F496306

General Info

Members Datasets Scaffolds Average Seq Length
2043 644 1967 197

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2928115317|2928120035
Length 212
Sequence PAAPKGPRTAGDAEGTPLRTTHDINDRIVRLVPEGARVLDLGCGDGALLERLQRERGCTGYGVEIADGNVLQCVRRGVDVIQLNLDEGLSMFEDASFDVVLQIDTLQHLRNAEIMLRETARVGRIGIVAFPNFAHWPNRLSILQGRMPVTRRLPYQWYDTPNIRVGTFRDFDALARKNRLRVLDAFGVQHGREVRWLPNLRAATAVFKFERD

Samples

Sample ID Description Type Environment
1 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
2 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
3 2547132374 Acidovorax radicis N35 Isolate Unclassified
4 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
5 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
6 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
7 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
8 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
9 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
10 2643221556 Massilia sp. Root1485 Isolate Unclassified
11 2643221570 Acidovorax sp. Root568 Isolate Unclassified
12 2643221585 Pelomonas sp. Root662 Isolate Unclassified
13 2643221596 Acidovorax sp. Root70 Isolate Unclassified
14 2643221609 Acidovorax sp. Root217 Isolate Unclassified
15 2643221611 Acidovorax sp. Root219 Isolate Unclassified
16 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
17 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
18 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
19 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
20 2643221652 Acidovorax sp. Root402 Isolate Unclassified
21 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
22 2643221656 Pelomonas sp. Root405 Isolate Unclassified
23 2643221658 Variovorax sp. Root411 Isolate Unclassified
24 2643221672 Variovorax sp. Root434 Isolate Unclassified
25 2643221683 Variovorax sp. Root473 Isolate Unclassified
26 2643221684 Massilia sp. Root133 Isolate Unclassified
27 2643221717 Acidovorax sp. Root267 Isolate Unclassified
28 2721755523 Delftia sp. HK171 Isolate Unclassified
29 2738541277 Variovorax sp. GV051 Isolate Unclassified
30 2738541307 Variovorax sp. GV008 Isolate Unclassified
31 2738541337 Pelomonas sp. BT06 Isolate Unclassified
32 2738543012 Acidovorax sp. CF301 Isolate Unclassified
33 2738543013 Variovorax sp. BT01 Isolate Unclassified
34 2738543019 Variovorax sp. GV040 Isolate Unclassified
35 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
36 2816332133 Acidovorax radicis 2721A Isolate Unclassified
37 2818991446 Variovorax sp. 1180 Isolate Unclassified
38 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
39 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
40 2839138175 Delftia acidovorans B15 Isolate Rhizosphere
41 2842677519 Variovorax sp. R-72495 Isolate Unclassified
42 2842718218 Acidovorax sp. R-73343 Isolate Unclassified
43 2842733646 Variovorax sp. R-72446 Isolate Unclassified
44 2842747753 Variovorax sp. R-72060 Isolate Unclassified
45 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
46 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
47 2885198086 Variovorax sp. 679 Isolate Unclassified
48 2885211737 Variovorax sp. 553 Isolate Unclassified
49 2886848708 Mitsuaria sp. TWR114 Isolate Rhizosphere
50 2894023352 Diaphorobacter ruginosibacter DSM 27467 Isolate Nodule
51 2899924645 Variovorax sp. 369 Isolate Unclassified
52 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
53 2904456579 Variovorax sp. 2002 Isolate Unclassified
54 2904479285 Comamonas sediminis 4487 Isolate Rhizosphere
55 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
56 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
57 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
58 2928037797 Variovorax sp. 1126 Isolate Unclassified
59 2928044640 Variovorax sp. 1128 Isolate Unclassified
60 2928051484 Variovorax sp. 1133 Isolate Unclassified
61 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
62 2928070936 Variovorax gossypii 1167 Isolate Unclassified
63 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
64 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
65 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
66 2929520902 Variovorax beijingensis 502 Isolate Unclassified
67 2932422444 Comamonas sp. 4034 Isolate Rhizosphere
68 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere
69 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
70 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
71 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
72 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
73 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
74 2974320154 Acidovorax wautersii SORGH_AS 335 Isolate Unclassified
75 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere
76 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
77 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
78 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
79 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
80 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
81 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
82 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
83 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
84 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
85 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
86 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
87 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
88 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
89 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
90 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
91 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
92 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
93 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
94 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
95 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
96 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
97 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
98 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
99 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
100 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
101 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
102 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
103 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
104 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
105 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
106 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
107 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
108 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
109 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
110 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
111 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
112 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
113 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
114 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
115 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
116 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
117 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
118 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
119 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
120 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
121 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
122 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
123 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
124 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
125 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
126 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
127 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
128 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
129 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
130 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
131 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
132 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
133 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
134 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
135 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
136 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
137 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
138 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
139 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
140 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
141 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
142 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
143 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
144 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
145 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
146 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
147 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
148 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
149 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
150 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
151 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
152 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
153 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
154 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
155 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
156 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
157 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
158 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
159 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
160 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
161 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
162 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
163 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
164 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
165 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
166 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
167 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
168 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
169 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
170 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
171 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
172 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
173 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
174 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
175 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
176 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
177 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
178 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
179 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
180 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
181 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
182 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
183 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
184 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
185 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
186 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
187 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
188 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
189 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
190 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
191 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
192 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
193 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
194 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
195 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
196 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
197 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
198 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
199 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
200 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
201 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
202 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
203 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
204 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
205 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
206 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
207 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
208 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
209 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
210 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
211 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
212 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
213 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
214 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
215 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
216 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
217 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
218 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
219 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
220 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
221 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
222 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
223 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
224 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
225 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
226 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
227 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
228 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
229 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
230 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
231 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
232 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
233 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
234 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
235 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
236 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
237 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
238 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
239 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
240 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
241 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
242 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
243 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
244 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
245 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
246 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
247 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
248 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
249 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
250 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
251 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
252 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
253 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
254 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
255 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
256 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
257 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
258 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
259 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
260 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
261 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
262 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
263 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
264 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
265 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
266 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
267 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
268 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
269 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
270 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
271 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
272 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
273 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
274 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
275 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
276 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
277 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
278 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
279 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
280 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
281 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
282 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
283 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
284 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
285 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
286 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
287 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
288 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
289 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
290 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
291 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
292 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
293 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
294 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
295 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
296 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
297 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
298 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
299 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
300 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
301 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
302 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
303 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
304 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
305 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
306 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
307 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
308 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
309 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
310 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
311 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
312 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
313 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
314 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
315 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
316 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
317 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
318 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
319 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
320 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
321 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
322 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
323 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
324 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
325 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
326 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
327 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
328 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
329 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
330 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
331 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
332 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
333 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
334 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
335 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
336 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
337 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
338 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
339 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
340 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
341 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
342 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
343 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
344 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
345 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
346 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
347 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
348 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
349 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
350 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
351 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
352 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
353 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
354 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
355 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
356 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
357 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
358 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
359 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
360 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
361 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
362 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
363 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
364 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
365 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
366 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
367 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
368 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
369 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
370 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
371 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
372 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
373 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
374 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
375 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
376 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
377 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
378 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
379 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
380 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
381 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
382 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
383 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
384 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
385 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
386 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
387 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
388 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
389 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
390 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
391 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
392 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
393 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
394 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
395 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
396 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
397 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
398 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
399 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
400 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
401 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
402 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
403 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
404 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
405 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
406 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
407 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
408 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
409 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
410 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
411 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
412 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
413 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
414 3300042123 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 Metagenome Rhizosphere
415 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
416 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
417 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
418 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
419 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
420 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
421 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
422 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
423 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
424 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
425 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
426 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
427 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
428 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
429 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
430 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
431 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
432 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
433 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
434 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
435 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
436 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
437 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
438 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
439 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
440 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
441 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
442 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
443 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
444 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
445 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
446 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
447 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
448 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
449 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
450 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
451 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
452 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
453 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
454 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
455 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
456 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
457 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
458 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
459 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
460 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
461 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
462 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
463 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
464 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
465 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
466 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
467 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
468 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
469 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
470 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
471 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
472 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
473 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
474 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
475 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
476 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
477 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
478 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
479 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
480 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
481 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
482 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
483 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
484 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
485 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
486 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
487 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
488 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
489 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
490 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
491 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
492 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
493 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
494 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
495 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
496 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
497 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
498 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
499 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
500 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
501 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
502 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
503 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
504 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
505 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
506 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
507 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
508 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
509 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
510 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
511 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
512 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
513 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
514 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
515 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
516 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
517 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
518 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
519 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
520 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
521 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
522 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
523 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
524 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
525 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
526 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
527 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
528 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
529 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
530 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
531 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
532 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
533 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
534 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
535 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
536 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
537 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
538 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
539 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
540 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
541 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
542 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
543 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
544 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
545 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
546 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
547 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
548 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
549 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
550 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
551 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
552 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
553 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
554 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
555 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
556 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
557 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
558 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
559 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
560 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
561 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
562 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
563 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
564 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
565 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
566 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
567 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
568 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
569 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
570 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
571 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
572 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
573 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
574 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
575 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
576 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
577 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
578 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
579 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
580 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
581 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
582 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
583 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
584 3300049684 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control Metagenome Rhizosphere
585 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
586 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
587 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
588 3300049757 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control Metagenome Rhizosphere
589 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
590 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
591 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
592 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
593 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
594 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
595 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
596 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
597 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
598 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
599 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
600 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
601 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
602 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
603 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
604 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
605 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
606 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
607 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
608 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
609 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
610 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
611 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
612 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
613 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
614 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
615 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
616 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
617 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
618 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
619 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
620 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
621 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
622 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
623 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
624 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
625 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
626 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
627 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
628 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
629 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
630 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
631 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
632 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
633 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
634 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
635 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
636 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
637 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
638 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
639 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
640 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
641 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
642 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
643 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
644 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.08
Metatranscriptomes 0.2
Isolates 3.72

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.98
Nodule 0.44
Rhizoplane 3.77
Rhizosphere 73.08
Stem 0
Stem Tuber 0
Unclassified 7.73

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10011092 3300001979 Bacteria 3441
2 JGI24740J21852_10036651 3300001979 Bacteria 1521
3 JGI24739J22299_10014654 3300001989 Bacteria 2850
4 JGI24742J22300_10031731 3300002244 Bacteria 925
5 JGI25156J39149_1000067 3300002705 Bacteria 82796
6 JGI25154J39366_1000089 3300002738 Bacteria 82796
7 JGI25157J39369_1000084 3300002741 Bacteria 82796
8 JGI25152J39213_1003882 3300002773 Bacteria 4914
9 JGI25152J39213_1005397 3300002773 Bacteria 3741
10 JGI25150J39212_1004058 3300002774 Bacteria 3315
11 JGI25151J46595_10002529 3300003187 Bacteria 10865
12 JGI25151J46595_10022822 3300003187 Bacteria 2590
13 JGI25151J46595_10025763 3300003187 Bacteria 2386
14 JGI25151J46595_10037340 3300003187 Bacteria 1823
15 JGI25153J46596_10001945 3300003215 Bacteria 12244
16 rootH1_10003069 3300003316 Bacteria 19949
17 rootH1_10021326 3300003316 Bacteria 3706
18 rootH1_10030074 3300003316 Bacteria 11370
19 rootL2_10003559 3300003322 Bacteria 24543
20 rootL2_10012528 3300003322 Bacteria 11700
21 rootL2_10024133 3300003322 Bacteria 13094
22 rootL2_10029984 3300003322 Bacteria 2070
23 rootH1_10022699 3300003323 Bacteria 2502
24 JGI25160J50197_1000076 3300003354 Bacteria 102318
25 JGI25160J50197_1035667 3300003354 Bacteria 1217
26 JGI25161J50226_1000058 3300003374 Bacteria 102318
27 Ga0006562J51391_1207517 3300003578 Bacteria 1726
28 Ga0006562J51391_1207518 3300003578 Bacteria 1676
29 Ga0006562J51391_1209414 3300003578 Bacteria 2340
30 Ga0006562J51391_1209415 3300003578 Bacteria 2260
31 Ga0055525_1000056 3300003759 Bacteria 212321
32 Ga0055535_1000759 3300003761 Bacteria 23986
33 Ga0055542_1000003 3300003762 Bacteria 582721
34 Ga0055526_1002268 3300003771 Bacteria 13142
35 Ga0055526_1002792 3300003771 Bacteria 11561
36 Ga0055526_1015571 3300003771 Bacteria 3046
37 Ga0055537_1000207 3300003773 Bacteria 44154
38 Ga0055537_1001177 3300003773 Bacteria 11189
39 Ga0055537_1006136 3300003773 Bacteria 3098
40 Ga0055537_1007083 3300003773 Bacteria 2754
41 Ga0055524_1000303 3300003775 Bacteria 47193
42 Ga0055524_1003264 3300003775 Bacteria 7939
43 Ga0055536_1063120 3300003781 Bacteria 759
44 Ga0055536_1063162 3300003781 Bacteria 759
45 Ga0055534_1000405 3300003784 Bacteria 26468
46 Ga0055534_1001307 3300003784 Bacteria 10072
47 Ga0055534_1007425 3300003784 Bacteria 2612
48 Ga0055528_1001078 3300003790 Bacteria 17974
49 Ga0055528_1013438 3300003790 Bacteria 3098
50 Ga0055530_10000449 3300003791 Bacteria 36583
51 Ga0055530_10005996 3300003791 Bacteria 5580
52 Ga0055530_10006738 3300003791 Bacteria 5025
53 Ga0055530_10038339 3300003791 Bacteria 1192
54 Ga0055530_10039544 3300003791 Bacteria 1164
55 Ga0055540_1000088 3300003792 Bacteria 102236
56 Ga0055540_1000184 3300003792 Bacteria 60646
57 Ga0055540_1005901 3300003792 Bacteria 5007
58 Ga0055540_1055227 3300003792 Bacteria 807
59 Ga0055531_10000247 3300003794 Bacteria 58229
60 Ga0055531_10000655 3300003794 Bacteria 29766
61 Ga0055531_10001983 3300003794 Bacteria 14249
62 Ga0055531_10002205 3300003794 Bacteria 13242
63 Ga0055531_10004665 3300003794 Bacteria 8215
64 Ga0055531_10079471 3300003794 Bacteria 727
65 Ga0055543_1000357 3300004625 Bacteria 30785
66 Ga0055543_1002997 3300004625 Bacteria 5229
67 Ga0065165_1008728 3300005262 Bacteria 4679
68 Ga0065165_1033112 3300005262 Bacteria 1611
69 Ga0065714_10067017 3300005288 Bacteria 5994
70 Ga0065714_10187895 3300005288 Bacteria 933
71 Ga0065704_10117484 3300005289 Bacteria 1833
72 Ga0065704_10132887 3300005289 Bacteria 1607
73 Ga0065704_10250685 3300005289 Bacteria 990
74 Ga0070658_10017404 3300005327 Bacteria 5752
75 Ga0070658_10084666 3300005327 Bacteria 2607
76 Ga0070658_10737148 3300005327 Bacteria 856
77 Ga0070676_10004649 3300005328 Bacteria 7250
78 Ga0070676_10009990 3300005328 Bacteria 5137
79 Ga0070676_10020755 3300005328 Bacteria 3672
80 Ga0070676_10067147 3300005328 Bacteria 2144
81 Ga0070676_10204940 3300005328 Bacteria 1295
82 Ga0070683_100091372 3300005329 Bacteria 2858
83 Ga0070683_100793175 3300005329 Bacteria 908
84 Ga0070690_100041899 3300005330 Bacteria 2899
85 Ga0070690_100393458 3300005330 Bacteria 1016
86 Ga0070670_100006074 3300005331 Bacteria 10215
87 Ga0070670_100055087 3300005331 Bacteria 3413
88 Ga0070670_100139611 3300005331 Bacteria 2095
89 Ga0070670_100381049 3300005331 Bacteria 1242
90 Ga0070670_100413555 3300005331 Bacteria 1192
91 Ga0070670_100497118 3300005331 Bacteria 1084
92 Ga0070677_10007390 3300005333 Bacteria 3664
93 Ga0070677_10026420 3300005333 Bacteria 2176
94 Ga0070677_10029186 3300005333 Bacteria 2090
95 Ga0070677_10062900 3300005333 Bacteria 1537
96 Ga0070677_10123146 3300005333 Bacteria 1174
97 Ga0070677_10205096 3300005333 Bacteria 954
98 Ga0068869_100017350 3300005334 Bacteria 4877
99 Ga0068869_100084533 3300005334 Bacteria 2376
100 Ga0068869_100108321 3300005334 Bacteria 2111
101 Ga0068869_100145212 3300005334 Bacteria 1835
102 Ga0068869_100173784 3300005334 Bacteria 1685
103 Ga0068869_100248234 3300005334 Bacteria 1420
104 Ga0068869_100455523 3300005334 Bacteria 1061
105 Ga0068869_100728512 3300005334 Bacteria 848
106 Ga0070666_10041404 3300005335 Bacteria 3078
107 Ga0070666_10125089 3300005335 Bacteria 1785
108 Ga0070666_10165307 3300005335 Bacteria 1548
109 Ga0070666_10449934 3300005335 Bacteria 930
110 Ga0070680_100008173 3300005336 Bacteria 7997
111 Ga0070680_100224004 3300005336 Bacteria 1588
112 Ga0070682_100057926 3300005337 Bacteria 2442
113 Ga0068868_100000616 3300005338 Bacteria 23942
114 Ga0068868_100016135 3300005338 Bacteria 5540
115 Ga0068868_100186545 3300005338 Bacteria 1723
116 Ga0068868_100228149 3300005338 Bacteria 1561
117 Ga0068868_100407985 3300005338 Bacteria 1174
118 Ga0068868_100557067 3300005338 Bacteria 1011
119 Ga0070660_100027055 3300005339 Bacteria 4277
120 Ga0070660_100037859 3300005339 Bacteria 3658
121 Ga0070689_100218227 3300005340 Bacteria 1563
122 Ga0070689_100384406 3300005340 Bacteria 1184
123 Ga0070689_100758545 3300005340 Bacteria 851
124 Ga0070687_100006034 3300005343 Bacteria 4939
125 Ga0070687_100317874 3300005343 Bacteria 994
126 Ga0070661_100001667 3300005344 Bacteria 15398
127 Ga0070661_100050850 3300005344 Bacteria 3032
128 Ga0070661_100116840 3300005344 Bacteria 1995
129 Ga0070661_100752919 3300005344 Bacteria 797
130 Ga0070668_100003853 3300005347 Bacteria 11069
131 Ga0070668_100050036 3300005347 Bacteria 3216
132 Ga0070668_100247501 3300005347 Bacteria 1479
133 Ga0070668_100753990 3300005347 Bacteria 862
134 Ga0070669_100004701 3300005353 Bacteria 9852
135 Ga0070669_100005123 3300005353 Bacteria 9478
136 Ga0070669_100013968 3300005353 Bacteria 5710
137 Ga0070669_100041628 3300005353 Bacteria 3342
138 Ga0070669_100058457 3300005353 Bacteria 2830
139 Ga0070675_100004569 3300005354 Bacteria 10565
140 Ga0070675_100017372 3300005354 Bacteria 5715
141 Ga0070675_100018260 3300005354 Bacteria 5583
142 Ga0070675_100059298 3300005354 Bacteria 3157
143 Ga0070675_100062899 3300005354 Bacteria 3067
144 Ga0070675_100669998 3300005354 Bacteria 944
145 Ga0070675_100933550 3300005354 Bacteria 796
146 Ga0070671_100023972 3300005355 Bacteria 4993
147 Ga0070671_100028965 3300005355 Bacteria 4565
148 Ga0070671_100040378 3300005355 Bacteria 3875
149 Ga0070671_100049088 3300005355 Bacteria 3511
150 Ga0070671_100073412 3300005355 Bacteria 2858
151 Ga0070671_100089187 3300005355 Bacteria 2581
152 Ga0070671_100166232 3300005355 Bacteria 1865
153 Ga0070671_100286154 3300005355 Bacteria 1402
154 Ga0070671_100466092 3300005355 Bacteria 1085
155 Ga0070671_100491890 3300005355 Bacteria 1055
156 Ga0070674_100062269 3300005356 Bacteria 2607
157 Ga0070674_100082308 3300005356 Bacteria 2302
158 Ga0070674_100173811 3300005356 Bacteria 1644
159 Ga0070674_100985348 3300005356 Bacteria 739
160 Ga0070674_101077632 3300005356 Bacteria 708
161 Ga0070673_100003566 3300005364 Bacteria 9717
162 Ga0070673_100004248 3300005364 Bacteria 9035
163 Ga0070673_100007794 3300005364 Bacteria 7088
164 Ga0070673_100024223 3300005364 Bacteria 4447
165 Ga0070673_100173549 3300005364 Bacteria 1841
166 Ga0070673_100255289 3300005364 Bacteria 1529
167 Ga0070673_100448193 3300005364 Bacteria 1161
168 Ga0070673_100568226 3300005364 Bacteria 1032
169 Ga0070673_100794416 3300005364 Bacteria 873
170 Ga0070673_101131268 3300005364 Bacteria 732
171 Ga0070688_100774281 3300005365 Bacteria 749
172 Ga0070659_100081493 3300005366 Bacteria 2584
173 Ga0070659_100094674 3300005366 Bacteria 2398
174 Ga0070659_100113619 3300005366 Bacteria 2187
175 Ga0070659_100283818 3300005366 Bacteria 1378
176 Ga0070659_100359786 3300005366 Bacteria 1222
177 Ga0070659_100521141 3300005366 Bacteria 1015
178 Ga0070659_100597763 3300005366 Bacteria 948
179 Ga0070659_100714118 3300005366 Bacteria 867
180 Ga0070667_100002201 3300005367 Bacteria 17158
181 Ga0070667_100005933 3300005367 Bacteria 10170
182 Ga0070667_100075987 3300005367 Bacteria 2868
183 Ga0070667_100076648 3300005367 Bacteria 2855
184 Ga0070667_100093539 3300005367 Bacteria 2589
185 Ga0070667_100177291 3300005367 Bacteria 1884
186 Ga0070667_100254212 3300005367 Bacteria 1571
187 Ga0070667_100352368 3300005367 Bacteria 1333
188 Ga0070667_100902176 3300005367 Bacteria 823
189 Ga0070701_10201858 3300005438 Bacteria 1176
190 Ga0070700_100260934 3300005441 Bacteria 1248
191 Ga0070663_100101009 3300005455 Bacteria 2152
192 Ga0070663_100101118 3300005455 Bacteria 2151
193 Ga0070663_100156296 3300005455 Bacteria 1752
194 Ga0070663_100282278 3300005455 Bacteria 1323
195 Ga0070678_100005645 3300005456 Bacteria 7262
196 Ga0070678_100020363 3300005456 Bacteria 4351
197 Ga0070678_100030205 3300005456 Bacteria 3722
198 Ga0070678_100032614 3300005456 Bacteria 3606
199 Ga0070678_100063711 3300005456 Bacteria 2729
200 Ga0070678_100124431 3300005456 Bacteria 2038
201 Ga0070678_100297382 3300005456 Bacteria 1371
202 Ga0070678_100342040 3300005456 Bacteria 1284
203 Ga0070678_100457810 3300005456 Bacteria 1118
204 Ga0070678_100460422 3300005456 Bacteria 1115
205 Ga0070678_100727871 3300005456 Bacteria 896
206 Ga0070662_100007391 3300005457 Bacteria 7120
207 Ga0070662_100035372 3300005457 Bacteria 3526
208 Ga0070662_100233007 3300005457 Bacteria 1474
209 Ga0070662_100293120 3300005457 Bacteria 1319
210 Ga0070662_100379951 3300005457 Bacteria 1163
211 Ga0070662_100423477 3300005457 Bacteria 1102
212 Ga0070681_10073982 3300005458 Bacteria 3369
213 Ga0070681_10659231 3300005458 Bacteria 961
214 Ga0068867_100001227 3300005459 Bacteria 17662
215 Ga0068867_100010749 3300005459 Bacteria 6455
216 Ga0068867_100022951 3300005459 Bacteria 4464
217 Ga0068867_100097755 3300005459 Bacteria 2237
218 Ga0068867_100099727 3300005459 Bacteria 2216
219 Ga0068867_100125108 3300005459 Bacteria 1991
220 Ga0068867_100248495 3300005459 Bacteria 1445
221 Ga0068867_100374330 3300005459 Bacteria 1195
222 Ga0070685_10490120 3300005466 Bacteria 868
223 Ga0070685_10785453 3300005466 Bacteria 701
224 Ga0070699_100354844 3300005518 Bacteria 1321
225 Ga0070679_100005692 3300005530 Bacteria 11550
226 Ga0070679_100063572 3300005530 Bacteria 3679
227 Ga0070679_100581050 3300005530 Bacteria 1064
228 Ga0070684_100040168 3300005535 Bacteria 4027
229 Ga0070684_100771302 3300005535 Bacteria 898
230 Ga0068853_100016970 3300005539 Bacteria 6002
231 Ga0068853_100064885 3300005539 Bacteria 3168
232 Ga0068853_100196568 3300005539 Bacteria 1834
233 Ga0068853_100515763 3300005539 Bacteria 1130
234 Ga0068853_100672180 3300005539 Bacteria 987
235 Ga0068853_100776401 3300005539 Bacteria 917
236 Ga0070672_100005430 3300005543 Bacteria 8448
237 Ga0070672_100011180 3300005543 Bacteria 6254
238 Ga0070672_100011962 3300005543 Bacteria 6068
239 Ga0070672_100018915 3300005543 Bacteria 4990
240 Ga0070672_100042466 3300005543 Bacteria 3501
241 Ga0070672_100059617 3300005543 Bacteria 3003
242 Ga0070672_100097115 3300005543 Bacteria 2385
243 Ga0070672_100236843 3300005543 Bacteria 1534
244 Ga0070672_100327714 3300005543 Bacteria 1302
245 Ga0070672_100394007 3300005543 Bacteria 1186
246 Ga0070672_100947428 3300005543 Bacteria 762
247 Ga0070686_100049032 3300005544 Bacteria 2678
248 Ga0070686_100569158 3300005544 Bacteria 889
249 Ga0070693_100079293 3300005547 Bacteria 1954
250 Ga0070693_100590180 3300005547 Bacteria 800
251 Ga0070665_100012813 3300005548 Bacteria 8443
252 Ga0070665_100084080 3300005548 Bacteria 3187
253 Ga0070665_100557155 3300005548 Bacteria 1158
254 Ga0068855_100064371 3300005563 Bacteria 4276
255 Ga0068855_100080910 3300005563 Bacteria 3766
256 Ga0068855_100252775 3300005563 Bacteria 1965
257 Ga0070664_100008765 3300005564 Bacteria 8193
258 Ga0070664_100071342 3300005564 Bacteria 2976
259 Ga0070664_100391727 3300005564 Bacteria 1269
260 Ga0070664_100624290 3300005564 Bacteria 1000
261 Ga0068857_100037710 3300005577 Bacteria 4282
262 Ga0068857_100404442 3300005577 Bacteria 1271
263 Ga0068854_100003884 3300005578 Bacteria 9365
264 Ga0068854_100039283 3300005578 Bacteria 3333
265 Ga0068854_100244131 3300005578 Bacteria 1431
266 Ga0068856_100807665 3300005614 Bacteria 958
267 Ga0070702_100060330 3300005615 Bacteria 2205
268 Ga0068852_100015504 3300005616 Bacteria 5914
269 Ga0068852_100028411 3300005616 Bacteria 4577
270 Ga0068852_100041175 3300005616 Bacteria 3902
271 Ga0068852_100113515 3300005616 Bacteria 2467
272 Ga0068852_100175945 3300005616 Bacteria 2009
273 Ga0068852_100260687 3300005616 Bacteria 1664
274 Ga0068852_100537827 3300005616 Bacteria 1167
275 Ga0068852_100599363 3300005616 Bacteria 1106
276 Ga0068852_100836641 3300005616 Bacteria 935
277 Ga0068852_101033026 3300005616 Bacteria 841
278 Ga0068859_100001692 3300005617 Bacteria 22475
279 Ga0068859_100037075 3300005617 Bacteria 4893
280 Ga0068859_100044631 3300005617 Bacteria 4453
281 Ga0068859_100220745 3300005617 Bacteria 1983
282 Ga0068859_100940551 3300005617 Bacteria 948
283 Ga0068864_100024067 3300005618 Bacteria 5119
284 Ga0068864_100026599 3300005618 Bacteria 4880
285 Ga0068864_100107030 3300005618 Bacteria 2487
286 Ga0068864_100319299 3300005618 Bacteria 1458
287 Ga0068864_100726339 3300005618 Bacteria 972
288 Ga0068866_10282131 3300005718 Bacteria 1029
289 Ga0068861_100005683 3300005719 Bacteria 8456
290 Ga0068861_100007197 3300005719 Bacteria 7623
291 Ga0068861_100026911 3300005719 Bacteria 4185
292 Ga0068861_100087666 3300005719 Bacteria 2449
293 Ga0068851_10014192 3300005834 Bacteria 3780
294 Ga0068851_10014208 3300005834 Bacteria 3778
295 Ga0068870_10010186 3300005840 Bacteria 4306
296 Ga0068870_10091494 3300005840 Bacteria 1701
297 Ga0068863_100003643 3300005841 Bacteria 15215
298 Ga0068863_100063085 3300005841 Bacteria 3504
299 Ga0068863_100075714 3300005841 Bacteria 3184
300 Ga0068863_100106875 3300005841 Bacteria 2663
301 Ga0068863_100125022 3300005841 Bacteria 2453
302 Ga0068863_100127664 3300005841 Bacteria 2427
303 Ga0068863_100751688 3300005841 Bacteria 971
304 Ga0068863_101026908 3300005841 Bacteria 828
305 Ga0068858_100003671 3300005842 Bacteria 15203
306 Ga0068858_100012513 3300005842 Bacteria 8002
307 Ga0068858_100032248 3300005842 Bacteria 4866
308 Ga0068858_100065468 3300005842 Bacteria 3363
309 Ga0068860_100002908 3300005843 Bacteria 17738
310 Ga0068860_100044216 3300005843 Bacteria 4246
311 Ga0068860_100044615 3300005843 Bacteria 4225
312 Ga0068860_100188444 3300005843 Bacteria 1996
313 Ga0068860_100317509 3300005843 Bacteria 1529
314 Ga0068860_100382546 3300005843 Bacteria 1389
315 Ga0068860_101234493 3300005843 Bacteria 768
316 Ga0068862_100019144 3300005844 Bacteria 5708
317 Ga0068862_100075168 3300005844 Bacteria 2921
318 Ga0068862_100131682 3300005844 Bacteria 2212
319 Ga0068862_100143468 3300005844 Bacteria 2121
320 Ga0068862_100159661 3300005844 Bacteria 2011
321 Ga0068862_100516914 3300005844 Bacteria 1136
322 Ga0068862_100743491 3300005844 Bacteria 954
323 Ga0075365_10076249 3300006038 Bacteria 2263
324 Ga0075365_10678720 3300006038 Bacteria 728
325 Ga0075368_10019549 3300006042 Bacteria 2557
326 Ga0075368_10076126 3300006042 Bacteria 1361
327 Ga0075363_100014811 3300006048 Bacteria 3821
328 Ga0075363_100034213 3300006048 Bacteria 2651
329 Ga0075363_100058665 3300006048 Bacteria 2068
330 Ga0075363_100063213 3300006048 Bacteria 1997
331 Ga0075363_100196238 3300006048 Bacteria 1152
332 Ga0075363_100405870 3300006048 Bacteria 801
333 Ga0075364_10008537 3300006051 Bacteria 6128
334 Ga0075364_10061844 3300006051 Bacteria 2457
335 Ga0075364_10112071 3300006051 Bacteria 1821
336 Ga0075364_10285587 3300006051 Bacteria 1123
337 Ga0075364_10362944 3300006051 Bacteria 987
338 Ga0075432_10009757 3300006058 Bacteria 3267
339 Ga0070715_10209897 3300006163 Bacteria 995
340 Ga0070716_100709262 3300006173 Bacteria 770
341 Ga0075362_10005777 3300006177 Bacteria 4558
342 Ga0075362_10007388 3300006177 Bacteria 4160
343 Ga0075362_10037092 3300006177 Bacteria 2135
344 Ga0075362_10106386 3300006177 Bacteria 1317
345 Ga0075367_10004234 3300006178 Bacteria 6968
346 Ga0075367_10040277 3300006178 Bacteria 2727
347 Ga0075367_10042880 3300006178 Bacteria 2649
348 Ga0075367_10044378 3300006178 Bacteria 2606
349 Ga0075367_10279967 3300006178 Bacteria 1048
350 Ga0075367_10286653 3300006178 Bacteria 1036
351 Ga0075369_10037984 3300006186 Bacteria 2053
352 Ga0075366_10003407 3300006195 Bacteria 8373
353 Ga0075366_10005458 3300006195 Bacteria 6892
354 Ga0075366_10005910 3300006195 Bacteria 6654
355 Ga0075366_10012133 3300006195 Bacteria 4881
356 Ga0075366_10013206 3300006195 Bacteria 4698
357 Ga0075366_10013684 3300006195 Bacteria 4625
358 Ga0075366_10013960 3300006195 Bacteria 4581
359 Ga0075366_10020947 3300006195 Bacteria 3799
360 Ga0075366_10030020 3300006195 Bacteria 3195
361 Ga0075366_10036393 3300006195 Bacteria 2902
362 Ga0075366_10054927 3300006195 Bacteria 2365
363 Ga0075366_10124751 3300006195 Bacteria 1553
364 Ga0075366_10150364 3300006195 Bacteria 1410
365 Ga0075366_10609299 3300006195 Bacteria 677
366 Ga0097621_100012521 3300006237 Bacteria 6293
367 Ga0097621_100101443 3300006237 Bacteria 2422
368 Ga0097621_100260330 3300006237 Bacteria 1522
369 Ga0097621_100438070 3300006237 Bacteria 1175
370 Ga0075370_10000225 3300006353 Bacteria 20118
371 Ga0075370_10001707 3300006353 Bacteria 9755
372 Ga0075370_10002348 3300006353 Bacteria 8750
373 Ga0075370_10004422 3300006353 Bacteria 6824
374 Ga0075370_10008916 3300006353 Bacteria 5183
375 Ga0075370_10012294 3300006353 Bacteria 4519
376 Ga0075370_10013870 3300006353 Bacteria 4288
377 Ga0075370_10040940 3300006353 Bacteria 2615
378 Ga0075370_10041400 3300006353 Bacteria 2601
379 Ga0075370_10044098 3300006353 Bacteria 2521
380 Ga0075370_10065987 3300006353 Bacteria 2064
381 Ga0075370_10269955 3300006353 Bacteria 1010
382 Ga0075370_10535714 3300006353 Bacteria 708
383 Ga0068871_100063713 3300006358 Bacteria 3016
384 Ga0068871_100152029 3300006358 Bacteria 1974
385 Ga0068871_100186995 3300006358 Bacteria 1782
386 Ga0068871_100228153 3300006358 Bacteria 1615
387 Ga0068871_100338389 3300006358 Bacteria 1328
388 Ga0075430_100149234 3300006846 Bacteria 1947
389 Ga0075430_100914555 3300006846 Bacteria 723
390 Ga0075434_100704901 3300006871 Bacteria 1027
391 Ga0075429_100002867 3300006880 Bacteria 14599
392 Ga0075429_100156324 3300006880 Bacteria 1997
393 Ga0068865_100027454 3300006881 Bacteria 3761
394 Ga0068865_100032733 3300006881 Bacteria 3476
395 Ga0068865_100141816 3300006881 Bacteria 1813
396 Ga0068865_100245462 3300006881 Bacteria 1411
397 Ga0068865_100259560 3300006881 Bacteria 1375
398 Ga0068865_100389715 3300006881 Bacteria 1138
399 Ga0075436_100248271 3300006914 Bacteria 1267
400 Ga0097620_100001692 3300006931 Bacteria 22475
401 Ga0097620_100037073 3300006931 Bacteria 4893
402 Ga0097620_100044631 3300006931 Bacteria 4453
403 Ga0097620_100220752 3300006931 Bacteria 1983
404 Ga0097620_100940517 3300006931 Bacteria 948
405 Ga0079104_1000008 3300006946 Bacteria 371223
406 Ga0079104_1000009 3300006946 Bacteria 367015
407 Ga0099826_10000531 3300006948 Bacteria 18831
408 Ga0099826_10199313 3300006948 Bacteria 1097
409 Ga0105244_10006199 3300009036 Bacteria 7800
410 Ga0105244_10057750 3300009036 Bacteria 1960
411 Ga0105250_10000385 3300009092 Bacteria 32922
412 Ga0105240_10015890 3300009093 Bacteria 10211
413 Ga0105240_10023280 3300009093 Bacteria 8197
414 Ga0111539_10456527 3300009094 Bacteria 1488
415 Ga0111539_10773151 3300009094 Bacteria 1118
416 Ga0105245_10122798 3300009098 Bacteria 2428
417 Ga0105245_10383289 3300009098 Bacteria 1400
418 Ga0105245_10425986 3300009098 Bacteria 1331
419 Ga0105247_10491885 3300009101 Bacteria 892
420 Ga0105243_10001352 3300009148 Bacteria 21800
421 Ga0105243_10031437 3300009148 Bacteria 4093
422 Ga0105243_10068966 3300009148 Bacteria 2851
423 Ga0105243_10144378 3300009148 Bacteria 2034
424 Ga0105243_10144456 3300009148 Bacteria 2034
425 Ga0105243_10159256 3300009148 Bacteria 1945
426 Ga0105243_10201928 3300009148 Bacteria 1744
427 Ga0105243_10498712 3300009148 Bacteria 1153
428 Ga0105243_10549882 3300009148 Bacteria 1103
429 Ga0105243_10700645 3300009148 Bacteria 987
430 Ga0105241_10025166 3300009174 Bacteria 4423
431 Ga0105241_10066804 3300009174 Bacteria 2782
432 Ga0105241_10194178 3300009174 Bacteria 1691
433 Ga0105242_10002509 3300009176 Bacteria 14399
434 Ga0105242_10400463 3300009176 Bacteria 1281
435 Ga0105242_11048213 3300009176 Bacteria 826
436 Ga0105248_10004153 3300009177 Bacteria 16021
437 Ga0105248_10010401 3300009177 Bacteria 10247
438 Ga0105248_10193974 3300009177 Bacteria 2288
439 Ga0105248_10197360 3300009177 Bacteria 2268
440 Ga0105248_12250224 3300009177 Bacteria 620
441 Ga0105237_10001628 3300009545 Bacteria 29150
442 Ga0105237_10081736 3300009545 Bacteria 3222
443 Ga0105237_10091032 3300009545 Bacteria 3040
444 Ga0105237_10456705 3300009545 Bacteria 1283
445 Ga0105237_10830367 3300009545 Bacteria 931
446 Ga0105238_10017351 3300009551 Bacteria 7314
447 Ga0105238_10027544 3300009551 Bacteria 5792
448 Ga0105238_10032655 3300009551 Bacteria 5297
449 Ga0105238_10148762 3300009551 Bacteria 2318
450 Ga0105238_10372062 3300009551 Bacteria 1419
451 Ga0105249_10169676 3300009553 Bacteria 2115
452 Ga0105249_10556432 3300009553 Bacteria 1198
453 Ga0105239_10001684 3300010375 Bacteria 29148
454 Ga0105239_10064793 3300010375 Bacteria 4012
455 Ga0105239_10188587 3300010375 Bacteria 2308
456 Ga0105239_11237604 3300010375 Bacteria 861
457 Ga0105246_10041957 3300011119 Bacteria 3096
458 Ga0105246_10166342 3300011119 Bacteria 1685
459 Ga0105246_10518643 3300011119 Bacteria 1015
460 Ga0157319_1000007 3300012497 Bacteria 318528
461 Ga0157347_1001108 3300012502 Bacteria 2027
462 Ga0157339_1001556 3300012505 Bacteria 1425
463 Ga0157326_1002527 3300012513 Bacteria 1953
464 Ga0157373_10030010 3300013100 Bacteria 3913
465 Ga0157373_10186777 3300013100 Bacteria 1460
466 Ga0157371_10000153 3300013102 Bacteria 101298
467 Ga0157371_10055385 3300013102 Bacteria 2814
468 Ga0157371_10120538 3300013102 Bacteria 1865
469 Ga0157371_10563443 3300013102 Bacteria 845
470 Ga0157371_10706933 3300013102 Bacteria 755
471 Ga0157370_10012041 3300013104 Bacteria 9003
472 Ga0157370_10391985 3300013104 Bacteria 1279
473 Ga0157370_10801777 3300013104 Bacteria 857
474 Ga0157369_10185424 3300013105 Bacteria 2188
475 Ga0157369_10526667 3300013105 Bacteria 1222
476 Ga0157374_10073196 3300013296 Bacteria 3234
477 Ga0157378_10008040 3300013297 Bacteria 9206
478 Ga0157378_10179017 3300013297 Bacteria 1993
479 Ga0163162_10017155 3300013306 Bacteria 7085
480 Ga0163162_10071865 3300013306 Bacteria 3514
481 Ga0163162_10445795 3300013306 Bacteria 1426
482 Ga0157372_10941156 3300013307 Bacteria 1002
483 Ga0157375_10030952 3300013308 Bacteria 5051
484 Ga0157375_10279795 3300013308 Bacteria 1832
485 Ga0157375_10462687 3300013308 Bacteria 1434
486 Ga0163163_10669300 3300014325 Bacteria 1101
487 Ga0163163_11235039 3300014325 Bacteria 810
488 Ga0157380_10869159 3300014326 Bacteria 925
489 Ga0157380_11098040 3300014326 Bacteria 834
490 Ga0182008_10005176 3300014497 Bacteria 7481
491 Ga0182008_10008326 3300014497 Bacteria 5666
492 Ga0182008_10021224 3300014497 Bacteria 3337
493 Ga0182008_10026144 3300014497 Bacteria 2960
494 Ga0182008_10060346 3300014497 Bacteria 1870
495 Ga0182008_10177068 3300014497 Bacteria 1078
496 Ga0157377_10107172 3300014745 Bacteria 1675
497 Ga0157377_10297880 3300014745 Bacteria 1063
498 Ga0157377_10368874 3300014745 Bacteria 968
499 Ga0157379_10007142 3300014968 Bacteria 9657
500 Ga0157379_10118471 3300014968 Bacteria 2381
501 Ga0157379_10152243 3300014968 Bacteria 2086
502 Ga0157379_10267905 3300014968 Bacteria 1553
503 Ga0157379_10313989 3300014968 Bacteria 1430
504 Ga0157379_11014439 3300014968 Bacteria 792
505 Ga0157376_10053662 3300014969 Bacteria 3357
506 Ga0157376_10235357 3300014969 Bacteria 1703
507 Ga0182006_1005565 3300015261 Bacteria 5985
508 Ga0182006_1014247 3300015261 Bacteria 3431
509 Ga0182006_1043727 3300015261 Bacteria 1750
510 Ga0182006_1109069 3300015261 Bacteria 973
511 Ga0182006_1110167 3300015261 Bacteria 967
512 Ga0182007_10002449 3300015262 Bacteria 9219
513 Ga0182007_10004830 3300015262 Bacteria 6034
514 Ga0182007_10132926 3300015262 Bacteria 838
515 Ga0182005_1015298 3300015265 Bacteria 2141
516 Ga0183362_10004 3300015683 Bacteria 569303
517 Ga0163161_10001130 3300017792 Bacteria 20132
518 Ga0163161_10009549 3300017792 Bacteria 6707
519 Ga0163161_10024563 3300017792 Bacteria 4259
520 Ga0163161_10034013 3300017792 Bacteria 3645
521 Ga0163161_10055647 3300017792 Bacteria 2872
522 Ga0163161_10060195 3300017792 Bacteria 2763
523 Ga0163161_10127921 3300017792 Bacteria 1914
524 Ga0163161_10245901 3300017792 Bacteria 1393
525 Ga0163161_10327964 3300017792 Bacteria 1212
526 Ga0163161_10356685 3300017792 Bacteria 1164
527 Ga0213872_10000066 3300021361 Bacteria 93052
528 Ga0213872_10000208 3300021361 Bacteria 52289
529 Ga0209435_100008 3300025206 Bacteria 503644
530 Ga0209436_105208 3300025208 Bacteria 3030
531 Ga0209674_112190 3300025226 Bacteria 848
532 Ga0209672_100962 3300025228 Bacteria 12795
533 Ga0209147_101143 3300025229 Bacteria 10894
534 Ga0209563_100014 3300025230 Bacteria 940582
535 Ga0209563_100143 3300025230 Bacteria 78744
536 Ga0209258_100015 3300025242 Bacteria 706310
537 Ga0207425_1000905 3300025245 Bacteria 14290
538 Ga0207425_1001302 3300025245 Bacteria 10769
539 Ga0207425_1004478 3300025245 Bacteria 4179
540 Ga0207425_1020924 3300025245 Bacteria 1392
541 Ga0209646_1000029 3300025246 Bacteria 386414
542 Ga0209026_1000016 3300025250 Bacteria 386457
543 Ga0209677_102615 3300025253 Bacteria 6561
544 Ga0209148_1000028 3300025254 Bacteria 582773
545 Ga0209148_1000229 3300025254 Bacteria 91956
546 Ga0209759_1000016 3300025256 Bacteria 386414
547 Ga0209129_1000038 3300025258 Bacteria 322778
548 Ga0209129_1000154 3300025258 Bacteria 109449
549 Ga0209129_1000246 3300025258 Bacteria 56795
550 Ga0209129_1000576 3300025258 Bacteria 25327
551 Ga0209129_1015665 3300025258 Bacteria 1550
552 Ga0209565_1000061 3300025263 Bacteria 185308
553 Ga0209565_1000405 3300025263 Bacteria 35986
554 Ga0209565_1000728 3300025263 Bacteria 19690
555 Ga0209565_1001344 3300025263 Bacteria 11185
556 Ga0209565_1007356 3300025263 Bacteria 2979
557 Ga0209565_1011639 3300025263 Bacteria 2130
558 Ga0209673_1000136 3300025273 Bacteria 159975
559 Ga0209673_1000356 3300025273 Bacteria 82432
560 Ga0209673_1000492 3300025273 Bacteria 65573
561 Ga0209673_1001242 3300025273 Bacteria 26534
562 Ga0209673_1008427 3300025273 Bacteria 4591
563 Ga0209673_1031239 3300025273 Bacteria 1661
564 Ga0209673_1033688 3300025273 Bacteria 1558
565 Ga0209673_1069634 3300025273 Bacteria 843
566 Ga0209130_1000014 3300025284 Bacteria 412039
567 Ga0209130_1000411 3300025284 Bacteria 46681
568 Ga0209130_1001104 3300025284 Bacteria 19948
569 Ga0209130_1001270 3300025284 Bacteria 17510
570 Ga0209130_1001682 3300025284 Bacteria 13460
571 Ga0209675_1000071 3300025291 Bacteria 168382
572 Ga0209675_1000607 3300025291 Bacteria 25724
573 Ga0209675_1000899 3300025291 Bacteria 19074
574 Ga0209675_1001168 3300025291 Bacteria 15930
575 Ga0209675_1005554 3300025291 Bacteria 5254
576 Ga0209675_1030176 3300025291 Bacteria 1296
577 Ga0209676_1000013 3300025292 Bacteria 816080
578 Ga0209676_1000153 3300025292 Bacteria 166393
579 Ga0209676_1000167 3300025292 Bacteria 156470
580 Ga0209676_1000643 3300025292 Bacteria 50106
581 Ga0209676_1000659 3300025292 Bacteria 49458
582 Ga0209676_1007050 3300025292 Bacteria 5389
583 Ga0209676_1014943 3300025292 Bacteria 2885
584 Ga0209025_1000775 3300025294 Bacteria 52922
585 Ga0209025_1001414 3300025294 Bacteria 31787
586 Ga0209025_1009412 3300025294 Bacteria 6811
587 Ga0209025_1012506 3300025294 Bacteria 5431
588 Ga0209025_1012733 3300025294 Bacteria 5361
589 Ga0209025_1015779 3300025294 Bacteria 4520
590 Ga0209025_1016664 3300025294 Bacteria 4310
591 Ga0209025_1035930 3300025294 Bacteria 2229
592 Ga0209025_1043759 3300025294 Bacteria 1881
593 Ga0209025_1045730 3300025294 Bacteria 1810
594 Ga0209025_1103288 3300025294 Bacteria 895
595 Ga0209564_1000162 3300025295 Bacteria 162265
596 Ga0209564_1000847 3300025295 Bacteria 40940
597 Ga0209564_1001101 3300025295 Bacteria 32085
598 Ga0209564_1001248 3300025295 Bacteria 28296
599 Ga0209564_1001479 3300025295 Bacteria 23739
600 Ga0209564_1007859 3300025295 Bacteria 5400
601 Ga0209758_1000039 3300025297 Bacteria 428951
602 Ga0209758_1000152 3300025297 Bacteria 162418
603 Ga0209758_1004145 3300025297 Bacteria 12358
604 Ga0209050_1000008 3300025298 Bacteria 1144179
605 Ga0209050_1000015 3300025298 Bacteria 759102
606 Ga0209050_1000945 3300025298 Bacteria 37767
607 Ga0209050_1001318 3300025298 Bacteria 27770
608 Ga0209050_1001545 3300025298 Bacteria 24091
609 Ga0209050_1006623 3300025298 Bacteria 6794
610 Ga0209050_1012349 3300025298 Bacteria 3927
611 Ga0209050_1018244 3300025298 Bacteria 2737
612 Ga0209050_1025087 3300025298 Bacteria 2038
613 Ga0209050_1071374 3300025298 Bacteria 774
614 Ga0209256_1000019 3300025299 Bacteria 558627
615 Ga0209256_1000039 3300025299 Bacteria 372337
616 Ga0209256_1000074 3300025299 Bacteria 236893
617 Ga0209256_1000154 3300025299 Bacteria 144509
618 Ga0209256_1000787 3300025299 Bacteria 40940
619 Ga0209256_1015015 3300025299 Bacteria 2739
620 Ga0209256_1036451 3300025299 Bacteria 1290
621 Ga0207426_1000121 3300025302 Bacteria 219007
622 Ga0207426_1000174 3300025302 Bacteria 160877
623 Ga0207426_1000683 3300025302 Bacteria 40932
624 Ga0207426_1001530 3300025302 Bacteria 18857
625 Ga0209051_1000004 3300025303 Bacteria 1155596
626 Ga0209051_1000005 3300025303 Bacteria 1142353
627 Ga0209051_1000010 3300025303 Bacteria 641298
628 Ga0209051_1000175 3300025303 Bacteria 116040
629 Ga0209051_1000180 3300025303 Bacteria 113724
630 Ga0209051_1000227 3300025303 Bacteria 94321
631 Ga0209051_1000513 3300025303 Bacteria 48907
632 Ga0209051_1002875 3300025303 Bacteria 11852
633 Ga0209051_1009880 3300025303 Bacteria 4875
634 Ga0209051_1050843 3300025303 Bacteria 1384
635 Ga0209257_1000015 3300025304 Bacteria 908141
636 Ga0209257_1000016 3300025304 Bacteria 908015
637 Ga0209257_1000026 3300025304 Bacteria 723225
638 Ga0209257_1000031 3300025304 Bacteria 688770
639 Ga0209257_1000038 3300025304 Bacteria 609032
640 Ga0209257_1000044 3300025304 Bacteria 486709
641 Ga0209257_1001106 3300025304 Bacteria 35067
642 Ga0209257_1002818 3300025304 Bacteria 16333
643 Ga0209257_1003300 3300025304 Bacteria 14057
644 Ga0209257_1011950 3300025304 Bacteria 4092
645 Ga0209257_1012758 3300025304 Bacteria 3835
646 Ga0209257_1016703 3300025304 Bacteria 2949
647 Ga0209257_1023145 3300025304 Bacteria 2193
648 Ga0207697_10122315 3300025315 Bacteria 1121
649 Ga0207656_10093589 3300025321 Bacteria 1368
650 Ga0207656_10115950 3300025321 Bacteria 1242
651 Ga0207656_10210514 3300025321 Bacteria 942
652 Ga0207696_1000284 3300025711 Bacteria 59551
653 Ga0207655_1007523 3300025728 Bacteria 7054
654 Ga0207682_10010775 3300025893 Bacteria 3580
655 Ga0207682_10040172 3300025893 Bacteria 1905
656 Ga0207682_10071258 3300025893 Bacteria 1473
657 Ga0207682_10094102 3300025893 Bacteria 1303
658 Ga0207682_10183142 3300025893 Bacteria 957
659 Ga0207642_10016503 3300025899 Bacteria 2783
660 Ga0207688_10017262 3300025901 Bacteria 3921
661 Ga0207688_10024880 3300025901 Bacteria 3285
662 Ga0207688_10029723 3300025901 Bacteria 3010
663 Ga0207688_10168944 3300025901 Bacteria 1300
664 Ga0207688_10455497 3300025901 Bacteria 798
665 Ga0207688_10536533 3300025901 Bacteria 734
666 Ga0207680_10097570 3300025903 Bacteria 1882
667 Ga0207680_10146541 3300025903 Bacteria 1570
668 Ga0207685_10034303 3300025905 Bacteria 1842
669 Ga0207645_10003346 3300025907 Bacteria 12223
670 Ga0207645_10011552 3300025907 Bacteria 6023
671 Ga0207645_10013620 3300025907 Bacteria 5473
672 Ga0207645_10086093 3300025907 Bacteria 2018
673 Ga0207645_10122254 3300025907 Bacteria 1690
674 Ga0207645_10324888 3300025907 Bacteria 1027
675 Ga0207643_10035180 3300025908 Bacteria 2807
676 Ga0207643_10097785 3300025908 Bacteria 1718
677 Ga0207643_10133600 3300025908 Bacteria 1478
678 Ga0207705_10002493 3300025909 Bacteria 14180
679 Ga0207705_10193191 3300025909 Bacteria 1540
680 Ga0207705_10197245 3300025909 Bacteria 1524
681 Ga0207705_10450412 3300025909 Bacteria 998
682 Ga0207684_10010838 3300025910 Bacteria 7998
683 Ga0207654_10087592 3300025911 Bacteria 1890
684 Ga0207654_10106349 3300025911 Bacteria 1737
685 Ga0207654_10291566 3300025911 Bacteria 1107
686 Ga0207707_10507356 3300025912 Bacteria 1028
687 Ga0207695_10041887 3300025913 Bacteria 4897
688 Ga0207695_10054927 3300025913 Bacteria 4155
689 Ga0207695_10332073 3300025913 Bacteria 1409
690 Ga0207695_10580992 3300025913 Bacteria 1002
691 Ga0207695_10973081 3300025913 Bacteria 728
692 Ga0207671_10002945 3300025914 Bacteria 17546
693 Ga0207671_10051654 3300025914 Bacteria 3046
694 Ga0207671_10073022 3300025914 Bacteria 2562
695 Ga0207671_10247550 3300025914 Bacteria 1401
696 Ga0207671_10444183 3300025914 Bacteria 1033
697 Ga0207660_10144632 3300025917 Bacteria 1821
698 Ga0207662_10016086 3300025918 Bacteria 4216
699 Ga0207662_10324195 3300025918 Bacteria 1029
700 Ga0207657_10032535 3300025919 Bacteria 4710
701 Ga0207657_10055775 3300025919 Bacteria 3411
702 Ga0207657_10076226 3300025919 Bacteria 2829
703 Ga0207657_10186334 3300025919 Bacteria 1676
704 Ga0207657_10268198 3300025919 Bacteria 1357
705 Ga0207657_10319427 3300025919 Bacteria 1228
706 Ga0207657_10510216 3300025919 Bacteria 941
707 Ga0207649_10031335 3300025920 Bacteria 3159
708 Ga0207649_10037522 3300025920 Bacteria 2927
709 Ga0207649_10190500 3300025920 Bacteria 1442
710 Ga0207649_10644110 3300025920 Bacteria 818
711 Ga0207681_10000367 3300025923 Bacteria 32064
712 Ga0207681_10002642 3300025923 Bacteria 11359
713 Ga0207681_10016724 3300025923 Bacteria 4596
714 Ga0207681_10070866 3300025923 Bacteria 2429
715 Ga0207681_10075197 3300025923 Bacteria 2368
716 Ga0207681_10132637 3300025923 Bacteria 1844
717 Ga0207681_10214819 3300025923 Bacteria 1484
718 Ga0207694_10089664 3300025924 Bacteria 2425
719 Ga0207694_10453455 3300025924 Bacteria 1071
720 Ga0207650_10002949 3300025925 Bacteria 11735
721 Ga0207650_10024167 3300025925 Bacteria 4317
722 Ga0207650_10045938 3300025925 Bacteria 3214
723 Ga0207650_10177447 3300025925 Bacteria 1696
724 Ga0207650_10412593 3300025925 Bacteria 1119
725 Ga0207650_10439259 3300025925 Bacteria 1085
726 Ga0207659_10001212 3300025926 Bacteria 15414
727 Ga0207659_10019168 3300025926 Bacteria 4497
728 Ga0207659_10052346 3300025926 Bacteria 2908
729 Ga0207659_10121573 3300025926 Bacteria 2001
730 Ga0207659_10127878 3300025926 Bacteria 1956
731 Ga0207687_10170912 3300025927 Bacteria 1676
732 Ga0207644_10015344 3300025931 Bacteria 5140
733 Ga0207644_10019987 3300025931 Bacteria 4549
734 Ga0207644_10024937 3300025931 Bacteria 4108
735 Ga0207644_10026791 3300025931 Bacteria 3977
736 Ga0207644_10030568 3300025931 Bacteria 3747
737 Ga0207644_10068448 3300025931 Bacteria 2590
738 Ga0207644_10379624 3300025931 Bacteria 1152
739 Ga0207644_10606708 3300025931 Bacteria 909
740 Ga0207690_10221868 3300025932 Bacteria 1447
741 Ga0207690_10472817 3300025932 Bacteria 1011
742 Ga0207690_10477821 3300025932 Bacteria 1005
743 Ga0207706_10010614 3300025933 Bacteria 8414
744 Ga0207706_10049571 3300025933 Bacteria 3711
745 Ga0207706_10061637 3300025933 Bacteria 3303
746 Ga0207706_10249018 3300025933 Bacteria 1552
747 Ga0207706_10341407 3300025933 Bacteria 1303
748 Ga0207686_10008679 3300025934 Bacteria 5490
749 Ga0207686_10026772 3300025934 Bacteria 3368
750 Ga0207686_10045158 3300025934 Bacteria 2710
751 Ga0207686_10423889 3300025934 Bacteria 1018
752 Ga0207709_10000121 3300025935 Bacteria 116804
753 Ga0207709_10000436 3300025935 Bacteria 39392
754 Ga0207709_10000534 3300025935 Bacteria 32767
755 Ga0207709_10006921 3300025935 Bacteria 6343
756 Ga0207709_10041841 3300025935 Bacteria 2752
757 Ga0207709_10072313 3300025935 Bacteria 2193
758 Ga0207709_10210079 3300025935 Bacteria 1396
759 Ga0207709_10386544 3300025935 Bacteria 1066
760 Ga0207709_10426493 3300025935 Bacteria 1020
761 Ga0207669_10157142 3300025937 Bacteria 1601
762 Ga0207669_10218127 3300025937 Bacteria 1398
763 Ga0207704_10015442 3300025938 Bacteria 3891
764 Ga0207704_10094030 3300025938 Bacteria 1978
765 Ga0207704_10134773 3300025938 Bacteria 1717
766 Ga0207665_10651198 3300025939 Bacteria 826
767 Ga0207691_10001450 3300025940 Bacteria 23610
768 Ga0207691_10003420 3300025940 Bacteria 15434
769 Ga0207691_10007414 3300025940 Bacteria 10560
770 Ga0207691_10011946 3300025940 Bacteria 8330
771 Ga0207691_10013320 3300025940 Bacteria 7877
772 Ga0207691_10016135 3300025940 Bacteria 7095
773 Ga0207691_10063024 3300025940 Bacteria 3363
774 Ga0207691_10077609 3300025940 Bacteria 2992
775 Ga0207691_10094002 3300025940 Bacteria 2683
776 Ga0207691_10149427 3300025940 Bacteria 2055
777 Ga0207691_10178992 3300025940 Bacteria 1853
778 Ga0207691_10217658 3300025940 Bacteria 1657
779 Ga0207711_10034232 3300025941 Bacteria 4302
780 Ga0207711_10049997 3300025941 Bacteria 3579
781 Ga0207711_10124795 3300025941 Bacteria 2302
782 Ga0207711_10203673 3300025941 Bacteria 1806
783 Ga0207711_10549728 3300025941 Bacteria 1077
784 Ga0207711_10964162 3300025941 Bacteria 792
785 Ga0207689_10008839 3300025942 Bacteria 8749
786 Ga0207689_10026041 3300025942 Bacteria 4897
787 Ga0207689_10102005 3300025942 Bacteria 2357
788 Ga0207689_10119812 3300025942 Bacteria 2165
789 Ga0207689_10221615 3300025942 Bacteria 1563
790 Ga0207689_10426304 3300025942 Bacteria 1107
791 Ga0207689_10720935 3300025942 Bacteria 841
792 Ga0207661_10010414 3300025944 Bacteria 6692
793 Ga0207679_10023351 3300025945 Bacteria 4227
794 Ga0207679_10055228 3300025945 Bacteria 2926
795 Ga0207679_10083564 3300025945 Bacteria 2447
796 Ga0207679_10117539 3300025945 Bacteria 2110
797 Ga0207679_10168399 3300025945 Bacteria 1801
798 Ga0207667_10006091 3300025949 Bacteria 14660
799 Ga0207667_10179008 3300025949 Bacteria 2178
800 Ga0207667_10197226 3300025949 Bacteria 2065
801 Ga0207667_10538960 3300025949 Bacteria 1181
802 Ga0207651_10003694 3300025960 Bacteria 7566
803 Ga0207651_10021326 3300025960 Bacteria 3935
804 Ga0207651_10071369 3300025960 Bacteria 2461
805 Ga0207651_10106054 3300025960 Bacteria 2097
806 Ga0207651_10227251 3300025960 Bacteria 1513
807 Ga0207712_10202436 3300025961 Bacteria 1575
808 Ga0207712_10734452 3300025961 Bacteria 864
809 Ga0207668_10006769 3300025972 Bacteria 6784
810 Ga0207668_10015717 3300025972 Bacteria 4709
811 Ga0207668_10045412 3300025972 Bacteria 2996
812 Ga0207668_10862911 3300025972 Bacteria 804
813 Ga0207640_10091596 3300025981 Bacteria 2106
814 Ga0207640_10205022 3300025981 Bacteria 1497
815 Ga0207658_10013870 3300025986 Bacteria 5514
816 Ga0207658_10014403 3300025986 Bacteria 5414
817 Ga0207658_10018033 3300025986 Bacteria 4867
818 Ga0207658_10089290 3300025986 Bacteria 2385
819 Ga0207658_10204891 3300025986 Bacteria 1649
820 Ga0207658_10432789 3300025986 Bacteria 1162
821 Ga0207677_10001669 3300026023 Bacteria 11755
822 Ga0207677_10002669 3300026023 Bacteria 9398
823 Ga0207677_10008949 3300026023 Bacteria 5617
824 Ga0207677_10088072 3300026023 Bacteria 2250
825 Ga0207677_10106221 3300026023 Bacteria 2079
826 Ga0207677_10180838 3300026023 Bacteria 1659
827 Ga0207677_10340220 3300026023 Bacteria 1253
828 Ga0207677_10373453 3300026023 Bacteria 1201
829 Ga0207703_10009567 3300026035 Bacteria 7610
830 Ga0207703_10068613 3300026035 Bacteria 2922
831 Ga0207703_10175137 3300026035 Bacteria 1890
832 Ga0207703_10191090 3300026035 Bacteria 1813
833 Ga0207639_10004292 3300026041 Bacteria 9606
834 Ga0207639_10193841 3300026041 Bacteria 1737
835 Ga0207639_10223070 3300026041 Bacteria 1629
836 Ga0207639_10479259 3300026041 Bacteria 1134
837 Ga0207678_10000060 3300026067 Bacteria 85708
838 Ga0207678_10074100 3300026067 Bacteria 2917
839 Ga0207678_10165587 3300026067 Bacteria 1888
840 Ga0207678_10469866 3300026067 Bacteria 1094
841 Ga0207708_10005130 3300026075 Bacteria 9662
842 Ga0207708_10066830 3300026075 Bacteria 2749
843 Ga0207702_10023522 3300026078 Bacteria 5110
844 Ga0207702_10050522 3300026078 Bacteria 3511
845 Ga0207702_10367302 3300026078 Bacteria 1381
846 Ga0207641_10005553 3300026088 Bacteria 10749
847 Ga0207641_10071210 3300026088 Bacteria 2990
848 Ga0207641_10103121 3300026088 Bacteria 2516
849 Ga0207641_10111819 3300026088 Bacteria 2422
850 Ga0207648_10005574 3300026089 Bacteria 12665
851 Ga0207648_10015155 3300026089 Bacteria 7095
852 Ga0207648_10018799 3300026089 Bacteria 6247
853 Ga0207648_10026807 3300026089 Bacteria 5118
854 Ga0207648_10027227 3300026089 Bacteria 5077
855 Ga0207648_10030658 3300026089 Bacteria 4760
856 Ga0207648_10058565 3300026089 Bacteria 3359
857 Ga0207648_10124178 3300026089 Bacteria 2270
858 Ga0207648_10144987 3300026089 Bacteria 2094
859 Ga0207648_10163120 3300026089 Bacteria 1969
860 Ga0207648_10535467 3300026089 Bacteria 1074
861 Ga0207648_10588941 3300026089 Bacteria 1024
862 Ga0207648_10768047 3300026089 Bacteria 896
863 Ga0207676_10001594 3300026095 Bacteria 16708
864 Ga0207676_10037438 3300026095 Bacteria 3697
865 Ga0207676_10051589 3300026095 Bacteria 3212
866 Ga0207676_10091889 3300026095 Bacteria 2494
867 Ga0207676_10126730 3300026095 Bacteria 2163
868 Ga0207676_10475497 3300026095 Bacteria 1182
869 Ga0207674_10011781 3300026116 Bacteria 9811
870 Ga0207674_10238522 3300026116 Bacteria 1765
871 Ga0207674_10321751 3300026116 Bacteria 1496
872 Ga0207674_10445099 3300026116 Bacteria 1252
873 Ga0207675_100004538 3300026118 Bacteria 13391
874 Ga0207675_100010737 3300026118 Bacteria 8579
875 Ga0207675_100021554 3300026118 Bacteria 6001
876 Ga0207675_100042676 3300026118 Bacteria 4235
877 Ga0207675_100989662 3300026118 Bacteria 859
878 Ga0207683_10032973 3300026121 Bacteria 4499
879 Ga0207683_10047017 3300026121 Bacteria 3779
880 Ga0207683_10116800 3300026121 Bacteria 2392
881 Ga0207683_10174016 3300026121 Bacteria 1950
882 Ga0207683_10180633 3300026121 Bacteria 1913
883 Ga0207683_10400328 3300026121 Bacteria 1263
884 Ga0207683_10451174 3300026121 Bacteria 1186
885 Ga0207683_10670704 3300026121 Bacteria 961
886 Ga0207683_10842965 3300026121 Bacteria 851
887 Ga0207698_10036933 3300026142 Bacteria 3592
888 Ga0207698_10216057 3300026142 Bacteria 1729
889 Ga0207698_10233129 3300026142 Bacteria 1672
890 Ga0207698_10805277 3300026142 Bacteria 942
891 Ga0207698_10995794 3300026142 Bacteria 849
892 Ga0209281_1000023 3300027111 Bacteria 519955
893 Ga0209281_1000029 3300027111 Bacteria 431495
894 Ga0209970_1000191 3300027614 Bacteria 9723
895 Ga0210002_1010230 3300027617 Bacteria 1438
896 Ga0209282_1005677 3300027666 Bacteria 7687
897 Ga0209971_1002573 3300027682 Bacteria 4346
898 Ga0209998_10065020 3300027717 Bacteria 864
899 Ga0209813_10044398 3300027866 Bacteria 1365
900 Ga0209813_10072934 3300027866 Bacteria 1120
901 Ga0209974_10010352 3300027876 Bacteria 3146
902 Ga0209974_10015457 3300027876 Bacteria 2535
903 Ga0207428_10083891 3300027907 Bacteria 2484
904 Ga0268266_10025956 3300028379 Bacteria 4984
905 Ga0268266_10035949 3300028379 Bacteria 4213
906 Ga0268266_10094857 3300028379 Bacteria 2620
907 Ga0268266_10377975 3300028379 Bacteria 1336
908 Ga0268266_10406580 3300028379 Bacteria 1288
909 Ga0268265_10001580 3300028380 Bacteria 18852
910 Ga0268265_10033303 3300028380 Bacteria 3745
911 Ga0268265_10034997 3300028380 Bacteria 3665
912 Ga0268265_10089321 3300028380 Bacteria 2457
913 Ga0268265_10372781 3300028380 Bacteria 1310
914 Ga0268264_10000909 3300028381 Bacteria 31074
915 Ga0268264_10012844 3300028381 Bacteria 6892
916 Ga0268264_10053084 3300028381 Bacteria 3381
917 Ga0268264_10155353 3300028381 Bacteria 2056
918 Ga0268264_10749191 3300028381 Bacteria 973
919 Ga0307517_10007370 3300028786 Bacteria 16050
920 Ga0307517_10181751 3300028786 Bacteria 1356
921 Ga0307515_10000123 3300028794 Bacteria 186601
922 Ga0307515_10000222 3300028794 Bacteria 140902
923 Ga0307515_10000468 3300028794 Bacteria 96483
924 Ga0307515_10001320 3300028794 Bacteria 56334
925 Ga0307515_10003752 3300028794 Bacteria 31839
926 Ga0307515_10004066 3300028794 Bacteria 30515
927 Ga0307515_10023096 3300028794 Bacteria 10923
928 Ga0307515_10024670 3300028794 Bacteria 10459
929 Ga0307515_10055750 3300028794 Bacteria 5764
930 Ga0307515_10061404 3300028794 Bacteria 5333
931 Ga0307515_10130543 3300028794 Bacteria 2771
932 Ga0307515_10197133 3300028794 Bacteria 1902
933 Ga0307515_10225703 3300028794 Bacteria 1679
934 Ga0307515_10264303 3300028794 Bacteria 1452
935 Ga0307515_10464829 3300028794 Bacteria 879
936 Ga0307515_10514455 3300028794 Bacteria 807
937 Ga0307512_10034515 3300030522 Bacteria 4326
938 Ga0307512_10052484 3300030522 Bacteria 3250
939 Ga0307512_10212678 3300030522 Bacteria 1025
940 Ga0316177_1037458 3300030731 Bacteria 1478
941 Ga0316176_1101539 3300030732 Bacteria 2065
942 Ga0316178_1135832 3300030735 Bacteria 6916
943 Ga0316180_1041316 3300030736 Bacteria 2278
944 Ga0316180_1122922 3300030736 Bacteria 3742
945 Ga0316181_1099919 3300030744 Bacteria 1569
946 Ga0316182_1410237 3300030745 Bacteria 2777
947 Ga0265330_10000281 3300031235 Bacteria 37503
948 Ga0265332_10000008 3300031238 Bacteria 301609
949 Ga0265332_10000015 3300031238 Bacteria 243944
950 Ga0265328_10003117 3300031239 Bacteria 7397
951 Ga0265325_10020353 3300031241 Bacteria 3657
952 Ga0265339_10321264 3300031249 Bacteria 734
953 Ga0265331_10003180 3300031250 Bacteria 10721
954 Ga0265331_10010532 3300031250 Bacteria 5114
955 Ga0265331_10219952 3300031250 Bacteria 854
956 Ga0265327_10000020 3300031251 Bacteria 424552
957 Ga0265327_10002288 3300031251 Bacteria 20545
958 Ga0265327_10089452 3300031251 Bacteria 1504
959 Ga0307513_10000025 3300031456 Bacteria 202918
960 Ga0307513_10000037 3300031456 Bacteria 175364
961 Ga0307513_10029877 3300031456 Bacteria 6200
962 Ga0307513_10035170 3300031456 Bacteria 5610
963 Ga0307513_10161174 3300031456 Bacteria 2136
964 Ga0307513_10184542 3300031456 Bacteria 1945
965 Ga0307513_10269906 3300031456 Bacteria 1485
966 Ga0307513_10324513 3300031456 Bacteria 1296
967 Ga0307513_10348362 3300031456 Bacteria 1230
968 Ga0307509_10000157 3300031507 Bacteria 106022
969 Ga0307509_10092949 3300031507 Bacteria 3081
970 Ga0307408_100000006 3300031548 Bacteria 472824
971 Ga0307408_100000117 3300031548 Bacteria 87442
972 Ga0307408_100010507 3300031548 Bacteria 6103
973 Ga0307408_100018753 3300031548 Bacteria 4649
974 Ga0307408_100019477 3300031548 Bacteria 4569
975 Ga0307408_100020891 3300031548 Bacteria 4424
976 Ga0307408_100056604 3300031548 Bacteria 2844
977 Ga0307408_100107360 3300031548 Bacteria 2137
978 Ga0307408_100227429 3300031548 Bacteria 1525
979 Ga0307408_100409840 3300031548 Bacteria 1166
980 Ga0307508_10000269 3300031616 Bacteria 63656
981 Ga0307508_10232672 3300031616 Bacteria 1441
982 Ga0307508_10239506 3300031616 Bacteria 1412
983 Ga0307514_10000585 3300031649 Bacteria 68393
984 Ga0307514_10001154 3300031649 Bacteria 35951
985 Ga0307514_10024785 3300031649 Bacteria 4852
986 Ga0307514_10098202 3300031649 Bacteria 2111
987 Ga0307514_10200404 3300031649 Bacteria 1255
988 Ga0265314_10000065 3300031711 Bacteria 158383
989 Ga0265314_10000481 3300031711 Bacteria 52341
990 Ga0265314_10018203 3300031711 Bacteria 5484
991 Ga0265342_10019697 3300031712 Bacteria 4344
992 Ga0265342_10393544 3300031712 Bacteria 716
993 Ga0307516_10001952 3300031730 Bacteria 28258
994 Ga0307516_10004413 3300031730 Bacteria 17380
995 Ga0307516_10012344 3300031730 Bacteria 9215
996 Ga0307516_10045798 3300031730 Bacteria 4318
997 Ga0307516_10083286 3300031730 Bacteria 3040
998 Ga0307405_10004869 3300031731 Bacteria 6409
999 Ga0307405_10012829 3300031731 Bacteria 4451
1000 Ga0307405_10017764 3300031731 Bacteria 3910
1001 Ga0307405_10050040 3300031731 Bacteria 2585
1002 Ga0307405_10091627 3300031731 Bacteria 2014
1003 Ga0307405_10105055 3300031731 Bacteria 1901
1004 Ga0307405_10186066 3300031731 Bacteria 1495
1005 Ga0307405_10475520 3300031731 Bacteria 996
1006 Ga0307413_10120858 3300031824 Bacteria 1774
1007 Ga0307413_10124153 3300031824 Bacteria 1754
1008 Ga0307413_10469259 3300031824 Bacteria 1003
1009 Ga0307410_10119667 3300031852 Bacteria 1918
1010 Ga0307410_10149747 3300031852 Bacteria 1736
1011 Ga0307410_10591607 3300031852 Bacteria 924
1012 Ga0307406_10000564 3300031901 Bacteria 21342
1013 Ga0307406_10002426 3300031901 Bacteria 10137
1014 Ga0307406_10018283 3300031901 Bacteria 4092
1015 Ga0307406_10072633 3300031901 Bacteria 2259
1016 Ga0307406_10152092 3300031901 Bacteria 1652
1017 Ga0307406_10155874 3300031901 Bacteria 1635
1018 Ga0307406_10416394 3300031901 Bacteria 1069
1019 Ga0307406_10467565 3300031901 Bacteria 1015
1020 Ga0307407_10091038 3300031903 Bacteria 1869
1021 Ga0307412_10028789 3300031911 Bacteria 3480
1022 Ga0307412_10058062 3300031911 Bacteria 2586
1023 Ga0307412_10083820 3300031911 Bacteria 2211
1024 Ga0307412_10095492 3300031911 Bacteria 2090
1025 Ga0307412_10145469 3300031911 Bacteria 1741
1026 Ga0307412_10239285 3300031911 Bacteria 1403
1027 Ga0307412_10274411 3300031911 Bacteria 1321
1028 Ga0307412_10276436 3300031911 Bacteria 1316
1029 Ga0307412_10349208 3300031911 Bacteria 1187
1030 Ga0307412_10455927 3300031911 Bacteria 1055
1031 Ga0307409_100061269 3300031995 Bacteria 2939
1032 Ga0307409_100090562 3300031995 Bacteria 2504
1033 Ga0307409_100137667 3300031995 Bacteria 2098
1034 Ga0307409_100753201 3300031995 Bacteria 978
1035 Ga0307416_100014791 3300032002 Bacteria 5363
1036 Ga0307416_100047940 3300032002 Bacteria 3386
1037 Ga0307416_100053337 3300032002 Bacteria 3243
1038 Ga0307416_100099825 3300032002 Bacteria 2522
1039 Ga0307416_100166292 3300032002 Bacteria 2046
1040 Ga0307416_100298118 3300032002 Bacteria 1600
1041 Ga0307416_100473808 3300032002 Bacteria 1310
1042 Ga0307416_100510676 3300032002 Bacteria 1268
1043 Ga0307416_100626988 3300032002 Bacteria 1158
1044 Ga0307416_100633437 3300032002 Bacteria 1152
1045 Ga0307416_101759310 3300032002 Bacteria 724
1046 Ga0307414_10480291 3300032004 Bacteria 1096
1047 Ga0307414_10719811 3300032004 Bacteria 905
1048 Ga0307411_10001308 3300032005 Bacteria 10014
1049 Ga0307411_10002448 3300032005 Bacteria 8205
1050 Ga0307411_10006757 3300032005 Bacteria 5770
1051 Ga0307411_10441138 3300032005 Bacteria 1086
1052 Ga0307411_10615071 3300032005 Bacteria 936
1053 Ga0307415_100063147 3300032126 Bacteria 2572
1054 Ga0307415_100176832 3300032126 Bacteria 1670
1055 Ga0307510_10003158 3300033180 Bacteria 19108
1056 Ga0307510_10136616 3300033180 Bacteria 2107
1057 Ga0373950_0032458 3300034818 Bacteria 972
1058 Ga0373928_0049261 3300035084 Bacteria 990
1059 Ga0373940_0006122 3300035088 Bacteria 2648
1060 Ga0373944_0023572 3300035089 Bacteria 1797
1061 Ga0373944_0081619 3300035089 Bacteria 1069
1062 Ga0373923_0106378 3300035111 Bacteria 1242
1063 Ga0373932_0009286 3300035112 Bacteria 2363
1064 Ga0373936_0355264 3300035113 Bacteria 668
1065 Ga0373939_0000034 3300035114 Bacteria 49433
1066 Ga0373945_0039471 3300035116 Bacteria 1702
1067 Ga0373953_0165992 3300035117 Bacteria 950
1068 Ga0373956_0196024 3300035119 Bacteria 957
1069 Ga0373957_0069546 3300035120 Bacteria 1375
1070 Ga0373955_0471964 3300035172 Bacteria 765
1071 Ga0373924_0081545 3300035410 Bacteria 1376
1072 Ga0373931_0023054 3300035691 Bacteria 3139
1073 Ga0373931_0037464 3300035691 Bacteria 2532
1074 Ga0373935_0096080 3300035692 Bacteria 1947
1075 Ga0373927_0014011 3300035695 Bacteria 5315
1076 Ga0373927_0393928 3300035695 Bacteria 914
1077 Ga0373947_0765966 3300035725 Bacteria 659
1078 Ga0373937_0160176 3300036401 Bacteria 2110
1079 Ga0373925_0034130 3300037068 Bacteria 3750
1080 Ga0373925_0063218 3300037068 Bacteria 2785
1081 Ga0373925_0294902 3300037068 Bacteria 1308
1082 Ga0395899_0004451 3300037312 Bacteria 10928
1083 Ga0395899_0033686 3300037312 Bacteria 3846
1084 Ga0395899_0036250 3300037312 Bacteria 3700
1085 Ga0395899_0403585 3300037312 Bacteria 904
1086 Ga0395900_0001245 3300037418 Bacteria 31261
1087 Ga0395900_0005828 3300037418 Bacteria 12871
1088 Ga0395900_0138960 3300037418 Bacteria 2488
1089 Ga0395900_0149756 3300037418 Bacteria 2384
1090 Ga0395900_0248012 3300037418 Bacteria 1783
1091 Ga0395900_0297355 3300037418 Bacteria 1601
1092 Ga0395900_0305251 3300037418 Bacteria 1576
1093 Ga0395900_0419760 3300037418 Bacteria 1299
1094 Ga0395900_0644114 3300037418 Bacteria 997
1095 Ga0395898_0001815 3300037466 Bacteria 27567
1096 Ga0395898_0007129 3300037466 Bacteria 11868
1097 Ga0395898_0114703 3300037466 Bacteria 2581
1098 Ga0395898_0126865 3300037466 Bacteria 2444
1099 Ga0395898_0249468 3300037466 Bacteria 1693
1100 Ga0395905_0000047 3300037471 Bacteria 237582
1101 Ga0395905_0000574 3300037471 Bacteria 49809
1102 Ga0395905_0000951 3300037471 Bacteria 37161
1103 Ga0395905_0010363 3300037471 Bacteria 9075
1104 Ga0395905_0039742 3300037471 Bacteria 4414
1105 Ga0395905_0071413 3300037471 Bacteria 3254
1106 Ga0395905_0074778 3300037471 Bacteria 3175
1107 Ga0395905_0090171 3300037471 Bacteria 2874
1108 Ga0395905_0095289 3300037471 Bacteria 2793
1109 Ga0395905_0101806 3300037471 Bacteria 2696
1110 Ga0395905_0118140 3300037471 Bacteria 2492
1111 Ga0395905_0139842 3300037471 Bacteria 2278
1112 Ga0395905_0141319 3300037471 Bacteria 2264
1113 Ga0395905_0179661 3300037471 Bacteria 1987
1114 Ga0395905_0191646 3300037471 Bacteria 1917
1115 Ga0395905_0304848 3300037471 Bacteria 1480
1116 Ga0395905_0348097 3300037471 Bacteria 1373
1117 Ga0436364_0558821 3300037853 Bacteria 1036
1118 Ga0395901_0000227 3300038443 Bacteria 70721
1119 Ga0395901_0009689 3300038443 Bacteria 9770
1120 Ga0395901_0017644 3300038443 Bacteria 7287
1121 Ga0395901_0051325 3300038443 Bacteria 4288
1122 Ga0395901_0116046 3300038443 Bacteria 2812
1123 Ga0395901_0157557 3300038443 Bacteria 2384
1124 Ga0395901_0314114 3300038443 Bacteria 1622
1125 Ga0395901_0342627 3300038443 Bacteria 1544
1126 Ga0395901_0355799 3300038443 Bacteria 1511
1127 Ga0395901_0458249 3300038443 Bacteria 1303
1128 Ga0395901_0511018 3300038443 Bacteria 1222
1129 Ga0395901_0858004 3300038443 Bacteria 893
1130 Ga0436365_0215796 3300039437 Bacteria 1260
1131 Ga0436365_0273360 3300039437 Bacteria 3901
1132 Ga0436361_0034087 3300039447 Bacteria 2524
1133 Ga0436361_0052534 3300039447 Bacteria 27577
1134 Ga0436361_0150911 3300039447 Bacteria 49105
1135 Ga0436361_1125703 3300039447 Bacteria 66289
1136 Ga0439436_0005656 3300041404 Bacteria 3832
1137 Ga0439436_0024429 3300041404 Bacteria 1784
1138 Ga0439436_0055304 3300041404 Bacteria 1115
1139 Ga0439438_024536 3300041405 Bacteria 1650
1140 Ga0439439_0003366 3300041406 Bacteria 3518
1141 Ga0439461_0005336 3300041410 Bacteria 2186
1142 Ga0439466_0003457 3300041411 Bacteria 6120
1143 Ga0439466_0007581 3300041411 Bacteria 4101
1144 Ga0439466_0017646 3300041411 Bacteria 2569
1145 Ga0439465_0020438 3300041413 Bacteria 2074
1146 Ga0451787_727763 3300041441 Bacteria 703
1147 Ga0451791_0365245 3300041451 Bacteria 778
1148 Ga0451795_0559006 3300041456 Bacteria 2858
1149 Ga0451800_0497913 3300041459 Bacteria 917
1150 Ga0451802_0944004 3300041460 Bacteria 989
1151 Ga0451802_1626350 3300041460 Bacteria 666
1152 Ga0451845_0479137 3300041501 Bacteria 682
1153 Ga0451851_1002806 3300041507 Bacteria 1611
1154 Ga0451855_1618156 3300041511 Bacteria 1399
1155 Ga0439433_0028952 3300041999 Bacteria 1262
1156 Ga0439433_0030210 3300041999 Bacteria 1238
1157 Ga0439441_045351 3300042001 Bacteria 892
1158 Ga0439448_0000870 3300042005 Bacteria 7382
1159 Ga0439448_0072957 3300042005 Bacteria 1144
1160 Ga0439432_002441 3300042006 Bacteria 6994
1161 Ga0439449_0001017 3300042007 Bacteria 11054
1162 Ga0439449_0001719 3300042007 Bacteria 8600
1163 Ga0439449_0002193 3300042007 Bacteria 7685
1164 Ga0439449_0007021 3300042007 Bacteria 4289
1165 Ga0439449_0030408 3300042007 Bacteria 2012
1166 Ga0439449_0054531 3300042007 Bacteria 1477
1167 Ga0439449_0074757 3300042007 Bacteria 1249
1168 Ga0439450_003215 3300042008 Bacteria 2674
1169 Ga0439450_016459 3300042008 Bacteria 1529
1170 Ga0439454_064521 3300042011 Bacteria 640
1171 Ga0439455_0035017 3300042012 Bacteria 1265
1172 Ga0439455_0047787 3300042012 Bacteria 1112
1173 Ga0439462_0009697 3300042015 Bacteria 2434
1174 Ga0439462_0021562 3300042015 Bacteria 1683
1175 Ga0439462_0132521 3300042015 Bacteria 696
1176 Ga0450911_000578 3300042115 Bacteria 11349
1177 Ga0450911_004528 3300042115 Bacteria 2270
1178 Ga0450911_010034 3300042115 Bacteria 1314
1179 Ga0450919_000956 3300042121 Bacteria 3742
1180 Ga0450920_066091 3300042122 Bacteria 733
1181 Ga0450921_003331 3300042123 Bacteria 1126
1182 Ga0450921_006869 3300042123 Bacteria 893
1183 Ga0450923_009202 3300042125 Bacteria 1722
1184 Ga0450923_011324 3300042125 Bacteria 1602
1185 Ga0450891_000197 3300042129 Bacteria 5956
1186 Ga0450892_000380 3300042130 Bacteria 5286
1187 Ga0450894_012811 3300042131 Bacteria 1099
1188 Ga0450903_014401 3300042138 Bacteria 1251
1189 Ga0450904_001473 3300042139 Bacteria 3280
1190 Ga0450889_000119 3300042144 Bacteria 7698
1191 Ga0450907_056188 3300042146 Bacteria 678
1192 Ga0439446_0005311 3300042156 Bacteria 3311
1193 Ga0439446_0072223 3300042156 Bacteria 1057
1194 Ga0439446_0087125 3300042156 Bacteria 974
1195 Ga0439458_0019461 3300042157 Bacteria 1562
1196 Ga0439434_0002288 3300042435 Bacteria 5565
1197 Ga0439434_0007693 3300042435 Bacteria 3157
1198 Ga0439459_0015354 3300042438 Bacteria 1402
1199 Ga0439460_0027777 3300042461 Bacteria 1592
1200 Ga0450918_000285 3300042531 Bacteria 11477
1201 Ga0450918_026288 3300042531 Bacteria 1021
1202 Ga0450893_0003766 3300042532 Bacteria 2398
1203 Ga0451577_0000093 3300042876 Bacteria 196838
1204 Ga0451577_0001338 3300042876 Bacteria 33477
1205 Ga0451577_0002254 3300042876 Bacteria 23406
1206 Ga0451577_0002648 3300042876 Bacteria 20969
1207 Ga0451577_0066100 3300042876 Bacteria 3225
1208 Ga0451577_0219434 3300042876 Bacteria 1718
1209 Ga0451577_1259235 3300042876 Bacteria 659
1210 Ga0466969_0000186 3300044656 Bacteria 33421
1211 Ga0466969_0058414 3300044656 Bacteria 1877
1212 Ga0466969_0091776 3300044656 Bacteria 1438
1213 Ga0466969_0160543 3300044656 Bacteria 1033
1214 Ga0453683_0278994 3300044673 Bacteria 1067
1215 Ga0466965_0020110 3300044683 Bacteria 3207
1216 Ga0466965_0023464 3300044683 Bacteria 2979
1217 Ga0466965_0101244 3300044683 Bacteria 1473
1218 Ga0466965_0122390 3300044683 Bacteria 1344
1219 Ga0466966_0015044 3300044684 Bacteria 5118
1220 Ga0466966_0015429 3300044684 Bacteria 5050
1221 Ga0466966_0052349 3300044684 Bacteria 2593
1222 Ga0466966_0107919 3300044684 Bacteria 1717
1223 Ga0466966_0200830 3300044684 Bacteria 1206
1224 Ga0466966_0225306 3300044684 Bacteria 1131
1225 Ga0466961_0143754 3300044693 Bacteria 1492
1226 Ga0466961_0247167 3300044693 Bacteria 1096
1227 Ga0466963_0110457 3300044694 Bacteria 1887
1228 Ga0466963_0151731 3300044694 Bacteria 1609
1229 Ga0466964_0000264 3300044706 Bacteria 15122
1230 Ga0466964_0120876 3300044706 Bacteria 1180
1231 Ga0453684_0000218 3300044712 Bacteria 250267
1232 Ga0453684_0033902 3300044712 Bacteria 7103
1233 Ga0453684_0034217 3300044712 Bacteria 7059
1234 Ga0453684_0060705 3300044712 Bacteria 4859
1235 Ga0453684_0281890 3300044712 Bacteria 1895
1236 Ga0453684_1937000 3300044712 Bacteria 595
1237 Ga0466971_0030769 3300044719 Bacteria 2402
1238 Ga0466957_0000288 3300044842 Bacteria 24625
1239 Ga0466957_0013525 3300044842 Bacteria 4735
1240 Ga0466957_0292085 3300044842 Bacteria 1093
1241 Ga0466957_0383746 3300044842 Bacteria 958
1242 Ga0466959_0020692 3300045049 Bacteria 4847
1243 Ga0466959_0123645 3300045049 Bacteria 1837
1244 Ga0466959_0123868 3300045049 Bacteria 1835
1245 Ga0466959_0220483 3300045049 Bacteria 1315
1246 Ga0451576_0002854 3300045051 Bacteria 24796
1247 Ga0451576_0004915 3300045051 Bacteria 17055
1248 Ga0451576_0005858 3300045051 Bacteria 15264
1249 Ga0451576_0034263 3300045051 Bacteria 5394
1250 Ga0451576_0109260 3300045051 Bacteria 2878
1251 Ga0451576_0163504 3300045051 Bacteria 2323
1252 Ga0451576_0335193 3300045051 Bacteria 1583
1253 Ga0451576_0471215 3300045051 Bacteria 1319
1254 Ga0451576_1152321 3300045051 Bacteria 810
1255 Ga0466958_0185593 3300045836 Bacteria 1320
1256 Ga0466958_0251068 3300045836 Bacteria 1131
1257 Ga0466967_0049432 3300045976 Bacteria 3677
1258 Ga0466967_0279833 3300045976 Bacteria 1600
1259 Ga0495617_000046 3300046452 Bacteria 115430
1260 Ga0495617_012911 3300046452 Bacteria 2846
1261 Ga0495627_000476 3300046453 Bacteria 33973
1262 Ga0495627_008595 3300046453 Bacteria 3812
1263 Ga0495627_033588 3300046453 Bacteria 1607
1264 Ga0495627_105277 3300046453 Bacteria 803
1265 Ga0495592_0000350 3300046454 Bacteria 37566
1266 Ga0495603_0037669 3300046455 Bacteria 2901
1267 Ga0495603_0073196 3300046455 Bacteria 2013
1268 Ga0495603_0386009 3300046455 Bacteria 803
1269 Ga0495590_0000134 3300046457 Bacteria 43957
1270 Ga0495590_0002591 3300046457 Bacteria 7473
1271 Ga0495590_0010844 3300046457 Bacteria 3414
1272 Ga0495590_0087403 3300046457 Bacteria 1101
1273 Ga0495591_001540 3300046458 Bacteria 14139
1274 Ga0495629_0027134 3300046459 Bacteria 4068
1275 Ga0495638_0001308 3300046460 Bacteria 23102
1276 Ga0495638_0066647 3300046460 Bacteria 2212
1277 Ga0495638_0359437 3300046460 Bacteria 766
1278 Ga0495638_0364683 3300046460 Bacteria 759
1279 Ga0495653_0123067 3300046463 Bacteria 1845
1280 Ga0495650_0000248 3300046471 Bacteria 106527
1281 Ga0495650_0001029 3300046471 Bacteria 31365
1282 Ga0495650_0019327 3300046471 Bacteria 3357
1283 Ga0495650_0041314 3300046471 Bacteria 1973
1284 Ga0495650_0041872 3300046471 Bacteria 1956
1285 Ga0495580_0840114 3300046472 Bacteria 593
1286 Ga0495582_0037622 3300046473 Bacteria 2661
1287 Ga0495582_0269050 3300046473 Bacteria 978
1288 Ga0495605_0000284 3300046474 Bacteria 56120
1289 Ga0495605_0003169 3300046474 Bacteria 9886
1290 Ga0495605_0003708 3300046474 Bacteria 9062
1291 Ga0495605_0007184 3300046474 Bacteria 6333
1292 Ga0495605_0025578 3300046474 Bacteria 3075
1293 Ga0495605_0030988 3300046474 Bacteria 2735
1294 Ga0495605_0071841 3300046474 Bacteria 1633
1295 Ga0495605_0122685 3300046474 Bacteria 1177
1296 Ga0495605_0217122 3300046474 Bacteria 827
1297 Ga0495584_0000241 3300046491 Bacteria 39535
1298 Ga0495584_0000276 3300046491 Bacteria 36518
1299 Ga0495584_0000360 3300046491 Bacteria 31720
1300 Ga0495584_0002554 3300046491 Bacteria 10275
1301 Ga0495584_0004319 3300046491 Bacteria 7654
1302 Ga0495584_0016912 3300046491 Bacteria 3716
1303 Ga0495584_0135096 3300046491 Bacteria 1252
1304 Ga0495584_0243957 3300046491 Bacteria 913
1305 Ga0495584_0371481 3300046491 Bacteria 726
1306 Ga0495585_0002464 3300046492 Bacteria 13235
1307 Ga0495585_0005435 3300046492 Bacteria 8032
1308 Ga0495585_0007132 3300046492 Bacteria 6866
1309 Ga0495585_0021982 3300046492 Bacteria 3661
1310 Ga0495585_0023714 3300046492 Bacteria 3520
1311 Ga0495585_0024052 3300046492 Bacteria 3494
1312 Ga0495585_0024939 3300046492 Bacteria 3427
1313 Ga0495585_0036294 3300046492 Bacteria 2781
1314 Ga0495585_0037171 3300046492 Bacteria 2742
1315 Ga0495585_0038810 3300046492 Bacteria 2679
1316 Ga0495585_0051421 3300046492 Bacteria 2283
1317 Ga0495585_0070094 3300046492 Bacteria 1912
1318 Ga0495594_0001034 3300046499 Bacteria 14476
1319 Ga0495594_0007956 3300046499 Bacteria 5450
1320 Ga0495594_0018814 3300046499 Bacteria 3664
1321 Ga0495594_0021622 3300046499 Bacteria 3434
1322 Ga0495594_0021993 3300046499 Bacteria 3409
1323 Ga0495594_0064178 3300046499 Bacteria 2035
1324 Ga0495594_0065167 3300046499 Bacteria 2021
1325 Ga0495594_0099124 3300046499 Bacteria 1638
1326 Ga0495596_0001002 3300046500 Bacteria 16788
1327 Ga0495596_0001598 3300046500 Bacteria 12897
1328 Ga0495596_0002577 3300046500 Bacteria 9625
1329 Ga0495596_0002731 3300046500 Bacteria 9270
1330 Ga0495596_0029077 3300046500 Bacteria 2217
1331 Ga0495596_0034738 3300046500 Bacteria 2000
1332 Ga0495596_0036710 3300046500 Bacteria 1940
1333 Ga0495596_0038443 3300046500 Bacteria 1891
1334 Ga0495596_0050386 3300046500 Bacteria 1631
1335 Ga0495607_0001573 3300046501 Bacteria 19927
1336 Ga0495607_0001871 3300046501 Bacteria 17855
1337 Ga0495607_0002451 3300046501 Bacteria 15080
1338 Ga0495607_0009801 3300046501 Bacteria 6468
1339 Ga0495607_0011551 3300046501 Bacteria 5872
1340 Ga0495607_0012895 3300046501 Bacteria 5496
1341 Ga0495607_0027715 3300046501 Bacteria 3499
1342 Ga0495607_0055635 3300046501 Bacteria 2275
1343 Ga0495607_0063895 3300046501 Bacteria 2080
1344 Ga0495607_0084815 3300046501 Bacteria 1731
1345 Ga0495607_0140263 3300046501 Bacteria 1247
1346 Ga0495607_0227953 3300046501 Bacteria 907
1347 Ga0495607_0302893 3300046501 Bacteria 751
1348 Ga0495583_0000063 3300046506 Bacteria 194362
1349 Ga0495583_0001885 3300046506 Bacteria 19477
1350 Ga0495583_0002379 3300046506 Bacteria 16213
1351 Ga0495583_0002792 3300046506 Bacteria 14379
1352 Ga0495583_0031975 3300046506 Bacteria 2544
1353 Ga0495583_0047815 3300046506 Bacteria 1965
1354 Ga0495583_0069700 3300046506 Bacteria 1548
1355 Ga0495606_0009114 3300046507 Bacteria 8452
1356 Ga0495606_0017080 3300046507 Bacteria 5503
1357 Ga0495606_0207396 3300046507 Bacteria 1112
1358 Ga0495608_0567520 3300046511 Bacteria 683
1359 Ga0495610_0004443 3300046512 Bacteria 10365
1360 Ga0495610_0012620 3300046512 Bacteria 5071
1361 Ga0495610_0041810 3300046512 Bacteria 2298
1362 Ga0495610_0047899 3300046512 Bacteria 2100
1363 Ga0495616_0000351 3300046513 Bacteria 36157
1364 Ga0495616_0001306 3300046513 Bacteria 17424
1365 Ga0495616_0003756 3300046513 Bacteria 9685
1366 Ga0495616_0008093 3300046513 Bacteria 6259
1367 Ga0495616_0008388 3300046513 Bacteria 6124
1368 Ga0495616_0011406 3300046513 Bacteria 5091
1369 Ga0495616_0017738 3300046513 Bacteria 3922
1370 Ga0495616_0022338 3300046513 Bacteria 3416
1371 Ga0495616_0031763 3300046513 Bacteria 2762
1372 Ga0495616_0033405 3300046513 Bacteria 2681
1373 Ga0495616_0033410 3300046513 Bacteria 2680
1374 Ga0495616_0077187 3300046513 Bacteria 1599
1375 Ga0495620_0086640 3300046515 Bacteria 1261
1376 Ga0495630_0023098 3300046517 Bacteria 4596
1377 Ga0495630_0099816 3300046517 Bacteria 2196
1378 Ga0495631_0000279 3300046518 Bacteria 35571
1379 Ga0495631_0000531 3300046518 Bacteria 25562
1380 Ga0495631_0003440 3300046518 Bacteria 8670
1381 Ga0495631_0004363 3300046518 Bacteria 7537
1382 Ga0495631_0006947 3300046518 Bacteria 5797
1383 Ga0495631_0008227 3300046518 Bacteria 5259
1384 Ga0495631_0012021 3300046518 Bacteria 4242
1385 Ga0495631_0016698 3300046518 Bacteria 3491
1386 Ga0495631_0037889 3300046518 Bacteria 2146
1387 Ga0495631_0139357 3300046518 Bacteria 1041
1388 Ga0495632_0000630 3300046519 Bacteria 32470
1389 Ga0495632_0001071 3300046519 Bacteria 23465
1390 Ga0495632_0001258 3300046519 Bacteria 21488
1391 Ga0495632_0001682 3300046519 Bacteria 18102
1392 Ga0495632_0003508 3300046519 Bacteria 11094
1393 Ga0495632_0005476 3300046519 Bacteria 8384
1394 Ga0495632_0012075 3300046519 Bacteria 4997
1395 Ga0495632_0086290 3300046519 Bacteria 1493
1396 Ga0495632_0297237 3300046519 Bacteria 716
1397 Ga0495637_0000349 3300046520 Bacteria 35312
1398 Ga0495637_0008518 3300046520 Bacteria 5032
1399 Ga0495637_0012583 3300046520 Bacteria 4041
1400 Ga0495637_0089504 3300046520 Bacteria 1216
1401 Ga0495637_0103937 3300046520 Bacteria 1107
1402 Ga0495643_0000931 3300046522 Bacteria 30502
1403 Ga0495643_0001000 3300046522 Bacteria 28866
1404 Ga0495643_0001329 3300046522 Bacteria 23372
1405 Ga0495643_0004615 3300046522 Bacteria 9589
1406 Ga0495643_0006332 3300046522 Bacteria 7819
1407 Ga0495643_0007491 3300046522 Bacteria 7026
1408 Ga0495643_0130649 3300046522 Bacteria 1261
1409 Ga0495644_0002145 3300046523 Bacteria 7916
1410 Ga0495644_0005106 3300046523 Bacteria 5137
1411 Ga0495644_0006599 3300046523 Bacteria 4496
1412 Ga0495644_0015113 3300046523 Bacteria 2956
1413 Ga0495644_0020223 3300046523 Bacteria 2539
1414 Ga0495648_0002900 3300046524 Bacteria 15420
1415 Ga0495648_0004016 3300046524 Bacteria 12712
1416 Ga0495648_0005157 3300046524 Bacteria 10930
1417 Ga0495648_0011182 3300046524 Bacteria 6779
1418 Ga0495648_0069662 3300046524 Bacteria 2046
1419 Ga0495648_0112506 3300046524 Bacteria 1478
1420 Ga0495648_0161656 3300046524 Bacteria 1157
1421 Ga0495648_0231626 3300046524 Bacteria 904
1422 Ga0495666_0000578 3300046526 Bacteria 16382
1423 Ga0495666_0049367 3300046526 Bacteria 2024
1424 Ga0495666_0052266 3300046526 Bacteria 1961
1425 Ga0495666_0081989 3300046526 Bacteria 1525
1426 Ga0495642_0000241 3300046528 Bacteria 30854
1427 Ga0495642_0000278 3300046528 Bacteria 28979
1428 Ga0495642_0001118 3300046528 Bacteria 12362
1429 Ga0495642_0001502 3300046528 Bacteria 10379
1430 Ga0495642_0010115 3300046528 Bacteria 3612
1431 Ga0495642_0030852 3300046528 Bacteria 2146
1432 Ga0495642_0033307 3300046528 Bacteria 2071
1433 Ga0495642_0075918 3300046528 Bacteria 1410
1434 Ga0495642_0101051 3300046528 Bacteria 1227
1435 Ga0495642_0279735 3300046528 Bacteria 730
1436 Ga0495642_0334279 3300046528 Bacteria 665
1437 Ga0495652_0018095 3300046529 Bacteria 6288
1438 Ga0495654_0005957 3300046530 Bacteria 7007
1439 Ga0495654_0007490 3300046530 Bacteria 6096
1440 Ga0495654_0010986 3300046530 Bacteria 4917
1441 Ga0495654_0043681 3300046530 Bacteria 2220
1442 Ga0495654_0047363 3300046530 Bacteria 2113
1443 Ga0495654_0047657 3300046530 Bacteria 2105
1444 Ga0495654_0123175 3300046530 Bacteria 1171
1445 Ga0495665_0014435 3300046531 Bacteria 4261
1446 Ga0495665_0067457 3300046531 Bacteria 1887
1447 Ga0495665_0306560 3300046531 Bacteria 812
1448 Ga0495640_0056868 3300046533 Bacteria 2671
1449 Ga0495586_0006169 3300046535 Bacteria 6408
1450 Ga0495587_0020194 3300046536 Bacteria 4115
1451 Ga0495587_0020794 3300046536 Bacteria 4047
1452 Ga0495609_0000005 3300046538 Bacteria 439165
1453 Ga0495609_0000846 3300046538 Bacteria 22605
1454 Ga0495609_0001506 3300046538 Bacteria 15365
1455 Ga0495609_0016726 3300046538 Bacteria 3415
1456 Ga0495609_0025175 3300046538 Bacteria 2729
1457 Ga0495609_0040889 3300046538 Bacteria 2085
1458 Ga0495609_0195392 3300046538 Bacteria 847
1459 Ga0495621_0047608 3300046539 Bacteria 1524
1460 Ga0495621_0162964 3300046539 Bacteria 883
1461 Ga0495597_0000325 3300046542 Bacteria 43126
1462 Ga0495597_0000531 3300046542 Bacteria 31589
1463 Ga0495597_0000789 3300046542 Bacteria 25015
1464 Ga0495597_0000880 3300046542 Bacteria 23368
1465 Ga0495597_0002191 3300046542 Bacteria 12826
1466 Ga0495597_0002703 3300046542 Bacteria 10944
1467 Ga0495597_0007241 3300046542 Bacteria 5652
1468 Ga0495597_0086688 3300046542 Bacteria 1333
1469 Ga0495597_0119167 3300046542 Bacteria 1101
1470 Ga0495597_0123112 3300046542 Bacteria 1080
1471 Ga0495645_0116452 3300046543 Bacteria 1886
1472 Ga0495622_0095770 3300046557 Bacteria 1362
1473 Ga0495633_0000959 3300046558 Bacteria 23887
1474 Ga0495633_0002165 3300046558 Bacteria 14090
1475 Ga0495633_0015452 3300046558 Bacteria 3959
1476 Ga0495633_0020058 3300046558 Bacteria 3368
1477 Ga0495633_0062581 3300046558 Bacteria 1742
1478 Ga0495633_0072041 3300046558 Bacteria 1611
1479 Ga0495633_0086637 3300046558 Bacteria 1456
1480 Ga0495633_0105194 3300046558 Bacteria 1309
1481 Ga0495656_0012654 3300046615 Bacteria 3119
1482 Ga0495656_0028047 3300046615 Bacteria 2255
1483 Ga0495656_0068687 3300046615 Bacteria 1567
1484 Ga0495668_0000906 3300046616 Bacteria 33252
1485 Ga0495668_0006526 3300046616 Bacteria 7626
1486 Ga0495668_0008911 3300046616 Bacteria 6205
1487 Ga0495668_0045707 3300046616 Bacteria 2434
1488 Ga0495668_0233839 3300046616 Bacteria 1006
1489 Ga0495668_0263559 3300046616 Bacteria 943
1490 Ga0495634_0008190 3300046642 Bacteria 7790
1491 Ga0495611_0000780 3300046648 Bacteria 17711
1492 Ga0495611_0002987 3300046648 Bacteria 7540
1493 Ga0495611_0012773 3300046648 Bacteria 3569
1494 Ga0495611_0068885 3300046648 Bacteria 1615
1495 Ga0495611_0224858 3300046648 Bacteria 873
1496 Ga0495625_0000114 3300046660 Bacteria 123268
1497 Ga0495625_0000807 3300046660 Bacteria 43441
1498 Ga0495625_0005169 3300046660 Bacteria 12040
1499 Ga0495625_0010120 3300046660 Bacteria 7834
1500 Ga0495625_0031431 3300046660 Bacteria 3949
1501 Ga0495625_0067643 3300046660 Bacteria 2514
1502 Ga0495625_0091515 3300046660 Bacteria 2102
1503 Ga0495625_0126687 3300046660 Bacteria 1733
1504 Ga0495625_0151238 3300046660 Bacteria 1560
1505 Ga0495625_0205944 3300046660 Bacteria 1295
1506 Ga0495625_0226251 3300046660 Bacteria 1223
1507 Ga0495625_0241160 3300046660 Bacteria 1177
1508 Ga0495625_0477756 3300046660 Bacteria 766
1509 Ga0495635_0172779 3300046663 Bacteria 1469
1510 Ga0495635_0229018 3300046663 Bacteria 1256
1511 Ga0495659_0002749 3300046664 Bacteria 5657
1512 Ga0495661_0000578 3300046665 Bacteria 38058
1513 Ga0495661_0001879 3300046665 Bacteria 16772
1514 Ga0495661_0002173 3300046665 Bacteria 15314
1515 Ga0495661_0002180 3300046665 Bacteria 15280
1516 Ga0495661_0003143 3300046665 Bacteria 12366
1517 Ga0495661_0007428 3300046665 Bacteria 7642
1518 Ga0495661_0012699 3300046665 Bacteria 5684
1519 Ga0495661_0030775 3300046665 Bacteria 3414
1520 Ga0495661_0039509 3300046665 Bacteria 2932
1521 Ga0495661_0040942 3300046665 Bacteria 2869
1522 Ga0495661_0052116 3300046665 Bacteria 2466
1523 Ga0495661_0070039 3300046665 Bacteria 2053
1524 Ga0495661_0086618 3300046665 Bacteria 1792
1525 Ga0495661_0089409 3300046665 Bacteria 1755
1526 Ga0495661_0094414 3300046665 Bacteria 1695
1527 Ga0495588_0000059 3300046674 Bacteria 263358
1528 Ga0495588_0011220 3300046674 Bacteria 4198
1529 Ga0495588_0044256 3300046674 Bacteria 2279
1530 Ga0495588_0071518 3300046674 Bacteria 1804
1531 Ga0495588_0074643 3300046674 Bacteria 1766
1532 Ga0495588_0079124 3300046674 Bacteria 1715
1533 Ga0495588_0088843 3300046674 Bacteria 1618
1534 Ga0495588_0210539 3300046674 Bacteria 1026
1535 Ga0495623_0066362 3300046679 Bacteria 2254
1536 Ga0495623_0196929 3300046679 Bacteria 1160
1537 Ga0495647_0006648 3300046681 Bacteria 3840
1538 Ga0495658_0046613 3300046683 Bacteria 2437
1539 Ga0495658_0155004 3300046683 Bacteria 1409
1540 Ga0495658_0283947 3300046683 Bacteria 1045
1541 Ga0495669_0000301 3300046684 Bacteria 27468
1542 Ga0495669_0002948 3300046684 Bacteria 6995
1543 Ga0495669_0004020 3300046684 Bacteria 6050
1544 Ga0495669_0053638 3300046684 Bacteria 1813
1545 Ga0495613_0036327 3300046689 Bacteria 3653
1546 Ga0495613_0274421 3300046689 Bacteria 1172
1547 Ga0495624_0502097 3300046690 Bacteria 726
1548 Ga0495670_0004367 3300046691 Bacteria 6931
1549 Ga0495670_0004955 3300046691 Bacteria 6541
1550 Ga0495670_0021399 3300046691 Bacteria 3189
1551 Ga0495670_0037772 3300046691 Bacteria 2407
1552 Ga0495670_0055944 3300046691 Bacteria 1978
1553 Ga0495670_0125338 3300046691 Bacteria 1336
1554 Ga0495670_0319480 3300046691 Bacteria 833
1555 Ga0495670_0365117 3300046691 Bacteria 778
1556 Ga0495671_0000893 3300046692 Bacteria 21240
1557 Ga0495671_0008746 3300046692 Bacteria 5687
1558 Ga0495671_0010857 3300046692 Bacteria 5033
1559 Ga0495671_0011017 3300046692 Bacteria 4991
1560 Ga0495671_0014253 3300046692 Bacteria 4283
1561 Ga0495671_0069543 3300046692 Bacteria 1730
1562 Ga0495671_0089616 3300046692 Bacteria 1506
1563 Ga0495671_0130900 3300046692 Bacteria 1223
1564 Ga0495649_0001009 3300046694 Bacteria 22135
1565 Ga0495649_0001486 3300046694 Bacteria 17605
1566 Ga0495649_0003700 3300046694 Bacteria 10173
1567 Ga0495649_0008972 3300046694 Bacteria 5978
1568 Ga0495649_0244954 3300046694 Bacteria 922
1569 Ga0495589_0000277 3300046794 Bacteria 41776
1570 Ga0495589_0000473 3300046794 Bacteria 29321
1571 Ga0495589_0000595 3300046794 Bacteria 24705
1572 Ga0495589_0003209 3300046794 Bacteria 8928
1573 Ga0495589_0015419 3300046794 Bacteria 3933
1574 Ga0495589_0025160 3300046794 Bacteria 3022
1575 Ga0495589_0031251 3300046794 Bacteria 2680
1576 Ga0495589_0062017 3300046794 Bacteria 1834
1577 Ga0495589_0134176 3300046794 Bacteria 1187
1578 Ga0495589_0201104 3300046794 Bacteria 940
1579 Ga0495589_0287142 3300046794 Bacteria 764
1580 Ga0495589_0426243 3300046794 Bacteria 608
1581 Ga0495600_0087627 3300046809 Bacteria 2031
1582 Ga0495600_0147791 3300046809 Bacteria 1523
1583 Ga0495600_0179732 3300046809 Bacteria 1363
1584 Ga0495600_0338476 3300046809 Bacteria 944
1585 Ga0495660_0001345 3300046810 Bacteria 16907
1586 Ga0495660_0001934 3300046810 Bacteria 13490
1587 Ga0495660_0001935 3300046810 Bacteria 13482
1588 Ga0495660_0004355 3300046810 Bacteria 8572
1589 Ga0495660_0008037 3300046810 Bacteria 6197
1590 Ga0495660_0016789 3300046810 Bacteria 4218
1591 Ga0495660_0069272 3300046810 Bacteria 1875
1592 Ga0495660_0254780 3300046810 Bacteria 813
1593 Ga0495581_0031510 3300047315 Bacteria 3072
1594 Ga0495581_0466994 3300047315 Bacteria 734
1595 Ga0495604_0002301 3300047317 Bacteria 15306
1596 Ga0495604_0054177 3300047317 Bacteria 3096
1597 Ga0495604_0080778 3300047317 Bacteria 2435
1598 Ga0495604_0094875 3300047317 Bacteria 2205
1599 Ga0495604_0192254 3300047317 Bacteria 1421
1600 Ga0495604_0259410 3300047317 Bacteria 1182
1601 Ga0495636_0002775 3300047318 Bacteria 6756
1602 Ga0495636_0055230 3300047318 Bacteria 1670
1603 Ga0495636_0309724 3300047318 Bacteria 740
1604 Ga0495674_0664358 3300047319 Bacteria 821
1605 Ga0495672_0000529 3300047320 Bacteria 43533
1606 Ga0495672_0000732 3300047320 Bacteria 36104
1607 Ga0495672_0000769 3300047320 Bacteria 34882
1608 Ga0495672_0000895 3300047320 Bacteria 31259
1609 Ga0495672_0008509 3300047320 Bacteria 7554
1610 Ga0495672_0013502 3300047320 Bacteria 5633
1611 Ga0495672_0115231 3300047320 Bacteria 1436
1612 Ga0495672_0154565 3300047320 Bacteria 1186
1613 Ga0495676_0000099 3300047321 Bacteria 65701
1614 Ga0495676_0006300 3300047321 Bacteria 10919
1615 Ga0495676_0117782 3300047321 Bacteria 1937
1616 Ga0495680_0007715 3300047322 Bacteria 9827
1617 Ga0495680_0028277 3300047322 Bacteria 4598
1618 Ga0495683_0000843 3300047323 Bacteria 21776
1619 Ga0495683_0005874 3300047323 Bacteria 6746
1620 Ga0495683_0012011 3300047323 Bacteria 4551
1621 Ga0495683_0087455 3300047323 Bacteria 1513
1622 Ga0495683_0099328 3300047323 Bacteria 1401
1623 Ga0495683_0241072 3300047323 Bacteria 797
1624 Ga0495687_000070 3300047443 Bacteria 159227
1625 Ga0495687_000221 3300047443 Bacteria 80968
1626 Ga0495687_000562 3300047443 Bacteria 43714
1627 Ga0495687_000821 3300047443 Bacteria 33210
1628 Ga0495687_001071 3300047443 Bacteria 26962
1629 Ga0495687_001138 3300047443 Bacteria 25784
1630 Ga0495687_001176 3300047443 Bacteria 25213
1631 Ga0495687_004427 3300047443 Bacteria 9504
1632 Ga0495687_008434 3300047443 Bacteria 5899
1633 Ga0495687_019205 3300047443 Bacteria 3360
1634 Ga0495675_0025612 3300047444 Bacteria 3759
1635 Ga0495675_0066442 3300047444 Bacteria 2279
1636 Ga0495675_0161310 3300047444 Bacteria 1380
1637 Ga0495677_0000060 3300047445 Bacteria 61831
1638 Ga0495677_0000482 3300047445 Bacteria 16922
1639 Ga0495677_0001125 3300047445 Bacteria 10693
1640 Ga0495677_0001127 3300047445 Bacteria 10691
1641 Ga0495677_0002011 3300047445 Bacteria 8115
1642 Ga0495677_0007858 3300047445 Bacteria 3970
1643 Ga0495677_0013295 3300047445 Bacteria 2994
1644 Ga0495677_0014005 3300047445 Bacteria 2920
1645 Ga0495677_0020665 3300047445 Bacteria 2386
1646 Ga0495677_0020924 3300047445 Bacteria 2371
1647 Ga0495677_0063601 3300047445 Bacteria 1370
1648 Ga0495677_0112791 3300047445 Bacteria 1034
1649 Ga0495677_0118327 3300047445 Bacteria 1009
1650 Ga0495679_003545 3300047446 Bacteria 7460
1651 Ga0495679_005612 3300047446 Bacteria 5534
1652 Ga0495679_017920 3300047446 Bacteria 2525
1653 Ga0495679_026077 3300047446 Bacteria 1945
1654 Ga0495679_106381 3300047446 Bacteria 775
1655 Ga0495685_000352 3300047447 Bacteria 14651
1656 Ga0495685_003376 3300047447 Bacteria 5092
1657 Ga0495685_007450 3300047447 Bacteria 3613
1658 Ga0495685_040565 3300047447 Bacteria 1592
1659 Ga0495673_0028551 3300047469 Bacteria 2641
1660 Ga0495673_0144092 3300047469 Bacteria 926
1661 Ga0495681_0001200 3300047470 Bacteria 19721
1662 Ga0495681_0001614 3300047470 Bacteria 16786
1663 Ga0495681_0002347 3300047470 Bacteria 13587
1664 Ga0495681_0005451 3300047470 Bacteria 8507
1665 Ga0495681_0031797 3300047470 Bacteria 2665
1666 Ga0495681_0067783 3300047470 Bacteria 1625
1667 Ga0495681_0082284 3300047470 Bacteria 1435
1668 Ga0495681_0117704 3300047470 Bacteria 1143
1669 Ga0495681_0161322 3300047470 Bacteria 933
1670 Ga0495684_0196520 3300047471 Bacteria 1489
1671 Ga0495686_0000960 3300047472 Bacteria 35489
1672 Ga0495686_0001068 3300047472 Bacteria 32627
1673 Ga0495686_0002128 3300047472 Bacteria 19378
1674 Ga0495686_0040778 3300047472 Bacteria 2959
1675 Ga0495686_0062293 3300047472 Bacteria 2314
1676 Ga0495686_0074519 3300047472 Bacteria 2082
1677 Ga0495686_0079466 3300047472 Bacteria 2005
1678 Ga0495686_0157666 3300047472 Bacteria 1328
1679 Ga0495686_0344425 3300047472 Bacteria 812
1680 Ga0495593_0001611 3300047673 Bacteria 13340
1681 Ga0495593_0002310 3300047673 Bacteria 11440
1682 Ga0495593_0085078 3300047673 Bacteria 1632
1683 Ga0495602_0005336 3300048088 Bacteria 13488
1684 Ga0495614_0003478 3300048089 Bacteria 7049
1685 Ga0495614_0153604 3300048089 Bacteria 1027
1686 Ga0495615_0001101 3300048090 Bacteria 3877
1687 Ga0495615_0057243 3300048090 Bacteria 1020
1688 Ga0495626_0000196 3300048091 Bacteria 73575
1689 Ga0495626_0000550 3300048091 Bacteria 37251
1690 Ga0495626_0001058 3300048091 Bacteria 23533
1691 Ga0495626_0002192 3300048091 Bacteria 14027
1692 Ga0495626_0003018 3300048091 Bacteria 11108
1693 Ga0495626_0003196 3300048091 Bacteria 10648
1694 Ga0495626_0004927 3300048091 Bacteria 8012
1695 Ga0495626_0012154 3300048091 Bacteria 4526
1696 Ga0495626_0012222 3300048091 Bacteria 4508
1697 Ga0495626_0012535 3300048091 Bacteria 4439
1698 Ga0495626_0014429 3300048091 Bacteria 4074
1699 Ga0495626_0039402 3300048091 Bacteria 2236
1700 Ga0495626_0106848 3300048091 Bacteria 1215
1701 Ga0495626_0124283 3300048091 Bacteria 1106
1702 Ga0495626_0135362 3300048091 Bacteria 1048
1703 Ga0495626_0214298 3300048091 Bacteria 784
1704 Ga0496100_0018441 3300048903 Bacteria 4138
1705 Ga0496100_0681690 3300048903 Bacteria 801
1706 Ga0496101_0004337 3300048904 Bacteria 8900
1707 Ga0496101_0004746 3300048904 Bacteria 8614
1708 Ga0496101_0008665 3300048904 Bacteria 6650
1709 Ga0496101_0263283 3300048904 Bacteria 1345
1710 Ga0496101_0437938 3300048904 Bacteria 1031
1711 Ga0496101_0874671 3300048904 Bacteria 708
1712 Ga0496102_0002551 3300048905 Bacteria 15536
1713 Ga0496102_0005601 3300048905 Bacteria 10663
1714 Ga0496102_0056636 3300048905 Bacteria 3576
1715 Ga0496102_0282884 3300048905 Bacteria 1563
1716 Ga0496102_0320440 3300048905 Bacteria 1460
1717 Ga0496102_0673529 3300048905 Bacteria 957
1718 Ga0496103_0064862 3300048906 Bacteria 2277
1719 Ga0496103_0366947 3300048906 Bacteria 925
1720 Ga0496104_0026291 3300048907 Bacteria 5372
1721 Ga0496104_0113723 3300048907 Bacteria 2596
1722 Ga0496104_0157594 3300048907 Bacteria 2179
1723 Ga0496104_0295100 3300048907 Bacteria 1534
1724 Ga0496105_0001549 3300048908 Bacteria 16271
1725 Ga0496105_0072087 3300048908 Bacteria 2855
1726 Ga0496105_0299489 3300048908 Bacteria 1293
1727 Ga0496105_0340141 3300048908 Bacteria 1200
1728 Ga0496106_0004648 3300048909 Bacteria 10179
1729 Ga0496106_0035220 3300048909 Bacteria 3743
1730 Ga0496106_0048701 3300048909 Bacteria 3192
1731 Ga0496106_0286110 3300048909 Bacteria 1321
1732 Ga0496107_0108846 3300048910 Bacteria 2035
1733 Ga0496107_0192800 3300048910 Bacteria 1514
1734 Ga0496107_0308775 3300048910 Bacteria 1177
1735 Ga0496107_0376022 3300048910 Bacteria 1057
1736 Ga0496107_0563533 3300048910 Bacteria 843
1737 Ga0496108_0098346 3300048911 Bacteria 2494
1738 Ga0496108_0098745 3300048911 Bacteria 2488
1739 Ga0496108_0269067 3300048911 Bacteria 1483
1740 Ga0496108_0492770 3300048911 Bacteria 1070
1741 Ga0496108_0524248 3300048911 Bacteria 1034
1742 Ga0496109_0020544 3300048912 Bacteria 5833
1743 Ga0496109_0079672 3300048912 Bacteria 3018
1744 Ga0496109_0160368 3300048912 Bacteria 2107
1745 Ga0496109_0292389 3300048912 Bacteria 1536
1746 Ga0496109_0294059 3300048912 Bacteria 1531
1747 Ga0496109_0399599 3300048912 Bacteria 1298
1748 Ga0496109_0498641 3300048912 Bacteria 1149
1749 Ga0496109_0553928 3300048912 Bacteria 1085
1750 Ga0496110_0000333 3300048913 Bacteria 31529
1751 Ga0496110_0131181 3300048913 Bacteria 2263
1752 Ga0496110_0208313 3300048913 Bacteria 1777
1753 Ga0496110_0284278 3300048913 Bacteria 1506
1754 Ga0496110_0370919 3300048913 Bacteria 1304
1755 Ga0496110_0906784 3300048913 Bacteria 787
1756 Ga0496111_0067547 3300048914 Bacteria 2597
1757 Ga0496111_0261400 3300048914 Bacteria 1284
1758 Ga0496111_0336782 3300048914 Bacteria 1117
1759 Ga0496111_0493489 3300048914 Bacteria 901
1760 Ga0496112_0043874 3300048915 Bacteria 4378
1761 Ga0496112_1179291 3300048915 Bacteria 683
1762 Ga0496113_0005508 3300048916 Bacteria 7902
1763 Ga0496113_0067135 3300048916 Bacteria 2718
1764 Ga0496113_0194322 3300048916 Bacteria 1611
1765 Ga0496113_0234448 3300048916 Bacteria 1464
1766 Ga0496114_0011308 3300048917 Bacteria 7128
1767 Ga0496114_0120093 3300048917 Bacteria 2260
1768 Ga0496114_0145078 3300048917 Bacteria 2057
1769 Ga0496114_0231058 3300048917 Bacteria 1625
1770 Ga0496115_0103015 3300048918 Bacteria 2341
1771 Ga0496115_0222164 3300048918 Bacteria 1559
1772 Ga0496116_0076692 3300048919 Bacteria 2092
1773 Ga0496117_0011451 3300048920 Bacteria 7946
1774 Ga0496117_0180607 3300048920 Bacteria 1213
1775 Ga0496117_0257761 3300048920 Bacteria 947
1776 Ga0496118_0005537 3300048921 Bacteria 14327
1777 Ga0496118_0031535 3300048921 Bacteria 4391
1778 Ga0496119_0064272 3300048922 Bacteria 2180
1779 Ga0496121_0040984 3300048924 Bacteria 4054
1780 Ga0496121_0154491 3300048924 Bacteria 1685
1781 Ga0496121_0238982 3300048924 Bacteria 1267
1782 Ga0496122_0000039 3300048925 Bacteria 295352
1783 Ga0496122_0001792 3300048925 Bacteria 32883
1784 Ga0496122_0002554 3300048925 Bacteria 25576
1785 Ga0496122_0011129 3300048925 Bacteria 9165
1786 Ga0496122_0157570 3300048925 Bacteria 1390
1787 Ga0496123_0000026 3300048926 Bacteria 318040
1788 Ga0496123_0005333 3300048926 Bacteria 12995
1789 Ga0496123_0005695 3300048926 Bacteria 12422
1790 Ga0496123_0030613 3300048926 Bacteria 3937
1791 Ga0496123_0048827 3300048926 Bacteria 2843
1792 Ga0496123_0065567 3300048926 Bacteria 2307
1793 Ga0496123_0151389 3300048926 Bacteria 1251
1794 Ga0496123_0302488 3300048926 Bacteria 763
1795 Ga0496124_0000089 3300048927 Bacteria 192423
1796 Ga0496124_0009419 3300048927 Bacteria 10058
1797 Ga0496124_0032375 3300048927 Bacteria 4617
1798 Ga0496124_0078943 3300048927 Bacteria 2711
1799 Ga0496124_0085839 3300048927 Bacteria 2578
1800 Ga0496124_0232720 3300048927 Bacteria 1376
1801 Ga0496124_0542791 3300048927 Bacteria 769
1802 Ga0496125_0001067 3300048928 Bacteria 42367
1803 Ga0496125_0001742 3300048928 Bacteria 30235
1804 Ga0496125_0018536 3300048928 Bacteria 6609
1805 Ga0496125_0045309 3300048928 Bacteria 3704
1806 Ga0496125_0047078 3300048928 Bacteria 3610
1807 Ga0496125_0166030 3300048928 Bacteria 1491
1808 Ga0496125_0214753 3300048928 Bacteria 1245
1809 Ga0496126_0004099 3300048929 Bacteria 17637
1810 Ga0496126_0163475 3300048929 Bacteria 1901
1811 Ga0496126_0918229 3300048929 Bacteria 663
1812 Ga0495678_000146 3300049459 Bacteria 85995
1813 Ga0495678_000561 3300049459 Bacteria 35692
1814 Ga0495678_001260 3300049459 Bacteria 20572
1815 Ga0495678_001614 3300049459 Bacteria 17233
1816 Ga0495678_003153 3300049459 Bacteria 10407
1817 Ga0495678_004600 3300049459 Bacteria 7926
1818 Ga0495678_018611 3300049459 Bacteria 3118
1819 Ga0495678_032453 3300049459 Bacteria 2165
1820 Ga0495682_0000691 3300049460 Bacteria 22121
1821 Ga0495682_0001011 3300049460 Bacteria 16683
1822 Ga0501290_005918 3300049513 Bacteria 1525
1823 Ga0501292_004282 3300049515 Bacteria 1946
1824 Ga0501294_002978 3300049517 Bacteria 1598
1825 Ga0501297_004804 3300049520 Bacteria 1395
1826 Ga0501297_019455 3300049520 Bacteria 840
1827 Ga0501031_0014406 3300049568 Bacteria 5139
1828 Ga0501034_0088700 3300049571 Bacteria 3091
1829 Ga0501034_0119342 3300049571 Bacteria 2624
1830 Ga0501034_0299092 3300049571 Bacteria 1546
1831 Ga0501036_0507191 3300049572 Bacteria 1004
1832 Ga0501043_0000018 3300049579 Bacteria 161101
1833 Ga0501043_0053161 3300049579 Bacteria 3181
1834 Ga0501046_0000042 3300049580 Bacteria 151850
1835 Ga0501046_0558856 3300049580 Bacteria 815
1836 Ga0501047_0000052 3300049581 Bacteria 153448
1837 Ga0501047_0078840 3300049581 Bacteria 3167
1838 Ga0501047_0229132 3300049581 Bacteria 1712
1839 Ga0501048_0000099 3300049582 Bacteria 47309
1840 Ga0501201_002325 3300049651 Bacteria 1740
1841 Ga0501202_013784 3300049652 Bacteria 1541
1842 Ga0501206_001511 3300049653 Bacteria 2898
1843 Ga0501211_000168 3300049658 Bacteria 5311
1844 Ga0501223_008662 3300049663 Bacteria 2071
1845 Ga0501227_012716 3300049665 Bacteria 1846
1846 Ga0501233_006600 3300049668 Bacteria 2184
1847 Ga0501235_016397 3300049669 Bacteria 1636
1848 Ga0501236_004761 3300049670 Bacteria 1619
1849 Ga0501238_017742 3300049671 Bacteria 993
1850 Ga0501249_009117 3300049679 Bacteria 2063
1851 Ga0501252_015913 3300049682 Bacteria 943
1852 Ga0501255_002027 3300049684 Bacteria 1728
1853 Ga0501221_001775 3300049704 Bacteria 3595
1854 Ga0501225_0025106 3300049705 Bacteria 1640
1855 Ga0501080_0060269 3300049742 Bacteria 3532
1856 Ga0501232_001200 3300049757 Bacteria 1999
1857 Ga0501262_000756 3300049759 Bacteria 3732
1858 Ga0501262_027515 3300049759 Bacteria 806
1859 Ga0501263_010287 3300049760 Bacteria 1146
1860 Ga0501265_003381 3300049762 Bacteria 1813
1861 Ga0501271_004040 3300049768 Bacteria 1377
1862 Ga0501281_04937 3300049777 Bacteria 934
1863 Ga0501035_0002697 3300049822 Bacteria 17270
1864 Ga0501035_0133239 3300049822 Bacteria 2165
1865 Ga0501035_0226365 3300049822 Bacteria 1595
1866 Ga0501044_0108609 3300049823 Bacteria 2784
1867 Ga0501045_0001720 3300049824 Bacteria 14745
1868 Ga0501226_003788 3300049853 Bacteria 1776
1869 nmdc:mga03683_128295_c1 3300050489 Bacteria 1133
1870 nmdc:mga03683_128927_c1 3300050489 Bacteria 671
1871 nmdc:mga03683_153433_c1 3300050489 Bacteria 1040
1872 nmdc:mga03683_328425_c1 3300050489 Bacteria 721
1873 nmdc:mga03683_3362_c2 3300050489 Bacteria 4122
1874 nmdc:mga03683_369395_c1 3300050489 Bacteria 681
1875 nmdc:mga03683_88396_c1 3300050489 Bacteria 1348
1876 nmdc:mga03683_9948_c1 3300050489 Bacteria 3399
1877 nmdc:mga03n38_131094_c1 3300050490 Bacteria 1242
1878 nmdc:mga03n38_7700_c1 3300050490 Bacteria 3822
1879 nmdc:mga0yw44_10446_c1 3300050492 Bacteria 4744
1880 nmdc:mga0yw44_569702_c1 3300050492 Bacteria 769
1881 nmdc:mga0k408_12675_c1 3300050493 Bacteria 4611
1882 nmdc:mga0k408_14643_c1 3300050493 Bacteria 4325
1883 nmdc:mga0k408_17774_c1 3300050493 Bacteria 3963
1884 nmdc:mga0k408_214216_c1 3300050493 Bacteria 1150
1885 nmdc:mga0k408_52285_c1 3300050493 Bacteria 2368
1886 nmdc:mga0k408_5694_c1 3300050493 Bacteria 6626
1887 nmdc:mga0k408_68474_c1 3300050493 Bacteria 2070
1888 nmdc:mga0k408_75714_c1 3300050493 Bacteria 1967
1889 nmdc:mga0k408_78015_c1 3300050493 Bacteria 1937
1890 nmdc:mga0k408_84534_c1 3300050493 Bacteria 1862
1891 nmdc:mga06z11_180623_c1 3300050494 Bacteria 1216
1892 nmdc:mga06z11_19486_c1 3300050494 Bacteria 3120
1893 nmdc:mga06z11_20777_c1 3300050494 Bacteria 3040
1894 nmdc:mga06z11_22017_c1 3300050494 Bacteria 2970
1895 nmdc:mga06z11_28782_c1 3300050494 Bacteria 2669
1896 nmdc:mga06z11_358722_c1 3300050494 Bacteria 873
1897 nmdc:mga06z11_44836_c1 3300050494 Bacteria 2232
1898 nmdc:mga04h51_73659_c1 3300050495 Bacteria 1198
1899 nmdc:mga07m45_102410_c1 3300050496 Bacteria 1645
1900 nmdc:mga07m45_11420_c1 3300050496 Bacteria 4666
1901 nmdc:mga07m45_11912_c1 3300050496 Bacteria 4582
1902 nmdc:mga07m45_162843_c1 3300050496 Bacteria 1295
1903 nmdc:mga07m45_1690_c1 3300050496 Bacteria 10148
1904 nmdc:mga07m45_18425_c1 3300050496 Bacteria 3769
1905 nmdc:mga07m45_19497_c1 3300050496 Bacteria 3676
1906 nmdc:mga07m45_200503_c1 3300050496 Bacteria 1161
1907 nmdc:mga07m45_2080_c1 3300050496 Bacteria 9294
1908 nmdc:mga07m45_340494_c1 3300050496 Bacteria 871
1909 nmdc:mga07m45_3462_c2 3300050496 Bacteria 7005
1910 nmdc:mga07m45_4915_c1 3300050496 Bacteria 6586
1911 nmdc:mga07m45_50058_c1 3300050496 Bacteria 2354
1912 nmdc:mga07m45_89179_c1 3300050496 Bacteria 1766
1913 nmdc:mga07m45_9743_c1 3300050496 Bacteria 4994
1914 nmdc:mga09592_33830_c1 3300050508 Bacteria 4270
1915 nmdc:mga09592_450375_c1 3300050508 Bacteria 1110
1916 nmdc:mga0qj67_178080_c1 3300050509 Bacteria 1727
1917 nmdc:mga08y16_704299_c1 3300050511 Bacteria 1009
1918 nmdc:mga0n895_831244_c1 3300050512 Bacteria 912
1919 nmdc:mga0n895_848914_c1 3300050512 Bacteria 901
1920 nmdc:mga0sz30_15826_c1 3300050516 Bacteria 2985
1921 Ga0495601_0016701 3300053077 Bacteria 4450
1922 Ga0495601_0042056 3300053077 Bacteria 2866
1923 Ga0495612_0144915 3300053078 Bacteria 1032
1924 Ga0500610_0000246 3300053079 Bacteria 16255
1925 Ga0500635_0000047 3300053080 Bacteria 84059
1926 Ga0495595_0220299 3300053084 Bacteria 947
1927 Ga0495619_0335778 3300053085 Bacteria 1046
1928 Ga0500578_0299420 3300053086 Bacteria 954
1929 Ga0500578_0419140 3300053086 Bacteria 768
1930 Ga0500643_012813 3300053087 Bacteria 2989
1931 Ga0500644_0002338 3300053088 Bacteria 4766
1932 Ga0500644_0006705 3300053088 Bacteria 2963
1933 Ga0500583_0119580 3300053092 Bacteria 1303
1934 Ga0500651_0000971 3300053093 Bacteria 14108
1935 Ga0500566_0088897 3300053094 Bacteria 1709
1936 Ga0500650_0049339 3300053098 Bacteria 1953
1937 Ga0500562_011064 3300053108 Bacteria 2289
1938 Ga0500571_000098 3300053110 Bacteria 28557
1939 Ga0500593_000722 3300053117 Bacteria 12547
1940 Ga0500594_0001357 3300053118 Bacteria 5310
1941 Ga0500594_0003672 3300053118 Bacteria 3382
1942 Ga0500607_001623 3300053121 Bacteria 19842
1943 Ga0500607_217196 3300053121 Bacteria 801
1944 Ga0500608_013019 3300053122 Bacteria 3673
1945 Ga0500618_027688 3300053125 Bacteria 1347
1946 Ga0500652_056632 3300053131 Bacteria 1608
1947 Ga0500655_003342 3300053133 Bacteria 2904
1948 Ga0500658_0006336 3300053134 Bacteria 4390
1949 Ga0500658_0034984 3300053134 Bacteria 1986
1950 Ga0500559_0000089 3300053136 Bacteria 72681
1951 Ga0500559_0001864 3300053136 Bacteria 11473
1952 Ga0500568_0007961 3300053139 Bacteria 5149
1953 Ga0500568_0015326 3300053139 Bacteria 3433
1954 Ga0500568_0059085 3300053139 Bacteria 1488
1955 Ga0500574_003226 3300053141 Bacteria 2846
1956 Ga0500590_120875 3300053148 Bacteria 1227
1957 Ga0500616_0079242 3300053153 Bacteria 1654
1958 Ga0500622_0009619 3300053156 Bacteria 5341
1959 Ga0500634_0058369 3300053161 Bacteria 2056
1960 Ga0500634_0112775 3300053161 Bacteria 1338
1961 Ga0500636_0025655 3300053177 Bacteria 3484
1962 Ga0500645_000677 3300053730 Bacteria 21292
1963 Ga0500645_001999 3300053730 Bacteria 9581
1964 Ga0500645_006234 3300053730 Bacteria 4280
1965 Ga0500587_002094 3300053739 Bacteria 2850
1966 Ga0466962_0019641 3300061719 Bacteria 3247
1967 Ga0466962_0274896 3300061719 Bacteria 831

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048908 Ga0496105_0340141 Ga0496105_0340141_511_1140 172
2 3300025920 Ga0207649_10190500 Ga0207649_101905002 174
3 3300009094 Ga0111539_10773151 Ga0111539_107731512 175
4 3300041460 Ga0451802_1626350 Ga0451802_1626350_12_539 175
5 3300042123 Ga0450921_003331 Ga0450921_003331_33_560 175
6 3300046472 Ga0495580_0840114 Ga0495580_0840114_55_582 175
7 3300046794 Ga0495589_0426243 Ga0495589_0426243_49_576 175
8 3300053131 Ga0500652_056632 Ga0500652_056632_1069_1596 175
9 3300042146 Ga0450907_056188 Ga0450907_056188_136_666 176
10 3300003773 Ga0055537_1006136 Ga0055537_10061362 177
11 3300003784 Ga0055534_1007425 Ga0055534_10074252 177
12 3300003790 Ga0055528_1013438 Ga0055528_10134382 177
13 3300046501 Ga0495607_0227953 Ga0495607_0227953_23_565 177
14 3300046528 Ga0495642_0010115 Ga0495642_0010115_3039_3581 177
15 3300048905 Ga0496102_0005601 Ga0496102_0005601_317_901 177
16 3300048903 Ga0496100_0681690 Ga0496100_0681690_228_791 183
17 3300048904 Ga0496101_0874671 Ga0496101_0874671_14_580 183
18 3300005340 Ga0070689_100384406 Ga0070689_1003844062 184
19 3300005367 Ga0070667_100005933 Ga0070667_1000059336 184
20 3300005616 Ga0068852_100599363 Ga0068852_1005993632 184
21 3300005834 Ga0068851_10014192 Ga0068851_100141925 184
22 3300005841 Ga0068863_100003643 Ga0068863_1000036437 184
23 3300005842 Ga0068858_100003671 Ga0068858_1000036712 184
24 3300005843 Ga0068860_100317509 Ga0068860_1003175092 184
25 3300025931 Ga0207644_10030568 Ga0207644_100305685 184
26 3300025941 Ga0207711_10124795 Ga0207711_101247952 184
27 3300025942 Ga0207689_10026041 Ga0207689_100260416 184
28 3300025986 Ga0207658_10013870 Ga0207658_100138706 184
29 3300026088 Ga0207641_10005553 Ga0207641_100055536 184
30 3300028381 Ga0268264_10053084 Ga0268264_100530844 184
31 3300048910 Ga0496107_0376022 Ga0496107_0376022_210_794 184
32 3300005333 Ga0070677_10123146 Ga0070677_101231462 185
33 3300005338 Ga0068868_100000616 Ga0068868_10000061614 185
34 3300005343 Ga0070687_100317874 Ga0070687_1003178742 185
35 3300005354 Ga0070675_100004569 Ga0070675_1000045696 185
36 3300005355 Ga0070671_100491890 Ga0070671_1004918902 185
37 3300005364 Ga0070673_100004248 Ga0070673_1000042483 185
38 3300005456 Ga0070678_100005645 Ga0070678_1000056455 185
39 3300005544 Ga0070686_100569158 Ga0070686_1005691582 185
40 3300005617 Ga0068859_100001692 Ga0068859_1000016922 185
41 3300005840 Ga0068870_10091494 Ga0068870_100914942 185
42 3300006931 Ga0097620_100001692 Ga0097620_10000169219 185
43 3300014745 Ga0157377_10368874 Ga0157377_103688742 185
44 3300017792 Ga0163161_10327964 Ga0163161_103279642 185
45 3300025908 Ga0207643_10097785 Ga0207643_100977852 185
46 3300025918 Ga0207662_10324195 Ga0207662_103241952 185
47 3300025926 Ga0207659_10001212 Ga0207659_100012128 185
48 3300025933 Ga0207706_10341407 Ga0207706_103414072 185
49 3300025960 Ga0207651_10003694 Ga0207651_100036946 185
50 3300026023 Ga0207677_10001669 Ga0207677_100016698 185
51 3300026095 Ga0207676_10001594 Ga0207676_1000159412 185
52 3300026121 Ga0207683_10032973 Ga0207683_100329735 185
53 3300035089 Ga0373944_0081619 Ga0373944_0081619_350_934 185
54 3300037068 Ga0373925_0063218 Ga0373925_0063218_2138_2722 185
55 3300048904 Ga0496101_0437938 Ga0496101_0437938_293_877 185
56 3300048908 Ga0496105_0072087 Ga0496105_0072087_1034_1618 185
57 3300048911 Ga0496108_0098745 Ga0496108_0098745_936_1520 185
58 3300048912 Ga0496109_0079672 Ga0496109_0079672_582_1166 185
59 3300028794 Ga0307515_10004066 Ga0307515_1000406624 186
60 3300031730 Ga0307516_10001952 Ga0307516_100019527 186
61 3300035725 Ga0373947_0765966 Ga0373947_0765966_23_610 186
62 3300005615 Ga0070702_100060330 Ga0070702_1000603302 187
63 iso_pu_bacteria 2643221544 2643741768 187
64 iso_pu_bacteria 2643221585 2643935041 187
65 iso_pu_bacteria 2643221639 2644220334 187
66 iso_pu_bacteria 2643221646 2644259259 187
67 iso_pu_bacteria 2643221656 2644316528 187
68 iso_pu_bacteria 2738541337 2739053525 187
69 3300005355 Ga0070671_100028965 Ga0070671_1000289652 188
70 3300005840 Ga0068870_10010186 Ga0068870_100101864 188
71 3300014968 Ga0157379_10267905 Ga0157379_102679052 188
72 3300025908 Ga0207643_10035180 Ga0207643_100351802 188
73 3300025923 Ga0207681_10070866 Ga0207681_100708663 188
74 3300025945 Ga0207679_10083564 Ga0207679_100835642 188
75 3300026089 Ga0207648_10005574 Ga0207648_100055742 188
76 3300031731 Ga0307405_10004869 Ga0307405_100048695 188
77 3300031901 Ga0307406_10072633 Ga0307406_100726332 188
78 3300031995 Ga0307409_100090562 Ga0307409_1000905622 188
79 3300032005 Ga0307411_10006757 Ga0307411_100067572 188
80 3300037418 Ga0395900_0644114 Ga0395900_0644114_214_780 188
81 3300037471 Ga0395905_0090171 Ga0395905_0090171_1894_2460 188
82 3300037471 Ga0395905_0101806 Ga0395905_0101806_385_951 188
83 3300038443 Ga0395901_0458249 Ga0395901_0458249_725_1291 188
84 3300044712 Ga0453684_0033902 Ga0453684_0033902_3696_4262 188
85 3300044712 Ga0453684_1937000 Ga0453684_1937000_12_578 188
86 3300046512 Ga0495610_0041810 Ga0495610_0041810_1193_1759 188
87 3300046524 Ga0495648_0231626 Ga0495648_0231626_270_836 188
88 3300046528 Ga0495642_0334279 Ga0495642_0334279_24_590 188
89 3300046660 Ga0495625_0241160 Ga0495625_0241160_304_870 188
90 3300047447 Ga0495685_040565 Ga0495685_040565_617_1183 188
91 3300047472 Ga0495686_0040778 Ga0495686_0040778_582_1148 188
92 3300049520 Ga0501297_019455 Ga0501297_019455_258_824 188
93 3300053088 Ga0500644_0002338 Ga0500644_0002338_2850_3416 188
94 3300053118 Ga0500594_0001357 Ga0500594_0001357_3395_3961 188
95 3300053136 Ga0500559_0000089 Ga0500559_0000089_69278_69844 188
96 3300053139 Ga0500568_0059085 Ga0500568_0059085_134_700 188
97 3300053156 Ga0500622_0009619 Ga0500622_0009619_1987_2553 188
98 3300053739 Ga0500587_002094 Ga0500587_002094_935_1501 188
99 3300014325 Ga0163163_11235039 Ga0163163_112350392 189
100 3300025893 Ga0207682_10040172 Ga0207682_100401722 189
101 3300026121 Ga0207683_10180633 Ga0207683_101806332 189
102 3300030522 Ga0307512_10212678 Ga0307512_102126781 189
103 3300031456 Ga0307513_10029877 Ga0307513_100298776 189
104 3300042012 Ga0439455_0047787 Ga0439455_0047787_471_1058 189
105 3300048927 Ga0496124_0000089 Ga0496124_0000089_141924_142508 189
106 3300048928 Ga0496125_0047078 Ga0496125_0047078_2263_2847 189
107 iso_pu_bacteria 2919704043 2919708340 189
108 iso_pu_bacteria 2928115317 2928120035 189
109 iso_pu_bacteria 2939631187 2939633466 189
110 3300005331 Ga0070670_100381049 Ga0070670_1003810492 190
111 3300005333 Ga0070677_10029186 Ga0070677_100291862 190
112 3300005354 Ga0070675_100669998 Ga0070675_1006699982 190
113 3300005356 Ga0070674_100173811 Ga0070674_1001738112 190
114 3300005364 Ga0070673_100568226 Ga0070673_1005682262 190
115 3300005616 Ga0068852_100113515 Ga0068852_1001135152 190
116 3300006178 Ga0075367_10040277 Ga0075367_100402772 190
117 3300025901 Ga0207688_10168944 Ga0207688_101689442 190
118 3300025925 Ga0207650_10412593 Ga0207650_104125932 190
119 3300025937 Ga0207669_10157142 Ga0207669_101571422 190
120 3300031616 Ga0307508_10232672 Ga0307508_102326722 190
121 3300031995 Ga0307409_100137667 Ga0307409_1001376672 190
122 3300032005 Ga0307411_10002448 Ga0307411_100024488 190
123 3300049665 Ga0501227_012716 Ga0501227_012716_1014_1586 190
124 3300050489 nmdc:mga03683_328425_c1 nmdc:mga03683_328425_c1_48_626 190
125 3300050489 nmdc:mga03683_88396_c1 nmdc:mga03683_88396_c1_331_909 190
126 3300050490 nmdc:mga03n38_131094_c1 nmdc:mga03n38_131094_c1_470_1048 190
127 3300050493 nmdc:mga0k408_84534_c1 nmdc:mga0k408_84534_c1_901_1479 190
128 3300053086 Ga0500578_0299420 Ga0500578_0299420_124_720 190
129 3300053133 Ga0500655_003342 Ga0500655_003342_1987_2559 190
130 3300053139 Ga0500568_0007961 Ga0500568_0007961_2048_2644 190
131 iso_pu_bacteria 2547132374 2548500607 190
132 iso_pu_bacteria 2585428062 2587757169 190
133 iso_pu_bacteria 2643221570 2643864392 190
134 iso_pu_bacteria 2643221596 2643991984 190
135 iso_pu_bacteria 2643221609 2644058116 190
136 iso_pu_bacteria 2643221611 2644073152 190
137 iso_pu_bacteria 2643221644 2644246647 190
138 iso_pu_bacteria 2643221652 2644291905 190
139 iso_pu_bacteria 2643221654 2644303748 190
140 iso_pu_bacteria 2643221717 2644646843 190
141 iso_pu_bacteria 2721755523 2722886571 190
142 iso_pu_bacteria 2738543012 2739242405 190
143 iso_pu_bacteria 2816332133 2816469978 190
144 iso_pu_bacteria 2839138175 2839144487 190
145 iso_pu_bacteria 2842718218 2842720707 190
146 iso_pu_bacteria 2842733646 2842737155 190
147 iso_pu_bacteria 2842747753 2842750402 190
148 iso_pu_bacteria 2881101125 2881104458 190
149 iso_pu_bacteria 2886848708 2886849439 190
150 iso_pu_bacteria 2894023352 2894027658 190
151 iso_pu_bacteria 2932422444 2932422635 190
152 iso_pu_bacteria 2974320154 2974321512 190
153 iso_pu_bacteria 2990710928 2990714994 190
154 3300003316 rootH1_10030074 rootH1_1003007410 191
155 3300003322 rootL2_10024133 rootL2_1002413310 191
156 3300003791 Ga0055530_10038339 Ga0055530_100383392 191
157 3300003794 Ga0055531_10000247 Ga0055531_1000024710 191
158 3300005337 Ga0070682_100057926 Ga0070682_1000579262 191
159 3300006195 Ga0075366_10150364 Ga0075366_101503642 191
160 3300021361 Ga0213872_10000208 Ga0213872_1000020824 191
161 3300025298 Ga0209050_1006623 Ga0209050_10066234 191
162 3300025304 Ga0209257_1000016 Ga0209257_1000016428 191
163 3300025304 Ga0209257_1016703 Ga0209257_10167033 191
164 3300028794 Ga0307515_10055750 Ga0307515_100557503 191
165 3300028794 Ga0307515_10225703 Ga0307515_102257031 191
166 3300031548 Ga0307408_100000006 Ga0307408_100000006244 191
167 3300035088 Ga0373940_0006122 Ga0373940_0006122_1555_2130 191
168 3300035114 Ga0373939_0000034 Ga0373939_0000034_27869_28444 191
169 3300037471 Ga0395905_0000951 Ga0395905_0000951_25162_25737 191
170 3300039447 Ga0436361_0034087 Ga0436361_0034087_1252_1827 191
171 3300039447 Ga0436361_0052534 Ga0436361_0052534_6861_7436 191
172 3300042129 Ga0450891_000197 Ga0450891_000197_5232_5807 191
173 3300042130 Ga0450892_000380 Ga0450892_000380_643_1218 191
174 3300042138 Ga0450903_014401 Ga0450903_014401_551_1126 191
175 3300042144 Ga0450889_000119 Ga0450889_000119_1691_2266 191
176 3300042532 Ga0450893_0003766 Ga0450893_0003766_841_1416 191
177 3300044712 Ga0453684_0060705 Ga0453684_0060705_665_1240 191
178 3300045051 Ga0451576_0034263 Ga0451576_0034263_4583_5158 191
179 3300049513 Ga0501290_005918 Ga0501290_005918_158_733 191
180 3300049520 Ga0501297_004804 Ga0501297_004804_361_936 191
181 3300049651 Ga0501201_002325 Ga0501201_002325_616_1191 191
182 3300049652 Ga0501202_013784 Ga0501202_013784_863_1438 191
183 3300049653 Ga0501206_001511 Ga0501206_001511_1323_1898 191
184 3300049658 Ga0501211_000168 Ga0501211_000168_777_1352 191
185 3300049663 Ga0501223_008662 Ga0501223_008662_715_1290 191
186 3300049668 Ga0501233_006600 Ga0501233_006600_862_1437 191
187 3300049669 Ga0501235_016397 Ga0501235_016397_294_869 191
188 3300049670 Ga0501236_004761 Ga0501236_004761_675_1250 191
189 3300049684 Ga0501255_002027 Ga0501255_002027_386_961 191
190 3300049704 Ga0501221_001775 Ga0501221_001775_2095_2670 191
191 3300049705 Ga0501225_0025106 Ga0501225_0025106_813_1388 191
192 3300049757 Ga0501232_001200 Ga0501232_001200_429_1004 191
193 3300049768 Ga0501271_004040 Ga0501271_004040_226_801 191
194 3300049853 Ga0501226_003788 Ga0501226_003788_776_1351 191
195 3300050496 nmdc:mga07m45_1690_c1 nmdc:mga07m45_1690_c1_284_859 191
196 iso_pu_bacteria 2643221628 2644163547 191
197 iso_pu_bacteria 2643221683 2644465739 191
198 iso_pu_bacteria 2842677519 2842682874 191
199 iso_pu_bacteria 2885192300 2885193597 191
200 iso_pu_bacteria 2904449895 2904451317 191
201 iso_pu_bacteria 2904456579 2904458179 191
202 iso_pu_bacteria 2904541872 2904542959 191
203 iso_pu_bacteria 2919462493 2919466697 191
204 iso_pu_bacteria 2929160207 2929166375 191
205 iso_pu_bacteria 2929520902 2929526206 191
206 iso_pu_bacteria 2945909444 2945915214 191
207 iso_pu_bacteria 2945945610 2945950777 191
208 iso_pu_bacteria 2945972063 2945974611 191
209 iso_pu_bacteria 2945984333 2945989372 191
210 iso_pu_bacteria 2954767861 2954769818 191
211 3300002705 JGI25156J39149_1000067 JGI25156J39149_100006735 192
212 3300002738 JGI25154J39366_1000089 JGI25154J39366_100008945 192
213 3300002741 JGI25157J39369_1000084 JGI25157J39369_100008435 192
214 3300003187 JGI25151J46595_10002529 JGI25151J46595_100025297 192
215 3300003187 JGI25151J46595_10022822 JGI25151J46595_100228222 192
216 3300003187 JGI25151J46595_10025763 JGI25151J46595_100257632 192
217 3300003354 JGI25160J50197_1000076 JGI25160J50197_100007661 192
218 3300003354 JGI25160J50197_1035667 JGI25160J50197_10356672 192
219 3300003374 JGI25161J50226_1000058 JGI25161J50226_100005832 192
220 3300003771 Ga0055526_1002268 Ga0055526_10022683 192
221 3300003771 Ga0055526_1015571 Ga0055526_10155712 192
222 3300003773 Ga0055537_1000207 Ga0055537_100020728 192
223 3300003773 Ga0055537_1007083 Ga0055537_10070832 192
224 3300003775 Ga0055524_1000303 Ga0055524_100030322 192
225 3300003781 Ga0055536_1063120 Ga0055536_10631201 192
226 3300003781 Ga0055536_1063162 Ga0055536_10631621 192
227 3300003784 Ga0055534_1001307 Ga0055534_10013078 192
228 3300003790 Ga0055528_1001078 Ga0055528_10010786 192
229 3300003791 Ga0055530_10000449 Ga0055530_1000044922 192
230 3300003791 Ga0055530_10039544 Ga0055530_100395441 192
231 3300003792 Ga0055540_1000088 Ga0055540_100008866 192
232 3300003794 Ga0055531_10002205 Ga0055531_100022054 192
233 3300003794 Ga0055531_10079471 Ga0055531_100794711 192
234 3300004625 Ga0055543_1000357 Ga0055543_100035722 192
235 3300005262 Ga0065165_1008728 Ga0065165_10087284 192
236 3300005262 Ga0065165_1033112 Ga0065165_10331122 192
237 3300005578 Ga0068854_100244131 Ga0068854_1002441312 192
238 3300006038 Ga0075365_10076249 Ga0075365_100762492 192
239 3300006048 Ga0075363_100034213 Ga0075363_1000342132 192
240 3300006051 Ga0075364_10061844 Ga0075364_100618442 192
241 3300006058 Ga0075432_10009757 Ga0075432_100097572 192
242 3300006177 Ga0075362_10005777 Ga0075362_100057772 192
243 3300006195 Ga0075366_10036393 Ga0075366_100363932 192
244 3300006353 Ga0075370_10040940 Ga0075370_100409402 192
245 3300012513 Ga0157326_1002527 Ga0157326_10025272 192
246 3300025206 Ga0209435_100008 Ga0209435_100008173 192
247 3300025208 Ga0209436_105208 Ga0209436_1052082 192
248 3300025245 Ga0207425_1020924 Ga0207425_10209242 192
249 3300025246 Ga0209646_1000029 Ga0209646_1000029106 192
250 3300025250 Ga0209026_1000016 Ga0209026_1000016106 192
251 3300025256 Ga0209759_1000016 Ga0209759_1000016106 192
252 3300025258 Ga0209129_1015665 Ga0209129_10156652 192
253 3300025263 Ga0209565_1000061 Ga0209565_100006128 192
254 3300025263 Ga0209565_1000728 Ga0209565_100072811 192
255 3300025273 Ga0209673_1000492 Ga0209673_100049221 192
256 3300025284 Ga0209130_1000014 Ga0209130_1000014258 192
257 3300025284 Ga0209130_1000411 Ga0209130_100041128 192
258 3300025291 Ga0209675_1000899 Ga0209675_10008994 192
259 3300025291 Ga0209675_1001168 Ga0209675_10011688 192
260 3300025291 Ga0209675_1030176 Ga0209675_10301762 192
261 3300025292 Ga0209676_1000013 Ga0209676_1000013491 192
262 3300025292 Ga0209676_1000153 Ga0209676_100015361 192
263 3300025294 Ga0209025_1012506 Ga0209025_10125064 192
264 3300025294 Ga0209025_1015779 Ga0209025_10157792 192
265 3300025294 Ga0209025_1016664 Ga0209025_10166642 192
266 3300025294 Ga0209025_1035930 Ga0209025_10359302 192
267 3300025294 Ga0209025_1043759 Ga0209025_10437592 192
268 3300025294 Ga0209025_1103288 Ga0209025_11032882 192
269 3300025295 Ga0209564_1001101 Ga0209564_100110111 192
270 3300025295 Ga0209564_1001248 Ga0209564_10012487 192
271 3300025295 Ga0209564_1007859 Ga0209564_10078594 192
272 3300025297 Ga0209758_1004145 Ga0209758_10041454 192
273 3300025298 Ga0209050_1000008 Ga0209050_1000008491 192
274 3300025298 Ga0209050_1001545 Ga0209050_100154517 192
275 3300025298 Ga0209050_1025087 Ga0209050_10250872 192
276 3300025298 Ga0209050_1071374 Ga0209050_10713741 192
277 3300025299 Ga0209256_1000039 Ga0209256_100003991 192
278 3300025299 Ga0209256_1015015 Ga0209256_10150152 192
279 3300025302 Ga0207426_1000174 Ga0207426_1000174133 192
280 3300025302 Ga0207426_1001530 Ga0207426_100153015 192
281 3300025303 Ga0209051_1000005 Ga0209051_1000005491 192
282 3300025304 Ga0209257_1000031 Ga0209257_100003181 192
283 3300025304 Ga0209257_1011950 Ga0209257_10119503 192
284 3300025981 Ga0207640_10205022 Ga0207640_102050222 192
285 3300027907 Ga0207428_10083891 Ga0207428_100838913 192
286 3300031456 Ga0307513_10000025 Ga0307513_10000025195 192
287 3300031456 Ga0307513_10000037 Ga0307513_10000037146 192
288 3300031548 Ga0307408_100020891 Ga0307408_1000208914 192
289 3300031730 Ga0307516_10012344 Ga0307516_100123444 192
290 3300031901 Ga0307406_10018283 Ga0307406_100182833 192
291 3300041507 Ga0451851_1002806 Ga0451851_1002806_714_1325 192
292 3300050489 nmdc:mga03683_128927_c1 nmdc:mga03683_128927_c1_35_643 192
293 3300050489 nmdc:mga03683_3362_c2 nmdc:mga03683_3362_c2_240_848 192
294 3300050494 nmdc:mga06z11_358722_c1 nmdc:mga06z11_358722_c1_61_669 192
295 3300050496 nmdc:mga07m45_162843_c1 nmdc:mga07m45_162843_c1_40_648 192
296 3300053088 Ga0500644_0006705 Ga0500644_0006705_2309_2917 192
297 3300053094 Ga0500566_0088897 Ga0500566_0088897_1052_1660 192
298 3300053098 Ga0500650_0049339 Ga0500650_0049339_566_1177 192
299 3300053117 Ga0500593_000722 Ga0500593_000722_8983_9594 192
300 3300053730 Ga0500645_000677 Ga0500645_000677_12163_12771 192
301 3300053730 Ga0500645_001999 Ga0500645_001999_492_1100 192
302 iso_pu_bacteria 2511231002 2511242647 192
303 iso_pu_bacteria 2513020051 2513229890 192
304 iso_pu_bacteria 2599185214 2599621543 192
305 iso_pu_bacteria 2599185226 2599670773 192
306 iso_pu_bacteria 2599185227 2599679263 192
307 iso_pu_bacteria 2599185229 2599691054 192
308 iso_pu_bacteria 2643221658 2644327241 192
309 iso_pu_bacteria 2643221672 2644399598 192
310 iso_pu_bacteria 2738541277 2738721660 192
311 iso_pu_bacteria 2738541307 2738883536 192
312 iso_pu_bacteria 2738543013 2739247649 192
313 iso_pu_bacteria 2738543019 2739282024 192
314 iso_pu_bacteria 2818991446 2819597718 192
315 iso_pu_bacteria 2831265667 2831268718 192
316 iso_pu_bacteria 2838054893 2838058148 192
317 iso_pu_bacteria 2885198086 2885204114 192
318 iso_pu_bacteria 2885211737 2885217552 192
319 iso_pu_bacteria 2899924645 2899929138 192
320 iso_pu_bacteria 2904479285 2904481472 192
321 iso_pu_bacteria 2928037797 2928040427 192
322 iso_pu_bacteria 2928044640 2928046824 192
323 iso_pu_bacteria 2928051484 2928057988 192
324 iso_pu_bacteria 2928064002 2928067672 192
325 iso_pu_bacteria 2928070936 2928072205 192
326 iso_pu_bacteria 2928084124 2928085412 192
327 3300005456 Ga0070678_100727871 Ga0070678_1007278711 193
328 3300006195 Ga0075366_10609299 Ga0075366_106092991 193
329 3300009174 Ga0105241_10194178 Ga0105241_101941782 193
330 3300009545 Ga0105237_10001628 Ga0105237_100016285 193
331 3300009551 Ga0105238_10017351 Ga0105238_100173515 193
332 3300010375 Ga0105239_10001684 Ga0105239_100016845 193
333 3300014325 Ga0163163_10669300 Ga0163163_106693002 193
334 3300025914 Ga0207671_10002945 Ga0207671_1000294511 193
335 3300026121 Ga0207683_10670704 Ga0207683_106707042 193
336 3300027614 Ga0209970_1000191 Ga0209970_10001914 193
337 3300031251 Ga0265327_10089452 Ga0265327_100894522 193
338 3300031649 Ga0307514_10001154 Ga0307514_100011548 193
339 3300032005 Ga0307411_10615071 Ga0307411_106150712 193
340 3300042015 Ga0439462_0132521 Ga0439462_0132521_20_601 193
341 3300042876 Ga0451577_0000093 Ga0451577_0000093_17763_18344 193
342 3300042876 Ga0451577_0219434 Ga0451577_0219434_922_1503 193
343 3300042876 Ga0451577_1259235 Ga0451577_1259235_53_634 193
344 3300044712 Ga0453684_0000218 Ga0453684_0000218_12421_13002 193
345 3300044712 Ga0453684_0034217 Ga0453684_0034217_6033_6614 193
346 3300045051 Ga0451576_0002854 Ga0451576_0002854_11894_12475 193
347 3300045051 Ga0451576_0004915 Ga0451576_0004915_5358_5939 193
348 3300045051 Ga0451576_0005858 Ga0451576_0005858_3635_4219 193
349 3300002773 JGI25152J39213_1003882 JGI25152J39213_10038825 194
350 3300002774 JGI25150J39212_1004058 JGI25150J39212_10040582 194
351 3300003215 JGI25153J46596_10001945 JGI25153J46596_100019454 194
352 3300003316 rootH1_10003069 rootH1_1000306910 194
353 3300003322 rootL2_10003559 rootL2_1000355912 194
354 3300003323 rootH1_10022699 rootH1_100226992 194
355 3300003759 Ga0055525_1000056 Ga0055525_100005664 194
356 3300003771 Ga0055526_1002792 Ga0055526_100279212 194
357 3300003775 Ga0055524_1003264 Ga0055524_10032642 194
358 3300003791 Ga0055530_10006738 Ga0055530_100067383 194
359 3300003792 Ga0055540_1000184 Ga0055540_100018412 194
360 3300003794 Ga0055531_10000655 Ga0055531_1000065517 194
361 3300003794 Ga0055531_10001983 Ga0055531_100019836 194
362 3300003794 Ga0055531_10004665 Ga0055531_100046659 194
363 3300005289 Ga0065704_10117484 Ga0065704_101174843 194
364 3300005289 Ga0065704_10250685 Ga0065704_102506851 194
365 3300005327 Ga0070658_10017404 Ga0070658_100174043 194
366 3300005327 Ga0070658_10737148 Ga0070658_107371481 194
367 3300005328 Ga0070676_10004649 Ga0070676_100046493 194
368 3300005328 Ga0070676_10020755 Ga0070676_100207554 194
369 3300005328 Ga0070676_10204940 Ga0070676_102049401 194
370 3300005331 Ga0070670_100055087 Ga0070670_1000550872 194
371 3300005331 Ga0070670_100413555 Ga0070670_1004135552 194
372 3300005331 Ga0070670_100497118 Ga0070670_1004971181 194
373 3300005333 Ga0070677_10007390 Ga0070677_100073903 194
374 3300005333 Ga0070677_10062900 Ga0070677_100629002 194
375 3300005333 Ga0070677_10205096 Ga0070677_102050961 194
376 3300005334 Ga0068869_100084533 Ga0068869_1000845333 194
377 3300005334 Ga0068869_100108321 Ga0068869_1001083213 194
378 3300005334 Ga0068869_100173784 Ga0068869_1001737842 194
379 3300005334 Ga0068869_100248234 Ga0068869_1002482342 194
380 3300005335 Ga0070666_10125089 Ga0070666_101250892 194
381 3300005335 Ga0070666_10165307 Ga0070666_101653072 194
382 3300005336 Ga0070680_100224004 Ga0070680_1002240042 194
383 3300005338 Ga0068868_100016135 Ga0068868_1000161354 194
384 3300005338 Ga0068868_100228149 Ga0068868_1002281492 194
385 3300005338 Ga0068868_100407985 Ga0068868_1004079852 194
386 3300005339 Ga0070660_100027055 Ga0070660_1000270552 194
387 3300005339 Ga0070660_100037859 Ga0070660_1000378592 194
388 3300005340 Ga0070689_100218227 Ga0070689_1002182272 194
389 3300005340 Ga0070689_100758545 Ga0070689_1007585451 194
390 3300005344 Ga0070661_100001667 Ga0070661_1000016672 194
391 3300005347 Ga0070668_100050036 Ga0070668_1000500363 194
392 3300005353 Ga0070669_100005123 Ga0070669_1000051232 194
393 3300005353 Ga0070669_100013968 Ga0070669_1000139686 194
394 3300005353 Ga0070669_100041628 Ga0070669_1000416282 194
395 3300005353 Ga0070669_100058457 Ga0070669_1000584573 194
396 3300005354 Ga0070675_100017372 Ga0070675_1000173725 194
397 3300005354 Ga0070675_100018260 Ga0070675_1000182602 194
398 3300005354 Ga0070675_100059298 Ga0070675_1000592983 194
399 3300005354 Ga0070675_100933550 Ga0070675_1009335501 194
400 3300005355 Ga0070671_100040378 Ga0070671_1000403784 194
401 3300005355 Ga0070671_100073412 Ga0070671_1000734123 194
402 3300005355 Ga0070671_100089187 Ga0070671_1000891873 194
403 3300005355 Ga0070671_100466092 Ga0070671_1004660922 194
404 3300005356 Ga0070674_100062269 Ga0070674_1000622692 194
405 3300005356 Ga0070674_100082308 Ga0070674_1000823082 194
406 3300005364 Ga0070673_100003566 Ga0070673_1000035668 194
407 3300005364 Ga0070673_100007794 Ga0070673_1000077946 194
408 3300005364 Ga0070673_100448193 Ga0070673_1004481932 194
409 3300005366 Ga0070659_100081493 Ga0070659_1000814932 194
410 3300005366 Ga0070659_100521141 Ga0070659_1005211412 194
411 3300005366 Ga0070659_100597763 Ga0070659_1005977632 194
412 3300005367 Ga0070667_100002201 Ga0070667_10000220114 194
413 3300005367 Ga0070667_100093539 Ga0070667_1000935392 194
414 3300005367 Ga0070667_100177291 Ga0070667_1001772911 194
415 3300005367 Ga0070667_100352368 Ga0070667_1003523682 194
416 3300005367 Ga0070667_100902176 Ga0070667_1009021762 194
417 3300005438 Ga0070701_10201858 Ga0070701_102018582 194
418 3300005441 Ga0070700_100260934 Ga0070700_1002609342 194
419 3300005455 Ga0070663_100101009 Ga0070663_1001010092 194
420 3300005456 Ga0070678_100020363 Ga0070678_1000203635 194
421 3300005456 Ga0070678_100032614 Ga0070678_1000326143 194
422 3300005456 Ga0070678_100063711 Ga0070678_1000637112 194
423 3300005456 Ga0070678_100124431 Ga0070678_1001244312 194
424 3300005456 Ga0070678_100342040 Ga0070678_1003420402 194
425 3300005457 Ga0070662_100379951 Ga0070662_1003799512 194
426 3300005458 Ga0070681_10073982 Ga0070681_100739823 194
427 3300005459 Ga0068867_100001227 Ga0068867_1000012277 194
428 3300005459 Ga0068867_100010749 Ga0068867_1000107496 194
429 3300005459 Ga0068867_100125108 Ga0068867_1001251082 194
430 3300005459 Ga0068867_100374330 Ga0068867_1003743301 194
431 3300005466 Ga0070685_10490120 Ga0070685_104901202 194
432 3300005466 Ga0070685_10785453 Ga0070685_107854531 194
433 3300005530 Ga0070679_100063572 Ga0070679_1000635723 194
434 3300005530 Ga0070679_100581050 Ga0070679_1005810502 194
435 3300005535 Ga0070684_100040168 Ga0070684_1000401683 194
436 3300005539 Ga0068853_100016970 Ga0068853_1000169704 194
437 3300005539 Ga0068853_100196568 Ga0068853_1001965682 194
438 3300005539 Ga0068853_100672180 Ga0068853_1006721801 194
439 3300005543 Ga0070672_100011180 Ga0070672_1000111806 194
440 3300005543 Ga0070672_100042466 Ga0070672_1000424662 194
441 3300005543 Ga0070672_100236843 Ga0070672_1002368432 194
442 3300005543 Ga0070672_100327714 Ga0070672_1003277142 194
443 3300005543 Ga0070672_100947428 Ga0070672_1009474282 194
444 3300005547 Ga0070693_100079293 Ga0070693_1000792933 194
445 3300005548 Ga0070665_100012813 Ga0070665_1000128137 194
446 3300005563 Ga0068855_100064371 Ga0068855_1000643714 194
447 3300005564 Ga0070664_100391727 Ga0070664_1003917272 194
448 3300005577 Ga0068857_100037710 Ga0068857_1000377102 194
449 3300005578 Ga0068854_100003884 Ga0068854_1000038842 194
450 3300005578 Ga0068854_100039283 Ga0068854_1000392832 194
451 3300005616 Ga0068852_100175945 Ga0068852_1001759452 194
452 3300005617 Ga0068859_100044631 Ga0068859_1000446314 194
453 3300005617 Ga0068859_100940551 Ga0068859_1009405512 194
454 3300005618 Ga0068864_100024067 Ga0068864_1000240673 194
455 3300005618 Ga0068864_100107030 Ga0068864_1001070302 194
456 3300005618 Ga0068864_100726339 Ga0068864_1007263392 194
457 3300005719 Ga0068861_100005683 Ga0068861_1000056836 194
458 3300005719 Ga0068861_100087666 Ga0068861_1000876662 194
459 3300005834 Ga0068851_10014208 Ga0068851_100142082 194
460 3300005841 Ga0068863_100063085 Ga0068863_1000630854 194
461 3300005841 Ga0068863_100075714 Ga0068863_1000757142 194
462 3300005841 Ga0068863_100106875 Ga0068863_1001068752 194
463 3300005841 Ga0068863_100127664 Ga0068863_1001276643 194
464 3300005841 Ga0068863_100751688 Ga0068863_1007516882 194
465 3300005841 Ga0068863_101026908 Ga0068863_1010269081 194
466 3300005842 Ga0068858_100012513 Ga0068858_1000125133 194
467 3300005843 Ga0068860_100044615 Ga0068860_1000446154 194
468 3300005843 Ga0068860_100188444 Ga0068860_1001884442 194
469 3300005843 Ga0068860_100382546 Ga0068860_1003825462 194
470 3300005843 Ga0068860_101234493 Ga0068860_1012344931 194
471 3300005844 Ga0068862_100516914 Ga0068862_1005169142 194
472 3300005844 Ga0068862_100743491 Ga0068862_1007434911 194
473 3300006042 Ga0075368_10076126 Ga0075368_100761262 194
474 3300006048 Ga0075363_100014811 Ga0075363_1000148114 194
475 3300006048 Ga0075363_100405870 Ga0075363_1004058702 194
476 3300006051 Ga0075364_10008537 Ga0075364_100085374 194
477 3300006177 Ga0075362_10106386 Ga0075362_101063862 194
478 3300006178 Ga0075367_10286653 Ga0075367_102866531 194
479 3300006195 Ga0075366_10003407 Ga0075366_100034077 194
480 3300006195 Ga0075366_10005910 Ga0075366_100059104 194
481 3300006195 Ga0075366_10124751 Ga0075366_101247512 194
482 3300006237 Ga0097621_100260330 Ga0097621_1002603302 194
483 3300006237 Ga0097621_100438070 Ga0097621_1004380702 194
484 3300006353 Ga0075370_10000225 Ga0075370_100002259 194
485 3300006353 Ga0075370_10004422 Ga0075370_100044226 194
486 3300006353 Ga0075370_10535714 Ga0075370_105357141 194
487 3300006358 Ga0068871_100063713 Ga0068871_1000637134 194
488 3300006358 Ga0068871_100152029 Ga0068871_1001520292 194
489 3300006871 Ga0075434_100704901 Ga0075434_1007049012 194
490 3300006880 Ga0075429_100156324 Ga0075429_1001563242 194
491 3300006881 Ga0068865_100032733 Ga0068865_1000327332 194
492 3300006881 Ga0068865_100259560 Ga0068865_1002595602 194
493 3300006931 Ga0097620_100044631 Ga0097620_1000446314 194
494 3300006931 Ga0097620_100940517 Ga0097620_1009405172 194
495 3300006946 Ga0079104_1000008 Ga0079104_100000852 194
496 3300006946 Ga0079104_1000009 Ga0079104_1000009293 194
497 3300009092 Ga0105250_10000385 Ga0105250_1000038519 194
498 3300009093 Ga0105240_10015890 Ga0105240_1001589010 194
499 3300009094 Ga0111539_10456527 Ga0111539_104565272 194
500 3300009098 Ga0105245_10122798 Ga0105245_101227981 194
501 3300009098 Ga0105245_10383289 Ga0105245_103832892 194
502 3300009148 Ga0105243_10001352 Ga0105243_1000135212 194
503 3300009148 Ga0105243_10144378 Ga0105243_101443782 194
504 3300009148 Ga0105243_10201928 Ga0105243_102019282 194
505 3300009176 Ga0105242_10002509 Ga0105242_1000250910 194
506 3300009177 Ga0105248_10004153 Ga0105248_100041539 194
507 3300009177 Ga0105248_10010401 Ga0105248_100104013 194
508 3300009177 Ga0105248_10193974 Ga0105248_101939741 194
509 3300009177 Ga0105248_10197360 Ga0105248_101973602 194
510 3300009177 Ga0105248_12250224 Ga0105248_122502241 194
511 3300009545 Ga0105237_10830367 Ga0105237_108303671 194
512 3300009551 Ga0105238_10027544 Ga0105238_100275444 194
513 3300009551 Ga0105238_10032655 Ga0105238_100326554 194
514 3300009551 Ga0105238_10372062 Ga0105238_103720622 194
515 3300010375 Ga0105239_10188587 Ga0105239_101885872 194
516 3300011119 Ga0105246_10518643 Ga0105246_105186432 194
517 3300012497 Ga0157319_1000007 Ga0157319_1000007212 194
518 3300013100 Ga0157373_10030010 Ga0157373_100300104 194
519 3300013102 Ga0157371_10120538 Ga0157371_101205382 194
520 3300013105 Ga0157369_10185424 Ga0157369_101854242 194
521 3300013296 Ga0157374_10073196 Ga0157374_100731963 194
522 3300013306 Ga0163162_10071865 Ga0163162_100718654 194
523 3300013306 Ga0163162_10445795 Ga0163162_104457952 194
524 3300013307 Ga0157372_10941156 Ga0157372_109411562 194
525 3300013308 Ga0157375_10030952 Ga0157375_100309523 194
526 3300013308 Ga0157375_10462687 Ga0157375_104626872 194
527 3300014497 Ga0182008_10021224 Ga0182008_100212245 194
528 3300014497 Ga0182008_10177068 Ga0182008_101770682 194
529 3300014745 Ga0157377_10107172 Ga0157377_101071722 194
530 3300014745 Ga0157377_10297880 Ga0157377_102978802 194
531 3300014968 Ga0157379_10007142 Ga0157379_100071427 194
532 3300014968 Ga0157379_11014439 Ga0157379_110144391 194
533 3300014969 Ga0157376_10053662 Ga0157376_100536622 194
534 3300014969 Ga0157376_10235357 Ga0157376_102353572 194
535 3300015261 Ga0182006_1043727 Ga0182006_10437272 194
536 3300015262 Ga0182007_10002449 Ga0182007_100024498 194
537 3300015265 Ga0182005_1015298 Ga0182005_10152982 194
538 3300015683 Ga0183362_10004 Ga0183362_10004236 194
539 3300017792 Ga0163161_10034013 Ga0163161_100340134 194
540 3300017792 Ga0163161_10127921 Ga0163161_101279211 194
541 3300017792 Ga0163161_10245901 Ga0163161_102459011 194
542 3300017792 Ga0163161_10356685 Ga0163161_103566852 194
543 3300021361 Ga0213872_10000066 Ga0213872_1000006678 194
544 3300025226 Ga0209674_112190 Ga0209674_1121902 194
545 3300025230 Ga0209563_100014 Ga0209563_100014130 194
546 3300025245 Ga0207425_1000905 Ga0207425_10009057 194
547 3300025258 Ga0209129_1000038 Ga0209129_1000038219 194
548 3300025258 Ga0209129_1000154 Ga0209129_100015499 194
549 3300025263 Ga0209565_1007356 Ga0209565_10073563 194
550 3300025263 Ga0209565_1011639 Ga0209565_10116394 194
551 3300025273 Ga0209673_1031239 Ga0209673_10312392 194
552 3300025273 Ga0209673_1033688 Ga0209673_10336882 194
553 3300025273 Ga0209673_1069634 Ga0209673_10696342 194
554 3300025295 Ga0209564_1000162 Ga0209564_1000162133 194
555 3300025297 Ga0209758_1000152 Ga0209758_100015222 194
556 3300025298 Ga0209050_1001318 Ga0209050_10013183 194
557 3300025298 Ga0209050_1018244 Ga0209050_10182443 194
558 3300025299 Ga0209256_1000019 Ga0209256_1000019354 194
559 3300025299 Ga0209256_1000154 Ga0209256_1000154104 194
560 3300025299 Ga0209256_1036451 Ga0209256_10364511 194
561 3300025303 Ga0209051_1000004 Ga0209051_100000443 194
562 3300025303 Ga0209051_1002875 Ga0209051_10028755 194
563 3300025303 Ga0209051_1050843 Ga0209051_10508432 194
564 3300025304 Ga0209257_1000015 Ga0209257_1000015235 194
565 3300025304 Ga0209257_1000038 Ga0209257_1000038177 194
566 3300025304 Ga0209257_1000044 Ga0209257_1000044383 194
567 3300025304 Ga0209257_1002818 Ga0209257_10028185 194
568 3300025304 Ga0209257_1023145 Ga0209257_10231455 194
569 3300025315 Ga0207697_10122315 Ga0207697_101223152 194
570 3300025321 Ga0207656_10093589 Ga0207656_100935892 194
571 3300025321 Ga0207656_10115950 Ga0207656_101159501 194
572 3300025711 Ga0207696_1000284 Ga0207696_100028443 194
573 3300025893 Ga0207682_10010775 Ga0207682_100107752 194
574 3300025893 Ga0207682_10071258 Ga0207682_100712582 194
575 3300025893 Ga0207682_10183142 Ga0207682_101831422 194
576 3300025901 Ga0207688_10017262 Ga0207688_100172624 194
577 3300025901 Ga0207688_10024880 Ga0207688_100248802 194
578 3300025901 Ga0207688_10455497 Ga0207688_104554971 194
579 3300025901 Ga0207688_10536533 Ga0207688_105365332 194
580 3300025903 Ga0207680_10146541 Ga0207680_101465412 194
581 3300025907 Ga0207645_10003346 Ga0207645_100033466 194
582 3300025907 Ga0207645_10011552 Ga0207645_100115524 194
583 3300025907 Ga0207645_10086093 Ga0207645_100860932 194
584 3300025907 Ga0207645_10122254 Ga0207645_101222542 194
585 3300025909 Ga0207705_10450412 Ga0207705_104504122 194
586 3300025911 Ga0207654_10291566 Ga0207654_102915662 194
587 3300025912 Ga0207707_10507356 Ga0207707_105073562 194
588 3300025913 Ga0207695_10054927 Ga0207695_100549274 194
589 3300025914 Ga0207671_10444183 Ga0207671_104441832 194
590 3300025917 Ga0207660_10144632 Ga0207660_101446322 194
591 3300025919 Ga0207657_10032535 Ga0207657_100325355 194
592 3300025919 Ga0207657_10076226 Ga0207657_100762262 194
593 3300025919 Ga0207657_10186334 Ga0207657_101863342 194
594 3300025920 Ga0207649_10644110 Ga0207649_106441101 194
595 3300025923 Ga0207681_10002642 Ga0207681_1000264211 194
596 3300025923 Ga0207681_10016724 Ga0207681_100167245 194
597 3300025923 Ga0207681_10132637 Ga0207681_101326372 194
598 3300025923 Ga0207681_10214819 Ga0207681_102148192 194
599 3300025924 Ga0207694_10089664 Ga0207694_100896641 194
600 3300025924 Ga0207694_10453455 Ga0207694_104534552 194
601 3300025925 Ga0207650_10024167 Ga0207650_100241674 194
602 3300025925 Ga0207650_10439259 Ga0207650_104392591 194
603 3300025926 Ga0207659_10019168 Ga0207659_100191684 194
604 3300025926 Ga0207659_10127878 Ga0207659_101278782 194
605 3300025931 Ga0207644_10019987 Ga0207644_100199874 194
606 3300025931 Ga0207644_10024937 Ga0207644_100249374 194
607 3300025931 Ga0207644_10026791 Ga0207644_100267914 194
608 3300025931 Ga0207644_10606708 Ga0207644_106067082 194
609 3300025932 Ga0207690_10472817 Ga0207690_104728172 194
610 3300025932 Ga0207690_10477821 Ga0207690_104778212 194
611 3300025933 Ga0207706_10049571 Ga0207706_100495712 194
612 3300025934 Ga0207686_10008679 Ga0207686_100086792 194
613 3300025934 Ga0207686_10423889 Ga0207686_104238892 194
614 3300025935 Ga0207709_10000121 Ga0207709_1000012124 194
615 3300025935 Ga0207709_10072313 Ga0207709_100723132 194
616 3300025935 Ga0207709_10386544 Ga0207709_103865442 194
617 3300025938 Ga0207704_10094030 Ga0207704_100940302 194
618 3300025940 Ga0207691_10001450 Ga0207691_1000145020 194
619 3300025940 Ga0207691_10007414 Ga0207691_100074147 194
620 3300025940 Ga0207691_10011946 Ga0207691_100119466 194
621 3300025940 Ga0207691_10016135 Ga0207691_100161357 194
622 3300025940 Ga0207691_10149427 Ga0207691_101494272 194
623 3300025940 Ga0207691_10217658 Ga0207691_102176582 194
624 3300025941 Ga0207711_10049997 Ga0207711_100499971 194
625 3300025942 Ga0207689_10102005 Ga0207689_101020052 194
626 3300025942 Ga0207689_10119812 Ga0207689_101198122 194
627 3300025942 Ga0207689_10221615 Ga0207689_102216152 194
628 3300025944 Ga0207661_10010414 Ga0207661_100104147 194
629 3300025945 Ga0207679_10117539 Ga0207679_101175392 194
630 3300025945 Ga0207679_10168399 Ga0207679_101683991 194
631 3300025949 Ga0207667_10179008 Ga0207667_101790083 194
632 3300025949 Ga0207667_10197226 Ga0207667_101972262 194
633 3300025960 Ga0207651_10071369 Ga0207651_100713692 194
634 3300025961 Ga0207712_10202436 Ga0207712_102024362 194
635 3300025972 Ga0207668_10862911 Ga0207668_108629111 194
636 3300025981 Ga0207640_10091596 Ga0207640_100915962 194
637 3300025986 Ga0207658_10018033 Ga0207658_100180332 194
638 3300025986 Ga0207658_10089290 Ga0207658_100892903 194
639 3300025986 Ga0207658_10204891 Ga0207658_102048912 194
640 3300025986 Ga0207658_10432789 Ga0207658_104327892 194
641 3300026023 Ga0207677_10002669 Ga0207677_100026695 194
642 3300026023 Ga0207677_10088072 Ga0207677_100880722 194
643 3300026023 Ga0207677_10106221 Ga0207677_101062212 194
644 3300026023 Ga0207677_10340220 Ga0207677_103402202 194
645 3300026023 Ga0207677_10373453 Ga0207677_103734532 194
646 3300026035 Ga0207703_10175137 Ga0207703_101751372 194
647 3300026035 Ga0207703_10191090 Ga0207703_101910901 194
648 3300026041 Ga0207639_10223070 Ga0207639_102230702 194
649 3300026075 Ga0207708_10066830 Ga0207708_100668303 194
650 3300026078 Ga0207702_10023522 Ga0207702_100235225 194
651 3300026088 Ga0207641_10071210 Ga0207641_100712103 194
652 3300026088 Ga0207641_10103121 Ga0207641_101031212 194
653 3300026089 Ga0207648_10015155 Ga0207648_100151557 194
654 3300026089 Ga0207648_10018799 Ga0207648_100187994 194
655 3300026089 Ga0207648_10030658 Ga0207648_100306582 194
656 3300026089 Ga0207648_10058565 Ga0207648_100585654 194
657 3300026089 Ga0207648_10163120 Ga0207648_101631202 194
658 3300026089 Ga0207648_10588941 Ga0207648_105889411 194
659 3300026095 Ga0207676_10037438 Ga0207676_100374384 194
660 3300026095 Ga0207676_10051589 Ga0207676_100515892 194
661 3300026095 Ga0207676_10126730 Ga0207676_101267302 194
662 3300026095 Ga0207676_10475497 Ga0207676_104754972 194
663 3300026116 Ga0207674_10011781 Ga0207674_100117817 194
664 3300026118 Ga0207675_100004538 Ga0207675_1000045386 194
665 3300026118 Ga0207675_100021554 Ga0207675_1000215542 194
666 3300026121 Ga0207683_10047017 Ga0207683_100470171 194
667 3300026121 Ga0207683_10400328 Ga0207683_104003282 194
668 3300026142 Ga0207698_10233129 Ga0207698_102331292 194
669 3300026142 Ga0207698_10995794 Ga0207698_109957941 194
670 3300027111 Ga0209281_1000023 Ga0209281_100002394 194
671 3300027111 Ga0209281_1000029 Ga0209281_1000029343 194
672 3300027717 Ga0209998_10065020 Ga0209998_100650201 194
673 3300027876 Ga0209974_10010352 Ga0209974_100103521 194
674 3300027876 Ga0209974_10015457 Ga0209974_100154572 194
675 3300028379 Ga0268266_10025956 Ga0268266_100259563 194
676 3300028379 Ga0268266_10406580 Ga0268266_104065802 194
677 3300028380 Ga0268265_10372781 Ga0268265_103727812 194
678 3300028381 Ga0268264_10155353 Ga0268264_101553532 194
679 3300028381 Ga0268264_10749191 Ga0268264_107491912 194
680 3300028786 Ga0307517_10007370 Ga0307517_100073702 194
681 3300028794 Ga0307515_10000123 Ga0307515_10000123159 194
682 3300028794 Ga0307515_10000222 Ga0307515_1000022239 194
683 3300028794 Ga0307515_10001320 Ga0307515_1000132021 194
684 3300028794 Ga0307515_10003752 Ga0307515_1000375233 194
685 3300028794 Ga0307515_10023096 Ga0307515_100230962 194
686 3300028794 Ga0307515_10024670 Ga0307515_1002467012 194
687 3300028794 Ga0307515_10061404 Ga0307515_100614043 194
688 3300028794 Ga0307515_10130543 Ga0307515_101305433 194
689 3300028794 Ga0307515_10264303 Ga0307515_102643031 194
690 3300028794 Ga0307515_10514455 Ga0307515_105144551 194
691 3300030522 Ga0307512_10052484 Ga0307512_100524843 194
692 3300031239 Ga0265328_10003117 Ga0265328_100031173 194
693 3300031249 Ga0265339_10321264 Ga0265339_103212641 194
694 3300031250 Ga0265331_10003180 Ga0265331_100031803 194
695 3300031250 Ga0265331_10010532 Ga0265331_100105322 194
696 3300031250 Ga0265331_10219952 Ga0265331_102199521 194
697 3300031251 Ga0265327_10000020 Ga0265327_10000020148 194
698 3300031251 Ga0265327_10002288 Ga0265327_1000228819 194
699 3300031456 Ga0307513_10035170 Ga0307513_100351701 194
700 3300031456 Ga0307513_10184542 Ga0307513_101845422 194
701 3300031456 Ga0307513_10269906 Ga0307513_102699062 194
702 3300031507 Ga0307509_10000157 Ga0307509_100001575 194
703 3300031507 Ga0307509_10092949 Ga0307509_100929494 194
704 3300031548 Ga0307408_100000117 Ga0307408_10000011720 194
705 3300031548 Ga0307408_100010507 Ga0307408_1000105075 194
706 3300031548 Ga0307408_100018753 Ga0307408_1000187534 194
707 3300031548 Ga0307408_100056604 Ga0307408_1000566042 194
708 3300031548 Ga0307408_100409840 Ga0307408_1004098401 194
709 3300031616 Ga0307508_10000269 Ga0307508_100002696 194
710 3300031616 Ga0307508_10239506 Ga0307508_102395062 194
711 3300031649 Ga0307514_10000585 Ga0307514_1000058539 194
712 3300031649 Ga0307514_10024785 Ga0307514_100247851 194
713 3300031649 Ga0307514_10098202 Ga0307514_100982022 194
714 3300031711 Ga0265314_10000481 Ga0265314_1000048138 194
715 3300031711 Ga0265314_10018203 Ga0265314_100182033 194
716 3300031712 Ga0265342_10019697 Ga0265342_100196971 194
717 3300031730 Ga0307516_10004413 Ga0307516_1000441313 194
718 3300031730 Ga0307516_10083286 Ga0307516_100832863 194
719 3300031731 Ga0307405_10186066 Ga0307405_101860661 194
720 3300031824 Ga0307413_10120858 Ga0307413_101208582 194
721 3300031824 Ga0307413_10124153 Ga0307413_101241532 194
722 3300031852 Ga0307410_10119667 Ga0307410_101196672 194
723 3300031852 Ga0307410_10149747 Ga0307410_101497472 194
724 3300031901 Ga0307406_10000564 Ga0307406_100005646 194
725 3300031901 Ga0307406_10155874 Ga0307406_101558742 194
726 3300031901 Ga0307406_10416394 Ga0307406_104163942 194
727 3300031903 Ga0307407_10091038 Ga0307407_100910382 194
728 3300031911 Ga0307412_10058062 Ga0307412_100580622 194
729 3300031911 Ga0307412_10095492 Ga0307412_100954922 194
730 3300031911 Ga0307412_10239285 Ga0307412_102392852 194
731 3300031911 Ga0307412_10349208 Ga0307412_103492082 194
732 3300031911 Ga0307412_10455927 Ga0307412_104559272 194
733 3300031995 Ga0307409_100061269 Ga0307409_1000612692 194
734 3300031995 Ga0307409_100753201 Ga0307409_1007532011 194
735 3300032002 Ga0307416_100099825 Ga0307416_1000998253 194
736 3300032002 Ga0307416_100166292 Ga0307416_1001662921 194
737 3300032002 Ga0307416_100298118 Ga0307416_1002981182 194
738 3300032002 Ga0307416_100473808 Ga0307416_1004738082 194
739 3300032002 Ga0307416_100510676 Ga0307416_1005106761 194
740 3300032002 Ga0307416_100626988 Ga0307416_1006269881 194
741 3300032004 Ga0307414_10480291 Ga0307414_104802912 194
742 3300032005 Ga0307411_10001308 Ga0307411_100013082 194
743 3300032126 Ga0307415_100063147 Ga0307415_1000631473 194
744 3300032126 Ga0307415_100176832 Ga0307415_1001768322 194
745 3300033180 Ga0307510_10003158 Ga0307510_100031589 194
746 3300033180 Ga0307510_10136616 Ga0307510_101366161 194
747 3300034818 Ga0373950_0032458 Ga0373950_0032458_15_599 194
748 3300035084 Ga0373928_0049261 Ga0373928_0049261_272_856 194
749 3300035111 Ga0373923_0106378 Ga0373923_0106378_21_605 194
750 3300035112 Ga0373932_0009286 Ga0373932_0009286_168_752 194
751 3300035113 Ga0373936_0355264 Ga0373936_0355264_68_652 194
752 3300035691 Ga0373931_0023054 Ga0373931_0023054_145_729 194
753 3300035691 Ga0373931_0037464 Ga0373931_0037464_1356_1940 194
754 3300035692 Ga0373935_0096080 Ga0373935_0096080_322_906 194
755 3300035695 Ga0373927_0393928 Ga0373927_0393928_286_870 194
756 3300037068 Ga0373925_0294902 Ga0373925_0294902_648_1232 194
757 3300037312 Ga0395899_0004451 Ga0395899_0004451_9114_9698 194
758 3300037312 Ga0395899_0403585 Ga0395899_0403585_132_716 194
759 3300037418 Ga0395900_0138960 Ga0395900_0138960_373_957 194
760 3300037418 Ga0395900_0149756 Ga0395900_0149756_1012_1596 194
761 3300037418 Ga0395900_0248012 Ga0395900_0248012_941_1525 194
762 3300037418 Ga0395900_0305251 Ga0395900_0305251_105_689 194
763 3300037466 Ga0395898_0001815 Ga0395898_0001815_12759_13343 194
764 3300037466 Ga0395898_0007129 Ga0395898_0007129_4725_5309 194
765 3300037471 Ga0395905_0000047 Ga0395905_0000047_58037_58621 194
766 3300037471 Ga0395905_0000574 Ga0395905_0000574_4145_4729 194
767 3300037471 Ga0395905_0010363 Ga0395905_0010363_2154_2738 194
768 3300037471 Ga0395905_0039742 Ga0395905_0039742_313_897 194
769 3300037471 Ga0395905_0071413 Ga0395905_0071413_390_974 194
770 3300037471 Ga0395905_0074778 Ga0395905_0074778_1062_1646 194
771 3300037471 Ga0395905_0139842 Ga0395905_0139842_200_784 194
772 3300037471 Ga0395905_0141319 Ga0395905_0141319_1189_1773 194
773 3300037471 Ga0395905_0179661 Ga0395905_0179661_1020_1604 194
774 3300037471 Ga0395905_0191646 Ga0395905_0191646_978_1562 194
775 3300037471 Ga0395905_0304848 Ga0395905_0304848_744_1328 194
776 3300037471 Ga0395905_0348097 Ga0395905_0348097_704_1288 194
777 3300037853 Ga0436364_0558821 Ga0436364_0558821_394_978 194
778 3300038443 Ga0395901_0017644 Ga0395901_0017644_2159_2743 194
779 3300038443 Ga0395901_0051325 Ga0395901_0051325_423_1007 194
780 3300038443 Ga0395901_0116046 Ga0395901_0116046_62_646 194
781 3300038443 Ga0395901_0157557 Ga0395901_0157557_761_1345 194
782 3300038443 Ga0395901_0314114 Ga0395901_0314114_634_1218 194
783 3300038443 Ga0395901_0342627 Ga0395901_0342627_396_980 194
784 3300038443 Ga0395901_0355799 Ga0395901_0355799_356_940 194
785 3300038443 Ga0395901_0511018 Ga0395901_0511018_192_776 194
786 3300038443 Ga0395901_0858004 Ga0395901_0858004_62_646 194
787 3300039437 Ga0436365_0215796 Ga0436365_0215796_517_1101 194
788 3300039447 Ga0436361_0150911 Ga0436361_0150911_25494_26078 194
789 3300039447 Ga0436361_1125703 Ga0436361_1125703_25134_25718 194
790 3300041410 Ga0439461_0005336 Ga0439461_0005336_158_742 194
791 3300041441 Ga0451787_727763 Ga0451787_727763_11_595 194
792 3300041451 Ga0451791_0365245 Ga0451791_0365245_111_695 194
793 3300041456 Ga0451795_0559006 Ga0451795_0559006_418_1002 194
794 3300041459 Ga0451800_0497913 Ga0451800_0497913_181_765 194
795 3300041501 Ga0451845_0479137 Ga0451845_0479137_68_652 194
796 3300041511 Ga0451855_1618156 Ga0451855_1618156_468_1052 194
797 3300042007 Ga0439449_0002193 Ga0439449_0002193_6632_7216 194
798 3300042007 Ga0439449_0074757 Ga0439449_0074757_159_743 194
799 3300042015 Ga0439462_0009697 Ga0439462_0009697_1388_1972 194
800 3300042115 Ga0450911_000578 Ga0450911_000578_590_1174 194
801 3300042121 Ga0450919_000956 Ga0450919_000956_2604_3188 194
802 3300042122 Ga0450920_066091 Ga0450920_066091_41_625 194
803 3300042125 Ga0450923_011324 Ga0450923_011324_535_1119 194
804 3300042156 Ga0439446_0087125 Ga0439446_0087125_366_950 194
805 3300042438 Ga0439459_0015354 Ga0439459_0015354_635_1219 194
806 3300042531 Ga0450918_000285 Ga0450918_000285_5633_6217 194
807 3300042876 Ga0451577_0001338 Ga0451577_0001338_15355_15939 194
808 3300042876 Ga0451577_0002254 Ga0451577_0002254_19683_20267 194
809 3300042876 Ga0451577_0002648 Ga0451577_0002648_15260_15844 194
810 3300042876 Ga0451577_0066100 Ga0451577_0066100_2565_3149 194
811 3300044656 Ga0466969_0000186 Ga0466969_0000186_27033_27617 194
812 3300044656 Ga0466969_0058414 Ga0466969_0058414_497_1081 194
813 3300044656 Ga0466969_0160543 Ga0466969_0160543_124_708 194
814 3300044673 Ga0453683_0278994 Ga0453683_0278994_161_745 194
815 3300044683 Ga0466965_0020110 Ga0466965_0020110_2602_3186 194
816 3300044683 Ga0466965_0101244 Ga0466965_0101244_154_738 194
817 3300044684 Ga0466966_0015429 Ga0466966_0015429_2866_3450 194
818 3300044684 Ga0466966_0200830 Ga0466966_0200830_290_874 194
819 3300044693 Ga0466961_0143754 Ga0466961_0143754_202_786 194
820 3300044693 Ga0466961_0247167 Ga0466961_0247167_347_931 194
821 3300044694 Ga0466963_0110457 Ga0466963_0110457_930_1514 194
822 3300045049 Ga0466959_0123645 Ga0466959_0123645_176_760 194
823 3300045049 Ga0466959_0123868 Ga0466959_0123868_745_1329 194
824 3300045051 Ga0451576_0109260 Ga0451576_0109260_1081_1665 194
825 3300045051 Ga0451576_0163504 Ga0451576_0163504_1408_1992 194
826 3300045051 Ga0451576_0335193 Ga0451576_0335193_419_1003 194
827 3300045051 Ga0451576_0471215 Ga0451576_0471215_191_775 194
828 3300045051 Ga0451576_1152321 Ga0451576_1152321_137_721 194
829 3300046453 Ga0495627_105277 Ga0495627_105277_133_720 194
830 3300046454 Ga0495592_0000350 Ga0495592_0000350_8639_9223 194
831 3300046459 Ga0495629_0027134 Ga0495629_0027134_2177_2761 194
832 3300046471 Ga0495650_0019327 Ga0495650_0019327_488_1072 194
833 3300046491 Ga0495584_0371481 Ga0495584_0371481_10_615 194
834 3300046492 Ga0495585_0038810 Ga0495585_0038810_645_1250 194
835 3300046511 Ga0495608_0567520 Ga0495608_0567520_20_604 194
836 3300046512 Ga0495610_0012620 Ga0495610_0012620_743_1327 194
837 3300046515 Ga0495620_0086640 Ga0495620_0086640_628_1212 194
838 3300046517 Ga0495630_0099816 Ga0495630_0099816_33_617 194
839 3300046519 Ga0495632_0297237 Ga0495632_0297237_94_678 194
840 3300046522 Ga0495643_0130649 Ga0495643_0130649_71_655 194
841 3300046524 Ga0495648_0161656 Ga0495648_0161656_146_730 194
842 3300046530 Ga0495654_0123175 Ga0495654_0123175_111_695 194
843 3300046539 Ga0495621_0047608 Ga0495621_0047608_783_1367 194
844 3300046539 Ga0495621_0162964 Ga0495621_0162964_86_670 194
845 3300046542 Ga0495597_0000325 Ga0495597_0000325_19653_20237 194
846 3300046542 Ga0495597_0086688 Ga0495597_0086688_546_1130 194
847 3300046558 Ga0495633_0000959 Ga0495633_0000959_22559_23146 194
848 3300046660 Ga0495625_0000807 Ga0495625_0000807_3614_4198 194
849 3300046681 Ga0495647_0006648 Ga0495647_0006648_2582_3166 194
850 3300046683 Ga0495658_0046613 Ga0495658_0046613_1473_2057 194
851 3300046683 Ga0495658_0283947 Ga0495658_0283947_423_1007 194
852 3300046689 Ga0495613_0274421 Ga0495613_0274421_448_1032 194
853 3300046809 Ga0495600_0147791 Ga0495600_0147791_272_856 194
854 3300047317 Ga0495604_0259410 Ga0495604_0259410_294_878 194
855 3300047318 Ga0495636_0309724 Ga0495636_0309724_28_612 194
856 3300047319 Ga0495674_0664358 Ga0495674_0664358_94_678 194
857 3300047321 Ga0495676_0117782 Ga0495676_0117782_555_1160 194
858 3300047472 Ga0495686_0000960 Ga0495686_0000960_30157_30741 194
859 3300047472 Ga0495686_0062293 Ga0495686_0062293_341_925 194
860 3300047472 Ga0495686_0344425 Ga0495686_0344425_216_800 194
861 3300048090 Ga0495615_0001101 Ga0495615_0001101_3173_3757 194
862 3300048090 Ga0495615_0057243 Ga0495615_0057243_363_947 194
863 3300048904 Ga0496101_0004337 Ga0496101_0004337_7620_8204 194
864 3300048904 Ga0496101_0263283 Ga0496101_0263283_10_594 194
865 3300048905 Ga0496102_0002551 Ga0496102_0002551_12712_13296 194
866 3300048906 Ga0496103_0064862 Ga0496103_0064862_759_1343 194
867 3300048907 Ga0496104_0026291 Ga0496104_0026291_2081_2665 194
868 3300048907 Ga0496104_0113723 Ga0496104_0113723_1599_2183 194
869 3300048907 Ga0496104_0295100 Ga0496104_0295100_759_1343 194
870 3300048908 Ga0496105_0001549 Ga0496105_0001549_3939_4523 194
871 3300048909 Ga0496106_0035220 Ga0496106_0035220_651_1235 194
872 3300048909 Ga0496106_0048701 Ga0496106_0048701_2170_2754 194
873 3300048910 Ga0496107_0108846 Ga0496107_0108846_397_981 194
874 3300048911 Ga0496108_0098346 Ga0496108_0098346_726_1310 194
875 3300048911 Ga0496108_0269067 Ga0496108_0269067_221_805 194
876 3300048912 Ga0496109_0160368 Ga0496109_0160368_1488_2072 194
877 3300048912 Ga0496109_0294059 Ga0496109_0294059_715_1299 194
878 3300048912 Ga0496109_0498641 Ga0496109_0498641_468_1052 194
879 3300048913 Ga0496110_0208313 Ga0496110_0208313_900_1484 194
880 3300048913 Ga0496110_0370919 Ga0496110_0370919_656_1240 194
881 3300048913 Ga0496110_0906784 Ga0496110_0906784_26_610 194
882 3300048914 Ga0496111_0261400 Ga0496111_0261400_353_937 194
883 3300048915 Ga0496112_0043874 Ga0496112_0043874_879_1463 194
884 3300048916 Ga0496113_0067135 Ga0496113_0067135_234_818 194
885 3300048916 Ga0496113_0234448 Ga0496113_0234448_561_1145 194
886 3300048917 Ga0496114_0011308 Ga0496114_0011308_3239_3823 194
887 3300048917 Ga0496114_0145078 Ga0496114_0145078_728_1312 194
888 3300048917 Ga0496114_0231058 Ga0496114_0231058_769_1353 194
889 3300048924 Ga0496121_0040984 Ga0496121_0040984_2804_3388 194
890 3300048925 Ga0496122_0000039 Ga0496122_0000039_141286_141870 194
891 3300048925 Ga0496122_0011129 Ga0496122_0011129_174_758 194
892 3300048925 Ga0496122_0157570 Ga0496122_0157570_605_1189 194
893 3300048926 Ga0496123_0000026 Ga0496123_0000026_141382_141966 194
894 3300048926 Ga0496123_0048827 Ga0496123_0048827_2084_2668 194
895 3300048927 Ga0496124_0032375 Ga0496124_0032375_258_842 194
896 3300048928 Ga0496125_0001067 Ga0496125_0001067_18585_19169 194
897 3300048928 Ga0496125_0018536 Ga0496125_0018536_5608_6192 194
898 3300048928 Ga0496125_0166030 Ga0496125_0166030_765_1349 194
899 3300048928 Ga0496125_0214753 Ga0496125_0214753_335_919 194
900 3300048929 Ga0496126_0004099 Ga0496126_0004099_7909_8493 194
901 3300048929 Ga0496126_0163475 Ga0496126_0163475_969_1553 194
902 3300048929 Ga0496126_0918229 Ga0496126_0918229_40_624 194
903 3300049568 Ga0501031_0014406 Ga0501031_0014406_4461_5045 194
904 3300049571 Ga0501034_0119342 Ga0501034_0119342_360_944 194
905 3300049571 Ga0501034_0299092 Ga0501034_0299092_558_1142 194
906 3300049579 Ga0501043_0000018 Ga0501043_0000018_73760_74344 194
907 3300049579 Ga0501043_0053161 Ga0501043_0053161_252_836 194
908 3300049580 Ga0501046_0000042 Ga0501046_0000042_73760_74344 194
909 3300049580 Ga0501046_0558856 Ga0501046_0558856_121_705 194
910 3300049581 Ga0501047_0000052 Ga0501047_0000052_79105_79689 194
911 3300049581 Ga0501047_0078840 Ga0501047_0078840_1050_1634 194
912 3300049581 Ga0501047_0229132 Ga0501047_0229132_652_1236 194
913 3300049582 Ga0501048_0000099 Ga0501048_0000099_974_1558 194
914 3300049671 Ga0501238_017742 Ga0501238_017742_175_759 194
915 3300049742 Ga0501080_0060269 Ga0501080_0060269_2715_3299 194
916 3300049760 Ga0501263_010287 Ga0501263_010287_402_986 194
917 3300049822 Ga0501035_0133239 Ga0501035_0133239_956_1540 194
918 3300049822 Ga0501035_0226365 Ga0501035_0226365_970_1554 194
919 3300049824 Ga0501045_0001720 Ga0501045_0001720_13525_14109 194
920 3300050489 nmdc:mga03683_153433_c1 nmdc:mga03683_153433_c1_396_980 194
921 3300050490 nmdc:mga03n38_7700_c1 nmdc:mga03n38_7700_c1_2550_3134 194
922 3300050492 nmdc:mga0yw44_10446_c1 nmdc:mga0yw44_10446_c1_3997_4581 194
923 3300050493 nmdc:mga0k408_14643_c1 nmdc:mga0k408_14643_c1_2330_2914 194
924 3300050493 nmdc:mga0k408_17774_c1 nmdc:mga0k408_17774_c1_1020_1604 194
925 3300050493 nmdc:mga0k408_214216_c1 nmdc:mga0k408_214216_c1_132_716 194
926 3300050493 nmdc:mga0k408_78015_c1 nmdc:mga0k408_78015_c1_1161_1745 194
927 3300050494 nmdc:mga06z11_44836_c1 nmdc:mga06z11_44836_c1_311_895 194
928 3300050496 nmdc:mga07m45_200503_c1 nmdc:mga07m45_200503_c1_445_1029 194
929 3300050496 nmdc:mga07m45_340494_c1 nmdc:mga07m45_340494_c1_251_835 194
930 3300050496 nmdc:mga07m45_3462_c2 nmdc:mga07m45_3462_c2_3864_4448 194
931 3300050496 nmdc:mga07m45_9743_c1 nmdc:mga07m45_9743_c1_3988_4572 194
932 3300050512 nmdc:mga0n895_848914_c1 nmdc:mga0n895_848914_c1_224_808 194
933 3300053077 Ga0495601_0016701 Ga0495601_0016701_1553_2137 194
934 3300053078 Ga0495612_0144915 Ga0495612_0144915_121_705 194
935 3300053080 Ga0500635_0000047 Ga0500635_0000047_25163_25747 194
936 3300053086 Ga0500578_0419140 Ga0500578_0419140_42_626 194
937 3300053108 Ga0500562_011064 Ga0500562_011064_145_729 194
938 3300053121 Ga0500607_217196 Ga0500607_217196_91_675 194
939 3300053125 Ga0500618_027688 Ga0500618_027688_560_1144 194
940 3300053134 Ga0500658_0034984 Ga0500658_0034984_135_719 194
941 3300053136 Ga0500559_0001864 Ga0500559_0001864_4387_4971 194
942 3300053148 Ga0500590_120875 Ga0500590_120875_517_1101 194
943 3300053730 Ga0500645_006234 Ga0500645_006234_3649_4233 194
944 3300061719 Ga0466962_0274896 Ga0466962_0274896_204_788 194
945 3300003187 JGI25151J46595_10037340 JGI25151J46595_100373402 195
946 3300003322 rootL2_10012528 rootL2_100125286 195
947 3300003322 rootL2_10029984 rootL2_100299841 195
948 3300003578 Ga0006562J51391_1209414 Ga0006562J51391_12094142 195
949 3300003578 Ga0006562J51391_1209415 Ga0006562J51391_12094152 195
950 3300003773 Ga0055537_1001177 Ga0055537_10011774 195
951 3300003784 Ga0055534_1000405 Ga0055534_100040510 195
952 3300003792 Ga0055540_1005901 Ga0055540_10059012 195
953 3300005288 Ga0065714_10067017 Ga0065714_100670174 195
954 3300005289 Ga0065704_10132887 Ga0065704_101328872 195
955 3300005327 Ga0070658_10084666 Ga0070658_100846663 195
956 3300005329 Ga0070683_100793175 Ga0070683_1007931751 195
957 3300005336 Ga0070680_100008173 Ga0070680_1000081737 195
958 3300005344 Ga0070661_100752919 Ga0070661_1007529192 195
959 3300005356 Ga0070674_100985348 Ga0070674_1009853481 195
960 3300005356 Ga0070674_101077632 Ga0070674_1010776321 195
961 3300005367 Ga0070667_100075987 Ga0070667_1000759872 195
962 3300005456 Ga0070678_100457810 Ga0070678_1004578102 195
963 3300005458 Ga0070681_10659231 Ga0070681_106592312 195
964 3300005530 Ga0070679_100005692 Ga0070679_1000056924 195
965 3300005543 Ga0070672_100097115 Ga0070672_1000971153 195
966 3300005543 Ga0070672_100394007 Ga0070672_1003940072 195
967 3300005548 Ga0070665_100084080 Ga0070665_1000840802 195
968 3300005548 Ga0070665_100557155 Ga0070665_1005571551 195
969 3300005844 Ga0068862_100019144 Ga0068862_1000191444 195
970 3300005844 Ga0068862_100131682 Ga0068862_1001316821 195
971 3300005844 Ga0068862_100143468 Ga0068862_1001434682 195
972 3300006048 Ga0075363_100058665 Ga0075363_1000586654 195
973 3300006048 Ga0075363_100063213 Ga0075363_1000632133 195
974 3300006051 Ga0075364_10112071 Ga0075364_101120712 195
975 3300006051 Ga0075364_10285587 Ga0075364_102855872 195
976 3300006051 Ga0075364_10362944 Ga0075364_103629442 195
977 3300006177 Ga0075362_10007388 Ga0075362_100073882 195
978 3300006177 Ga0075362_10037092 Ga0075362_100370922 195
979 3300006178 Ga0075367_10044378 Ga0075367_100443784 195
980 3300006178 Ga0075367_10279967 Ga0075367_102799672 195
981 3300006195 Ga0075366_10005458 Ga0075366_100054582 195
982 3300006195 Ga0075366_10013684 Ga0075366_100136842 195
983 3300006195 Ga0075366_10013960 Ga0075366_100139603 195
984 3300006353 Ga0075370_10008916 Ga0075370_100089164 195
985 3300006353 Ga0075370_10012294 Ga0075370_100122944 195
986 3300006353 Ga0075370_10044098 Ga0075370_100440982 195
987 3300006353 Ga0075370_10065987 Ga0075370_100659872 195
988 3300006353 Ga0075370_10269955 Ga0075370_102699552 195
989 3300006846 Ga0075430_100149234 Ga0075430_1001492342 195
990 3300006846 Ga0075430_100914555 Ga0075430_1009145552 195
991 3300006880 Ga0075429_100002867 Ga0075429_10000286713 195
992 3300006948 Ga0099826_10000531 Ga0099826_1000053113 195
993 3300006948 Ga0099826_10199313 Ga0099826_101993132 195
994 3300009148 Ga0105243_10031437 Ga0105243_100314373 195
995 3300009148 Ga0105243_10498712 Ga0105243_104987122 195
996 3300009545 Ga0105237_10091032 Ga0105237_100910325 195
997 3300012502 Ga0157347_1001108 Ga0157347_10011082 195
998 3300013100 Ga0157373_10186777 Ga0157373_101867772 195
999 3300013104 Ga0157370_10012041 Ga0157370_100120413 195
1000 3300013105 Ga0157369_10526667 Ga0157369_105266672 195
1001 3300014326 Ga0157380_11098040 Ga0157380_110980401 195
1002 3300014497 Ga0182008_10026144 Ga0182008_100261442 195
1003 3300014497 Ga0182008_10060346 Ga0182008_100603461 195
1004 3300015261 Ga0182006_1109069 Ga0182006_11090691 195
1005 3300015261 Ga0182006_1110167 Ga0182006_11101672 195
1006 3300015262 Ga0182007_10132926 Ga0182007_101329262 195
1007 3300017792 Ga0163161_10001130 Ga0163161_100011303 195
1008 3300017792 Ga0163161_10009549 Ga0163161_100095492 195
1009 3300017792 Ga0163161_10055647 Ga0163161_100556471 195
1010 3300025263 Ga0209565_1001344 Ga0209565_100134410 195
1011 3300025273 Ga0209673_1000136 Ga0209673_1000136111 195
1012 3300025273 Ga0209673_1008427 Ga0209673_10084273 195
1013 3300025291 Ga0209675_1000071 Ga0209675_1000071111 195
1014 3300025291 Ga0209675_1005554 Ga0209675_10055546 195
1015 3300025292 Ga0209676_1000643 Ga0209676_10006434 195
1016 3300025292 Ga0209676_1014943 Ga0209676_10149432 195
1017 3300025294 Ga0209025_1000775 Ga0209025_10007754 195
1018 3300025294 Ga0209025_1009412 Ga0209025_10094126 195
1019 3300025294 Ga0209025_1012733 Ga0209025_10127334 195
1020 3300025294 Ga0209025_1045730 Ga0209025_10457302 195
1021 3300025298 Ga0209050_1012349 Ga0209050_10123495 195
1022 3300025303 Ga0209051_1000180 Ga0209051_100018039 195
1023 3300025303 Ga0209051_1000227 Ga0209051_100022718 195
1024 3300025909 Ga0207705_10193191 Ga0207705_101931912 195
1025 3300025914 Ga0207671_10051654 Ga0207671_100516542 195
1026 3300025935 Ga0207709_10000534 Ga0207709_100005347 195
1027 3300025935 Ga0207709_10006921 Ga0207709_100069215 195
1028 3300025935 Ga0207709_10426493 Ga0207709_104264931 195
1029 3300025940 Ga0207691_10063024 Ga0207691_100630242 195
1030 3300025940 Ga0207691_10178992 Ga0207691_101789922 195
1031 3300025942 Ga0207689_10720935 Ga0207689_107209351 195
1032 3300025960 Ga0207651_10227251 Ga0207651_102272512 195
1033 3300025961 Ga0207712_10734452 Ga0207712_107344522 195
1034 3300026067 Ga0207678_10000060 Ga0207678_1000006033 195
1035 3300026089 Ga0207648_10124178 Ga0207648_101241783 195
1036 3300026089 Ga0207648_10535467 Ga0207648_105354672 195
1037 3300026116 Ga0207674_10321751 Ga0207674_103217511 195
1038 3300026118 Ga0207675_100989662 Ga0207675_1009896621 195
1039 3300027617 Ga0210002_1010230 Ga0210002_10102302 195
1040 3300027666 Ga0209282_1005677 Ga0209282_10056776 195
1041 3300027682 Ga0209971_1002573 Ga0209971_10025733 195
1042 3300028379 Ga0268266_10035949 Ga0268266_100359494 195
1043 3300028380 Ga0268265_10034997 Ga0268265_100349971 195
1044 3300028380 Ga0268265_10089321 Ga0268265_100893212 195
1045 3300028794 Ga0307515_10000468 Ga0307515_1000046825 195
1046 3300030522 Ga0307512_10034515 Ga0307512_100345152 195
1047 3300030731 Ga0316177_1037458 Ga0316177_10374583 195
1048 3300030732 Ga0316176_1101539 Ga0316176_11015393 195
1049 3300030735 Ga0316178_1135832 Ga0316178_11358324 195
1050 3300030736 Ga0316180_1122922 Ga0316180_11229224 195
1051 3300030744 Ga0316181_1099919 Ga0316181_10999192 195
1052 3300030745 Ga0316182_1410237 Ga0316182_14102374 195
1053 3300031235 Ga0265330_10000281 Ga0265330_1000028129 195
1054 3300031238 Ga0265332_10000008 Ga0265332_10000008140 195
1055 3300031238 Ga0265332_10000015 Ga0265332_100000156 195
1056 3300031241 Ga0265325_10020353 Ga0265325_100203535 195
1057 3300031456 Ga0307513_10161174 Ga0307513_101611742 195
1058 3300031548 Ga0307408_100019477 Ga0307408_1000194776 195
1059 3300031548 Ga0307408_100107360 Ga0307408_1001073602 195
1060 3300031548 Ga0307408_100227429 Ga0307408_1002274293 195
1061 3300031649 Ga0307514_10200404 Ga0307514_102004042 195
1062 3300031711 Ga0265314_10000065 Ga0265314_100000656 195
1063 3300031712 Ga0265342_10393544 Ga0265342_103935441 195
1064 3300031731 Ga0307405_10012829 Ga0307405_100128295 195
1065 3300031731 Ga0307405_10017764 Ga0307405_100177645 195
1066 3300031731 Ga0307405_10050040 Ga0307405_100500403 195
1067 3300031731 Ga0307405_10091627 Ga0307405_100916272 195
1068 3300031731 Ga0307405_10105055 Ga0307405_101050552 195
1069 3300031731 Ga0307405_10475520 Ga0307405_104755202 195
1070 3300031824 Ga0307413_10469259 Ga0307413_104692592 195
1071 3300031852 Ga0307410_10591607 Ga0307410_105916072 195
1072 3300031901 Ga0307406_10002426 Ga0307406_100024266 195
1073 3300031901 Ga0307406_10152092 Ga0307406_101520922 195
1074 3300031901 Ga0307406_10467565 Ga0307406_104675652 195
1075 3300031911 Ga0307412_10028789 Ga0307412_100287892 195
1076 3300031911 Ga0307412_10083820 Ga0307412_100838202 195
1077 3300031911 Ga0307412_10145469 Ga0307412_101454692 195
1078 3300031911 Ga0307412_10274411 Ga0307412_102744112 195
1079 3300031911 Ga0307412_10276436 Ga0307412_102764362 195
1080 3300032002 Ga0307416_100014791 Ga0307416_1000147917 195
1081 3300032002 Ga0307416_100047940 Ga0307416_1000479402 195
1082 3300032002 Ga0307416_100053337 Ga0307416_1000533372 195
1083 3300032002 Ga0307416_100633437 Ga0307416_1006334371 195
1084 3300032002 Ga0307416_101759310 Ga0307416_1017593102 195
1085 3300032005 Ga0307411_10441138 Ga0307411_104411382 195
1086 3300036401 Ga0373937_0160176 Ga0373937_0160176_1059_1646 195
1087 3300037418 Ga0395900_0419760 Ga0395900_0419760_137_766 195
1088 3300041404 Ga0439436_0005656 Ga0439436_0005656_2489_3076 195
1089 3300041404 Ga0439436_0024429 Ga0439436_0024429_291_878 195
1090 3300041404 Ga0439436_0055304 Ga0439436_0055304_375_962 195
1091 3300041405 Ga0439438_024536 Ga0439438_024536_372_959 195
1092 3300041406 Ga0439439_0003366 Ga0439439_0003366_2738_3325 195
1093 3300041411 Ga0439466_0003457 Ga0439466_0003457_878_1465 195
1094 3300041411 Ga0439466_0007581 Ga0439466_0007581_672_1259 195
1095 3300041411 Ga0439466_0017646 Ga0439466_0017646_108_695 195
1096 3300041413 Ga0439465_0020438 Ga0439465_0020438_1339_1926 195
1097 3300041460 Ga0451802_0944004 Ga0451802_0944004_313_900 195
1098 3300041999 Ga0439433_0028952 Ga0439433_0028952_175_762 195
1099 3300041999 Ga0439433_0030210 Ga0439433_0030210_132_719 195
1100 3300042001 Ga0439441_045351 Ga0439441_045351_236_823 195
1101 3300042006 Ga0439432_002441 Ga0439432_002441_2951_3538 195
1102 3300042007 Ga0439449_0001017 Ga0439449_0001017_3296_3883 195
1103 3300042007 Ga0439449_0001719 Ga0439449_0001719_7591_8178 195
1104 3300042007 Ga0439449_0030408 Ga0439449_0030408_194_781 195
1105 3300042007 Ga0439449_0054531 Ga0439449_0054531_553_1140 195
1106 3300042008 Ga0439450_003215 Ga0439450_003215_1499_2116 195
1107 3300042011 Ga0439454_064521 Ga0439454_064521_10_627 195
1108 3300042012 Ga0439455_0035017 Ga0439455_0035017_138_755 195
1109 3300042015 Ga0439462_0021562 Ga0439462_0021562_855_1442 195
1110 3300042115 Ga0450911_004528 Ga0450911_004528_703_1320 195
1111 3300042115 Ga0450911_010034 Ga0450911_010034_317_904 195
1112 3300042123 Ga0450921_006869 Ga0450921_006869_201_788 195
1113 3300042125 Ga0450923_009202 Ga0450923_009202_112_699 195
1114 3300042131 Ga0450894_012811 Ga0450894_012811_139_726 195
1115 3300042156 Ga0439446_0005311 Ga0439446_0005311_2419_3006 195
1116 3300042156 Ga0439446_0072223 Ga0439446_0072223_440_1027 195
1117 3300042435 Ga0439434_0002288 Ga0439434_0002288_3442_4029 195
1118 3300042435 Ga0439434_0007693 Ga0439434_0007693_2475_3062 195
1119 3300042461 Ga0439460_0027777 Ga0439460_0027777_905_1492 195
1120 3300042531 Ga0450918_026288 Ga0450918_026288_233_820 195
1121 3300044684 Ga0466966_0052349 Ga0466966_0052349_866_1483 195
1122 3300044684 Ga0466966_0107919 Ga0466966_0107919_182_799 195
1123 3300044706 Ga0466964_0000264 Ga0466964_0000264_2401_3018 195
1124 3300044712 Ga0453684_0281890 Ga0453684_0281890_632_1219 195
1125 3300044719 Ga0466971_0030769 Ga0466971_0030769_390_1007 195
1126 3300044842 Ga0466957_0383746 Ga0466957_0383746_322_939 195
1127 3300045049 Ga0466959_0220483 Ga0466959_0220483_24_641 195
1128 3300045836 Ga0466958_0185593 Ga0466958_0185593_344_961 195
1129 3300045976 Ga0466967_0279833 Ga0466967_0279833_327_944 195
1130 3300046491 Ga0495584_0000360 Ga0495584_0000360_23817_24434 195
1131 3300046501 Ga0495607_0011551 Ga0495607_0011551_4470_5087 195
1132 3300046501 Ga0495607_0012895 Ga0495607_0012895_4440_5057 195
1133 3300046507 Ga0495606_0009114 Ga0495606_0009114_7429_8046 195
1134 3300046513 Ga0495616_0033405 Ga0495616_0033405_949_1566 195
1135 3300046520 Ga0495637_0012583 Ga0495637_0012583_2220_2807 195
1136 3300046522 Ga0495643_0001000 Ga0495643_0001000_19510_20127 195
1137 3300046524 Ga0495648_0011182 Ga0495648_0011182_4430_5047 195
1138 3300046528 Ga0495642_0000278 Ga0495642_0000278_11200_11817 195
1139 3300046542 Ga0495597_0123112 Ga0495597_0123112_150_767 195
1140 3300046660 Ga0495625_0000114 Ga0495625_0000114_101990_102577 195
1141 3300046660 Ga0495625_0151238 Ga0495625_0151238_501_1088 195
1142 3300046665 Ga0495661_0002180 Ga0495661_0002180_3060_3677 195
1143 3300046665 Ga0495661_0040942 Ga0495661_0040942_1567_2184 195
1144 3300046665 Ga0495661_0094414 Ga0495661_0094414_650_1267 195
1145 3300046674 Ga0495588_0000059 Ga0495588_0000059_261553_262170 195
1146 3300046674 Ga0495588_0071518 Ga0495588_0071518_799_1386 195
1147 3300046674 Ga0495588_0074643 Ga0495588_0074643_312_899 195
1148 3300046692 Ga0495671_0008746 Ga0495671_0008746_2202_2789 195
1149 3300046694 Ga0495649_0008972 Ga0495649_0008972_1870_2487 195
1150 3300046794 Ga0495589_0000473 Ga0495589_0000473_9193_9810 195
1151 3300046794 Ga0495589_0287142 Ga0495589_0287142_41_658 195
1152 3300046810 Ga0495660_0001345 Ga0495660_0001345_6057_6674 195
1153 3300047320 Ga0495672_0000529 Ga0495672_0000529_19561_20178 195
1154 3300047443 Ga0495687_000821 Ga0495687_000821_5818_6435 195
1155 3300047443 Ga0495687_004427 Ga0495687_004427_4418_5035 195
1156 3300047445 Ga0495677_0001125 Ga0495677_0001125_1624_2241 195
1157 3300047445 Ga0495677_0112791 Ga0495677_0112791_359_946 195
1158 3300048091 Ga0495626_0000550 Ga0495626_0000550_19510_20127 195
1159 3300048918 Ga0496115_0222164 Ga0496115_0222164_551_1138 195
1160 3300048919 Ga0496116_0076692 Ga0496116_0076692_1443_2030 195
1161 3300048926 Ga0496123_0030613 Ga0496123_0030613_77_694 195
1162 3300048926 Ga0496123_0302488 Ga0496123_0302488_132_719 195
1163 3300048927 Ga0496124_0078943 Ga0496124_0078943_1882_2499 195
1164 3300049515 Ga0501292_004282 Ga0501292_004282_732_1319 195
1165 3300049517 Ga0501294_002978 Ga0501294_002978_384_971 195
1166 3300049571 Ga0501034_0088700 Ga0501034_0088700_790_1407 195
1167 3300049572 Ga0501036_0507191 Ga0501036_0507191_122_739 195
1168 3300049679 Ga0501249_009117 Ga0501249_009117_511_1098 195
1169 3300049682 Ga0501252_015913 Ga0501252_015913_289_876 195
1170 3300049759 Ga0501262_000756 Ga0501262_000756_264_851 195
1171 3300049759 Ga0501262_027515 Ga0501262_027515_111_698 195
1172 3300049762 Ga0501265_003381 Ga0501265_003381_554_1141 195
1173 3300049777 Ga0501281_04937 Ga0501281_04937_165_752 195
1174 3300050489 nmdc:mga03683_128295_c1 nmdc:mga03683_128295_c1_406_993 195
1175 3300050489 nmdc:mga03683_369395_c1 nmdc:mga03683_369395_c1_27_614 195
1176 3300050489 nmdc:mga03683_9948_c1 nmdc:mga03683_9948_c1_253_840 195
1177 3300050493 nmdc:mga0k408_75714_c1 nmdc:mga0k408_75714_c1_886_1473 195
1178 3300050494 nmdc:mga06z11_180623_c1 nmdc:mga06z11_180623_c1_476_1063 195
1179 3300050494 nmdc:mga06z11_22017_c1 nmdc:mga06z11_22017_c1_1998_2585 195
1180 3300050496 nmdc:mga07m45_19497_c1 nmdc:mga07m45_19497_c1_367_954 195
1181 3300050496 nmdc:mga07m45_2080_c1 nmdc:mga07m45_2080_c1_6219_6806 195
1182 3300050496 nmdc:mga07m45_50058_c1 nmdc:mga07m45_50058_c1_1236_1823 195
1183 3300050496 nmdc:mga07m45_89179_c1 nmdc:mga07m45_89179_c1_555_1142 195
1184 3300050508 nmdc:mga09592_33830_c1 nmdc:mga09592_33830_c1_3349_3936 195
1185 3300050509 nmdc:mga0qj67_178080_c1 nmdc:mga0qj67_178080_c1_406_993 195
1186 3300050516 nmdc:mga0sz30_15826_c1 nmdc:mga0sz30_15826_c1_2032_2619 195
1187 3300053079 Ga0500610_0000246 Ga0500610_0000246_8226_8813 195
1188 3300053121 Ga0500607_001623 Ga0500607_001623_10903_11490 195
1189 3300053122 Ga0500608_013019 Ga0500608_013019_190_780 195
1190 3300053161 Ga0500634_0058369 Ga0500634_0058369_1440_2027 195
1191 3300053161 Ga0500634_0112775 Ga0500634_0112775_183_770 195
1192 iso_pu_bacteria 2643221556 2643797159 195
1193 iso_pu_bacteria 2643221684 2644469737 195
1194 iso_pu_bacteria 8047673197 8047676555 195
1195 3300001979 JGI24740J21852_10011092 JGI24740J21852_100110922 196
1196 3300001979 JGI24740J21852_10036651 JGI24740J21852_100366512 196
1197 3300001989 JGI24739J22299_10014654 JGI24739J22299_100146543 196
1198 3300002244 JGI24742J22300_10031731 JGI24742J22300_100317312 196
1199 3300002773 JGI25152J39213_1005397 JGI25152J39213_10053972 196
1200 3300003316 rootH1_10021326 rootH1_100213262 196
1201 3300003578 Ga0006562J51391_1207517 Ga0006562J51391_12075172 196
1202 3300003578 Ga0006562J51391_1207518 Ga0006562J51391_12075182 196
1203 3300003761 Ga0055535_1000759 Ga0055535_10007594 196
1204 3300003762 Ga0055542_1000003 Ga0055542_1000003333 196
1205 3300003791 Ga0055530_10005996 Ga0055530_100059965 196
1206 3300003792 Ga0055540_1055227 Ga0055540_10552271 196
1207 3300004625 Ga0055543_1002997 Ga0055543_10029975 196
1208 3300005288 Ga0065714_10187895 Ga0065714_101878952 196
1209 3300005328 Ga0070676_10009990 Ga0070676_100099903 196
1210 3300005328 Ga0070676_10067147 Ga0070676_100671472 196
1211 3300005329 Ga0070683_100091372 Ga0070683_1000913723 196
1212 3300005330 Ga0070690_100041899 Ga0070690_1000418992 196
1213 3300005330 Ga0070690_100393458 Ga0070690_1003934581 196
1214 3300005331 Ga0070670_100006074 Ga0070670_1000060746 196
1215 3300005331 Ga0070670_100139611 Ga0070670_1001396112 196
1216 3300005333 Ga0070677_10026420 Ga0070677_100264202 196
1217 3300005334 Ga0068869_100017350 Ga0068869_1000173503 196
1218 3300005334 Ga0068869_100145212 Ga0068869_1001452122 196
1219 3300005334 Ga0068869_100455523 Ga0068869_1004555232 196
1220 3300005334 Ga0068869_100728512 Ga0068869_1007285122 196
1221 3300005335 Ga0070666_10041404 Ga0070666_100414042 196
1222 3300005335 Ga0070666_10449934 Ga0070666_104499341 196
1223 3300005338 Ga0068868_100186545 Ga0068868_1001865452 196
1224 3300005338 Ga0068868_100557067 Ga0068868_1005570672 196
1225 3300005343 Ga0070687_100006034 Ga0070687_1000060344 196
1226 3300005344 Ga0070661_100050850 Ga0070661_1000508502 196
1227 3300005344 Ga0070661_100116840 Ga0070661_1001168402 196
1228 3300005347 Ga0070668_100003853 Ga0070668_1000038535 196
1229 3300005347 Ga0070668_100247501 Ga0070668_1002475012 196
1230 3300005347 Ga0070668_100753990 Ga0070668_1007539901 196
1231 3300005353 Ga0070669_100004701 Ga0070669_1000047014 196
1232 3300005354 Ga0070675_100062899 Ga0070675_1000628992 196
1233 3300005355 Ga0070671_100023972 Ga0070671_1000239726 196
1234 3300005355 Ga0070671_100049088 Ga0070671_1000490882 196
1235 3300005355 Ga0070671_100166232 Ga0070671_1001662321 196
1236 3300005355 Ga0070671_100286154 Ga0070671_1002861542 196
1237 3300005364 Ga0070673_100024223 Ga0070673_1000242235 196
1238 3300005364 Ga0070673_100173549 Ga0070673_1001735492 196
1239 3300005364 Ga0070673_100255289 Ga0070673_1002552892 196
1240 3300005364 Ga0070673_100794416 Ga0070673_1007944161 196
1241 3300005364 Ga0070673_101131268 Ga0070673_1011312681 196
1242 3300005365 Ga0070688_100774281 Ga0070688_1007742812 196
1243 3300005366 Ga0070659_100094674 Ga0070659_1000946742 196
1244 3300005366 Ga0070659_100113619 Ga0070659_1001136193 196
1245 3300005366 Ga0070659_100283818 Ga0070659_1002838182 196
1246 3300005366 Ga0070659_100359786 Ga0070659_1003597861 196
1247 3300005366 Ga0070659_100714118 Ga0070659_1007141182 196
1248 3300005367 Ga0070667_100076648 Ga0070667_1000766482 196
1249 3300005367 Ga0070667_100254212 Ga0070667_1002542122 196
1250 3300005455 Ga0070663_100101118 Ga0070663_1001011184 196
1251 3300005455 Ga0070663_100156296 Ga0070663_1001562962 196
1252 3300005455 Ga0070663_100282278 Ga0070663_1002822782 196
1253 3300005456 Ga0070678_100030205 Ga0070678_1000302053 196
1254 3300005456 Ga0070678_100297382 Ga0070678_1002973821 196
1255 3300005456 Ga0070678_100460422 Ga0070678_1004604221 196
1256 3300005457 Ga0070662_100007391 Ga0070662_1000073915 196
1257 3300005457 Ga0070662_100035372 Ga0070662_1000353723 196
1258 3300005457 Ga0070662_100233007 Ga0070662_1002330072 196
1259 3300005457 Ga0070662_100293120 Ga0070662_1002931202 196
1260 3300005457 Ga0070662_100423477 Ga0070662_1004234772 196
1261 3300005459 Ga0068867_100022951 Ga0068867_1000229514 196
1262 3300005459 Ga0068867_100097755 Ga0068867_1000977552 196
1263 3300005459 Ga0068867_100099727 Ga0068867_1000997272 196
1264 3300005459 Ga0068867_100248495 Ga0068867_1002484952 196
1265 3300005518 Ga0070699_100354844 Ga0070699_1003548442 196
1266 3300005535 Ga0070684_100771302 Ga0070684_1007713021 196
1267 3300005539 Ga0068853_100064885 Ga0068853_1000648851 196
1268 3300005539 Ga0068853_100515763 Ga0068853_1005157632 196
1269 3300005539 Ga0068853_100776401 Ga0068853_1007764011 196
1270 3300005543 Ga0070672_100005430 Ga0070672_1000054304 196
1271 3300005543 Ga0070672_100011962 Ga0070672_1000119627 196
1272 3300005543 Ga0070672_100018915 Ga0070672_1000189155 196
1273 3300005543 Ga0070672_100059617 Ga0070672_1000596173 196
1274 3300005544 Ga0070686_100049032 Ga0070686_1000490322 196
1275 3300005547 Ga0070693_100590180 Ga0070693_1005901802 196
1276 3300005563 Ga0068855_100080910 Ga0068855_1000809104 196
1277 3300005563 Ga0068855_100252775 Ga0068855_1002527752 196
1278 3300005564 Ga0070664_100008765 Ga0070664_1000087652 196
1279 3300005564 Ga0070664_100071342 Ga0070664_1000713423 196
1280 3300005564 Ga0070664_100624290 Ga0070664_1006242902 196
1281 3300005577 Ga0068857_100404442 Ga0068857_1004044422 196
1282 3300005614 Ga0068856_100807665 Ga0068856_1008076651 196
1283 3300005616 Ga0068852_100015504 Ga0068852_1000155043 196
1284 3300005616 Ga0068852_100028411 Ga0068852_1000284112 196
1285 3300005616 Ga0068852_100041175 Ga0068852_1000411753 196
1286 3300005616 Ga0068852_100260687 Ga0068852_1002606872 196
1287 3300005616 Ga0068852_100537827 Ga0068852_1005378272 196
1288 3300005616 Ga0068852_100836641 Ga0068852_1008366412 196
1289 3300005616 Ga0068852_101033026 Ga0068852_1010330261 196
1290 3300005617 Ga0068859_100037075 Ga0068859_1000370752 196
1291 3300005617 Ga0068859_100220745 Ga0068859_1002207453 196
1292 3300005618 Ga0068864_100026599 Ga0068864_1000265995 196
1293 3300005618 Ga0068864_100319299 Ga0068864_1003192992 196
1294 3300005718 Ga0068866_10282131 Ga0068866_102821312 196
1295 3300005719 Ga0068861_100007197 Ga0068861_1000071975 196
1296 3300005719 Ga0068861_100026911 Ga0068861_1000269114 196
1297 3300005841 Ga0068863_100125022 Ga0068863_1001250223 196
1298 3300005842 Ga0068858_100032248 Ga0068858_1000322486 196
1299 3300005842 Ga0068858_100065468 Ga0068858_1000654683 196
1300 3300005843 Ga0068860_100002908 Ga0068860_1000029084 196
1301 3300005843 Ga0068860_100044216 Ga0068860_1000442164 196
1302 3300005844 Ga0068862_100075168 Ga0068862_1000751684 196
1303 3300005844 Ga0068862_100159661 Ga0068862_1001596612 196
1304 3300006038 Ga0075365_10678720 Ga0075365_106787202 196
1305 3300006042 Ga0075368_10019549 Ga0075368_100195492 196
1306 3300006048 Ga0075363_100196238 Ga0075363_1001962382 196
1307 3300006163 Ga0070715_10209897 Ga0070715_102098971 196
1308 3300006173 Ga0070716_100709262 Ga0070716_1007092622 196
1309 3300006178 Ga0075367_10004234 Ga0075367_100042344 196
1310 3300006178 Ga0075367_10042880 Ga0075367_100428802 196
1311 3300006186 Ga0075369_10037984 Ga0075369_100379841 196
1312 3300006195 Ga0075366_10012133 Ga0075366_100121333 196
1313 3300006195 Ga0075366_10013206 Ga0075366_100132065 196
1314 3300006195 Ga0075366_10020947 Ga0075366_100209472 196
1315 3300006195 Ga0075366_10030020 Ga0075366_100300202 196
1316 3300006195 Ga0075366_10054927 Ga0075366_100549273 196
1317 3300006237 Ga0097621_100012521 Ga0097621_1000125212 196
1318 3300006237 Ga0097621_100101443 Ga0097621_1001014433 196
1319 3300006353 Ga0075370_10001707 Ga0075370_100017072 196
1320 3300006353 Ga0075370_10002348 Ga0075370_100023485 196
1321 3300006353 Ga0075370_10013870 Ga0075370_100138703 196
1322 3300006353 Ga0075370_10041400 Ga0075370_100414002 196
1323 3300006358 Ga0068871_100186995 Ga0068871_1001869952 196
1324 3300006358 Ga0068871_100228153 Ga0068871_1002281532 196
1325 3300006358 Ga0068871_100338389 Ga0068871_1003383892 196
1326 3300006881 Ga0068865_100027454 Ga0068865_1000274542 196
1327 3300006881 Ga0068865_100141816 Ga0068865_1001418162 196
1328 3300006881 Ga0068865_100245462 Ga0068865_1002454622 196
1329 3300006881 Ga0068865_100389715 Ga0068865_1003897152 196
1330 3300006914 Ga0075436_100248271 Ga0075436_1002482712 196
1331 3300006931 Ga0097620_100037073 Ga0097620_1000370732 196
1332 3300006931 Ga0097620_100220752 Ga0097620_1002207522 196
1333 3300009036 Ga0105244_10006199 Ga0105244_100061999 196
1334 3300009036 Ga0105244_10057750 Ga0105244_100577502 196
1335 3300009093 Ga0105240_10023280 Ga0105240_100232804 196
1336 3300009098 Ga0105245_10425986 Ga0105245_104259862 196
1337 3300009101 Ga0105247_10491885 Ga0105247_104918851 196
1338 3300009148 Ga0105243_10068966 Ga0105243_100689662 196
1339 3300009148 Ga0105243_10144456 Ga0105243_101444562 196
1340 3300009148 Ga0105243_10159256 Ga0105243_101592562 196
1341 3300009148 Ga0105243_10549882 Ga0105243_105498822 196
1342 3300009148 Ga0105243_10700645 Ga0105243_107006452 196
1343 3300009174 Ga0105241_10025166 Ga0105241_100251662 196
1344 3300009174 Ga0105241_10066804 Ga0105241_100668043 196
1345 3300009176 Ga0105242_10400463 Ga0105242_104004632 196
1346 3300009176 Ga0105242_11048213 Ga0105242_110482131 196
1347 3300009545 Ga0105237_10081736 Ga0105237_100817362 196
1348 3300009545 Ga0105237_10456705 Ga0105237_104567052 196
1349 3300009551 Ga0105238_10148762 Ga0105238_101487622 196
1350 3300009553 Ga0105249_10169676 Ga0105249_101696762 196
1351 3300009553 Ga0105249_10556432 Ga0105249_105564322 196
1352 3300010375 Ga0105239_10064793 Ga0105239_100647933 196
1353 3300010375 Ga0105239_11237604 Ga0105239_112376042 196
1354 3300011119 Ga0105246_10041957 Ga0105246_100419575 196
1355 3300011119 Ga0105246_10166342 Ga0105246_101663423 196
1356 3300012505 Ga0157339_1001556 Ga0157339_10015562 196
1357 3300013102 Ga0157371_10000153 Ga0157371_1000015319 196
1358 3300013102 Ga0157371_10055385 Ga0157371_100553853 196
1359 3300013102 Ga0157371_10563443 Ga0157371_105634432 196
1360 3300013102 Ga0157371_10706933 Ga0157371_107069331 196
1361 3300013104 Ga0157370_10391985 Ga0157370_103919852 196
1362 3300013104 Ga0157370_10801777 Ga0157370_108017772 196
1363 3300013297 Ga0157378_10008040 Ga0157378_100080402 196
1364 3300013297 Ga0157378_10179017 Ga0157378_101790172 196
1365 3300013306 Ga0163162_10017155 Ga0163162_100171551 196
1366 3300013308 Ga0157375_10279795 Ga0157375_102797952 196
1367 3300014326 Ga0157380_10869159 Ga0157380_108691592 196
1368 3300014497 Ga0182008_10005176 Ga0182008_100051766 196
1369 3300014497 Ga0182008_10008326 Ga0182008_100083266 196
1370 3300014968 Ga0157379_10118471 Ga0157379_101184713 196
1371 3300014968 Ga0157379_10152243 Ga0157379_101522433 196
1372 3300014968 Ga0157379_10313989 Ga0157379_103139892 196
1373 3300015261 Ga0182006_1005565 Ga0182006_10055653 196
1374 3300015261 Ga0182006_1014247 Ga0182006_10142473 196
1375 3300015262 Ga0182007_10004830 Ga0182007_100048306 196
1376 3300017792 Ga0163161_10024563 Ga0163161_100245632 196
1377 3300017792 Ga0163161_10060195 Ga0163161_100601952 196
1378 3300025228 Ga0209672_100962 Ga0209672_1009626 196
1379 3300025229 Ga0209147_101143 Ga0209147_1011438 196
1380 3300025230 Ga0209563_100143 Ga0209563_10014322 196
1381 3300025242 Ga0209258_100015 Ga0209258_100015452 196
1382 3300025245 Ga0207425_1001302 Ga0207425_10013029 196
1383 3300025245 Ga0207425_1004478 Ga0207425_10044784 196
1384 3300025253 Ga0209677_102615 Ga0209677_1026156 196
1385 3300025254 Ga0209148_1000028 Ga0209148_1000028217 196
1386 3300025254 Ga0209148_1000229 Ga0209148_100022963 196
1387 3300025258 Ga0209129_1000246 Ga0209129_100024636 196
1388 3300025258 Ga0209129_1000576 Ga0209129_100057620 196
1389 3300025263 Ga0209565_1000405 Ga0209565_100040520 196
1390 3300025273 Ga0209673_1000356 Ga0209673_100035614 196
1391 3300025273 Ga0209673_1001242 Ga0209673_100124219 196
1392 3300025284 Ga0209130_1001104 Ga0209130_10011045 196
1393 3300025284 Ga0209130_1001270 Ga0209130_10012705 196
1394 3300025284 Ga0209130_1001682 Ga0209130_10016823 196
1395 3300025291 Ga0209675_1000607 Ga0209675_10006077 196
1396 3300025292 Ga0209676_1000167 Ga0209676_1000167110 196
1397 3300025292 Ga0209676_1000659 Ga0209676_10006594 196
1398 3300025292 Ga0209676_1007050 Ga0209676_10070505 196
1399 3300025294 Ga0209025_1001414 Ga0209025_100141419 196
1400 3300025295 Ga0209564_1000847 Ga0209564_100084719 196
1401 3300025295 Ga0209564_1001479 Ga0209564_10014793 196
1402 3300025297 Ga0209758_1000039 Ga0209758_1000039220 196
1403 3300025298 Ga0209050_1000015 Ga0209050_1000015489 196
1404 3300025298 Ga0209050_1000945 Ga0209050_10009452 196
1405 3300025299 Ga0209256_1000074 Ga0209256_1000074220 196
1406 3300025299 Ga0209256_1000787 Ga0209256_100078719 196
1407 3300025302 Ga0207426_1000121 Ga0207426_1000121219 196
1408 3300025302 Ga0207426_1000683 Ga0207426_100068320 196
1409 3300025303 Ga0209051_1000010 Ga0209051_1000010489 196
1410 3300025303 Ga0209051_1000175 Ga0209051_1000175110 196
1411 3300025303 Ga0209051_1000513 Ga0209051_100051335 196
1412 3300025303 Ga0209051_1009880 Ga0209051_10098805 196
1413 3300025304 Ga0209257_1000026 Ga0209257_1000026188 196
1414 3300025304 Ga0209257_1001106 Ga0209257_100110613 196
1415 3300025304 Ga0209257_1003300 Ga0209257_10033008 196
1416 3300025304 Ga0209257_1012758 Ga0209257_10127582 196
1417 3300025321 Ga0207656_10210514 Ga0207656_102105142 196
1418 3300025728 Ga0207655_1007523 Ga0207655_10075236 196
1419 3300025893 Ga0207682_10094102 Ga0207682_100941022 196
1420 3300025899 Ga0207642_10016503 Ga0207642_100165031 196
1421 3300025901 Ga0207688_10029723 Ga0207688_100297233 196
1422 3300025903 Ga0207680_10097570 Ga0207680_100975701 196
1423 3300025905 Ga0207685_10034303 Ga0207685_100343031 196
1424 3300025907 Ga0207645_10013620 Ga0207645_100136202 196
1425 3300025907 Ga0207645_10324888 Ga0207645_103248881 196
1426 3300025908 Ga0207643_10133600 Ga0207643_101336002 196
1427 3300025909 Ga0207705_10002493 Ga0207705_1000249310 196
1428 3300025909 Ga0207705_10197245 Ga0207705_101972452 196
1429 3300025910 Ga0207684_10010838 Ga0207684_100108384 196
1430 3300025911 Ga0207654_10087592 Ga0207654_100875922 196
1431 3300025911 Ga0207654_10106349 Ga0207654_101063492 196
1432 3300025913 Ga0207695_10041887 Ga0207695_100418876 196
1433 3300025913 Ga0207695_10332073 Ga0207695_103320732 196
1434 3300025913 Ga0207695_10580992 Ga0207695_105809922 196
1435 3300025913 Ga0207695_10973081 Ga0207695_109730812 196
1436 3300025914 Ga0207671_10073022 Ga0207671_100730222 196
1437 3300025914 Ga0207671_10247550 Ga0207671_102475502 196
1438 3300025918 Ga0207662_10016086 Ga0207662_100160862 196
1439 3300025919 Ga0207657_10055775 Ga0207657_100557753 196
1440 3300025919 Ga0207657_10268198 Ga0207657_102681982 196
1441 3300025919 Ga0207657_10319427 Ga0207657_103194272 196
1442 3300025919 Ga0207657_10510216 Ga0207657_105102162 196
1443 3300025920 Ga0207649_10031335 Ga0207649_100313353 196
1444 3300025920 Ga0207649_10037522 Ga0207649_100375224 196
1445 3300025923 Ga0207681_10000367 Ga0207681_100003673 196
1446 3300025923 Ga0207681_10075197 Ga0207681_100751973 196
1447 3300025925 Ga0207650_10002949 Ga0207650_100029498 196
1448 3300025925 Ga0207650_10045938 Ga0207650_100459382 196
1449 3300025925 Ga0207650_10177447 Ga0207650_101774472 196
1450 3300025926 Ga0207659_10052346 Ga0207659_100523463 196
1451 3300025926 Ga0207659_10121573 Ga0207659_101215732 196
1452 3300025927 Ga0207687_10170912 Ga0207687_101709122 196
1453 3300025931 Ga0207644_10015344 Ga0207644_100153446 196
1454 3300025931 Ga0207644_10068448 Ga0207644_100684482 196
1455 3300025931 Ga0207644_10379624 Ga0207644_103796242 196
1456 3300025932 Ga0207690_10221868 Ga0207690_102218682 196
1457 3300025933 Ga0207706_10010614 Ga0207706_100106144 196
1458 3300025933 Ga0207706_10061637 Ga0207706_100616372 196
1459 3300025933 Ga0207706_10249018 Ga0207706_102490182 196
1460 3300025934 Ga0207686_10026772 Ga0207686_100267723 196
1461 3300025934 Ga0207686_10045158 Ga0207686_100451583 196
1462 3300025935 Ga0207709_10000436 Ga0207709_1000043619 196
1463 3300025935 Ga0207709_10041841 Ga0207709_100418412 196
1464 3300025935 Ga0207709_10210079 Ga0207709_102100792 196
1465 3300025937 Ga0207669_10218127 Ga0207669_102181272 196
1466 3300025938 Ga0207704_10015442 Ga0207704_100154423 196
1467 3300025938 Ga0207704_10134773 Ga0207704_101347732 196
1468 3300025939 Ga0207665_10651198 Ga0207665_106511982 196
1469 3300025940 Ga0207691_10003420 Ga0207691_100034207 196
1470 3300025940 Ga0207691_10013320 Ga0207691_100133205 196
1471 3300025940 Ga0207691_10077609 Ga0207691_100776092 196
1472 3300025940 Ga0207691_10094002 Ga0207691_100940022 196
1473 3300025941 Ga0207711_10034232 Ga0207711_100342324 196
1474 3300025941 Ga0207711_10203673 Ga0207711_102036732 196
1475 3300025941 Ga0207711_10549728 Ga0207711_105497282 196
1476 3300025941 Ga0207711_10964162 Ga0207711_109641621 196
1477 3300025942 Ga0207689_10008839 Ga0207689_100088395 196
1478 3300025942 Ga0207689_10426304 Ga0207689_104263042 196
1479 3300025945 Ga0207679_10023351 Ga0207679_100233516 196
1480 3300025945 Ga0207679_10055228 Ga0207679_100552282 196
1481 3300025949 Ga0207667_10006091 Ga0207667_100060913 196
1482 3300025949 Ga0207667_10538960 Ga0207667_105389601 196
1483 3300025960 Ga0207651_10021326 Ga0207651_100213265 196
1484 3300025960 Ga0207651_10106054 Ga0207651_101060542 196
1485 3300025972 Ga0207668_10006769 Ga0207668_100067695 196
1486 3300025972 Ga0207668_10015717 Ga0207668_100157174 196
1487 3300025972 Ga0207668_10045412 Ga0207668_100454122 196
1488 3300025986 Ga0207658_10014403 Ga0207658_100144034 196
1489 3300026023 Ga0207677_10008949 Ga0207677_100089496 196
1490 3300026023 Ga0207677_10180838 Ga0207677_101808381 196
1491 3300026035 Ga0207703_10009567 Ga0207703_100095677 196
1492 3300026035 Ga0207703_10068613 Ga0207703_100686133 196
1493 3300026041 Ga0207639_10004292 Ga0207639_100042929 196
1494 3300026041 Ga0207639_10193841 Ga0207639_101938413 196
1495 3300026041 Ga0207639_10479259 Ga0207639_104792592 196
1496 3300026067 Ga0207678_10074100 Ga0207678_100741002 196
1497 3300026067 Ga0207678_10165587 Ga0207678_101655872 196
1498 3300026067 Ga0207678_10469866 Ga0207678_104698662 196
1499 3300026075 Ga0207708_10005130 Ga0207708_100051304 196
1500 3300026078 Ga0207702_10050522 Ga0207702_100505224 196
1501 3300026078 Ga0207702_10367302 Ga0207702_103673022 196
1502 3300026088 Ga0207641_10111819 Ga0207641_101118192 196
1503 3300026089 Ga0207648_10026807 Ga0207648_100268074 196
1504 3300026089 Ga0207648_10027227 Ga0207648_100272272 196
1505 3300026089 Ga0207648_10144987 Ga0207648_101449872 196
1506 3300026089 Ga0207648_10768047 Ga0207648_107680472 196
1507 3300026095 Ga0207676_10091889 Ga0207676_100918892 196
1508 3300026116 Ga0207674_10238522 Ga0207674_102385222 196
1509 3300026116 Ga0207674_10445099 Ga0207674_104450992 196
1510 3300026118 Ga0207675_100010737 Ga0207675_1000107375 196
1511 3300026118 Ga0207675_100042676 Ga0207675_1000426762 196
1512 3300026121 Ga0207683_10116800 Ga0207683_101168001 196
1513 3300026121 Ga0207683_10174016 Ga0207683_101740162 196
1514 3300026121 Ga0207683_10451174 Ga0207683_104511742 196
1515 3300026121 Ga0207683_10842965 Ga0207683_108429651 196
1516 3300026142 Ga0207698_10036933 Ga0207698_100369333 196
1517 3300026142 Ga0207698_10216057 Ga0207698_102160573 196
1518 3300026142 Ga0207698_10805277 Ga0207698_108052772 196
1519 3300027866 Ga0209813_10044398 Ga0209813_100443982 196
1520 3300027866 Ga0209813_10072934 Ga0209813_100729341 196
1521 3300028379 Ga0268266_10094857 Ga0268266_100948573 196
1522 3300028379 Ga0268266_10377975 Ga0268266_103779752 196
1523 3300028380 Ga0268265_10001580 Ga0268265_100015804 196
1524 3300028380 Ga0268265_10033303 Ga0268265_100333034 196
1525 3300028381 Ga0268264_10000909 Ga0268264_1000090911 196
1526 3300028381 Ga0268264_10012844 Ga0268264_100128445 196
1527 3300028786 Ga0307517_10181751 Ga0307517_101817512 196
1528 3300028794 Ga0307515_10197133 Ga0307515_101971333 196
1529 3300028794 Ga0307515_10464829 Ga0307515_104648292 196
1530 3300030736 Ga0316180_1041316 Ga0316180_10413162 196
1531 3300031456 Ga0307513_10324513 Ga0307513_103245133 196
1532 3300031456 Ga0307513_10348362 Ga0307513_103483622 196
1533 3300031730 Ga0307516_10045798 Ga0307516_100457984 196
1534 3300032004 Ga0307414_10719811 Ga0307414_107198111 196
1535 3300035089 Ga0373944_0023572 Ga0373944_0023572_103_705 196
1536 3300035116 Ga0373945_0039471 Ga0373945_0039471_748_1338 196
1537 3300035117 Ga0373953_0165992 Ga0373953_0165992_41_631 196
1538 3300035119 Ga0373956_0196024 Ga0373956_0196024_133_723 196
1539 3300035120 Ga0373957_0069546 Ga0373957_0069546_172_762 196
1540 3300035172 Ga0373955_0471964 Ga0373955_0471964_97_687 196
1541 3300035410 Ga0373924_0081545 Ga0373924_0081545_659_1249 196
1542 3300035695 Ga0373927_0014011 Ga0373927_0014011_2894_3496 196
1543 3300037068 Ga0373925_0034130 Ga0373925_0034130_844_1446 196
1544 3300037312 Ga0395899_0033686 Ga0395899_0033686_2766_3386 196
1545 3300037312 Ga0395899_0036250 Ga0395899_0036250_1542_2162 196
1546 3300037418 Ga0395900_0001245 Ga0395900_0001245_24691_25311 196
1547 3300037418 Ga0395900_0005828 Ga0395900_0005828_2341_2961 196
1548 3300037418 Ga0395900_0297355 Ga0395900_0297355_419_1039 196
1549 3300037466 Ga0395898_0114703 Ga0395898_0114703_1227_1847 196
1550 3300037466 Ga0395898_0126865 Ga0395898_0126865_406_1026 196
1551 3300037466 Ga0395898_0249468 Ga0395898_0249468_325_942 196
1552 3300037471 Ga0395905_0095289 Ga0395905_0095289_1529_2149 196
1553 3300037471 Ga0395905_0118140 Ga0395905_0118140_842_1462 196
1554 3300038443 Ga0395901_0000227 Ga0395901_0000227_2916_3536 196
1555 3300038443 Ga0395901_0009689 Ga0395901_0009689_7618_8238 196
1556 3300039437 Ga0436365_0273360 Ga0436365_0273360_208_804 196
1557 3300042005 Ga0439448_0000870 Ga0439448_0000870_869_1489 196
1558 3300042005 Ga0439448_0072957 Ga0439448_0072957_449_1069 196
1559 3300042007 Ga0439449_0007021 Ga0439449_0007021_271_891 196
1560 3300042008 Ga0439450_016459 Ga0439450_016459_348_968 196
1561 3300042139 Ga0450904_001473 Ga0450904_001473_2128_2742 196
1562 3300042157 Ga0439458_0019461 Ga0439458_0019461_567_1187 196
1563 3300044656 Ga0466969_0091776 Ga0466969_0091776_194_814 196
1564 3300044683 Ga0466965_0023464 Ga0466965_0023464_36_656 196
1565 3300044683 Ga0466965_0122390 Ga0466965_0122390_158_778 196
1566 3300044684 Ga0466966_0015044 Ga0466966_0015044_2378_2998 196
1567 3300044684 Ga0466966_0225306 Ga0466966_0225306_14_634 196
1568 3300044694 Ga0466963_0151731 Ga0466963_0151731_682_1302 196
1569 3300044706 Ga0466964_0120876 Ga0466964_0120876_480_1100 196
1570 3300044842 Ga0466957_0000288 Ga0466957_0000288_22499_23119 196
1571 3300044842 Ga0466957_0013525 Ga0466957_0013525_1471_2121 196
1572 3300044842 Ga0466957_0292085 Ga0466957_0292085_374_994 196
1573 3300045049 Ga0466959_0020692 Ga0466959_0020692_1882_2502 196
1574 3300045836 Ga0466958_0251068 Ga0466958_0251068_285_905 196
1575 3300045976 Ga0466967_0049432 Ga0466967_0049432_2311_2931 196
1576 3300046452 Ga0495617_000046 Ga0495617_000046_96390_97007 196
1577 3300046452 Ga0495617_012911 Ga0495617_012911_1094_1705 196
1578 3300046453 Ga0495627_000476 Ga0495627_000476_14883_15500 196
1579 3300046453 Ga0495627_008595 Ga0495627_008595_2193_2810 196
1580 3300046453 Ga0495627_033588 Ga0495627_033588_312_902 196
1581 3300046455 Ga0495603_0037669 Ga0495603_0037669_1715_2332 196
1582 3300046455 Ga0495603_0073196 Ga0495603_0073196_969_1586 196
1583 3300046455 Ga0495603_0386009 Ga0495603_0386009_125_715 196
1584 3300046457 Ga0495590_0000134 Ga0495590_0000134_23515_24132 196
1585 3300046457 Ga0495590_0002591 Ga0495590_0002591_319_936 196
1586 3300046457 Ga0495590_0010844 Ga0495590_0010844_1761_2378 196
1587 3300046457 Ga0495590_0087403 Ga0495590_0087403_282_893 196
1588 3300046458 Ga0495591_001540 Ga0495591_001540_8677_9294 196
1589 3300046460 Ga0495638_0001308 Ga0495638_0001308_10192_10803 196
1590 3300046460 Ga0495638_0066647 Ga0495638_0066647_255_872 196
1591 3300046460 Ga0495638_0359437 Ga0495638_0359437_83_697 196
1592 3300046460 Ga0495638_0364683 Ga0495638_0364683_30_647 196
1593 3300046463 Ga0495653_0123067 Ga0495653_0123067_550_1167 196
1594 3300046471 Ga0495650_0000248 Ga0495650_0000248_70351_70965 196
1595 3300046471 Ga0495650_0001029 Ga0495650_0001029_14759_15376 196
1596 3300046471 Ga0495650_0041314 Ga0495650_0041314_627_1241 196
1597 3300046471 Ga0495650_0041872 Ga0495650_0041872_670_1287 196
1598 3300046473 Ga0495582_0037622 Ga0495582_0037622_958_1575 196
1599 3300046473 Ga0495582_0269050 Ga0495582_0269050_322_912 196
1600 3300046474 Ga0495605_0000284 Ga0495605_0000284_18424_19041 196
1601 3300046474 Ga0495605_0003169 Ga0495605_0003169_5908_6519 196
1602 3300046474 Ga0495605_0003708 Ga0495605_0003708_6156_6773 196
1603 3300046474 Ga0495605_0007184 Ga0495605_0007184_4890_5507 196
1604 3300046474 Ga0495605_0025578 Ga0495605_0025578_2140_2757 196
1605 3300046474 Ga0495605_0030988 Ga0495605_0030988_1427_2044 196
1606 3300046474 Ga0495605_0071841 Ga0495605_0071841_507_1124 196
1607 3300046474 Ga0495605_0122685 Ga0495605_0122685_112_729 196
1608 3300046474 Ga0495605_0217122 Ga0495605_0217122_47_664 196
1609 3300046491 Ga0495584_0000241 Ga0495584_0000241_12983_13603 196
1610 3300046491 Ga0495584_0000276 Ga0495584_0000276_16076_16693 196
1611 3300046491 Ga0495584_0002554 Ga0495584_0002554_7108_7728 196
1612 3300046491 Ga0495584_0004319 Ga0495584_0004319_5066_5683 196
1613 3300046491 Ga0495584_0016912 Ga0495584_0016912_2548_3165 196
1614 3300046491 Ga0495584_0135096 Ga0495584_0135096_344_961 196
1615 3300046491 Ga0495584_0243957 Ga0495584_0243957_219_836 196
1616 3300046492 Ga0495585_0002464 Ga0495585_0002464_12084_12701 196
1617 3300046492 Ga0495585_0005435 Ga0495585_0005435_3344_3961 196
1618 3300046492 Ga0495585_0007132 Ga0495585_0007132_5796_6413 196
1619 3300046492 Ga0495585_0021982 Ga0495585_0021982_2359_2970 196
1620 3300046492 Ga0495585_0023714 Ga0495585_0023714_2019_2636 196
1621 3300046492 Ga0495585_0024052 Ga0495585_0024052_2061_2678 196
1622 3300046492 Ga0495585_0024939 Ga0495585_0024939_406_1023 196
1623 3300046492 Ga0495585_0036294 Ga0495585_0036294_1231_1842 196
1624 3300046492 Ga0495585_0037171 Ga0495585_0037171_686_1303 196
1625 3300046492 Ga0495585_0051421 Ga0495585_0051421_370_987 196
1626 3300046492 Ga0495585_0070094 Ga0495585_0070094_1122_1739 196
1627 3300046499 Ga0495594_0001034 Ga0495594_0001034_5001_5639 196
1628 3300046499 Ga0495594_0007956 Ga0495594_0007956_4424_5041 196
1629 3300046499 Ga0495594_0018814 Ga0495594_0018814_1848_2465 196
1630 3300046499 Ga0495594_0021622 Ga0495594_0021622_237_854 196
1631 3300046499 Ga0495594_0021993 Ga0495594_0021993_2233_2850 196
1632 3300046499 Ga0495594_0064178 Ga0495594_0064178_210_827 196
1633 3300046499 Ga0495594_0065167 Ga0495594_0065167_477_1094 196
1634 3300046499 Ga0495594_0099124 Ga0495594_0099124_789_1406 196
1635 3300046500 Ga0495596_0001002 Ga0495596_0001002_15826_16443 196
1636 3300046500 Ga0495596_0001598 Ga0495596_0001598_711_1328 196
1637 3300046500 Ga0495596_0002577 Ga0495596_0002577_8532_9149 196
1638 3300046500 Ga0495596_0002731 Ga0495596_0002731_2617_3234 196
1639 3300046500 Ga0495596_0029077 Ga0495596_0029077_879_1496 196
1640 3300046500 Ga0495596_0034738 Ga0495596_0034738_142_759 196
1641 3300046500 Ga0495596_0036710 Ga0495596_0036710_1006_1623 196
1642 3300046500 Ga0495596_0038443 Ga0495596_0038443_81_698 196
1643 3300046500 Ga0495596_0050386 Ga0495596_0050386_743_1360 196
1644 3300046501 Ga0495607_0001573 Ga0495607_0001573_5972_6589 196
1645 3300046501 Ga0495607_0001871 Ga0495607_0001871_16595_17215 196
1646 3300046501 Ga0495607_0002451 Ga0495607_0002451_10931_11548 196
1647 3300046501 Ga0495607_0009801 Ga0495607_0009801_2281_2898 196
1648 3300046501 Ga0495607_0027715 Ga0495607_0027715_2105_2716 196
1649 3300046501 Ga0495607_0055635 Ga0495607_0055635_1358_1975 196
1650 3300046501 Ga0495607_0063895 Ga0495607_0063895_254_865 196
1651 3300046501 Ga0495607_0084815 Ga0495607_0084815_1068_1685 196
1652 3300046501 Ga0495607_0140263 Ga0495607_0140263_590_1207 196
1653 3300046501 Ga0495607_0302893 Ga0495607_0302893_47_664 196
1654 3300046506 Ga0495583_0000063 Ga0495583_0000063_9810_10421 196
1655 3300046506 Ga0495583_0001885 Ga0495583_0001885_12918_13535 196
1656 3300046506 Ga0495583_0002379 Ga0495583_0002379_8044_8661 196
1657 3300046506 Ga0495583_0002792 Ga0495583_0002792_950_1567 196
1658 3300046506 Ga0495583_0031975 Ga0495583_0031975_423_1019 196
1659 3300046506 Ga0495583_0047815 Ga0495583_0047815_157_774 196
1660 3300046506 Ga0495583_0069700 Ga0495583_0069700_929_1519 196
1661 3300046507 Ga0495606_0017080 Ga0495606_0017080_3052_3669 196
1662 3300046507 Ga0495606_0207396 Ga0495606_0207396_16_633 196
1663 3300046512 Ga0495610_0004443 Ga0495610_0004443_5778_6395 196
1664 3300046512 Ga0495610_0047899 Ga0495610_0047899_1264_1854 196
1665 3300046513 Ga0495616_0000351 Ga0495616_0000351_7482_8096 196
1666 3300046513 Ga0495616_0001306 Ga0495616_0001306_4697_5314 196
1667 3300046513 Ga0495616_0003756 Ga0495616_0003756_8160_8750 196
1668 3300046513 Ga0495616_0008093 Ga0495616_0008093_1428_2048 196
1669 3300046513 Ga0495616_0008388 Ga0495616_0008388_39_656 196
1670 3300046513 Ga0495616_0011406 Ga0495616_0011406_367_984 196
1671 3300046513 Ga0495616_0017738 Ga0495616_0017738_670_1287 196
1672 3300046513 Ga0495616_0022338 Ga0495616_0022338_2777_3394 196
1673 3300046513 Ga0495616_0031763 Ga0495616_0031763_485_1102 196
1674 3300046513 Ga0495616_0033410 Ga0495616_0033410_661_1272 196
1675 3300046513 Ga0495616_0077187 Ga0495616_0077187_752_1369 196
1676 3300046517 Ga0495630_0023098 Ga0495630_0023098_568_1185 196
1677 3300046518 Ga0495631_0000279 Ga0495631_0000279_15153_15770 196
1678 3300046518 Ga0495631_0000531 Ga0495631_0000531_7552_8169 196
1679 3300046518 Ga0495631_0003440 Ga0495631_0003440_567_1157 196
1680 3300046518 Ga0495631_0004363 Ga0495631_0004363_823_1440 196
1681 3300046518 Ga0495631_0006947 Ga0495631_0006947_2601_3218 196
1682 3300046518 Ga0495631_0008227 Ga0495631_0008227_3679_4296 196
1683 3300046518 Ga0495631_0012021 Ga0495631_0012021_671_1288 196
1684 3300046518 Ga0495631_0016698 Ga0495631_0016698_2120_2737 196
1685 3300046518 Ga0495631_0037889 Ga0495631_0037889_195_812 196
1686 3300046518 Ga0495631_0139357 Ga0495631_0139357_67_684 196
1687 3300046519 Ga0495632_0000630 Ga0495632_0000630_20896_21513 196
1688 3300046519 Ga0495632_0001071 Ga0495632_0001071_6877_7494 196
1689 3300046519 Ga0495632_0001258 Ga0495632_0001258_14060_14677 196
1690 3300046519 Ga0495632_0001682 Ga0495632_0001682_13343_13960 196
1691 3300046519 Ga0495632_0003508 Ga0495632_0003508_10268_10864 196
1692 3300046519 Ga0495632_0005476 Ga0495632_0005476_1384_2001 196
1693 3300046519 Ga0495632_0012075 Ga0495632_0012075_1544_2161 196
1694 3300046519 Ga0495632_0086290 Ga0495632_0086290_675_1292 196
1695 3300046520 Ga0495637_0000349 Ga0495637_0000349_14870_15487 196
1696 3300046520 Ga0495637_0008518 Ga0495637_0008518_1698_2312 196
1697 3300046520 Ga0495637_0089504 Ga0495637_0089504_51_668 196
1698 3300046520 Ga0495637_0103937 Ga0495637_0103937_99_716 196
1699 3300046522 Ga0495643_0000931 Ga0495643_0000931_17565_18182 196
1700 3300046522 Ga0495643_0001329 Ga0495643_0001329_12303_12917 196
1701 3300046522 Ga0495643_0004615 Ga0495643_0004615_7403_8014 196
1702 3300046522 Ga0495643_0006332 Ga0495643_0006332_681_1298 196
1703 3300046522 Ga0495643_0007491 Ga0495643_0007491_3833_4450 196
1704 3300046523 Ga0495644_0002145 Ga0495644_0002145_657_1274 196
1705 3300046523 Ga0495644_0005106 Ga0495644_0005106_3819_4436 196
1706 3300046523 Ga0495644_0006599 Ga0495644_0006599_3839_4456 196
1707 3300046523 Ga0495644_0015113 Ga0495644_0015113_1355_1966 196
1708 3300046523 Ga0495644_0020223 Ga0495644_0020223_1291_1908 196
1709 3300046524 Ga0495648_0002900 Ga0495648_0002900_14665_15282 196
1710 3300046524 Ga0495648_0004016 Ga0495648_0004016_9620_10231 196
1711 3300046524 Ga0495648_0005157 Ga0495648_0005157_8795_9412 196
1712 3300046524 Ga0495648_0069662 Ga0495648_0069662_718_1335 196
1713 3300046524 Ga0495648_0112506 Ga0495648_0112506_723_1340 196
1714 3300046526 Ga0495666_0000578 Ga0495666_0000578_14288_14905 196
1715 3300046526 Ga0495666_0049367 Ga0495666_0049367_1275_1892 196
1716 3300046526 Ga0495666_0052266 Ga0495666_0052266_777_1394 196
1717 3300046526 Ga0495666_0081989 Ga0495666_0081989_134_772 196
1718 3300046528 Ga0495642_0000241 Ga0495642_0000241_18428_19045 196
1719 3300046528 Ga0495642_0001118 Ga0495642_0001118_600_1217 196
1720 3300046528 Ga0495642_0001502 Ga0495642_0001502_2736_3353 196
1721 3300046528 Ga0495642_0030852 Ga0495642_0030852_56_673 196
1722 3300046528 Ga0495642_0033307 Ga0495642_0033307_565_1182 196
1723 3300046528 Ga0495642_0075918 Ga0495642_0075918_415_1032 196
1724 3300046528 Ga0495642_0101051 Ga0495642_0101051_413_1030 196
1725 3300046528 Ga0495642_0279735 Ga0495642_0279735_102_719 196
1726 3300046529 Ga0495652_0018095 Ga0495652_0018095_3821_4438 196
1727 3300046530 Ga0495654_0005957 Ga0495654_0005957_675_1292 196
1728 3300046530 Ga0495654_0007490 Ga0495654_0007490_638_1255 196
1729 3300046530 Ga0495654_0010986 Ga0495654_0010986_648_1262 196
1730 3300046530 Ga0495654_0043681 Ga0495654_0043681_1165_1782 196
1731 3300046530 Ga0495654_0047363 Ga0495654_0047363_393_983 196
1732 3300046530 Ga0495654_0047657 Ga0495654_0047657_436_1053 196
1733 3300046531 Ga0495665_0014435 Ga0495665_0014435_644_1261 196
1734 3300046531 Ga0495665_0067457 Ga0495665_0067457_770_1387 196
1735 3300046531 Ga0495665_0306560 Ga0495665_0306560_27_644 196
1736 3300046533 Ga0495640_0056868 Ga0495640_0056868_340_957 196
1737 3300046535 Ga0495586_0006169 Ga0495586_0006169_5257_5874 196
1738 3300046536 Ga0495587_0020194 Ga0495587_0020194_3402_4019 196
1739 3300046536 Ga0495587_0020794 Ga0495587_0020794_1829_2446 196
1740 3300046538 Ga0495609_0000005 Ga0495609_0000005_419744_420364 196
1741 3300046538 Ga0495609_0000846 Ga0495609_0000846_12177_12794 196
1742 3300046538 Ga0495609_0001506 Ga0495609_0001506_543_1160 196
1743 3300046538 Ga0495609_0016726 Ga0495609_0016726_1153_1764 196
1744 3300046538 Ga0495609_0025175 Ga0495609_0025175_34_651 196
1745 3300046538 Ga0495609_0040889 Ga0495609_0040889_973_1590 196
1746 3300046538 Ga0495609_0195392 Ga0495609_0195392_29_646 196
1747 3300046542 Ga0495597_0000531 Ga0495597_0000531_17357_17974 196
1748 3300046542 Ga0495597_0000789 Ga0495597_0000789_4827_5438 196
1749 3300046542 Ga0495597_0000880 Ga0495597_0000880_11104_11721 196
1750 3300046542 Ga0495597_0002191 Ga0495597_0002191_1148_1789 196
1751 3300046542 Ga0495597_0002703 Ga0495597_0002703_901_1518 196
1752 3300046542 Ga0495597_0007241 Ga0495597_0007241_4542_5177 196
1753 3300046542 Ga0495597_0119167 Ga0495597_0119167_435_1052 196
1754 3300046543 Ga0495645_0116452 Ga0495645_0116452_1013_1633 196
1755 3300046557 Ga0495622_0095770 Ga0495622_0095770_479_1096 196
1756 3300046558 Ga0495633_0002165 Ga0495633_0002165_12084_12701 196
1757 3300046558 Ga0495633_0015452 Ga0495633_0015452_2109_2720 196
1758 3300046558 Ga0495633_0020058 Ga0495633_0020058_178_795 196
1759 3300046558 Ga0495633_0062581 Ga0495633_0062581_542_1159 196
1760 3300046558 Ga0495633_0072041 Ga0495633_0072041_504_1121 196
1761 3300046558 Ga0495633_0086637 Ga0495633_0086637_319_936 196
1762 3300046558 Ga0495633_0105194 Ga0495633_0105194_421_1038 196
1763 3300046615 Ga0495656_0012654 Ga0495656_0012654_1652_2263 196
1764 3300046615 Ga0495656_0028047 Ga0495656_0028047_67_687 196
1765 3300046615 Ga0495656_0068687 Ga0495656_0068687_439_1056 196
1766 3300046616 Ga0495668_0000906 Ga0495668_0000906_15716_16333 196
1767 3300046616 Ga0495668_0006526 Ga0495668_0006526_2311_2928 196
1768 3300046616 Ga0495668_0008911 Ga0495668_0008911_621_1238 196
1769 3300046616 Ga0495668_0045707 Ga0495668_0045707_1255_1872 196
1770 3300046616 Ga0495668_0233839 Ga0495668_0233839_301_918 196
1771 3300046616 Ga0495668_0263559 Ga0495668_0263559_39_656 196
1772 3300046642 Ga0495634_0008190 Ga0495634_0008190_5560_6177 196
1773 3300046648 Ga0495611_0000780 Ga0495611_0000780_680_1297 196
1774 3300046648 Ga0495611_0002987 Ga0495611_0002987_180_797 196
1775 3300046648 Ga0495611_0012773 Ga0495611_0012773_2353_2970 196
1776 3300046648 Ga0495611_0068885 Ga0495611_0068885_293_904 196
1777 3300046648 Ga0495611_0224858 Ga0495611_0224858_211_807 196
1778 3300046660 Ga0495625_0005169 Ga0495625_0005169_6379_6996 196
1779 3300046660 Ga0495625_0010120 Ga0495625_0010120_6104_6700 196
1780 3300046660 Ga0495625_0031431 Ga0495625_0031431_1331_1948 196
1781 3300046660 Ga0495625_0067643 Ga0495625_0067643_546_1163 196
1782 3300046660 Ga0495625_0091515 Ga0495625_0091515_1313_1924 196
1783 3300046660 Ga0495625_0126687 Ga0495625_0126687_869_1483 196
1784 3300046660 Ga0495625_0205944 Ga0495625_0205944_616_1233 196
1785 3300046660 Ga0495625_0226251 Ga0495625_0226251_381_992 196
1786 3300046660 Ga0495625_0477756 Ga0495625_0477756_104_718 196
1787 3300046663 Ga0495635_0172779 Ga0495635_0172779_723_1340 196
1788 3300046663 Ga0495635_0229018 Ga0495635_0229018_85_702 196
1789 3300046664 Ga0495659_0002749 Ga0495659_0002749_695_1306 196
1790 3300046665 Ga0495661_0000578 Ga0495661_0000578_18594_19214 196
1791 3300046665 Ga0495661_0001879 Ga0495661_0001879_2119_2736 196
1792 3300046665 Ga0495661_0002173 Ga0495661_0002173_12084_12701 196
1793 3300046665 Ga0495661_0003143 Ga0495661_0003143_9325_9942 196
1794 3300046665 Ga0495661_0007428 Ga0495661_0007428_5092_5709 196
1795 3300046665 Ga0495661_0012699 Ga0495661_0012699_2420_3037 196
1796 3300046665 Ga0495661_0030775 Ga0495661_0030775_1345_1962 196
1797 3300046665 Ga0495661_0039509 Ga0495661_0039509_2109_2726 196
1798 3300046665 Ga0495661_0052116 Ga0495661_0052116_223_840 196
1799 3300046665 Ga0495661_0070039 Ga0495661_0070039_552_1169 196
1800 3300046665 Ga0495661_0086618 Ga0495661_0086618_165_782 196
1801 3300046665 Ga0495661_0089409 Ga0495661_0089409_886_1503 196
1802 3300046674 Ga0495588_0011220 Ga0495588_0011220_1445_2062 196
1803 3300046674 Ga0495588_0044256 Ga0495588_0044256_1350_1967 196
1804 3300046674 Ga0495588_0079124 Ga0495588_0079124_416_1033 196
1805 3300046674 Ga0495588_0088843 Ga0495588_0088843_456_1073 196
1806 3300046674 Ga0495588_0210539 Ga0495588_0210539_175_792 196
1807 3300046679 Ga0495623_0066362 Ga0495623_0066362_577_1194 196
1808 3300046679 Ga0495623_0196929 Ga0495623_0196929_426_1043 196
1809 3300046683 Ga0495658_0155004 Ga0495658_0155004_743_1345 196
1810 3300046684 Ga0495669_0000301 Ga0495669_0000301_17373_17990 196
1811 3300046684 Ga0495669_0002948 Ga0495669_0002948_5024_5641 196
1812 3300046684 Ga0495669_0004020 Ga0495669_0004020_5071_5688 196
1813 3300046684 Ga0495669_0053638 Ga0495669_0053638_1127_1744 196
1814 3300046689 Ga0495613_0036327 Ga0495613_0036327_456_1073 196
1815 3300046690 Ga0495624_0502097 Ga0495624_0502097_46_663 196
1816 3300046691 Ga0495670_0004367 Ga0495670_0004367_850_1467 196
1817 3300046691 Ga0495670_0004955 Ga0495670_0004955_2822_3439 196
1818 3300046691 Ga0495670_0021399 Ga0495670_0021399_715_1332 196
1819 3300046691 Ga0495670_0037772 Ga0495670_0037772_1159_1776 196
1820 3300046691 Ga0495670_0055944 Ga0495670_0055944_1300_1911 196
1821 3300046691 Ga0495670_0125338 Ga0495670_0125338_498_1115 196
1822 3300046691 Ga0495670_0319480 Ga0495670_0319480_43_660 196
1823 3300046691 Ga0495670_0365117 Ga0495670_0365117_161_751 196
1824 3300046692 Ga0495671_0000893 Ga0495671_0000893_11515_12132 196
1825 3300046692 Ga0495671_0010857 Ga0495671_0010857_926_1543 196
1826 3300046692 Ga0495671_0011017 Ga0495671_0011017_1242_1853 196
1827 3300046692 Ga0495671_0014253 Ga0495671_0014253_2614_3231 196
1828 3300046692 Ga0495671_0069543 Ga0495671_0069543_890_1507 196
1829 3300046692 Ga0495671_0089616 Ga0495671_0089616_731_1348 196
1830 3300046692 Ga0495671_0130900 Ga0495671_0130900_140_757 196
1831 3300046694 Ga0495649_0001009 Ga0495649_0001009_2816_3412 196
1832 3300046694 Ga0495649_0001486 Ga0495649_0001486_1517_2134 196
1833 3300046694 Ga0495649_0003700 Ga0495649_0003700_754_1371 196
1834 3300046694 Ga0495649_0244954 Ga0495649_0244954_154_771 196
1835 3300046794 Ga0495589_0000277 Ga0495589_0000277_22350_22970 196
1836 3300046794 Ga0495589_0000595 Ga0495589_0000595_4405_5022 196
1837 3300046794 Ga0495589_0003209 Ga0495589_0003209_576_1193 196
1838 3300046794 Ga0495589_0015419 Ga0495589_0015419_2432_3049 196
1839 3300046794 Ga0495589_0025160 Ga0495589_0025160_2005_2622 196
1840 3300046794 Ga0495589_0031251 Ga0495589_0031251_1473_2090 196
1841 3300046794 Ga0495589_0062017 Ga0495589_0062017_773_1390 196
1842 3300046794 Ga0495589_0134176 Ga0495589_0134176_62_679 196
1843 3300046794 Ga0495589_0201104 Ga0495589_0201104_208_819 196
1844 3300046809 Ga0495600_0087627 Ga0495600_0087627_776_1393 196
1845 3300046809 Ga0495600_0179732 Ga0495600_0179732_317_934 196
1846 3300046809 Ga0495600_0338476 Ga0495600_0338476_138_728 196
1847 3300046810 Ga0495660_0001934 Ga0495660_0001934_12349_12966 196
1848 3300046810 Ga0495660_0001935 Ga0495660_0001935_2534_3151 196
1849 3300046810 Ga0495660_0004355 Ga0495660_0004355_6638_7234 196
1850 3300046810 Ga0495660_0008037 Ga0495660_0008037_2159_2776 196
1851 3300046810 Ga0495660_0016789 Ga0495660_0016789_3072_3689 196
1852 3300046810 Ga0495660_0069272 Ga0495660_0069272_392_1009 196
1853 3300046810 Ga0495660_0254780 Ga0495660_0254780_85_702 196
1854 3300047315 Ga0495581_0031510 Ga0495581_0031510_319_936 196
1855 3300047315 Ga0495581_0466994 Ga0495581_0466994_105_722 196
1856 3300047317 Ga0495604_0002301 Ga0495604_0002301_10842_11459 196
1857 3300047317 Ga0495604_0054177 Ga0495604_0054177_510_1127 196
1858 3300047317 Ga0495604_0080778 Ga0495604_0080778_207_824 196
1859 3300047317 Ga0495604_0094875 Ga0495604_0094875_771_1388 196
1860 3300047317 Ga0495604_0192254 Ga0495604_0192254_340_957 196
1861 3300047318 Ga0495636_0002775 Ga0495636_0002775_3405_4022 196
1862 3300047318 Ga0495636_0055230 Ga0495636_0055230_181_798 196
1863 3300047320 Ga0495672_0000732 Ga0495672_0000732_14554_15171 196
1864 3300047320 Ga0495672_0000769 Ga0495672_0000769_14440_15057 196
1865 3300047320 Ga0495672_0000895 Ga0495672_0000895_15914_16531 196
1866 3300047320 Ga0495672_0008509 Ga0495672_0008509_784_1395 196
1867 3300047320 Ga0495672_0013502 Ga0495672_0013502_52_669 196
1868 3300047320 Ga0495672_0115231 Ga0495672_0115231_677_1288 196
1869 3300047320 Ga0495672_0154565 Ga0495672_0154565_119_736 196
1870 3300047321 Ga0495676_0000099 Ga0495676_0000099_51669_52286 196
1871 3300047321 Ga0495676_0006300 Ga0495676_0006300_9375_9992 196
1872 3300047322 Ga0495680_0007715 Ga0495680_0007715_2821_3438 196
1873 3300047322 Ga0495680_0028277 Ga0495680_0028277_538_1155 196
1874 3300047323 Ga0495683_0000843 Ga0495683_0000843_6856_7473 196
1875 3300047323 Ga0495683_0005874 Ga0495683_0005874_4261_4872 196
1876 3300047323 Ga0495683_0012011 Ga0495683_0012011_393_1010 196
1877 3300047323 Ga0495683_0087455 Ga0495683_0087455_594_1211 196
1878 3300047323 Ga0495683_0099328 Ga0495683_0099328_732_1349 196
1879 3300047323 Ga0495683_0241072 Ga0495683_0241072_38_655 196
1880 3300047443 Ga0495687_000070 Ga0495687_000070_38822_39418 196
1881 3300047443 Ga0495687_000221 Ga0495687_000221_18997_19617 196
1882 3300047443 Ga0495687_000562 Ga0495687_000562_9864_10475 196
1883 3300047443 Ga0495687_001071 Ga0495687_001071_17450_18067 196
1884 3300047443 Ga0495687_001138 Ga0495687_001138_7761_8378 196
1885 3300047443 Ga0495687_001176 Ga0495687_001176_15609_16226 196
1886 3300047443 Ga0495687_008434 Ga0495687_008434_1596_2198 196
1887 3300047443 Ga0495687_019205 Ga0495687_019205_945_1541 196
1888 3300047444 Ga0495675_0025612 Ga0495675_0025612_610_1227 196
1889 3300047444 Ga0495675_0066442 Ga0495675_0066442_1108_1725 196
1890 3300047444 Ga0495675_0161310 Ga0495675_0161310_299_916 196
1891 3300047445 Ga0495677_0000060 Ga0495677_0000060_42361_42981 196
1892 3300047445 Ga0495677_0000482 Ga0495677_0000482_261_878 196
1893 3300047445 Ga0495677_0001127 Ga0495677_0001127_1643_2260 196
1894 3300047445 Ga0495677_0002011 Ga0495677_0002011_3573_4184 196
1895 3300047445 Ga0495677_0007858 Ga0495677_0007858_2693_3310 196
1896 3300047445 Ga0495677_0013295 Ga0495677_0013295_1790_2407 196
1897 3300047445 Ga0495677_0014005 Ga0495677_0014005_956_1573 196
1898 3300047445 Ga0495677_0020665 Ga0495677_0020665_1539_2156 196
1899 3300047445 Ga0495677_0020924 Ga0495677_0020924_1244_1861 196
1900 3300047445 Ga0495677_0063601 Ga0495677_0063601_298_915 196
1901 3300047445 Ga0495677_0118327 Ga0495677_0118327_259_876 196
1902 3300047446 Ga0495679_003545 Ga0495679_003545_6428_7045 196
1903 3300047446 Ga0495679_005612 Ga0495679_005612_4323_4940 196
1904 3300047446 Ga0495679_017920 Ga0495679_017920_502_1119 196
1905 3300047446 Ga0495679_026077 Ga0495679_026077_1248_1865 196
1906 3300047446 Ga0495679_106381 Ga0495679_106381_53_664 196
1907 3300047447 Ga0495685_000352 Ga0495685_000352_7286_7897 196
1908 3300047447 Ga0495685_003376 Ga0495685_003376_2333_2950 196
1909 3300047447 Ga0495685_007450 Ga0495685_007450_1093_1710 196
1910 3300047469 Ga0495673_0028551 Ga0495673_0028551_1532_2143 196
1911 3300047469 Ga0495673_0144092 Ga0495673_0144092_33_644 196
1912 3300047470 Ga0495681_0001200 Ga0495681_0001200_2449_3066 196
1913 3300047470 Ga0495681_0001614 Ga0495681_0001614_6670_7287 196
1914 3300047470 Ga0495681_0002347 Ga0495681_0002347_11252_11869 196
1915 3300047470 Ga0495681_0005451 Ga0495681_0005451_5357_5974 196
1916 3300047470 Ga0495681_0031797 Ga0495681_0031797_1576_2193 196
1917 3300047470 Ga0495681_0067783 Ga0495681_0067783_591_1208 196
1918 3300047470 Ga0495681_0082284 Ga0495681_0082284_307_921 196
1919 3300047470 Ga0495681_0117704 Ga0495681_0117704_497_1114 196
1920 3300047470 Ga0495681_0161322 Ga0495681_0161322_172_786 196
1921 3300047471 Ga0495684_0196520 Ga0495684_0196520_642_1232 196
1922 3300047472 Ga0495686_0001068 Ga0495686_0001068_23731_24348 196
1923 3300047472 Ga0495686_0002128 Ga0495686_0002128_1544_2161 196
1924 3300047472 Ga0495686_0074519 Ga0495686_0074519_277_894 196
1925 3300047472 Ga0495686_0079466 Ga0495686_0079466_457_1074 196
1926 3300047472 Ga0495686_0157666 Ga0495686_0157666_321_938 196
1927 3300047673 Ga0495593_0001611 Ga0495593_0001611_9667_10284 196
1928 3300047673 Ga0495593_0002310 Ga0495593_0002310_3454_4044 196
1929 3300047673 Ga0495593_0085078 Ga0495593_0085078_231_848 196
1930 3300048088 Ga0495602_0005336 Ga0495602_0005336_638_1255 196
1931 3300048089 Ga0495614_0003478 Ga0495614_0003478_5900_6517 196
1932 3300048089 Ga0495614_0153604 Ga0495614_0153604_80_697 196
1933 3300048091 Ga0495626_0000196 Ga0495626_0000196_55235_55852 196
1934 3300048091 Ga0495626_0001058 Ga0495626_0001058_15156_15773 196
1935 3300048091 Ga0495626_0002192 Ga0495626_0002192_190_804 196
1936 3300048091 Ga0495626_0003018 Ga0495626_0003018_717_1334 196
1937 3300048091 Ga0495626_0003196 Ga0495626_0003196_761_1396 196
1938 3300048091 Ga0495626_0004927 Ga0495626_0004927_6744_7361 196
1939 3300048091 Ga0495626_0012154 Ga0495626_0012154_2088_2708 196
1940 3300048091 Ga0495626_0012222 Ga0495626_0012222_1715_2332 196
1941 3300048091 Ga0495626_0012535 Ga0495626_0012535_3689_4303 196
1942 3300048091 Ga0495626_0014429 Ga0495626_0014429_651_1268 196
1943 3300048091 Ga0495626_0039402 Ga0495626_0039402_1157_1774 196
1944 3300048091 Ga0495626_0106848 Ga0495626_0106848_297_914 196
1945 3300048091 Ga0495626_0124283 Ga0495626_0124283_48_665 196
1946 3300048091 Ga0495626_0135362 Ga0495626_0135362_236_853 196
1947 3300048091 Ga0495626_0214298 Ga0495626_0214298_55_672 196
1948 3300048903 Ga0496100_0018441 Ga0496100_0018441_1046_1663 196
1949 3300048904 Ga0496101_0004746 Ga0496101_0004746_5828_6418 196
1950 3300048904 Ga0496101_0008665 Ga0496101_0008665_694_1311 196
1951 3300048905 Ga0496102_0056636 Ga0496102_0056636_1873_2493 196
1952 3300048905 Ga0496102_0282884 Ga0496102_0282884_72_692 196
1953 3300048905 Ga0496102_0320440 Ga0496102_0320440_728_1348 196
1954 3300048905 Ga0496102_0673529 Ga0496102_0673529_296_913 196
1955 3300048906 Ga0496103_0366947 Ga0496103_0366947_292_912 196
1956 3300048907 Ga0496104_0157594 Ga0496104_0157594_315_935 196
1957 3300048908 Ga0496105_0299489 Ga0496105_0299489_547_1164 196
1958 3300048909 Ga0496106_0004648 Ga0496106_0004648_8670_9290 196
1959 3300048909 Ga0496106_0286110 Ga0496106_0286110_536_1153 196
1960 3300048910 Ga0496107_0192800 Ga0496107_0192800_420_1040 196
1961 3300048910 Ga0496107_0308775 Ga0496107_0308775_81_698 196
1962 3300048910 Ga0496107_0563533 Ga0496107_0563533_52_672 196
1963 3300048911 Ga0496108_0492770 Ga0496108_0492770_43_663 196
1964 3300048911 Ga0496108_0524248 Ga0496108_0524248_363_953 196
1965 3300048912 Ga0496109_0020544 Ga0496109_0020544_480_1097 196
1966 3300048912 Ga0496109_0292389 Ga0496109_0292389_659_1276 196
1967 3300048912 Ga0496109_0399599 Ga0496109_0399599_145_765 196
1968 3300048912 Ga0496109_0553928 Ga0496109_0553928_89_679 196
1969 3300048913 Ga0496110_0000333 Ga0496110_0000333_13185_13802 196
1970 3300048913 Ga0496110_0131181 Ga0496110_0131181_744_1352 196
1971 3300048913 Ga0496110_0284278 Ga0496110_0284278_504_1121 196
1972 3300048914 Ga0496111_0067547 Ga0496111_0067547_1548_2165 196
1973 3300048914 Ga0496111_0336782 Ga0496111_0336782_389_1006 196
1974 3300048914 Ga0496111_0493489 Ga0496111_0493489_18_638 196
1975 3300048915 Ga0496112_1179291 Ga0496112_1179291_42_659 196
1976 3300048916 Ga0496113_0005508 Ga0496113_0005508_6032_6649 196
1977 3300048916 Ga0496113_0194322 Ga0496113_0194322_293_913 196
1978 3300048917 Ga0496114_0120093 Ga0496114_0120093_430_1020 196
1979 3300048918 Ga0496115_0103015 Ga0496115_0103015_1179_1796 196
1980 3300048920 Ga0496117_0011451 Ga0496117_0011451_2404_2994 196
1981 3300048920 Ga0496117_0180607 Ga0496117_0180607_552_1142 196
1982 3300048920 Ga0496117_0257761 Ga0496117_0257761_170_760 196
1983 3300048921 Ga0496118_0005537 Ga0496118_0005537_3351_3941 196
1984 3300048921 Ga0496118_0031535 Ga0496118_0031535_2295_2885 196
1985 3300048922 Ga0496119_0064272 Ga0496119_0064272_50_640 196
1986 3300048924 Ga0496121_0154491 Ga0496121_0154491_461_1078 196
1987 3300048924 Ga0496121_0238982 Ga0496121_0238982_607_1197 196
1988 3300048925 Ga0496122_0001792 Ga0496122_0001792_13581_14198 196
1989 3300048925 Ga0496122_0002554 Ga0496122_0002554_4752_5372 196
1990 3300048926 Ga0496123_0005333 Ga0496123_0005333_5472_6089 196
1991 3300048926 Ga0496123_0005695 Ga0496123_0005695_9692_10312 196
1992 3300048926 Ga0496123_0065567 Ga0496123_0065567_869_1486 196
1993 3300048926 Ga0496123_0151389 Ga0496123_0151389_612_1202 196
1994 3300048927 Ga0496124_0009419 Ga0496124_0009419_979_1599 196
1995 3300048927 Ga0496124_0085839 Ga0496124_0085839_159_776 196
1996 3300048927 Ga0496124_0232720 Ga0496124_0232720_468_1058 196
1997 3300048927 Ga0496124_0542791 Ga0496124_0542791_86_703 196
1998 3300048928 Ga0496125_0001742 Ga0496125_0001742_10996_11613 196
1999 3300048928 Ga0496125_0045309 Ga0496125_0045309_1878_2468 196
2000 3300049459 Ga0495678_000146 Ga0495678_000146_65551_66168 196
2001 3300049459 Ga0495678_000561 Ga0495678_000561_15666_16283 196
2002 3300049459 Ga0495678_001260 Ga0495678_001260_15355_15972 196
2003 3300049459 Ga0495678_001614 Ga0495678_001614_2595_3212 196
2004 3300049459 Ga0495678_003153 Ga0495678_003153_374_985 196
2005 3300049459 Ga0495678_004600 Ga0495678_004600_7030_7647 196
2006 3300049459 Ga0495678_018611 Ga0495678_018611_1756_2370 196
2007 3300049459 Ga0495678_032453 Ga0495678_032453_447_1064 196
2008 3300049460 Ga0495682_0000691 Ga0495682_0000691_9212_9823 196
2009 3300049460 Ga0495682_0001011 Ga0495682_0001011_3762_4373 196
2010 3300049822 Ga0501035_0002697 Ga0501035_0002697_3696_4316 196
2011 3300049823 Ga0501044_0108609 Ga0501044_0108609_1104_1724 196
2012 3300050492 nmdc:mga0yw44_569702_c1 nmdc:mga0yw44_569702_c1_116_712 196
2013 3300050493 nmdc:mga0k408_12675_c1 nmdc:mga0k408_12675_c1_588_1184 196
2014 3300050493 nmdc:mga0k408_52285_c1 nmdc:mga0k408_52285_c1_19_621 196
2015 3300050493 nmdc:mga0k408_5694_c1 nmdc:mga0k408_5694_c1_1498_2094 196
2016 3300050493 nmdc:mga0k408_68474_c1 nmdc:mga0k408_68474_c1_685_1278 196
2017 3300050494 nmdc:mga06z11_19486_c1 nmdc:mga06z11_19486_c1_838_1434 196
2018 3300050494 nmdc:mga06z11_20777_c1 nmdc:mga06z11_20777_c1_2189_2785 196
2019 3300050494 nmdc:mga06z11_28782_c1 nmdc:mga06z11_28782_c1_515_1117 196
2020 3300050495 nmdc:mga04h51_73659_c1 nmdc:mga04h51_73659_c1_458_1054 196
2021 3300050496 nmdc:mga07m45_102410_c1 nmdc:mga07m45_102410_c1_984_1574 196
2022 3300050496 nmdc:mga07m45_11420_c1 nmdc:mga07m45_11420_c1_1647_2243 196
2023 3300050496 nmdc:mga07m45_11912_c1 nmdc:mga07m45_11912_c1_814_1416 196
2024 3300050496 nmdc:mga07m45_18425_c1 nmdc:mga07m45_18425_c1_1147_1743 196
2025 3300050496 nmdc:mga07m45_4915_c1 nmdc:mga07m45_4915_c1_4832_5428 196
2026 3300050508 nmdc:mga09592_450375_c1 nmdc:mga09592_450375_c1_480_1070 196
2027 3300050511 nmdc:mga08y16_704299_c1 nmdc:mga08y16_704299_c1_194_784 196
2028 3300050512 nmdc:mga0n895_831244_c1 nmdc:mga0n895_831244_c1_115_705 196
2029 3300053077 Ga0495601_0042056 Ga0495601_0042056_1405_1995 196
2030 3300053084 Ga0495595_0220299 Ga0495595_0220299_285_875 196
2031 3300053085 Ga0495619_0335778 Ga0495619_0335778_331_921 196
2032 3300053087 Ga0500643_012813 Ga0500643_012813_2124_2714 196
2033 3300053092 Ga0500583_0119580 Ga0500583_0119580_281_877 196
2034 3300053093 Ga0500651_0000971 Ga0500651_0000971_163_753 196
2035 3300053110 Ga0500571_000098 Ga0500571_000098_7569_8159 196
2036 3300053118 Ga0500594_0003672 Ga0500594_0003672_555_1145 196
2037 3300053134 Ga0500658_0006336 Ga0500658_0006336_2170_2760 196
2038 3300053139 Ga0500568_0015326 Ga0500568_0015326_1261_1851 196
2039 3300053141 Ga0500574_003226 Ga0500574_003226_1652_2242 196
2040 3300053153 Ga0500616_0079242 Ga0500616_0079242_424_1014 196
2041 3300053177 Ga0500636_0025655 Ga0500636_0025655_2689_3279 196
2042 3300061719 Ga0466962_0019641 Ga0466962_0019641_1960_2580 196
2043 iso_pu_bacteria 2808606418 2809147457 196

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07021

MetW

Methionine biosynthesis protein MetW

22

209

0.96

PF13649

Methyltransf_25

Methyltransferase domain

38

126

0.91

PF08241

Methyltransf_11

Methyltransferase domain

39

130

0.87

PF08242

Methyltransf_12

Methyltransferase domain

39

126

0.84

PF13847

Methyltransf_31

Methyltransferase domain

33

187

0.81

PF13489

Methyltransf_23

Methyltransferase domain

18

176

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
7v6h-assembly2.cif.gz_B crystal structure of the spnl 0.7998 5 167
3cgg-assembly2.cif.gz_B crystal structure of tehb-like sam-dependent methyltransferase (np_600671.1) from corynebacterium glutamicum atcc 13032 kitasato at 2.00 a resolution 0.7644 5 193
3cc8-assembly1.cif.gz_A-2 crystal structure of a putative methyltransferase (bce_1332) from bacillus cereus atcc 10987 at 1.64 a resolution 0.7509 9 196
4lwo-assembly1.cif.gz_B crystal structure of prmt6 0.7503 6 83
3l9w-assembly1.cif.gz_B kefc c-terminal domain in complex with keff and gsh 0.7461 19 110
ID Description Score Start End Superfamily
af_A0A1D6MBP0_252_453_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8824 4 105 3.40.50.150
af_K7LS70_12_147_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8464 14 58 3.40.50.150
af_Q4CM63_15_263_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8447 6 105 3.40.50.150
af_C7J169_1_82_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8419 6 58 3.40.50.150
af_A0A1D6LLF5_1_112_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8315 16 65 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A257PEJ9-F1-model_v4 Methionine biosynthesis protein MetW 0.9863 7 105
AF-A0A259PNQ0-F1-model_v4 Methionine biosynthesis protein MetW 0.9809 7 121
AF-A0A2G1BNU2-F1-model_v4 Methionine biosynthesis protein MetW 0.9777 21 118
AF-A0A7Y5EGM4-F1-model_v4 Methyltransferase domain-containing protein 0.9761 6 106 GO:0008168
GO:0032259
AF-A0A520I6Z6-F1-model_v4 Methyltransferase domain-containing protein 0.9759 7 106 GO:0008168
GO:0032259

Feature Viewer

pLDDT pTM Quality
83.68 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map