||
| 2940 | Ga0373941_0052552 | |||
| 2941 | Ga0373941_0117662 | |||
| 2942 | Ga0373941_0121937 | |||
| 2943 | Ga0373945_0037106 | |||
| 2944 | Ga0373953_0014188 | |||
| 2945 | Ga0373957_0044855 | |||
| 2946 | Ga0373943_0004711 | |||
| 2947 | Ga0373943_0011784 | |||
| 2948 | Ga0373943_0177040 | |||
| 2949 | Ga0373943_0206992 | |||
| 2950 | Ga0373946_0000291 | |||
| 2951 | Ga0373946_0022235 | |||
| 2952 | Ga0373955_0050928 | |||
| 2953 | Ga0373942_0018872 | |||
| 2954 | Ga0373942_0041948 | |||
| 2955 | Ga0373962_0004822 | |||
| 2956 | Ga0373962_0108324 | |||
| 2957 | Ga0373924_0011374 | |||
| 2958 | Ga0373931_0001201 | |||
| 2959 | Ga0373931_0004184 | |||
| 2960 | Ga0373931_0010541 | |||
| 2961 | Ga0373931_0046697 | |||
| 2962 | Ga0373931_0051624 | |||
| 2963 | Ga0373935_0006219 | |||
| 2964 | Ga0373935_0023117 | |||
| 2965 | Ga0373927_0007441 | |||
| 2966 | Ga0373927_0008160 | |||
| 2967 | Ga0373927_0040539 | |||
| 2968 | Ga0373927_0314224 | |||
| 2969 | Ga0373933_0017826 | |||
| 2970 | Ga0373947_0001133 | |||
| 2971 | Ga0373947_0006846 | |||
| 2972 | Ga0373947_0093089 | |||
| 2973 | Ga0373947_0249626 | |||
| 2974 | Ga0373947_0267782 | |||
| 2975 | Ga0373937_0000031 | |||
| 2976 | Ga0373937_0058789 | |||
| 2977 | Ga0373937_0480412 | |||
| 2978 | Ga0373937_0529728 | |||
| 2979 | Ga0373925_0000063 | |||
| 2980 | Ga0373925_0016226 | |||
| 2981 | Ga0373925_0029499 | |||
| 2982 | Ga0373925_0030675 | |||
| 2983 | Ga0373925_0109804 | |||
| 2984 | Ga0373925_0200227 | |||
| 2985 | Ga0395899_0000059 | |||
| 2986 | Ga0395900_0000017 | |||
| 2987 | Ga0395900_0030214 | |||
| 2988 | Ga0395900_0155881 | |||
| 2989 | Ga0395900_0187810 | |||
| 2990 | Ga0395898_0000030 | |||
| 2991 | Ga0395898_0013945 | |||
| 2992 | Ga0395898_0014421 | |||
| 2993 | Ga0395898_0169502 | |||
| 2994 | Ga0395905_0000056 | |||
| 2995 | Ga0395905_0000553 | |||
| 2996 | Ga0395905_0048020 | |||
| 2997 | Ga0395905_0133490 | |||
| 2998 | Ga0395905_0212066 | |||
| 2999 | Ga0395905_0274356 | |||
| 3000 | Ga0395905_0431606 | |||
| 3001 | Ga0436364_0275973 | |||
| 3002 | Ga0436364_0499842 | |||
| 3003 | Ga0436364_0702728 | |||
| 3004 | Ga0436364_0821808 | |||
| 3005 | Ga0436364_1163562 | |||
| 3006 | Ga0436364_1172199 | |||
| 3007 | Ga0436364_1338890 | |||
| 3008 | Ga0395901_0000015 | |||
| 3009 | Ga0395901_0055418 | |||
| 3010 | Ga0395901_0082529 | |||
| 3011 | Ga0395901_0105451 | |||
| 3012 | Ga0395901_0540556 | |||
| 3013 | Ga0242420_022981 | |||
| 3014 | Ga0237816_00384 | |||
| 3015 | Ga0436365_0125505 | |||
| 3016 | Ga0436365_0235359 | |||
| 3017 | Ga0436365_0247443 | |||
| 3018 | Ga0436365_0443046 | |||
| 3019 | Ga0436365_0876105 | |||
| 3020 | Ga0436365_1009793 | |||
| 3021 | Ga0436365_1031004 | |||
| 3022 | Ga0436365_1620828 | |||
| 3023 | Ga0436360_0612193 | |||
| 3024 | Ga0436360_1365466 | |||
| 3025 | Ga0436361_0333837 | |||
| 3026 | Ga0436361_1169094 | |||
| 3027 | Ga0436361_1179362 | |||
| 3028 | Ga0436363_0745057 | |||
| 3029 | Ga0436363_0845878 | |||
| 3030 | Ga0436363_1374215 | |||
| 3031 | Ga0436363_1425116 | |||
| 3032 | Ga0436363_1588421 | |||
| 3033 | Ga0436363_1691519 | |||
| 3034 | Ga0436362_0936835 | |||
| 3035 | Ga0436362_0983745 | |||
| 3036 | Ga0439433_0015502 | |||
| 3037 | Ga0439451_009314 | |||
| 3038 | Ga0450889_001635 | |||
| 3039 | Ga0439435_0013585 | |||
| 3040 | Ga0439444_0006155 | |||
| 3041 | Ga0439460_0038896 | |||
| 3042 | Ga0439440_0070336 | |||
| 3043 | Ga0466966_0014115 | |||
| 3044 | Ga0466960_0226163 | |||
| 3045 | Ga0466959_0014113 | |||
| 3046 | Ga0466959_0286409 | |||
| 3047 | Ga0466958_0011243 | |||
| 3048 | Ga0466967_0349558 | |||
| 3049 | Ga0495592_0000072 | |||
| 3050 | Ga0495592_0035668 | |||
| 3051 | Ga0495603_0000872 | |||
| 3052 | Ga0495603_0030425 | |||
| 3053 | Ga0495603_0035030 | |||
| 3054 | Ga0495590_0129834 | |||
| 3055 | Ga0495629_0013500 | |||
| 3056 | Ga0495629_0031933 | |||
| 3057 | Ga0495629_0129920 | |||
| 3058 | Ga0495629_0213149 | |||
| 3059 | Ga0495629_0255501 | |||
| 3060 | Ga0495641_0084465 | |||
| 3061 | Ga0495651_0000595 | |||
| 3062 | Ga0495651_0321323 | |||
| 3063 | Ga0495651_0341694 | |||
| 3064 | Ga0495653_0000020 | |||
| 3065 | Ga0495653_0080502 | |||
| 3066 | Ga0495580_0002021 | |||
| 3067 | Ga0495580_0008232 | |||
| 3068 | Ga0495580_0040401 | |||
| 3069 | Ga0495580_0066496 | |||
| 3070 | Ga0495582_0009149 | |||
| 3071 | Ga0495582_0014054 | |||
| 3072 | Ga0495582_0043622 | |||
| 3073 | Ga0495605_0014755 | |||
| 3074 | Ga0495639_0001587 | |||
| 3075 | Ga0495639_0228104 | |||
| 3076 | Ga0495662_0058783 | |||
| 3077 | Ga0495664_0000006 | |||
| 3078 | Ga0495664_0071738 | |||
| 3079 | Ga0495584_0012859 | |||
| 3080 | Ga0495584_0044716 | |||
| 3081 | Ga0495584_0110763 | |||
| 3082 | Ga0495594_0003039 | |||
| 3083 | Ga0495596_0085134 | |||
| 3084 | Ga0495583_0035766 | |||
| 3085 | Ga0495608_0000002 | |||
| 3086 | Ga0495616_0061849 | |||
| 3087 | Ga0495618_0000017 | |||
| 3088 | Ga0495628_0000004 | |||
| 3089 | Ga0495628_0058832 | |||
| 3090 | Ga0495628_0121517 | |||
| 3091 | Ga0495628_0462378 | |||
| 3092 | Ga0495630_0001747 | |||
| 3093 | Ga0495630_0083557 | |||
| 3094 | Ga0495630_0359047 | |||
| 3095 | Ga0495631_0037033 | |||
| 3096 | Ga0495637_0032744 | |||
| 3097 | Ga0495648_0012530 | |||
| 3098 | Ga0495652_0000007 | |||
| 3099 | Ga0495652_0028570 | |||
| 3100 | Ga0495652_0114470 | |||
| 3101 | Ga0495665_0004975 | |||
| 3102 | Ga0495665_0034806 | |||
| 3103 | Ga0495640_0000004 | |||
| 3104 | Ga0495587_0000002 | |||
| 3105 | Ga0495609_0089866 | |||
| 3106 | Ga0495645_0000008 | |||
| 3107 | Ga0495622_0002253 | |||
| 3108 | Ga0495622_0004419 | |||
| 3109 | Ga0495622_0018640 | |||
| 3110 | Ga0495622_0043283 | |||
| 3111 | Ga0495622_0111601 | |||
| 3112 | Ga0495667_0000010 | |||
| 3113 | Ga0495667_0026144 | |||
| 3114 | Ga0495656_0086783 | |||
| 3115 | Ga0495656_0161507 | |||
| 3116 | Ga0495656_0231568 | |||
| 3117 | Ga0495668_0064356 | |||
| 3118 | Ga0495668_0265588 | |||
| 3119 | Ga0495634_0000001 | |||
| 3120 | Ga0495634_0001869 | |||
| 3121 | Ga0495634_0074172 | |||
| 3122 | Ga0495634_0095237 | |||
| 3123 | Ga0495611_0132880 | |||
| 3124 | Ga0495625_0146735 | |||
| 3125 | Ga0495635_0000004 | |||
| 3126 | Ga0495635_0032326 | |||
| 3127 | Ga0495661_0074097 | |||
| 3128 | Ga0495661_0219838 | |||
| 3129 | Ga0495588_0002382 | |||
| 3130 | Ga0495588_0065551 | |||
| 3131 | Ga0495657_0000265 | |||
| 3132 | Ga0495657_0027279 | |||
| 3133 | Ga0495657_0073609 | |||
| 3134 | Ga0495599_0000003 | |||
| 3135 | Ga0495599_0061749 | |||
| 3136 | Ga0495623_0000009 | |||
| 3137 | Ga0495646_0000001 | |||
| 3138 | Ga0495647_0062155 | |||
| 3139 | Ga0495658_0001840 | |||
| 3140 | Ga0495658_0031541 | |||
| 3141 | Ga0495658_0048625 | |||
| 3142 | Ga0495658_0098402 | |||
| 3143 | Ga0495658_0118172 | |||
| 3144 | Ga0495658_0206799 | |||
| 3145 | Ga0495613_0006074 | |||
| 3146 | Ga0495613_0041421 | |||
| 3147 | Ga0495613_0260116 | |||
| 3148 | Ga0495613_0276643 | |||
| 3149 | Ga0495624_0030783 | |||
| 3150 | Ga0495624_0077669 | |||
| 3151 | Ga0495649_0044888 | |||
| 3152 | Ga0495649_0069411 | |||
| 3153 | Ga0495589_0067982 | |||
| 3154 | Ga0495589_0104639 | |||
| 3155 | Ga0495600_0000008 | |||
| 3156 | Ga0495600_0010717 | |||
| 3157 | Ga0495600_0041579 | |||
| 3158 | Ga0495581_0005894 | |||
| 3159 | Ga0495604_0000003 | |||
| 3160 | Ga0495604_0013870 | |||
| 3161 | Ga0495604_0029289 | |||
| 3162 | Ga0495604_0069459 | |||
| 3163 | Ga0495604_0235417 | |||
| 3164 | Ga0495674_0000021 | |||
| 3165 | Ga0495674_0024249 | |||
| 3166 | Ga0495674_0048481 | |||
| 3167 | Ga0495674_0085431 | |||
| 3168 | Ga0495674_0405671 | |||
| 3169 | Ga0495672_0026399 | |||
| 3170 | Ga0495676_0034639 | |||
| 3171 | Ga0495676_0070430 | |||
| 3172 | Ga0495676_0107454 | |||
| 3173 | Ga0495676_0244250 | |||
| 3174 | Ga0495676_0307605 | |||
| 3175 | Ga0495680_0000552 | |||
| 3176 | Ga0495680_0078439 | |||
| 3177 | Ga0495683_0012510 | |||
| 3178 | Ga0495687_020145 | |||
| 3179 | Ga0495675_0000581 | |||
| 3180 | Ga0495673_0035805 | |||
| 3181 | Ga0495684_0000003 | |||
| 3182 | Ga0495684_0065541 | |||
| 3183 | Ga0495686_0041614 | |||
| 3184 | Ga0495686_0193035 | |||
| 3185 | Ga0495686_0194100 | |||
| 3186 | Ga0495593_0000179 | |||
| 3187 | Ga0495593_0003265 | |||
| 3188 | Ga0495593_0227661 | |||
| 3189 | Ga0495593_0234678 | |||
| 3190 | Ga0495602_0000012 | |||
| 3191 | Ga0495602_0018907 | |||
| 3192 | Ga0495602_0299980 | |||
| 3193 | Ga0495602_0302882 | |||
| 3194 | Ga0495615_0016519 | |||
| 3195 | Ga0495626_0027147 | |||
| 3196 | Ga0495626_0089816 | |||
| 3197 | Ga0496100_0008478 | |||
| 3198 | Ga0496100_0010401 | |||
| 3199 | Ga0496100_0012941 | |||
| 3200 | Ga0496100_0017404 | |||
| 3201 | Ga0496100_0024025 | |||
| 3202 | Ga0496100_0027348 | |||
| 3203 | Ga0496100_0158517 | |||
| 3204 | Ga0496100_0249214 | |||
| 3205 | Ga0496100_0644846 | |||
| 3206 | Ga0496101_0010920 | |||
| 3207 | Ga0496101_0027095 | |||
| 3208 | Ga0496101_0033222 | |||
| 3209 | Ga0496101_0046917 | |||
| 3210 | Ga0496101_0086815 | |||
| 3211 | Ga0496101_0090509 | |||
| 3212 | Ga0496101_0109979 | |||
| 3213 | Ga0496101_0126850 | |||
| 3214 | Ga0496101_0169733 | |||
| 3215 | Ga0496101_0530890 | |||
| 3216 | Ga0496102_0004821 | |||
| 3217 | Ga0496102_0011587 | |||
| 3218 | Ga0496102_0014879 | |||
| 3219 | Ga0496102_0023806 | |||
| 3220 | Ga0496102_0024872 | |||
| 3221 | Ga0496102_0025489 | |||
| 3222 | Ga0496102_0034651 | |||
| 3223 | Ga0496102_0077614 | |||
| 3224 | Ga0496102_0106937 | |||
| 3225 | Ga0496102_0120995 | |||
| 3226 | Ga0496102_0618109 | |||
| 3227 | Ga0496103_0010759 | |||
| 3228 | Ga0496103_0015362 | |||
| 3229 | Ga0496103_0017250 | |||
| 3230 | Ga0496103_0030461 | |||
| 3231 | Ga0496103_0044726 | |||
| 3232 | Ga0496103_0053127 | |||
| 3233 | Ga0496103_0139030 | |||
| 3234 | Ga0496104_0000080 | |||
| 3235 | Ga0496104_0000149 | |||
| 3236 | Ga0496104_0000279 | |||
| 3237 | Ga0496104_0001052 | |||
| 3238 | Ga0496104_0009332 | |||
| 3239 | Ga0496104_0016854 | |||
| 3240 | Ga0496104_0016989 | |||
| 3241 | Ga0496104_0025519 | |||
| 3242 | Ga0496104_0044083 | |||
| 3243 | Ga0496104_0051156 | |||
| 3244 | Ga0496104_0064234 | |||
| 3245 | Ga0496104_0118303 | |||
| 3246 | Ga0496104_0124202 | |||
| 3247 | Ga0496104_0200303 | |||
| 3248 | Ga0496105_0000052 | |||
| 3249 | Ga0496105_0000272 | |||
| 3250 | Ga0496105_0009202 | |||
| 3251 | Ga0496105_0015532 | |||
| 3252 | Ga0496105_0022029 | |||
| 3253 | Ga0496105_0027606 | |||
| 3254 | Ga0496105_0033734 | |||
| 3255 | Ga0496105_0058309 | |||
| 3256 | Ga0496105_0061825 | |||
| 3257 | Ga0496105_0082323 | |||
| 3258 | Ga0496105_0086293 | |||
| 3259 | Ga0496105_0269455 | |||
| 3260 | Ga0496105_0304496 | |||
| 3261 | Ga0496105_0420974 | |||
| 3262 | Ga0496106_0000854 | |||
| 3263 | Ga0496106_0002017 | |||
| 3264 | Ga0496106_0003517 | |||
| 3265 | Ga0496106_0010756 | |||
| 3266 | Ga0496106_0012358 | |||
| 3267 | Ga0496106_0012742 | |||
| 3268 | Ga0496106_0025337 | |||
| 3269 | Ga0496106_0040891 | |||
| 3270 | Ga0496106_0073437 | |||
| 3271 | Ga0496106_0089094 | |||
| 3272 | Ga0496106_0100196 | |||
| 3273 | Ga0496106_0151879 | |||
| 3274 | Ga0496106_0263565 | |||
| 3275 | Ga0496106_0446107 | |||
| 3276 | Ga0496107_0000548 | |||
| 3277 | Ga0496107_0003678 | |||
| 3278 | Ga0496107_0008310 | |||
| 3279 | Ga0496107_0008765 | |||
| 3280 | Ga0496107_0011962 | |||
| 3281 | Ga0496107_0012866 | |||
| 3282 | Ga0496107_0017790 | |||
| 3283 | Ga0496107_0017891 | |||
| 3284 | Ga0496107_0052669 | |||
| 3285 | Ga0496107_0057487 | |||
| 3286 | Ga0496107_0103731 | |||
| 3287 | Ga0496107_0211317 | |||
| 3288 | Ga0496107_0263517 | |||
| 3289 | Ga0496107_0339092 | |||
| 3290 | Ga0496107_0379097 | |||
| 3291 | Ga0496108_0000625 | |||
| 3292 | Ga0496108_0045486 | |||
| 3293 | Ga0496108_0045705 | |||
| 3294 | Ga0496108_0064682 | |||
| 3295 | Ga0496108_0071113 | |||
| 3296 | Ga0496108_0076414 | |||
| 3297 | Ga0496108_0076676 | |||
| 3298 | Ga0496108_0105961 | |||
| 3299 | Ga0496108_0122073 | |||
| 3300 | Ga0496108_0362267 | |||
| 3301 | Ga0496109_0001375 | |||
| 3302 | Ga0496109_0075473 | |||
| 3303 | Ga0496109_0088197 | |||
| 3304 | Ga0496109_0101494 | |||
| 3305 | Ga0496109_0128441 | |||
| 3306 | Ga0496109_0143356 | |||
| 3307 | Ga0496109_0145078 | |||
| 3308 | Ga0496109_0187784 | |||
| 3309 | Ga0496109_0419893 | |||
| 3310 | Ga0496109_0503483 | |||
| 3311 | Ga0496110_0001079 | |||
| 3312 | Ga0496110_0005932 | |||
| 3313 | Ga0496110_0010159 | |||
| 3314 | Ga0496110_0011880 | |||
| 3315 | Ga0496110_0025085 | |||
| 3316 | Ga0496110_0026794 | |||
| 3317 | Ga0496110_0036438 | |||
| 3318 | Ga0496110_0044969 | |||
| 3319 | Ga0496110_0046494 | |||
| 3320 | Ga0496110_0212192 | |||
| 3321 | Ga0496110_0225184 | |||
| 3322 | Ga0496110_0386129 | |||
| 3323 | Ga0496110_0446990 | |||
| 3324 | Ga0496110_0822528 | |||
| 3325 | Ga0496111_0001188 | |||
| 3326 | Ga0496111_0001541 | |||
| 3327 | Ga0496111_0011957 | |||
| 3328 | Ga0496111_0014085 | |||
| 3329 | Ga0496111_0015529 | |||
| 3330 | Ga0496111_0130861 | |||
| 3331 | Ga0496111_0171028 | |||
| 3332 | Ga0496111_0258619 | |||
| 3333 | Ga0496112_0002410 | |||
| 3334 | Ga0496112_0010794 | |||
| 3335 | Ga0496112_0039568 | |||
| 3336 | Ga0496112_0050078 | |||
| 3337 | Ga0496112_0057434 | |||
| 3338 | Ga0496112_0068331 | |||
| 3339 | Ga0496112_0076393 | |||
| 3340 | Ga0496112_0090183 | |||
| 3341 | Ga0496112_0106746 | |||
| 3342 | Ga0496112_0118913 | |||
| 3343 | Ga0496112_0141664 | |||
| 3344 | Ga0496113_0000087 | |||
| 3345 | Ga0496113_0001148 | |||
| 3346 | Ga0496113_0008398 | |||
| 3347 | Ga0496113_0011985 | |||
| 3348 | Ga0496113_0015454 | |||
| 3349 | Ga0496113_0020844 | |||
| 3350 | Ga0496113_0030815 | |||
| 3351 | Ga0496113_0103608 | |||
| 3352 | Ga0496113_0283710 | |||
| 3353 | Ga0496113_0404113 | |||
| 3354 | Ga0496113_0658383 | |||
| 3355 | Ga0496114_0029790 | |||
| 3356 | Ga0496114_0031434 | |||
| 3357 | Ga0496114_0070514 | |||
| 3358 | Ga0496114_0074061 | |||
| 3359 | Ga0496114_0094884 | |||
| 3360 | Ga0496114_0108867 | |||
| 3361 | Ga0496114_0142382 | |||
| 3362 | Ga0496114_0430736 | |||
| 3363 | Ga0496114_0593412 | |||
| 3364 | Ga0496115_0006310 | |||
| 3365 | Ga0496115_0011417 | |||
| 3366 | Ga0496115_0022102 | |||
| 3367 | Ga0496115_0032978 | |||
| 3368 | Ga0496115_0072893 | |||
| 3369 | Ga0496115_0118662 | |||
| 3370 | Ga0496115_0127441 | |||
| 3371 | Ga0496115_0179324 | |||
| 3372 | Ga0496115_0249773 | |||
| 3373 | Ga0496115_0266743 | |||
| 3374 | Ga0496115_0269574 | |||
| 3375 | Ga0496115_0316442 | |||
| 3376 | Ga0496115_0362769 | |||
| 3377 | Ga0496115_0453805 | |||
| 3378 | Ga0496115_0470930 | |||
| 3379 | Ga0496116_0227582 | |||
| 3380 | Ga0496118_0260937 | |||
| 3381 | Ga0496119_0000898 | |||
| 3382 | Ga0496119_0009306 | |||
| 3383 | Ga0496119_0012124 | |||
| 3384 | Ga0496119_0014229 | |||
| 3385 | Ga0496119_0139992 | |||
| 3386 | Ga0496120_0011646 | |||
| 3387 | Ga0496120_0057874 | |||
| 3388 | Ga0496121_0006038 | |||
| 3389 | Ga0496121_0067741 | |||
| 3390 | Ga0496122_0000399 | |||
| 3391 | Ga0496122_0218868 | |||
| 3392 | Ga0496123_0003753 | |||
| 3393 | Ga0496123_0057939 | |||
| 3394 | Ga0496123_0069764 | |||
| 3395 | Ga0496124_0030416 | |||
| 3396 | Ga0496125_0065438 | |||
| 3397 | Ga0496125_0072523 | |||
| 3398 | Ga0496125_0162158 | |||
| 3399 | Ga0496125_0252571 | |||
| 3400 | Ga0496126_0003453 | |||
| 3401 | Ga0496126_0024000 | |||
| 3402 | Ga0496126_0038264 | |||
| 3403 | Ga0496126_0043355 | |||
| 3404 | Ga0496126_0105456 | |||
| 3405 | Ga0501031_0000018 | |||
| 3406 | Ga0501031_0046757 | |||
| 3407 | Ga0501031_0053942 | |||
| 3408 | Ga0501031_0078422 | |||
| 3409 | Ga0501031_0091473 | |||
| 3410 | Ga0501032_0000031 | |||
| 3411 | Ga0501032_0000201 | |||
| 3412 | Ga0501032_0013095 | |||
| 3413 | Ga0501032_0101147 | |||
| 3414 | Ga0501032_0114842 | |||
| 3415 | Ga0501032_0255155 | |||
| 3416 | Ga0501032_0264440 | |||
| 3417 | Ga0501033_0000126 | |||
| 3418 | Ga0501033_0000328 | |||
| 3419 | Ga0501033_0006625 | |||
| 3420 | Ga0501033_0009424 | |||
| 3421 | Ga0501033_0018584 | |||
| 3422 | Ga0501033_0019815 | |||
| 3423 | Ga0501033_0025403 | |||
| 3424 | Ga0501033_0052548 | |||
| 3425 | Ga0501033_0105997 | |||
| 3426 | Ga0501033_0316847 | |||
| 3427 | Ga0501034_0000005 | |||
| 3428 | Ga0501034_0000064 | |||
| 3429 | Ga0501034_0000076 | |||
| 3430 | Ga0501034_0009541 | |||
| 3431 | Ga0501034_0021935 | |||
| 3432 | Ga0501034_0054192 | |||
| 3433 | Ga0501034_0147647 | |||
| 3434 | Ga0501034_0284559 | |||
| 3435 | Ga0501034_0346887 | |||
| 3436 | Ga0501034_0489622 | |||
| 3437 | Ga0501036_0000005 | |||
| 3438 | Ga0501036_0005686 | |||
| 3439 | Ga0501036_0005749 | |||
| 3440 | Ga0501036_0070327 | |||
| 3441 | Ga0501036_0079858 | |||
| 3442 | Ga0501036_0154955 | |||
| 3443 | Ga0501036_0262175 | |||
| 3444 | Ga0501036_0297434 | |||
| 3445 | Ga0501036_0517530 | |||
| 3446 | Ga0501037_0000045 | |||
| 3447 | Ga0501037_0002164 | |||
| 3448 | Ga0501037_0003332 | |||
| 3449 | Ga0501037_0005389 | |||
| 3450 | Ga0501037_0005524 | |||
| 3451 | Ga0501037_0083410 | |||
| 3452 | Ga0501037_0226391 | |||
| 3453 | Ga0501037_0434533 | |||
| 3454 | Ga0501038_0000001 | |||
| 3455 | Ga0501038_0000205 | |||
| 3456 | Ga0501038_0015483 | |||
| 3457 | Ga0501038_0053176 | |||
| 3458 | Ga0501038_0062717 | |||
| 3459 | Ga0501038_0071835 | |||
| 3460 | Ga0501038_0139198 | |||
| 3461 | Ga0501038_0149467 | |||
| 3462 | Ga0501038_0175311 | |||
| 3463 | Ga0501038_0289319 | |||
| 3464 | Ga0501038_0307398 | |||
| 3465 | Ga0501038_0388240 | |||
| 3466 | Ga0501039_0000007 | |||
| 3467 | Ga0501039_0000105 | |||
| 3468 | Ga0501039_0002792 | |||
| 3469 | Ga0501039_0008466 | |||
| 3470 | Ga0501039_0012743 | |||
| 3471 | Ga0501039_0060468 | |||
| 3472 | Ga0501039_0113942 | |||
| 3473 | Ga0501039_0160710 | |||
| 3474 | Ga0501039_0188883 | |||
| 3475 | Ga0501039_0398430 | |||
| 3476 | Ga0501040_0026013 | |||
| 3477 | Ga0501040_0029852 | |||
| 3478 | Ga0501040_0052412 | |||
| 3479 | Ga0501040_0098807 | |||
| 3480 | Ga0501040_0128627 | |||
| 3481 | Ga0501040_0132300 | |||
| 3482 | Ga0501040_0148742 | |||
| 3483 | Ga0501040_0282644 | |||
| 3484 | Ga0501041_0024244 | |||
| 3485 | Ga0501041_0055484 | |||
| 3486 | Ga0501041_0063423 | |||
| 3487 | Ga0501041_0074071 | |||
| 3488 | Ga0501041_0187157 | |||
| 3489 | Ga0501042_0007562 | |||
| 3490 | Ga0501042_0042178 | |||
| 3491 | Ga0501042_0049320 | |||
| 3492 | Ga0501042_0057666 | |||
| 3493 | Ga0501042_0206237 | |||
| 3494 | Ga0501042_0298318 | |||
| 3495 | Ga0501042_0438440 | |||
| 3496 | Ga0501043_0000015 | |||
| 3497 | Ga0501043_0000107 | |||
| 3498 | Ga0501043_0056281 | |||
| 3499 | Ga0501043_0079453 | |||
| 3500 | Ga0501043_0232884 | |||
| 3501 | Ga0501043_0288373 | |||
| 3502 | Ga0501043_0348444 | |||
| 3503 | Ga0501043_0437769 | |||
| 3504 | Ga0501043_0485698 | |||
| 3505 | Ga0501046_0001416 | |||
| 3506 | Ga0501046_0006723 | |||
| 3507 | Ga0501046_0009778 | |||
| 3508 | Ga0501046_0015459 | |||
| 3509 | Ga0501046_0032371 | |||
| 3510 | Ga0501046_0071334 | |||
| 3511 | Ga0501046_0074334 | |||
| 3512 | Ga0501046_0109985 | |||
| 3513 | Ga0501046_0133453 | |||
| 3514 | Ga0501046_0202364 | |||
| 3515 | Ga0501046_0236924 | |||
| 3516 | Ga0501047_0000749 | |||
| 3517 | Ga0501047_0020996 | |||
| 3518 | Ga0501047_0059969 | |||
| 3519 | Ga0501047_0083424 | |||
| 3520 | Ga0501047_0140646 | |||
| 3521 | Ga0501047_0149101 | |||
| 3522 | Ga0501047_0154243 | |||
| 3523 | Ga0501047_0316422 | |||
| 3524 | Ga0501047_0422943 | |||
| 3525 | Ga0501048_0001563 | |||
| 3526 | Ga0501048_0021329 | |||
| 3527 | Ga0501048_0068570 | |||
| 3528 | Ga0501048_0120298 | |||
| 3529 | Ga0501048_0182528 | |||
| 3530 | Ga0501048_0365788 | |||
| 3531 | Ga0501067_0000091 | |||
| 3532 | Ga0501067_0003300 | |||
| 3533 | Ga0501067_0011645 | |||
| 3534 | Ga0501067_0022295 | |||
| 3535 | Ga0501067_0023338 | |||
| 3536 | Ga0501067_0066765 | |||
| 3537 | Ga0501067_0244369 | |||
| 3538 | Ga0501068_0002658 | |||
| 3539 | Ga0501068_0111995 | |||
| 3540 | Ga0501068_0149164 | |||
| 3541 | Ga0501069_0000039 | |||
| 3542 | Ga0501069_0006899 | |||
| 3543 | Ga0501069_0011283 | |||
| 3544 | Ga0501069_0121149 | |||
| 3545 | Ga0501069_0143401 | |||
| 3546 | Ga0501069_0154645 | |||
| 3547 | Ga0501069_0167243 | |||
| 3548 | Ga0501069_0344466 | |||
| 3549 | Ga0501070_0000132 | |||
| 3550 | Ga0501070_0000299 | |||
| 3551 | Ga0501070_0002117 | |||
| 3552 | Ga0501070_0017763 | |||
| 3553 | Ga0501070_0072038 | |||
| 3554 | Ga0501070_0155983 | |||
| 3555 | Ga0501070_0159579 | |||
| 3556 | Ga0501070_0174991 | |||
| 3557 | Ga0501070_0202340 | |||
| 3558 | Ga0501070_0210840 | |||
| 3559 | Ga0501070_0298993 | |||
| 3560 | Ga0501070_0350415 | |||
| 3561 | Ga0501071_0009502 | |||
| 3562 | Ga0501071_0059576 | |||
| 3563 | Ga0501071_0069731 | |||
| 3564 | Ga0501071_0102429 | |||
| 3565 | Ga0501071_0232297 | |||
| 3566 | Ga0501071_0238034 | |||
| 3567 | Ga0501071_0489398 | |||
| 3568 | Ga0501072_0042737 | |||
| 3569 | Ga0501072_0050121 | |||
| 3570 | Ga0501072_0101090 | |||
| 3571 | Ga0501072_0204696 | |||
| 3572 | Ga0501072_0269426 | |||
| 3573 | Ga0501072_0324779 | |||
| 3574 | Ga0501072_0425513 | |||
| 3575 | Ga0501073_0000011 | |||
| 3576 | Ga0501073_0023740 | |||
| 3577 | Ga0501073_0042848 | |||
| 3578 | Ga0501073_0074563 | |||
| 3579 | Ga0501073_0129836 | |||
| 3580 | Ga0501073_0165808 | |||
| 3581 | Ga0501073_0246409 | |||
| 3582 | Ga0501074_0029210 | |||
| 3583 | Ga0501074_0105413 | |||
| 3584 | Ga0501074_0153177 | |||
| 3585 | Ga0501074_0195871 | |||
| 3586 | Ga0501074_0209210 | |||
| 3587 | Ga0501074_0367637 | |||
| 3588 | Ga0501075_0011328 | |||
| 3589 | Ga0501075_0071281 | |||
| 3590 | Ga0501075_0114157 | |||
| 3591 | Ga0501075_0129483 | |||
| 3592 | Ga0501075_0147766 | |||
| 3593 | Ga0501075_0182438 | |||
| 3594 | Ga0501076_0020611 | |||
| 3595 | Ga0501076_0025189 | |||
| 3596 | Ga0501076_0031924 | |||
| 3597 | Ga0501076_0047363 | |||
| 3598 | Ga0501076_0076567 | |||
| 3599 | Ga0501076_0077646 | |||
| 3600 | Ga0501076_0084120 | |||
| 3601 | Ga0501076_0132547 | |||
| 3602 | Ga0501076_0272820 | |||
| 3603 | Ga0501076_0465036 | |||
| 3604 | Ga0501077_0000011 | |||
| 3605 | Ga0501077_0007078 | |||
| 3606 | Ga0501077_0007395 | |||
| 3607 | Ga0501077_0010077 | |||
| 3608 | Ga0501077_0013376 | |||
| 3609 | Ga0501077_0032924 | |||
| 3610 | Ga0501077_0032975 | |||
| 3611 | Ga0501077_0075545 | |||
| 3612 | Ga0501077_0113740 | |||
| 3613 | Ga0501077_0114634 | |||
| 3614 | Ga0501077_0282502 | |||
| 3615 | Ga0501079_0024804 | |||
| 3616 | Ga0501079_0046675 | |||
| 3617 | Ga0501079_0051845 | |||
| 3618 | Ga0501079_0070038 | |||
| 3619 | Ga0501079_0152991 | |||
| 3620 | Ga0501079_0202415 | |||
| 3621 | Ga0501079_0269421 | |||
| 3622 | Ga0501079_0312226 | |||
| 3623 | Ga0501079_0318913 | |||
| 3624 | Ga0501079_0378459 | |||
| 3625 | Ga0501080_0000004 | |||
| 3626 | Ga0501080_0001484 | |||
| 3627 | Ga0501080_0003023 | |||
| 3628 | Ga0501080_0013324 | |||
| 3629 | Ga0501080_0055277 | |||
| 3630 | Ga0501080_0125630 | |||
| 3631 | Ga0501080_0128121 | |||
| 3632 | Ga0501080_0212342 | |||
| 3633 | Ga0501080_0221725 | |||
| 3634 | Ga0501080_0254450 | |||
| 3635 | Ga0501080_0287134 | |||
| 3636 | Ga0501080_0443696 | |||
| 3637 | Ga0501081_0004485 | |||
| 3638 | Ga0501081_0007228 | |||
| 3639 | Ga0501081_0180358 | |||
| 3640 | Ga0501081_0186404 | |||
| 3641 | Ga0501081_0219637 | |||
| 3642 | Ga0501081_0387631 | |||
| 3643 | Ga0501081_0572578 | |||
| 3644 | Ga0501083_0007222 | |||
| 3645 | Ga0501083_0011832 | |||
| 3646 | Ga0501083_0042437 | |||
| 3647 | Ga0501083_0166039 | |||
| 3648 | Ga0501083_0234010 | |||
| 3649 | Ga0501035_0000008 | |||
| 3650 | Ga0501035_0000055 | |||
| 3651 | Ga0501035_0000272 | |||
| 3652 | Ga0501035_0000436 | |||
| 3653 | Ga0501035_0000807 | |||
| 3654 | Ga0501035_0002108 | |||
| 3655 | Ga0501035_0011205 | |||
| 3656 | Ga0501035_0072735 | |||
| 3657 | Ga0501035_0076459 | |||
| 3658 | Ga0501035_0103199 | |||
| 3659 | Ga0501035_0147493 | |||
| 3660 | Ga0501035_0147623 | |||
| 3661 | Ga0501035_0214906 | |||
| 3662 | Ga0501035_0348481 | |||
| 3663 | Ga0501035_0448309 | |||
| 3664 | Ga0501035_0770353 | |||
| 3665 | Ga0501044_0000001 | |||
| 3666 | Ga0501044_0000007 | |||
| 3667 | Ga0501044_0000071 | |||
| 3668 | Ga0501044_0004447 | |||
| 3669 | Ga0501044_0005930 | |||
| 3670 | Ga0501044_0015843 | |||
| 3671 | Ga0501044_0024335 | |||
| 3672 | Ga0501044_0077649 | |||
| 3673 | Ga0501044_0089138 | |||
| 3674 | Ga0501044_0089954 | |||
| 3675 | Ga0501044_0094218 | |||
| 3676 | Ga0501044_0119737 | |||
| 3677 | Ga0501044_0134921 | |||
| 3678 | Ga0501044_0164592 | |||
| 3679 | Ga0501044_0209839 | |||
| 3680 | Ga0501044_0465092 | |||
| 3681 | Ga0501044_0531803 | |||
| 3682 | Ga0501044_0549580 | |||
| 3683 | Ga0501044_0818935 | |||
| 3684 | Ga0501045_0059098 | |||
| 3685 | Ga0501045_0072997 | |||
| 3686 | Ga0501045_0116382 | |||
| 3687 | Ga0501045_0117374 | |||
| 3688 | Ga0501045_0159776 | |||
| 3689 | Ga0501045_0187914 | |||
| 3690 | Ga0501045_0257986 | |||
| 3691 | nmdc:mga03683_12592_c1 | |||
| 3692 | nmdc:mga03683_12819_c1 | |||
| 3693 | nmdc:mga03683_929_c1 | |||
| 3694 | nmdc:mga03n38_168019_c1 | |||
| 3695 | nmdc:mga03n38_696_c1 | |||
| 3696 | nmdc:mga03n38_80019_c1 | |||
| 3697 | nmdc:mga03n38_89094_c1 | |||
| 3698 | nmdc:mga00v17_83626_c1 | |||
| 3699 | nmdc:mga00v17_89517_c1 | |||
| 3700 | nmdc:mga00v17_9731_c1 | |||
| 3701 | nmdc:mga0yw44_23765_c1 | |||
| 3702 | nmdc:mga0yw44_25254_c1 | |||
| 3703 | nmdc:mga0yw44_303901_c1 | |||
| 3704 | nmdc:mga0yw44_386906_c1 | |||
| 3705 | nmdc:mga0yw44_6095_c1 | |||
| 3706 | nmdc:mga0yw44_78671_c1 | |||
| 3707 | nmdc:mga0yw44_80069_c1 | |||
| 3708 | nmdc:mga0k408_1244_c1 | |||
| 3709 | nmdc:mga0k408_13616_c1 | |||
| 3710 | nmdc:mga06z11_122402_c1 | |||
| 3711 | nmdc:mga06z11_1333_c1 | |||
| 3712 | nmdc:mga06z11_2154_c1 | |||
| 3713 | nmdc:mga06z11_312244_c1 | |||
| 3714 | nmdc:mga06z11_4896_c1 | |||
| 3715 | nmdc:mga06z11_8900_c1 | |||
| 3716 | nmdc:mga04h51_12706_c1 | |||
| 3717 | nmdc:mga04h51_9040_c1 | |||
| 3718 | nmdc:mga04h51_9274_c1 | |||
| 3719 | nmdc:mga07m45_47150_c2 | |||
| 3720 | nmdc:mga05p37_166313_c1 | |||
| 3721 | nmdc:mga05p37_363778_c1 | |||
| 3722 | nmdc:mga05p37_505050_c1 | |||
| 3723 | nmdc:mga05p37_615_c1 | |||
| 3724 | nmdc:mga09592_2442_c1 | |||
| 3725 | nmdc:mga09592_41347_c1 | |||
| 3726 | nmdc:mga09592_494138_c1 | |||
| 3727 | nmdc:mga0qj67_204464_c1 | |||
| 3728 | nmdc:mga0qj67_414859_c1 | |||
| 3729 | nmdc:mga0qj67_54957_c1 | |||
| 3730 | nmdc:mga0qj67_646139_c1 | |||
| 3731 | nmdc:mga0qj67_65917_c2 | |||
| 3732 | nmdc:mga0qj67_85110_c1 | |||
| 3733 | nmdc:mga06r32_111265_c1 | |||
| 3734 | nmdc:mga06r32_25081_c1 | |||
| 3735 | nmdc:mga06r32_2964_c1 | |||
| 3736 | nmdc:mga06r32_489150_c1 | |||
| 3737 | nmdc:mga06r32_54034_c1 | |||
| 3738 | nmdc:mga06r32_67561_c1 | |||
| 3739 | nmdc:mga06r32_95_c1 | |||
| 3740 | nmdc:mga08y16_145341_c1 | |||
| 3741 | nmdc:mga08y16_20535_c1 | |||
| 3742 | nmdc:mga08y16_464415_c1 | |||
| 3743 | nmdc:mga08y16_507_c1 | |||
| 3744 | nmdc:mga08y16_573813_c1 | |||
| 3745 | nmdc:mga08y16_680302_c1 | |||
| 3746 | nmdc:mga0n895_178050_c1 | |||
| 3747 | nmdc:mga0n895_44054_c1 | |||
| 3748 | nmdc:mga0n895_80375_c1 | |||
| 3749 | nmdc:mga0n895_8526_c1 | |||
| 3750 | nmdc:mga0rr50_55543_c1 | |||
| 3751 | nmdc:mga0rr50_563129_c1 | |||
| 3752 | nmdc:mga0rr50_610187_c1 | |||
| 3753 | nmdc:mga0rr50_8626_c1 | |||
| 3754 | nmdc:mga08x19_10184_c1 | |||
| 3755 | nmdc:mga08x19_4_c2 | |||
| 3756 | nmdc:mga08x19_79452_c1 | |||
| 3757 | nmdc:mga08x19_9189_c1 | |||
| 3758 | nmdc:mga0a205_371719_c1 | |||
| 3759 | nmdc:mga0a205_77637_c1 | |||
| 3760 | nmdc:mga0sz30_26781_c1 | |||
| 3761 | Ga0495601_0000004 | |||
| 3762 | Ga0495601_0014727 | |||
| 3763 | Ga0495601_0015682 | |||
| 3764 | Ga0495601_0071357 | |||
| 3765 | Ga0495601_0160204 | |||
| 3766 | Ga0495601_0204695 | |||
| 3767 | Ga0495612_0000013 | |||
| 3768 | Ga0495655_0000576 | |||
| 3769 | Ga0495655_0001905 | |||
| 3770 | Ga0495595_0000057 | |||
| 3771 | Ga0495595_0051362 | |||
| 3772 | Ga0495619_0000005 | |||
| 3773 | Ga0495619_0000852 | |||
| 3774 | Ga0495619_0004963 | |||
| 3775 | Ga0495619_0016894 | |||
| 3776 | Ga0495619_0036371 | |||
| 3777 | Ga0495619_0106040 | |||
| 3778 | Ga0495619_0318658 | |||
| 3779 | Ga0500566_0012676 | |||
| 3780 | Ga0500566_0100630 | |||
| 3781 | Ga0500556_0040318 | |||
| 3782 | Ga0500593_002987 | |||
| 3783 | Ga0500595_026436 | |||
| 3784 | Ga0500595_029415 | |||
| 3785 | Ga0500595_038229 | |||
| 3786 | Ga0500595_059747 | |||
| 3787 | Ga0500618_000106 | |||
| 3788 | Ga0500652_000003 | |||
| 3789 | Ga0500658_0182122 | |||
| 3790 | Ga0500559_0012340 | |||
| 3791 | Ga0500559_0101671 | |||
| 3792 | Ga0500568_0000118 | |||
| 3793 | Ga0500577_0052068 | |||
| 3794 | Ga0500604_0046995 | |||
| 3795 | Ga0500616_0021703 | |||
| 3796 | Ga0500616_0066140 | |||
| 3797 | Ga0500616_0068405 | |||
| 3798 | Ga0500616_0121611 | |||
| 3799 | Ga0500620_089104 | |||
| 3800 | Ga0500622_0020243 | |||
| 3801 | Ga0500638_106305 | |||
| 3802 | Ga0500639_065573 | |||
| 3803 | Ga0500636_0017572 | |||
| 3804 | Ga0500636_0040856 | |||
| 3805 | Ga0500636_0176452 | |||
| 3806 | Ga0500637_0100355 | |||
| 3807 | Ga0500637_0116846 | |||
| 3808 | Ga0501084_0011545 | |||
| 3809 | Ga0501084_0035585 | |||
| 3810 | Ga0501084_0046352 | |||
| 3811 | Ga0501084_0048945 | |||
| 3812 | Ga0501084_0058411 | |||
| 3813 | Ga0501084_0135262 | |||
| 3814 | Ga0501084_0144960 | |||
| 3815 | Ga0501084_0199231 | |||
| 3816 | Ga0590071_045141 | |||
| 3817 | Ga0501082_0007486 | |||
| 3818 | Ga0501082_0009497 | |||
| 3819 | Ga0501082_0029330 | |||
| 3820 | Ga0501082_0038675 | |||
| 3821 | Ga0501082_0046340 | |||
| 3822 | Ga0501082_0084979 | |||
| 3823 | Ga0501082_0085974 | |||
| 3824 | Ga0501082_0099623 | |||
| 3825 | Ga0501082_0129782 | |||
| 3826 | Ga0501082_0230082 | |||
| 3827 | Ga0501082_0307887 | |||
| 3828 | Ga0501082_0360340 | |||
| 3829 | Ga0501082_0416936 | |||
| 3830 | Ga0501082_0617704 | |||
| 3831 | Ga0530510_0009644 | |||
| 3832 | Ga0530510_0049645 | |||
| 3833 | Ga0530510_0072704 | |||
| 3834 | Ga0530510_0088628 | |||
| 3835 | Ga0530510_0090621 | |||
| 3836 | Ga0530510_0090629 | |||
| 3837 | Ga0530510_0255782 | |||
| 3838 | Ga0530510_0266714 | |||
| 3839 | Ga0530510_0279450 | |||
| 3840 | 2503202882 | |||
| 3841 | 2508726744 | |||
| 3842 | 2509115392 | |||
| 3843 | 2509143731 | |||
| 3844 | 2509372288 | |||
| 3845 | 2509397373 | |||
| 3846 | 2510317812 | |||
| 3847 | 2512930344 | |||
| 3848 | 2512958061 | |||
| 3849 | 2512971345 | |||
| 3850 | 2513590728 | |||
| 3851 | 2513604055 | |||
| 3852 | 2513610042 | |||
| 3853 | 2513987397 | |||
| 3854 | 2514006281 | |||
| 3855 | 2514032800 | |||
| 3856 | 2514422589 | |||
| 3857 | 2514588760 | |||
| 3858 | 2517569772 | |||
| 3859 | 2563064599 | |||
| 3860 | 2588515957 | |||
| 3861 | 2597814513 | |||
| 3862 | 2599938199 | |||
| 3863 | 2600193305 | |||
| 3864 | 2643770546 | |||
| 3865 | 2643774975 | |||
| 3866 | 2643793419 | |||
| 3867 | 2643840650 | |||
| 3868 | 2643989643 | |||
| 3869 | 2644107916 | |||
| 3870 | 2644130094 | |||
| 3871 | 2644148411 | |||
| 3872 | 2644157733 | |||
| 3873 | 2644309310 | |||
| 3874 | 2644333137 | |||
| 3875 | 2644545691 | |||
| 3876 | 2644615252 | |||
| 3877 | 2644673557 | |||
| 3878 | 2644735692 | |||
| 3879 | 2657683880 | |||
| 3880 | 2688599742 | |||
| 3881 | 2694630586 | |||
| 3882 | 2694639356 | |||
| 3883 | 2713472907 | |||
| 3884 | 2723576506 | |||
| 3885 | 2739308867 | |||
| 3886 | 2753359238 | |||
| 3887 | 2756676066 | |||
| 3888 | 2792582035 | |||
| 3889 | 2792619934 | |||
| 3890 | 2792639586 | |||
| 3891 | 2792748730 | |||
| 3892 | 2802719047 | |||
| 3893 | 2802727278 | |||
| 3894 | 2802732060 | |||
| 3895 | 2802738990 | |||
| 3896 | 2802744889 | |||
| 3897 | 2802752165 | |||
| 3898 | 2804752142 | |||
| 3899 | 2808940714 | |||
| 3900 | 2819718411 | |||
| 3901 | 2828308083 | |||
| 3902 | 2837680097 | |||
| 3903 | 2838078805 | |||
| 3904 | 2841740687 | |||
| 3905 | 2841761744 | |||
| 3906 | 2841912081 | |||
| 3907 | 2841922975 | |||
| 3908 | 2842339519 | |||
| 3909 | 2844007035 | |||
| 3910 | 2844015030 | |||
| 3911 | 2844104769 | |||
| 3912 | 2844167352 | |||
| 3913 | 2847676187 | |||
| 3914 | 2847692841 | |||
| 3915 | 2851184761 | |||
| 3916 | 2851247757 | |||
| 3917 | 2856315973 | |||
| 3918 | 2856324787 | |||
| 3919 | 2856333019 | |||
| 3920 | 2856339069 | |||
| 3921 | 2856346470 | |||
| 3922 | 2856356253 | |||
| 3923 | 2856368706 | |||
| 3924 | 2857350412 | |||
| 3925 | 2857374224 | |||
| 3926 | 2869167232 | |||
| 3927 | 2869176972 | |||
| 3928 | 2869237406 | |||
| 3929 | 2869247851 | |||
| 3930 | 2869251425 | |||
| 3931 | 2869266939 | |||
| 3932 | 2869272373 | |||
| 3933 | 2869281222 | |||
| 3934 | 2869291201 | |||
| 3935 | 2871433481 | |||
| 3936 | 2871440038 | |||
| 3937 | 2871444491 | |||
| 3938 | 2871455620 | |||
| 3939 | 2871463217 | |||
| 3940 | 2871472914 | |||
| 3941 | 2871476090 | |||
| 3942 | 2871487434 | |||
| 3943 | 2871495899 | |||
| 3944 | 2871503113 | |||
| 3945 | 2874105963 | |||
| 3946 | 2874114700 | |||
| 3947 | 2874119345 | |||
| 3948 | 2874126104 | |||
| 3949 | 2874134267 | |||
| 3950 | 2874141174 | |||
| 3951 | 2874153082 | |||
| 3952 | 2874160347 | |||
| 3953 | 2874165252 | |||
| 3954 | 2874170847 | |||
| 3955 | 2876368314 | |||
| 3956 | 2876371532 | |||
| 3957 | 2876384050 | |||
| 3958 | 2876392738 | |||
| 3959 | 2876394853 | |||
| 3960 | 2876400905 | |||
| 3961 | 2876408639 | |||
| 3962 | 2876419373 | |||
| 3963 | 2876425701 | |||
| 3964 | 2878040241 | |||
| 3965 | 2878742895 | |||
| 3966 | 2878751092 | |||
| 3967 | 2878753303 | |||
| 3968 | 2878767002 | |||
| 3969 | 2878774200 | |||
| 3970 | 2878776205 | |||
| 3971 | 2881152210 | |||
| 3972 | 2881156481 | |||
| 3973 | 2881168183 | |||
| 3974 | 2881847298 | |||
| 3975 | 2881857020 | |||
| 3976 | 2881864340 | |||
| 3977 | 2882633306 | |||
| 3978 | 2882915083 | |||
| 3979 | 2885310062 | |||
| 3980 | 2885316797 | |||
| 3981 | 2885326074 | |||
| 3982 | 2885329551 | |||
| 3983 | 2885349031 | |||
| 3984 | 2885352465 | |||
| 3985 | 2888340921 | |||
| 3986 | 2888348123 | |||
| 3987 | 2888356423 | |||
| 3988 | 2888393198 | |||
| 3989 | 2889011335 | |||
| 3990 | 2889016935 | |||
| 3991 | 2889793687 | |||
| 3992 | 2889919510 | |||
| 3993 | 2894818350 | |||
| 3994 | 2896390676 | |||
| 3995 | 2903452332 | |||
| 3996 | 2903495157 | |||
| 3997 | 2903503148 | |||
| 3998 | 2903513881 | |||
| 3999 | 2903527310 | |||
| 4000 | 2903531456 | |||
| 4001 | 2903548302 | |||
| 4002 | 2904661484 | |||
| 4003 | 2906313033 | |||
| 4004 | 2906325744 | |||
| 4005 | 2906328914 | |||
| 4006 | 2906356024 | |||
| 4007 | 2906368308 | |||
| 4008 | 2906374917 | |||
| 4009 | 2906382228 | |||
| 4010 | 2906391582 | |||
| 4011 | 2906397343 | |||
| 4012 | 2906406608 | |||
| 4013 | 2906410874 | |||
| 4014 | 2906416110 | |||
| 4015 | 2906432426 | |||
| 4016 | 2915651759 | |||
| 4017 | 2915981529 | |||
| 4018 | 2916066076 | |||
| 4019 | 2920766277 | |||
| 4020 | 2921255057 | |||
| 4021 | 2921261288 | |||
| 4022 | 2922136811 | |||
| 4023 | 2922157915 | |||
| 4024 | 2922165543 | |||
| 4025 | 2922177286 | |||
| 4026 | 2922183154 | |||
| 4027 | 2922191461 | |||
| 4028 | 2924715357 | |||
| 4029 | 2924724603 | |||
| 4030 | 2924732342 | |||
| 4031 | 2924734983 | |||
| 4032 | 2924741910 | |||
| 4033 | 2924754266 | |||
| 4034 | 2924757759 | |||
| 4035 | 2924765175 | |||
| 4036 | 2924780695 | |||
| 4037 | 2924789787 | |||
| 4038 | 2937025907 | |||
| 4039 | 2937032632 | |||
| 4040 | 2937038729 | |||
| 4041 | 2937079200 | |||
| 4042 | 2937086042 | |||
| 4043 | 2937820815 | |||
| 4044 | 2937827433 | |||
| 4045 | 2937836861 | |||
| 4046 | 2937854332 | |||
| 4047 | 2937864475 | |||
| 4048 | 2937873077 | |||
| 4049 | 2937879801 | |||
| 4050 | 2937893950 | |||
| 4051 | 2937974689 | |||
| 4052 | 2937988202 | |||
| 4053 | 2938002126 | |||
| 4054 | 2938021477 | |||
| 4055 | 2939670292 | |||
| 4056 | 2941503762 | |||
| 4057 | 2957381594 | |||
| 4058 | 2957400380 | |||
| 4059 | 2957442484 | |||
| 4060 | 2958037184 | |||
| 4061 | 2958046896 | |||
| 4062 | 2958067411 | |||
| 4063 | 2958076956 | |||
| 4064 | 2958086979 | |||
| 4065 | 2958098107 | |||
| 4066 | 2958106155 | |||
| 4067 | 2958111845 | |||
| 4068 | 2958122148 | |||
| 4069 | 2958126554 | |||
| 4070 | 2958135602 | |||
| 4071 | 2958146942 | |||
| 4072 | 2958160345 | |||
| 4073 | 2958172180 | |||
| 4074 | 2958185093 | |||
| 4075 | 2960597198 | |||
| 4076 | 2960631778 | |||
| 4077 | 2960687150 | |||
| 4078 | 2960699123 | |||
| 4079 | 2961083360 | |||
| 4080 | 2961116636 | |||
| 4081 | 2961131898 | |||
| 4082 | 2961138864 | |||
| 4083 | 2961170628 | |||
| 4084 | 2961177747 | |||
| 4085 | 2961184517 | |||
| 4086 | 2963648887 | |||
| 4087 | 2964620548 | |||
| 4088 | 2965025375 | |||
| 4089 | 2965027985 | |||
| 4090 | 2965032117 | |||
| 4091 | 2965050090 | |||
| 4092 | 2965065505 | |||
| 4093 | 2965090402 | |||
| 4094 | 2965103523 | |||
| 4095 | 2965112136 | |||
| 4096 | 2965121510 | |||
| 4097 | 2967687486 | |||
| 4098 | 2967729238 | |||
| 4099 | 2967757145 | |||
| 4100 | 2968003014 | |||
| 4101 | 2968003839 | |||
| 4102 | 2968019998 | |||
| 4103 | 2968084112 | |||
| 4104 | 2968095957 | |||
| 4105 | 2968099726 | |||
| 4106 | 2968112543 | |||
| 4107 | 2968121318 | |||
| 4108 | 2968130848 | |||
| 4109 | 2968179014 | |||
| 4110 | 2970029838 | |||
| 4111 | 2970105126 | |||
| 4112 | 2970125775 | |||
| 4113 | 2970146894 | |||
| 4114 | 2970473319 | |||
| 4115 | 2970495441 | |||
| 4116 | 2970510423 | |||
| 4117 | 2970514124 | |||
| 4118 | 2970532026 | |||
| 4119 | 2970532649 | |||
| 4120 | 2970545243 | |||
| 4121 | 2970552114 | |||
| 4122 | 2970561858 | |||
| 4123 | 2970595826 | |||
| 4124 | 2970620363 | |||
| 4125 | 2970632140 | |||
| 4126 | 2977532869 | |||
| 4127 | 2977548462 | |||
| 4128 | 2977822757 | |||
| 4129 | 2977833224 | |||
| 4130 | 2977849113 | |||
| 4131 | 2977851368 | |||
| 4132 | 2977864460 | |||
| 4133 | 2977872395 | |||
| 4134 | 2977874470 | |||
| 4135 | 2977905740 | |||
| 4136 | 2977909720 | |||
| 4137 | 2977917204 | |||
| 4138 | 2977926742 | |||
| 4139 | 2977936273 | |||
| 4140 | 2977948122 | |||
| 4141 | 2977952319 | |||
| 4142 | 2977961330 | |||
| 4143 | 2977979635 | |||
| 4144 | 2977992439 | |||
| 4145 | 2979712218 | |||
| 4146 | 2979750902 | |||
| 4147 | 2979770727 | |||
| 4148 | 2979777368 | |||
| 4149 | 2979781438 | |||
| 4150 | 2979794399 | |||
| 4151 | 2979815297 | |||
| 4152 | 2987637598 | |||
| 4153 | 2987650676 | |||
| 4154 | 2987653284 | |||
| 4155 | 2987666867 | |||
| 4156 | 2987667782 | |||
| 4157 | 2987675637 | |||
| 4158 | 2996310750 | |||
| 4159 | 2996340694 | |||
| 4160 | 2996348448 | |||
| 4161 | 2996351490 | |||
| 4162 | 2996389382 | |||
| 4163 | 3000138864 | |||
| 4164 | 3003933601 | |||
| 4165 | 3004170452 | |||
| 4166 | 3004195871 | |||
| 4167 | 3004201846 | |||
| 4168 | 3004206080 | |||
| 4169 | 3004215043 | |||
| 4170 | 3004222366 | |||
| 4171 | 3004236832 | |||
| 4172 | 3004241026 | |||
| 4173 | 3004250036 | |||
| 4174 | 3004274406 | |||
| 4175 | 3004278190 | |||
| 4176 | 3004295090 | |||
| 4177 | 3004339926 | |||
| 4178 | 637073339 | |||
| 4179 | 641337011 | |||
| 4180 | 643392821 | |||
| 4181 | 649874247 | |||
| 4182 | 8002285423 | |||
| 4183 | 8004001136 | |||
| 4184 | 8004302584 | |||
| 4185 | 8004315347 | |||
| 4186 | 8004364183 | |||
| 4187 | 8004374875 | |||
| 4188 | 8004394243 | |||
| 4189 | 8004399852 | |||
| 4190 | 8004446075 | |||
| 4191 | 8004638216 | |||
| 4192 | 8004642037 | |||
| 4193 | 8004695664 | |||
| 4194 | 8004713582 | |||
| 4195 | 8004719291 | |||
| 4196 | 8004729666 | |||
| 4197 | 8049294690 | |||
| 4198 | 8054558967 | |||
| 4199 | 8055622238 | |||
| 4200 | 8057530133 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2zu0-assembly1.cif.gz_C | crystal structure of sufc-sufd complex involved in the iron-sulfur cluster biosynthesis | 0.9465 | 3 | 242 |
| 5awf-assembly1.cif.gz_D | crystal structure of sufb-sufc-sufd complex from escherichia coli | 0.9448 | 3 | 230 |
| 2zu0-assembly1.cif.gz_C | crystal structure of sufc-sufd complex involved in the iron-sulfur cluster biosynthesis | 0.9168 | 3 | 242 |
| 5awf-assembly1.cif.gz_D | crystal structure of sufb-sufc-sufd complex from escherichia coli | 0.9136 | 3 | 230 |
| 2d2f-assembly1.cif.gz_A | crystal structure of atypical cytoplasmic abc-atpase sufc from thermus thermophilus hb8 | 0.8848 | 1 | 246 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2FZY7_2_252_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.963 | 2 | 251 | 3.40.50.300 |
| af_Q8ILW0_99_346_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9236 | 3 | 240 | 3.40.50.300 |
| af_Q60350_5_243_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8931 | 1 | 245 | 3.40.50.300 |
| af_Q60350_5_243_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8862 | 1 | 245 | 3.40.50.300 |
| af_P16676_2_258_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8854 | 3 | 231 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A838M3S9-F1-model_v4 | deleted | 0.8835 | 2 | 231 |
|
| AF-A0A7K4CYQ9-F1-model_v4 | Molybdate/tungstate import ATP-binding protein WtpC (EC 7.3.2.6) | 0.88 | 2 | 231 |
GO:0005524
GO:0005886 GO:0015408 GO:0016887 |
| AF-A0A2E7MAH5-F1-model_v4 | ABC transporter ATP-binding protein | 0.8717 | 3 | 231 |
GO:0005524
GO:0005886 GO:0015408 GO:0016887 |
| AF-F0F0M3-F1-model_v4 | ABC transporter, ATP-binding protein (EC 3.6.3.-) | 0.8695 | 2 | 231 |
GO:0005524
GO:0005886 GO:0015408 GO:0016887 |
| AF-A0A7X6Z633-F1-model_v4 | Sulfate ABC transporter ATP-binding protein | 0.8658 | 1 | 231 |
GO:0005524
GO:0015419 GO:0016887 GO:0043190 |