F496288

General Info

Members Datasets Scaffolds Average Seq Length
2032 434 2022 247

Family's Representative Sequence

Representative Sequence 3300006844|Ga0075428_100030809|Ga0075428_1000308092
Length 283
Sequence MARIETTSKAVLDVFRYRPDEDSEPRFERFEVPFHEDWVVLDALHYIKDHLDGTLSYRWSCRMGICGSCGMMIDGEPKLSCSVFLRDYYPRPIRVEPLANFPVVRDLVINLEDFLDKLGQVKAWLIPKEPREAADGEYKQTPGELAHYRQYSMCINCMLCYSACPVYAKHPEFVGPAAIALAQRYNLDSRDAGFDERADAIFSHEGIWECTFVGDCTRVCPKHVDPAGAIQQAKVTATNDWFWSLLVPWGKRRSRAPAHEQNGGAAAGHRDAQQDQLVSSQSK

Samples

Sample ID Description Type Environment
1 2622736605 Geodermatophilus ruber DSM 45317 Isolate Rhizosphere
2 2738541264 Mycobacterium sp. OK889 Isolate Unclassified
3 2738541356 Mycobacterium sp. OK887 Isolate Unclassified
4 2738543011 Rhodococcus sp. OK611 Isolate Unclassified
5 2868088558 Phytoactinopolyspora endophytica EGI 60009 Isolate Unclassified
6 2883821847 Microlunatus elymi KUDC0627 Isolate Rhizosphere
7 2889300758 Rhodococcus sp. PvR099 Isolate Rhizosphere
8 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere
9 2939743619 Rhodococcus sp. PvR044 Isolate Rhizosphere
10 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
11 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
12 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
13 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
14 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
15 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
16 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
17 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
18 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
19 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
20 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
21 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
22 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
23 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
24 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
25 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
26 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
27 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
28 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
29 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
30 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
31 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
32 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
33 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
34 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
35 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
36 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
37 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
38 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
39 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
40 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
41 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
42 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
43 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
44 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
45 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
46 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
47 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
48 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
49 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
50 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
51 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
52 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
53 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
54 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
55 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
56 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
57 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
58 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
59 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
60 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
61 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
62 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
63 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
64 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
65 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
66 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
67 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
68 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
69 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
70 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
71 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
72 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
73 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
74 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
75 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
76 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
77 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
78 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
79 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
80 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
81 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
82 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
83 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
84 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
85 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
86 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
87 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
88 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
89 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
90 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
91 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
92 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
93 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
94 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
95 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
96 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
97 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
98 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
99 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
100 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
101 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
102 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
103 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
104 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
105 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
106 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
107 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
108 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
109 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
110 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
111 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
112 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
113 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
114 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
115 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
116 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
117 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
118 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
119 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
120 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
121 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
122 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
123 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
124 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
125 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
126 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
127 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
128 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
129 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
130 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
131 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
132 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
133 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
134 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
135 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
136 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
137 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
138 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
139 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
140 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
141 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
142 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
143 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
144 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
145 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
146 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
147 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
148 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
149 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
150 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
151 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
152 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
153 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
154 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
155 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
156 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
214 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
215 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
216 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
217 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
218 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
219 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
220 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
221 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
223 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
224 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
225 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
229 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
230 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
231 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
232 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
233 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
234 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
235 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
236 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
237 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
238 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
239 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
240 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
241 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
242 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
243 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
244 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
245 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
246 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
247 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
248 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
249 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
250 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
251 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
252 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
253 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
254 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
255 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
256 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
257 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
258 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
259 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
260 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
261 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
262 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
263 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
264 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
265 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
266 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
267 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
268 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
269 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
270 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
271 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
272 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
273 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
274 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
275 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
276 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
277 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
278 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
279 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
280 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
281 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
282 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
283 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
284 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
285 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
286 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
287 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
288 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
289 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
290 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
291 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
292 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
293 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
294 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
295 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
296 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
297 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
298 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
299 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
300 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
301 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
302 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
303 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
304 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
305 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
306 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
307 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
308 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
309 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
310 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
311 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
312 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
313 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
314 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
315 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
316 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
317 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
318 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
319 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
320 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
321 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
322 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
323 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
324 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
325 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
326 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
327 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
328 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
329 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
330 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
331 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
332 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
333 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
334 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
335 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
336 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
337 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
338 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
339 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
340 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
341 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
342 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
343 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
344 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
345 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
346 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
347 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
348 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
349 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
350 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
351 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
352 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
353 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
354 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
355 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
356 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
357 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
358 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
359 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
360 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
361 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
362 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
363 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
364 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
365 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
366 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
367 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
368 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
369 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
370 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
371 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
372 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
373 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
374 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
375 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
376 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
377 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
378 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
379 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
380 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
381 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
382 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
383 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
384 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
385 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
386 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
387 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
388 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
389 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
390 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
391 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
392 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
393 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
394 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
395 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
396 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
397 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
398 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
399 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
400 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
401 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
402 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
403 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
404 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
405 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
406 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
407 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
408 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
409 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
410 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
411 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
412 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
413 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
414 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
415 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
416 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
417 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
418 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
419 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
420 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
421 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
422 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
423 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
424 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
425 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
426 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
427 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
428 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
429 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
430 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
431 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
432 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
433 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
434 8054609563 Nocardioides astragali CGMCC 4.7327 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 98.62
Metatranscriptomes 0.89
Isolates 0.49

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.18
Nodule 0.05
Rhizoplane 2.12
Rhizosphere 95.92
Stem 0
Stem Tuber 0
Unclassified 0.74

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJQas_1000420 3300000549 Bacteria 7098
2 LJQas_1008308 3300000549 Bacteria 1263
3 JGI24737J22298_10036815 3300001990 Bacteria 1510
4 JGI24738J21930_10003088 3300002075 Bacteria 4258
5 JGI25406J46586_10008281 3300003203 Bacteria 4718
6 JGI25406J46586_10013787 3300003203 Bacteria 3456
7 JGI25406J46586_10041197 3300003203 Bacteria 1628
8 JGI25406J46586_10041485 3300003203 Bacteria 1619
9 JGI25407J50210_10004889 3300003373 Bacteria 3272
10 JGI25407J50210_10055027 3300003373 Bacteria 1005
11 Ga0065714_10100146 3300005288 Bacteria 1671
12 Ga0065704_10186240 3300005289 Bacteria 1212
13 Ga0065704_10197022 3300005289 Bacteria 1163
14 Ga0065704_10266112 3300005289 Bacteria 954
15 Ga0065712_10069913 3300005290 Bacteria 6517
16 Ga0065712_10076054 3300005290 Bacteria 3743
17 Ga0065712_10173497 3300005290 Bacteria 1230
18 Ga0065715_10042756 3300005293 Bacteria 1087
19 Ga0065715_10089458 3300005293 Bacteria 10092
20 Ga0065707_10140802 3300005295 Bacteria 1775
21 Ga0065707_10174049 3300005295 Bacteria 1429
22 Ga0065707_10233834 3300005295 Bacteria 1179
23 Ga0065707_10272934 3300005295 Bacteria 1067
24 Ga0070658_10244362 3300005327 Bacteria 1522
25 Ga0070676_10014798 3300005328 Bacteria 4292
26 Ga0070676_10058092 3300005328 Bacteria 2291
27 Ga0070683_100034253 3300005329 Bacteria 4637
28 Ga0070683_100035235 3300005329 Bacteria 4575
29 Ga0070683_100084185 3300005329 Bacteria 2979
30 Ga0070683_100086957 3300005329 Bacteria 2931
31 Ga0070683_100110296 3300005329 Bacteria 2595
32 Ga0070683_100193940 3300005329 Bacteria 1929
33 Ga0070683_100525473 3300005329 Bacteria 1131
34 Ga0070683_100724624 3300005329 Bacteria 953
35 Ga0070683_100801969 3300005329 Bacteria 903
36 Ga0070690_100016860 3300005330 Bacteria 4385
37 Ga0070690_100048038 3300005330 Bacteria 2717
38 Ga0070690_100054679 3300005330 Bacteria 2556
39 Ga0070690_100162400 3300005330 Bacteria 1532
40 Ga0070670_100006991 3300005331 Bacteria 9565
41 Ga0070670_100010250 3300005331 Bacteria 7996
42 Ga0070670_100027666 3300005331 Bacteria 4877
43 Ga0070670_100092414 3300005331 Bacteria 2602
44 Ga0068869_100012011 3300005334 Bacteria 5702
45 Ga0068869_100034559 3300005334 Bacteria 3577
46 Ga0068869_100155695 3300005334 Bacteria 1775
47 Ga0068869_100220452 3300005334 Bacteria 1503
48 Ga0068869_100308095 3300005334 Bacteria 1281
49 Ga0070666_10024219 3300005335 Bacteria 3954
50 Ga0070680_100030862 3300005336 Bacteria 4305
51 Ga0070680_100498316 3300005336 Bacteria 1042
52 Ga0070682_100014272 3300005337 Bacteria 4588
53 Ga0070682_100212472 3300005337 Bacteria 1372
54 Ga0068868_100013869 3300005338 Bacteria 5924
55 Ga0068868_100020679 3300005338 Bacteria 4950
56 Ga0068868_100141117 3300005338 Bacteria 1978
57 Ga0070660_100064130 3300005339 Bacteria 2858
58 Ga0070660_100144673 3300005339 Bacteria 1909
59 Ga0070689_100014096 3300005340 Bacteria 5798
60 Ga0070689_100029345 3300005340 Bacteria 4162
61 Ga0070689_100204671 3300005340 Bacteria 1613
62 Ga0070689_100266552 3300005340 Bacteria 1417
63 Ga0070691_10099193 3300005341 Bacteria 1445
64 Ga0070687_100003460 3300005343 Bacteria 6134
65 Ga0070687_100035368 3300005343 Bacteria 2480
66 Ga0070687_100069904 3300005343 Bacteria 1881
67 Ga0070687_100073033 3300005343 Bacteria 1848
68 Ga0070687_100181605 3300005343 Bacteria 1261
69 Ga0070687_100214502 3300005343 Bacteria 1175
70 Ga0070661_100047638 3300005344 Bacteria 3137
71 Ga0070661_100059110 3300005344 Bacteria 2810
72 Ga0070692_10006201 3300005345 Bacteria 5172
73 Ga0070692_10012817 3300005345 Bacteria 3895
74 Ga0070692_10067167 3300005345 Bacteria 1903
75 Ga0070668_100000665 3300005347 Bacteria 23269
76 Ga0070668_100006733 3300005347 Bacteria 8515
77 Ga0070668_100012784 3300005347 Bacteria 6250
78 Ga0070668_100104516 3300005347 Bacteria 2248
79 Ga0070668_100111180 3300005347 Bacteria 2180
80 Ga0070668_100209529 3300005347 Bacteria 1603
81 Ga0070668_100224337 3300005347 Bacteria 1551
82 Ga0070668_100368861 3300005347 Bacteria 1219
83 Ga0070668_100518537 3300005347 Bacteria 1034
84 Ga0070669_100002826 3300005353 Bacteria 12540
85 Ga0070669_100013613 3300005353 Bacteria 5781
86 Ga0070669_100043577 3300005353 Bacteria 3269
87 Ga0070669_100093161 3300005353 Bacteria 2262
88 Ga0070669_100133179 3300005353 Bacteria 1909
89 Ga0070669_100658037 3300005353 Bacteria 882
90 Ga0070669_100739707 3300005353 Bacteria 833
91 Ga0070675_100000359 3300005354 Bacteria 30845
92 Ga0070675_100008632 3300005354 Bacteria 7913
93 Ga0070675_100014038 3300005354 Bacteria 6308
94 Ga0070675_100025228 3300005354 Bacteria 4766
95 Ga0070675_100031708 3300005354 Bacteria 4274
96 Ga0070675_100177035 3300005354 Bacteria 1842
97 Ga0070671_100049850 3300005355 Bacteria 3483
98 Ga0070671_100065628 3300005355 Bacteria 3024
99 Ga0070671_100248710 3300005355 Bacteria 1510
100 Ga0070671_100256693 3300005355 Bacteria 1485
101 Ga0070674_100022163 3300005356 Bacteria 4093
102 Ga0070674_100031806 3300005356 Bacteria 3500
103 Ga0070674_100168347 3300005356 Bacteria 1668
104 Ga0070674_100176911 3300005356 Bacteria 1631
105 Ga0070674_100298199 3300005356 Bacteria 1284
106 Ga0070673_100218525 3300005364 Bacteria 1648
107 Ga0070688_100060790 3300005365 Bacteria 2387
108 Ga0070688_100257194 3300005365 Bacteria 1245
109 Ga0070659_100014895 3300005366 Bacteria 5816
110 Ga0070659_100096073 3300005366 Bacteria 2380
111 Ga0070667_100005271 3300005367 Bacteria 10814
112 Ga0070667_100009111 3300005367 Bacteria 8214
113 Ga0070667_100109969 3300005367 Bacteria 2389
114 Ga0070709_10076746 3300005434 Bacteria 2171
115 Ga0070709_10339796 3300005434 Bacteria 1107
116 Ga0070709_10619569 3300005434 Bacteria 835
117 Ga0070714_100005586 3300005435 Bacteria 9607
118 Ga0070714_100029593 3300005435 Bacteria 4554
119 Ga0070714_100050179 3300005435 Bacteria 3553
120 Ga0070714_100197537 3300005435 Bacteria 1839
121 Ga0070714_100315216 3300005435 Bacteria 1461
122 Ga0070713_100000605 3300005436 Bacteria 22815
123 Ga0070713_100037445 3300005436 Bacteria 3922
124 Ga0070713_100190933 3300005436 Bacteria 1846
125 Ga0070701_10001683 3300005438 Bacteria 8296
126 Ga0070701_10009062 3300005438 Bacteria 4344
127 Ga0070701_10074247 3300005438 Bacteria 1826
128 Ga0070701_10247097 3300005438 Bacteria 1076
129 Ga0070711_100003300 3300005439 Bacteria 9395
130 Ga0070711_100191567 3300005439 Bacteria 1572
131 Ga0070705_100000208 3300005440 Bacteria 34616
132 Ga0070705_100009674 3300005440 Bacteria 4800
133 Ga0070705_100017050 3300005440 Bacteria 3783
134 Ga0070705_100031097 3300005440 Bacteria 2953
135 Ga0070705_100039254 3300005440 Bacteria 2685
136 Ga0070705_100108732 3300005440 Bacteria 1767
137 Ga0070700_100008927 3300005441 Bacteria 5482
138 Ga0070700_100023961 3300005441 Bacteria 3576
139 Ga0070700_100041068 3300005441 Bacteria 2834
140 Ga0070700_100064579 3300005441 Bacteria 2319
141 Ga0070700_100079585 3300005441 Bacteria 2113
142 Ga0070700_100416692 3300005441 Bacteria 1014
143 Ga0070694_100003476 3300005444 Bacteria 9428
144 Ga0070694_100009334 3300005444 Bacteria 6021
145 Ga0070694_100037547 3300005444 Bacteria 3213
146 Ga0070694_100039591 3300005444 Bacteria 3138
147 Ga0070694_100080034 3300005444 Bacteria 2269
148 Ga0070694_100096896 3300005444 Bacteria 2080
149 Ga0070694_100104108 3300005444 Bacteria 2012
150 Ga0070694_100147694 3300005444 Bacteria 1714
151 Ga0070694_100254370 3300005444 Bacteria 1330
152 Ga0070694_100367354 3300005444 Bacteria 1119
153 Ga0070694_100392995 3300005444 Bacteria 1084
154 Ga0070708_100000121 3300005445 Bacteria 52326
155 Ga0070708_100000271 3300005445 Bacteria 38546
156 Ga0070708_100002396 3300005445 Bacteria 14528
157 Ga0070708_100002575 3300005445 Bacteria 14040
158 Ga0070708_100004143 3300005445 Bacteria 11381
159 Ga0070708_100004526 3300005445 Bacteria 10949
160 Ga0070708_100006577 3300005445 Bacteria 9252
161 Ga0070708_100014589 3300005445 Bacteria 6473
162 Ga0070708_100014715 3300005445 Bacteria 6445
163 Ga0070708_100014915 3300005445 Bacteria 6405
164 Ga0070708_100019210 3300005445 Bacteria 5738
165 Ga0070708_100024450 3300005445 Bacteria 5155
166 Ga0070708_100025794 3300005445 Bacteria 5026
167 Ga0070708_100026906 3300005445 Bacteria 4929
168 Ga0070708_100053857 3300005445 Bacteria 3572
169 Ga0070708_100056583 3300005445 Bacteria 3489
170 Ga0070708_100069344 3300005445 Bacteria 3170
171 Ga0070708_100078733 3300005445 Bacteria 2980
172 Ga0070708_100097719 3300005445 Bacteria 2684
173 Ga0070708_100135719 3300005445 Bacteria 2279
174 Ga0070708_100156842 3300005445 Bacteria 2120
175 Ga0070708_100159890 3300005445 Bacteria 2099
176 Ga0070708_100214855 3300005445 Bacteria 1802
177 Ga0070708_100443051 3300005445 Bacteria 1225
178 Ga0070708_100454296 3300005445 Bacteria 1209
179 Ga0070708_100540475 3300005445 Bacteria 1099
180 Ga0070708_100552864 3300005445 Bacteria 1086
181 Ga0070663_100156246 3300005455 Bacteria 1752
182 Ga0070663_100161190 3300005455 Bacteria 1727
183 Ga0070663_100416139 3300005455 Bacteria 1102
184 Ga0070662_100005310 3300005457 Bacteria 8227
185 Ga0070662_100051609 3300005457 Bacteria 2971
186 Ga0070662_100085252 3300005457 Bacteria 2361
187 Ga0070662_100191158 3300005457 Bacteria 1619
188 Ga0070662_100278177 3300005457 Bacteria 1354
189 Ga0070662_100325382 3300005457 Bacteria 1254
190 Ga0070662_100409798 3300005457 Bacteria 1120
191 Ga0070662_100510823 3300005457 Bacteria 1003
192 Ga0070662_100530953 3300005457 Bacteria 984
193 Ga0070681_10253256 3300005458 Bacteria 1673
194 Ga0068867_100011302 3300005459 Bacteria 6298
195 Ga0068867_100159666 3300005459 Bacteria 1777
196 Ga0068867_100249043 3300005459 Bacteria 1444
197 Ga0068867_100387332 3300005459 Bacteria 1176
198 Ga0070685_10045738 3300005466 Bacteria 2511
199 Ga0070685_10079380 3300005466 Bacteria 1964
200 Ga0070706_100000021 3300005467 Bacteria 162774
201 Ga0070706_100000184 3300005467 Bacteria 78994
202 Ga0070706_100000201 3300005467 Bacteria 75183
203 Ga0070706_100000221 3300005467 Bacteria 69778
204 Ga0070706_100000771 3300005467 Bacteria 35831
205 Ga0070706_100020429 3300005467 Bacteria 6104
206 Ga0070706_100031835 3300005467 Bacteria 4863
207 Ga0070706_100033625 3300005467 Bacteria 4733
208 Ga0070706_100039738 3300005467 Bacteria 4342
209 Ga0070706_100053224 3300005467 Bacteria 3736
210 Ga0070706_100075207 3300005467 Bacteria 3125
211 Ga0070706_100080795 3300005467 Bacteria 3011
212 Ga0070706_100081043 3300005467 Bacteria 3006
213 Ga0070706_100086093 3300005467 Bacteria 2912
214 Ga0070706_100090556 3300005467 Bacteria 2836
215 Ga0070706_100109090 3300005467 Bacteria 2575
216 Ga0070706_100119496 3300005467 Bacteria 2456
217 Ga0070706_100123818 3300005467 Bacteria 2410
218 Ga0070706_100129256 3300005467 Bacteria 2357
219 Ga0070706_100153270 3300005467 Bacteria 2151
220 Ga0070706_100159428 3300005467 Bacteria 2106
221 Ga0070706_100173188 3300005467 Bacteria 2015
222 Ga0070706_100195865 3300005467 Bacteria 1888
223 Ga0070706_100263910 3300005467 Bacteria 1607
224 Ga0070706_100309063 3300005467 Bacteria 1475
225 Ga0070706_100408884 3300005467 Bacteria 1263
226 Ga0070706_100471557 3300005467 Bacteria 1168
227 Ga0070707_100000047 3300005468 Bacteria 105077
228 Ga0070707_100000105 3300005468 Bacteria 76460
229 Ga0070707_100000169 3300005468 Bacteria 63287
230 Ga0070707_100000561 3300005468 Bacteria 37306
231 Ga0070707_100002097 3300005468 Bacteria 19110
232 Ga0070707_100005665 3300005468 Bacteria 11663
233 Ga0070707_100007825 3300005468 Bacteria 9925
234 Ga0070707_100008508 3300005468 Bacteria 9532
235 Ga0070707_100015581 3300005468 Bacteria 7134
236 Ga0070707_100017537 3300005468 Bacteria 6733
237 Ga0070707_100018229 3300005468 Bacteria 6606
238 Ga0070707_100022162 3300005468 Bacteria 6005
239 Ga0070707_100025413 3300005468 Bacteria 5618
240 Ga0070707_100047494 3300005468 Bacteria 4110
241 Ga0070707_100048491 3300005468 Bacteria 4069
242 Ga0070707_100054421 3300005468 Bacteria 3836
243 Ga0070707_100055469 3300005468 Bacteria 3799
244 Ga0070707_100059758 3300005468 Bacteria 3655
245 Ga0070707_100062709 3300005468 Bacteria 3566
246 Ga0070707_100063077 3300005468 Unclassified 3556
247 Ga0070707_100071471 3300005468 Bacteria 3343
248 Ga0070707_100079201 3300005468 Bacteria 3171
249 Ga0070707_100081806 3300005468 Bacteria 3118
250 Ga0070707_100100232 3300005468 Bacteria 2806
251 Ga0070707_100104656 3300005468 Bacteria 2744
252 Ga0070707_100117334 3300005468 Bacteria 2583
253 Ga0070707_100119216 3300005468 Bacteria 2561
254 Ga0070707_100128345 3300005468 Bacteria 2465
255 Ga0070707_100180863 3300005468 Bacteria 2056
256 Ga0070707_100195775 3300005468 Bacteria 1970
257 Ga0070707_100208476 3300005468 Bacteria 1905
258 Ga0070707_100219862 3300005468 Bacteria 1850
259 Ga0070707_100222748 3300005468 Bacteria 1837
260 Ga0070707_100230588 3300005468 Bacteria 1802
261 Ga0070707_100232953 3300005468 Bacteria 1792
262 Ga0070707_100243786 3300005468 Bacteria 1749
263 Ga0070707_100371473 3300005468 Bacteria 1389
264 Ga0070707_100421078 3300005468 Bacteria 1296
265 Ga0070707_100437359 3300005468 Bacteria 1268
266 Ga0070707_100578428 3300005468 Bacteria 1085
267 Ga0070707_100657884 3300005468 Bacteria 1010
268 Ga0070698_100002013 3300005471 Bacteria 22580
269 Ga0070698_100005186 3300005471 Bacteria 14250
270 Ga0070698_100006725 3300005471 Bacteria 12468
271 Ga0070698_100007640 3300005471 Bacteria 11700
272 Ga0070698_100008829 3300005471 Bacteria 10841
273 Ga0070698_100017587 3300005471 Bacteria 7534
274 Ga0070698_100023686 3300005471 Bacteria 6414
275 Ga0070698_100039929 3300005471 Bacteria 4825
276 Ga0070698_100050580 3300005471 Bacteria 4235
277 Ga0070698_100056226 3300005471 Bacteria 3988
278 Ga0070698_100066812 3300005471 Bacteria 3617
279 Ga0070698_100074897 3300005471 Bacteria 3390
280 Ga0070698_100086725 3300005471 Bacteria 3117
281 Ga0070698_100112963 3300005471 Bacteria 2681
282 Ga0070698_100113656 3300005471 Bacteria 2672
283 Ga0070698_100125676 3300005471 Bacteria 2522
284 Ga0070698_100126044 3300005471 Bacteria 2518
285 Ga0070698_100293557 3300005471 Bacteria 1557
286 Ga0070698_100578803 3300005471 Bacteria 1063
287 Ga0070699_100000028 3300005518 Bacteria 156839
288 Ga0070699_100000176 3300005518 Bacteria 61756
289 Ga0070699_100000212 3300005518 Bacteria 57491
290 Ga0070699_100000258 3300005518 Bacteria 51734
291 Ga0070699_100000984 3300005518 Bacteria 26585
292 Ga0070699_100002329 3300005518 Bacteria 17052
293 Ga0070699_100008116 3300005518 Bacteria 9117
294 Ga0070699_100024912 3300005518 Bacteria 5158
295 Ga0070699_100029727 3300005518 Bacteria 4712
296 Ga0070699_100094019 3300005518 Bacteria 2624
297 Ga0070699_100105998 3300005518 Bacteria 2466
298 Ga0070699_100125553 3300005518 Unclassified 2259
299 Ga0070699_100127223 3300005518 Bacteria 2244
300 Ga0070699_100131132 3300005518 Bacteria 2209
301 Ga0070699_100134084 3300005518 Bacteria 2184
302 Ga0070699_100202740 3300005518 Bacteria 1764
303 Ga0070699_100230738 3300005518 Bacteria 1650
304 Ga0070699_100387881 3300005518 Bacteria 1262
305 Ga0070699_100400623 3300005518 Bacteria 1241
306 Ga0070699_100428429 3300005518 Bacteria 1198
307 Ga0070679_100159818 3300005530 Bacteria 2228
308 Ga0070684_100004503 3300005535 Bacteria 10609
309 Ga0070684_100034910 3300005535 Bacteria 4302
310 Ga0070684_100038444 3300005535 Bacteria 4111
311 Ga0070684_100115293 3300005535 Bacteria 2412
312 Ga0070684_100358881 3300005535 Bacteria 1341
313 Ga0070684_100646047 3300005535 Bacteria 985
314 Ga0070697_100000001 3300005536 Bacteria 662298
315 Ga0070697_100002209 3300005536 Bacteria 14929
316 Ga0070697_100002259 3300005536 Bacteria 14778
317 Ga0070697_100006224 3300005536 Bacteria 9241
318 Ga0070697_100010423 3300005536 Bacteria 7253
319 Ga0070697_100013408 3300005536 Bacteria 6429
320 Ga0070697_100020758 3300005536 Bacteria 5201
321 Ga0070697_100020988 3300005536 Bacteria 5170
322 Ga0070697_100023502 3300005536 Bacteria 4902
323 Ga0070697_100035412 3300005536 Bacteria 4027
324 Ga0070697_100040579 3300005536 Bacteria 3767
325 Ga0070697_100045077 3300005536 Bacteria 3573
326 Ga0070697_100050391 3300005536 Bacteria 3379
327 Ga0070697_100063797 3300005536 Unclassified 3009
328 Ga0070697_100076439 3300005536 Bacteria 2754
329 Ga0070697_100105371 3300005536 Bacteria 2346
330 Ga0070697_100122756 3300005536 Bacteria 2174
331 Ga0070697_100143714 3300005536 Bacteria 2007
332 Ga0070697_100164015 3300005536 Bacteria 1878
333 Ga0070697_100173200 3300005536 Bacteria 1827
334 Ga0070697_100206358 3300005536 Bacteria 1672
335 Ga0070697_100206578 3300005536 Bacteria 1671
336 Ga0070697_100257719 3300005536 Bacteria 1493
337 Ga0070697_100588632 3300005536 Bacteria 977
338 Ga0070697_100768933 3300005536 Bacteria 851
339 Ga0068853_100007035 3300005539 Bacteria 8992
340 Ga0068853_100044095 3300005539 Bacteria 3818
341 Ga0068853_100271795 3300005539 Bacteria 1561
342 Ga0070672_100006373 3300005543 Bacteria 7925
343 Ga0070672_100012407 3300005543 Bacteria 5980
344 Ga0070672_100016504 3300005543 Bacteria 5288
345 Ga0070672_100025350 3300005543 Bacteria 4396
346 Ga0070672_100133077 3300005543 Bacteria 2046
347 Ga0070672_100158254 3300005543 Bacteria 1877
348 Ga0070686_100013356 3300005544 Bacteria 4699
349 Ga0070686_100067204 3300005544 Bacteria 2334
350 Ga0070686_100261013 3300005544 Bacteria 1270
351 Ga0070695_100000437 3300005545 Bacteria 21662
352 Ga0070695_100027378 3300005545 Bacteria 3530
353 Ga0070695_100197894 3300005545 Unclassified 1434
354 Ga0070695_100210403 3300005545 Bacteria 1396
355 Ga0070695_100230044 3300005545 Bacteria 1340
356 Ga0070695_100333606 3300005545 Bacteria 1131
357 Ga0070696_100001386 3300005546 Bacteria 15844
358 Ga0070696_100008934 3300005546 Bacteria 6704
359 Ga0070696_100014635 3300005546 Bacteria 5266
360 Ga0070696_100024924 3300005546 Bacteria 4065
361 Ga0070696_100075706 3300005546 Bacteria 2375
362 Ga0070696_100143531 3300005546 Unclassified 1747
363 Ga0070696_100235450 3300005546 Bacteria 1379
364 Ga0070696_100264521 3300005546 Bacteria 1305
365 Ga0070696_100383090 3300005546 Bacteria 1096
366 Ga0070696_100537052 3300005546 Bacteria 935
367 Ga0070665_100080619 3300005548 Bacteria 3260
368 Ga0070665_100402375 3300005548 Bacteria 1377
369 Ga0070704_100006725 3300005549 Bacteria 6803
370 Ga0070704_100018059 3300005549 Bacteria 4500
371 Ga0070704_100026276 3300005549 Bacteria 3845
372 Ga0070704_100032125 3300005549 Bacteria 3537
373 Ga0070704_100035495 3300005549 Bacteria 3390
374 Ga0070704_100099383 3300005549 Bacteria 2188
375 Ga0070704_100127661 3300005549 Bacteria 1965
376 Ga0070704_100162036 3300005549 Bacteria 1770
377 Ga0070704_100171176 3300005549 Bacteria 1727
378 Ga0070704_100298245 3300005549 Bacteria 1342
379 Ga0070704_100316595 3300005549 Bacteria 1306
380 Ga0068855_100015199 3300005563 Bacteria 9270
381 Ga0068855_100260247 3300005563 Bacteria 1933
382 Ga0068855_100559086 3300005563 Bacteria 1238
383 Ga0070664_100017097 3300005564 Bacteria 5952
384 Ga0070664_100017131 3300005564 Bacteria 5949
385 Ga0070664_100038318 3300005564 Bacteria 4034
386 Ga0070664_100172266 3300005564 Bacteria 1920
387 Ga0068857_100014484 3300005577 Bacteria 6880
388 Ga0068857_100072347 3300005577 Bacteria 3072
389 Ga0068857_100083638 3300005577 Bacteria 2851
390 Ga0068857_100102344 3300005577 Bacteria 2571
391 Ga0068857_100379247 3300005577 Bacteria 1313
392 Ga0068857_100647812 3300005577 Bacteria 1001
393 Ga0068854_100084491 3300005578 Bacteria 2349
394 Ga0068854_100215186 3300005578 Bacteria 1518
395 Ga0068856_100002182 3300005614 Bacteria 20301
396 Ga0068856_100213537 3300005614 Bacteria 1945
397 Ga0068856_100279633 3300005614 Bacteria 1686
398 Ga0070702_100001770 3300005615 Bacteria 8985
399 Ga0070702_100005985 3300005615 Bacteria 5724
400 Ga0070702_100008423 3300005615 Bacteria 4994
401 Ga0070702_100187386 3300005615 Bacteria 1359
402 Ga0070702_100205120 3300005615 Bacteria 1308
403 Ga0070702_100234665 3300005615 Bacteria 1235
404 Ga0070702_100248560 3300005615 Unclassified 1204
405 Ga0068852_100020835 3300005616 Bacteria 5218
406 Ga0068852_100286152 3300005616 Bacteria 1591
407 Ga0068859_100005674 3300005617 Bacteria 12705
408 Ga0068859_100006934 3300005617 Bacteria 11504
409 Ga0068859_100032628 3300005617 Bacteria 5230
410 Ga0068859_100114717 3300005617 Bacteria 2758
411 Ga0068859_100177118 3300005617 Bacteria 2214
412 Ga0068859_100236238 3300005617 Bacteria 1916
413 Ga0068859_100255757 3300005617 Bacteria 1842
414 Ga0068859_100291337 3300005617 Bacteria 1725
415 Ga0068864_100002153 3300005618 Bacteria 16276
416 Ga0068864_100011322 3300005618 Bacteria 7371
417 Ga0068864_100064424 3300005618 Bacteria 3178
418 Ga0068864_100379613 3300005618 Bacteria 1339
419 Ga0068866_10022809 3300005718 Bacteria 2902
420 Ga0068866_10045017 3300005718 Bacteria 2211
421 Ga0068866_10112345 3300005718 Bacteria 1522
422 Ga0068866_10124801 3300005718 Bacteria 1456
423 Ga0068861_100004172 3300005719 Bacteria 9686
424 Ga0068861_100006765 3300005719 Bacteria 7832
425 Ga0068861_100016484 3300005719 Bacteria 5229
426 Ga0068861_100036905 3300005719 Bacteria 3630
427 Ga0068861_100127531 3300005719 Bacteria 2061
428 Ga0068861_100137584 3300005719 Bacteria 1989
429 Ga0068870_10000557 3300005840 Bacteria 14121
430 Ga0068870_10006514 3300005840 Bacteria 5152
431 Ga0068870_10009111 3300005840 Bacteria 4498
432 Ga0068870_10072886 3300005840 Bacteria 1878
433 Ga0068870_10118420 3300005840 Bacteria 1522
434 Ga0068870_10159185 3300005840 Unclassified 1337
435 Ga0068863_100002178 3300005841 Bacteria 19421
436 Ga0068863_100074444 3300005841 Bacteria 3213
437 Ga0068863_100420346 3300005841 Bacteria 1309
438 Ga0068863_100423778 3300005841 Bacteria 1304
439 Ga0068858_100013286 3300005842 Bacteria 7763
440 Ga0068858_100197737 3300005842 Unclassified 1900
441 Ga0068858_100380985 3300005842 Bacteria 1354
442 Ga0068860_100013045 3300005843 Bacteria 8156
443 Ga0068860_100047726 3300005843 Bacteria 4081
444 Ga0068860_100107227 3300005843 Bacteria 2669
445 Ga0068860_100237678 3300005843 Bacteria 1772
446 Ga0068860_100588625 3300005843 Bacteria 1117
447 Ga0068862_100003736 3300005844 Bacteria 12990
448 Ga0068862_100008127 3300005844 Bacteria 8679
449 Ga0068862_100017981 3300005844 Bacteria 5888
450 Ga0068862_100031803 3300005844 Bacteria 4457
451 Ga0068862_100054238 3300005844 Bacteria 3432
452 Ga0068862_100064273 3300005844 Bacteria 3158
453 Ga0068862_100114304 3300005844 Unclassified 2372
454 Ga0068862_100241030 3300005844 Bacteria 1644
455 Ga0068862_100767709 3300005844 Bacteria 939
456 Ga0081455_10000117 3300005937 Bacteria 91308
457 Ga0081455_10008160 3300005937 Bacteria 10922
458 Ga0081455_10013302 3300005937 Bacteria 8145
459 Ga0081455_10026852 3300005937 Bacteria 5287
460 Ga0081455_10028601 3300005937 Bacteria 5092
461 Ga0081455_10052051 3300005937 Bacteria 3508
462 Ga0081455_10058940 3300005937 Bacteria 3245
463 Ga0081455_10068856 3300005937 Bacteria 2945
464 Ga0081538_10001519 3300005981 Bacteria 23824
465 Ga0081538_10006724 3300005981 Bacteria 10062
466 Ga0081538_10011267 3300005981 Bacteria 7257
467 Ga0081538_10017184 3300005981 Bacteria 5503
468 Ga0081538_10021239 3300005981 Bacteria 4748
469 Ga0081538_10025235 3300005981 Bacteria 4199
470 Ga0081538_10125338 3300005981 Bacteria 1222
471 Ga0081540_1002404 3300005983 Bacteria 15259
472 Ga0081540_1048898 3300005983 Bacteria 2114
473 Ga0081540_1067717 3300005983 Bacteria 1667
474 Ga0081540_1085559 3300005983 Bacteria 1404
475 Ga0081539_10000661 3300005985 Bacteria 69277
476 Ga0081539_10001109 3300005985 Bacteria 48782
477 Ga0081539_10001453 3300005985 Bacteria 40412
478 Ga0081539_10005512 3300005985 Bacteria 12850
479 Ga0081539_10012499 3300005985 Bacteria 6535
480 Ga0081539_10023501 3300005985 Bacteria 4037
481 Ga0081539_10043657 3300005985 Bacteria 2596
482 Ga0081539_10056670 3300005985 Bacteria 2173
483 Ga0081539_10066143 3300005985 Bacteria 1960
484 Ga0081539_10071202 3300005985 Bacteria 1863
485 Ga0070717_10000455 3300006028 Bacteria 25952
486 Ga0070717_10000474 3300006028 Bacteria 25595
487 Ga0070717_10000663 3300006028 Bacteria 22135
488 Ga0070717_10001305 3300006028 Bacteria 17052
489 Ga0070717_10004710 3300006028 Bacteria 9910
490 Ga0070717_10006234 3300006028 Bacteria 8760
491 Ga0070717_10019190 3300006028 Bacteria 5358
492 Ga0070717_10069708 3300006028 Unclassified 2929
493 Ga0070717_10322195 3300006028 Bacteria 1377
494 Ga0070717_10342567 3300006028 Bacteria 1335
495 Ga0075365_10028966 3300006038 Bacteria 3534
496 Ga0075368_10000654 3300006042 Bacteria 10548
497 Ga0075363_100004116 3300006048 Bacteria 6311
498 Ga0075364_10119852 3300006051 Bacteria 1761
499 Ga0075432_10000257 3300006058 Bacteria 14537
500 Ga0075432_10000605 3300006058 Bacteria 10873
501 Ga0075432_10017643 3300006058 Bacteria 2433
502 Ga0075432_10019506 3300006058 Bacteria 2318
503 Ga0075432_10020674 3300006058 Bacteria 2251
504 Ga0075432_10077002 3300006058 Bacteria 1205
505 Ga0075432_10122241 3300006058 Bacteria 979
506 Ga0070716_100029466 3300006173 Bacteria 2968
507 Ga0070716_100111105 3300006173 Bacteria 1699
508 Ga0070712_100043532 3300006175 Bacteria 3091
509 Ga0070712_100105520 3300006175 Bacteria 2093
510 Ga0075367_10003476 3300006178 Bacteria 7519
511 Ga0075367_10014792 3300006178 Bacteria 4227
512 Ga0075366_10083875 3300006195 Bacteria 1905
513 Ga0097621_100345089 3300006237 Bacteria 1323
514 Ga0097621_100636857 3300006237 Bacteria 977
515 Ga0075370_10105583 3300006353 Bacteria 1633
516 Ga0068871_100107850 3300006358 Bacteria 2340
517 Ga0068871_100273256 3300006358 Bacteria 1477
518 Ga0075428_100004044 3300006844 Bacteria 16119
519 Ga0075428_100004057 3300006844 Bacteria 16096
520 Ga0075428_100004979 3300006844 Bacteria 14754
521 Ga0075428_100005176 3300006844 Bacteria 14480
522 Ga0075428_100005945 3300006844 Bacteria 13561
523 Ga0075428_100020165 3300006844 Bacteria 7383
524 Ga0075428_100021003 3300006844 Bacteria 7232
525 Ga0075428_100023949 3300006844 Bacteria 6755
526 Ga0075428_100029571 3300006844 Bacteria 6061
527 Ga0075428_100030809 3300006844 Bacteria 5931
528 Ga0075428_100033433 3300006844 Bacteria 5679
529 Ga0075428_100050891 3300006844 Bacteria 4542
530 Ga0075428_100059236 3300006844 Bacteria 4193
531 Ga0075428_100081203 3300006844 Bacteria 3538
532 Ga0075428_100081513 3300006844 Bacteria 3531
533 Ga0075428_100100894 3300006844 Bacteria 3147
534 Ga0075428_100110686 3300006844 Bacteria 2992
535 Ga0075428_100130992 3300006844 Bacteria 2728
536 Ga0075428_100196055 3300006844 Bacteria 2184
537 Ga0075428_100208825 3300006844 Bacteria 2110
538 Ga0075428_100295291 3300006844 Bacteria 1743
539 Ga0075428_100296912 3300006844 Bacteria 1737
540 Ga0075428_100410494 3300006844 Bacteria 1451
541 Ga0075428_100449133 3300006844 Unclassified 1381
542 Ga0075428_100469036 3300006844 Bacteria 1348
543 Ga0075428_100472117 3300006844 Bacteria 1343
544 Ga0075430_100002680 3300006846 Bacteria 14865
545 Ga0075430_100009788 3300006846 Bacteria 8108
546 Ga0075430_100015860 3300006846 Bacteria 6418
547 Ga0075430_100016591 3300006846 Bacteria 6272
548 Ga0075430_100019558 3300006846 Bacteria 5760
549 Ga0075430_100019595 3300006846 Bacteria 5755
550 Ga0075430_100027885 3300006846 Bacteria 4797
551 Ga0075430_100033393 3300006846 Bacteria 4367
552 Ga0075430_100035876 3300006846 Bacteria 4205
553 Ga0075430_100036140 3300006846 Bacteria 4189
554 Ga0075430_100054190 3300006846 Bacteria 3375
555 Ga0075430_100081703 3300006846 Bacteria 2707
556 Ga0075430_100090787 3300006846 Bacteria 2555
557 Ga0075430_100341442 3300006846 Bacteria 1237
558 Ga0075431_100000365 3300006847 Bacteria 35889
559 Ga0075431_100002302 3300006847 Bacteria 18344
560 Ga0075431_100005031 3300006847 Bacteria 13007
561 Ga0075431_100008223 3300006847 Bacteria 10427
562 Ga0075431_100008304 3300006847 Bacteria 10384
563 Ga0075431_100016368 3300006847 Bacteria 7525
564 Ga0075431_100022587 3300006847 Bacteria 6432
565 Ga0075431_100038040 3300006847 Bacteria 4954
566 Ga0075431_100043250 3300006847 Bacteria 4649
567 Ga0075431_100059967 3300006847 Bacteria 3926
568 Ga0075431_100069085 3300006847 Bacteria 3645
569 Ga0075431_100071494 3300006847 Bacteria 3580
570 Ga0075431_100074281 3300006847 Bacteria 3508
571 Ga0075431_100104748 3300006847 Bacteria 2919
572 Ga0075431_100118150 3300006847 Bacteria 2736
573 Ga0075431_100192008 3300006847 Bacteria 2092
574 Ga0075431_100216808 3300006847 Bacteria 1953
575 Ga0075431_100229350 3300006847 Bacteria 1892
576 Ga0075431_100236249 3300006847 Unclassified 1861
577 Ga0075431_100290843 3300006847 Bacteria 1653
578 Ga0075431_100394543 3300006847 Bacteria 1386
579 Ga0075433_10000376 3300006852 Bacteria 28135
580 Ga0075433_10002577 3300006852 Bacteria 13817
581 Ga0075433_10004697 3300006852 Bacteria 10641
582 Ga0075433_10006409 3300006852 Bacteria 9305
583 Ga0075433_10007197 3300006852 Bacteria 8810
584 Ga0075433_10008229 3300006852 Bacteria 8311
585 Ga0075433_10010783 3300006852 Bacteria 7350
586 Ga0075433_10024132 3300006852 Bacteria 5128
587 Ga0075433_10024370 3300006852 Bacteria 5105
588 Ga0075433_10028207 3300006852 Bacteria 4772
589 Ga0075433_10039083 3300006852 Bacteria 4101
590 Ga0075433_10048992 3300006852 Bacteria 3675
591 Ga0075433_10052614 3300006852 Bacteria 3548
592 Ga0075433_10060745 3300006852 Bacteria 3310
593 Ga0075433_10090919 3300006852 Bacteria 2698
594 Ga0075433_10119880 3300006852 Bacteria 2335
595 Ga0075433_10158428 3300006852 Bacteria 2014
596 Ga0075433_10273274 3300006852 Bacteria 1498
597 Ga0075433_10275182 3300006852 Bacteria 1492
598 Ga0075433_10287315 3300006852 Bacteria 1457
599 Ga0075433_10425106 3300006852 Bacteria 1172
600 Ga0075434_100001579 3300006871 Bacteria 19302
601 Ga0075434_100004645 3300006871 Bacteria 12415
602 Ga0075434_100007556 3300006871 Bacteria 10070
603 Ga0075434_100007992 3300006871 Bacteria 9806
604 Ga0075434_100011377 3300006871 Bacteria 8392
605 Ga0075434_100019500 3300006871 Bacteria 6565
606 Ga0075434_100027032 3300006871 Bacteria 5631
607 Ga0075434_100027245 3300006871 Bacteria 5608
608 Ga0075434_100032985 3300006871 Bacteria 5108
609 Ga0075434_100036602 3300006871 Bacteria 4855
610 Ga0075434_100039325 3300006871 Bacteria 4686
611 Ga0075434_100043193 3300006871 Bacteria 4470
612 Ga0075434_100076878 3300006871 Bacteria 3333
613 Ga0075434_100115001 3300006871 Bacteria 2703
614 Ga0075434_100118683 3300006871 Bacteria 2659
615 Ga0075434_100133541 3300006871 Bacteria 2501
616 Ga0075434_100135347 3300006871 Bacteria 2483
617 Ga0075434_100146243 3300006871 Bacteria 2384
618 Ga0075434_100147708 3300006871 Bacteria 2371
619 Ga0075434_100167568 3300006871 Bacteria 2217
620 Ga0075434_100186619 3300006871 Bacteria 2094
621 Ga0075434_100468816 3300006871 Bacteria 1280
622 Ga0075434_100717819 3300006871 Bacteria 1017
623 Ga0075434_100744941 3300006871 Bacteria 997
624 Ga0075434_100744964 3300006871 Bacteria 997
625 Ga0075429_100001630 3300006880 Bacteria 18533
626 Ga0075429_100006488 3300006880 Bacteria 10131
627 Ga0075429_100008200 3300006880 Bacteria 9081
628 Ga0075429_100013336 3300006880 Bacteria 7126
629 Ga0075429_100025841 3300006880 Bacteria 5098
630 Ga0075429_100031310 3300006880 Bacteria 4623
631 Ga0075429_100032280 3300006880 Bacteria 4551
632 Ga0075429_100048430 3300006880 Bacteria 3696
633 Ga0075429_100051809 3300006880 Bacteria 3570
634 Ga0075429_100052001 3300006880 Bacteria 3564
635 Ga0075429_100073644 3300006880 Bacteria 2974
636 Ga0075429_100079930 3300006880 Bacteria 2850
637 Ga0075429_100125977 3300006880 Bacteria 2240
638 Ga0075429_100135232 3300006880 Bacteria 2157
639 Ga0075429_100136642 3300006880 Bacteria 2145
640 Ga0075429_100157714 3300006880 Bacteria 1987
641 Ga0075429_100191635 3300006880 Bacteria 1791
642 Ga0075429_100231116 3300006880 Bacteria 1620
643 Ga0075429_100253861 3300006880 Bacteria 1540
644 Ga0075429_100280883 3300006880 Bacteria 1458
645 Ga0075429_100372263 3300006880 Bacteria 1251
646 Ga0075429_100477922 3300006880 Bacteria 1092
647 Ga0075429_100633535 3300006880 Bacteria 937
648 Ga0075429_100654144 3300006880 Bacteria 921
649 Ga0068865_100027436 3300006881 Bacteria 3762
650 Ga0068865_100042278 3300006881 Bacteria 3107
651 Ga0068865_100384515 3300006881 Bacteria 1145
652 Ga0068865_100396643 3300006881 Bacteria 1129
653 Ga0075436_100000378 3300006914 Bacteria 28438
654 Ga0075436_100003944 3300006914 Bacteria 10171
655 Ga0075436_100011097 3300006914 Bacteria 6180
656 Ga0075436_100011395 3300006914 Bacteria 6104
657 Ga0075436_100014189 3300006914 Bacteria 5454
658 Ga0075436_100026276 3300006914 Bacteria 4008
659 Ga0075436_100037362 3300006914 Bacteria 3353
660 Ga0075436_100061810 3300006914 Bacteria 2588
661 Ga0075436_100266771 3300006914 Bacteria 1222
662 Ga0075436_100283675 3300006914 Bacteria 1184
663 Ga0097620_100005674 3300006931 Bacteria 12705
664 Ga0097620_100006935 3300006931 Bacteria 11504
665 Ga0097620_100032630 3300006931 Bacteria 5230
666 Ga0097620_100114716 3300006931 Bacteria 2758
667 Ga0097620_100177111 3300006931 Bacteria 2214
668 Ga0097620_100236233 3300006931 Bacteria 1916
669 Ga0097620_100255770 3300006931 Bacteria 1842
670 Ga0097620_100291349 3300006931 Bacteria 1725
671 Ga0075435_100002839 3300007076 Bacteria 11595
672 Ga0075435_100004207 3300007076 Bacteria 9877
673 Ga0075435_100008343 3300007076 Bacteria 7426
674 Ga0075435_100025191 3300007076 Bacteria 4628
675 Ga0075435_100041444 3300007076 Bacteria 3680
676 Ga0075435_100174000 3300007076 Bacteria 1817
677 Ga0075435_100174944 3300007076 Bacteria 1812
678 Ga0099794_10000234 3300007265 Bacteria 19924
679 Ga0099794_10001438 3300007265 Bacteria 8327
680 Ga0099794_10001892 3300007265 Bacteria 7502
681 Ga0099794_10003489 3300007265 Archaea 6011
682 Ga0099794_10003901 3300007265 Bacteria 5777
683 Ga0099794_10011400 3300007265 Bacteria 3805
684 Ga0099794_10014370 3300007265 Bacteria 3468
685 Ga0099794_10028151 3300007265 Bacteria 2612
686 Ga0099794_10040249 3300007265 Bacteria 2222
687 Ga0099794_10046086 3300007265 Bacteria 2087
688 Ga0099794_10112145 3300007265 Bacteria 1367
689 Ga0099794_10182848 3300007265 Bacteria 1070
690 Ga0099795_10021648 3300007788 Bacteria 2112
691 Ga0099795_10123680 3300007788 Bacteria 1037
692 Ga0105240_10012393 3300009093 Bacteria 11774
693 Ga0111539_10002609 3300009094 Bacteria 23891
694 Ga0111539_10009519 3300009094 Bacteria 12264
695 Ga0111539_10033335 3300009094 Bacteria 6253
696 Ga0111539_10044490 3300009094 Bacteria 5319
697 Ga0111539_10049129 3300009094 Bacteria 5034
698 Ga0111539_10056002 3300009094 Bacteria 4688
699 Ga0111539_10073734 3300009094 Bacteria 4024
700 Ga0111539_10092847 3300009094 Bacteria 3546
701 Ga0111539_10152112 3300009094 Bacteria 2708
702 Ga0111539_10193113 3300009094 Unclassified 2375
703 Ga0111539_10263737 3300009094 Bacteria 2005
704 Ga0111539_10294627 3300009094 Unclassified 1888
705 Ga0111539_10412118 3300009094 Bacteria 1574
706 Ga0111539_10437985 3300009094 Bacteria 1522
707 Ga0111539_10460640 3300009094 Bacteria 1481
708 Ga0111539_11066035 3300009094 Bacteria 939
709 Ga0105245_10012084 3300009098 Bacteria 7508
710 Ga0105245_10022829 3300009098 Bacteria 5490
711 Ga0105245_10071039 3300009098 Bacteria 3160
712 Ga0105245_10091412 3300009098 Bacteria 2801
713 Ga0105245_10204557 3300009098 Bacteria 1897
714 Ga0105245_10501335 3300009098 Bacteria 1230
715 Ga0105245_10648864 3300009098 Bacteria 1085
716 Ga0105247_10015245 3300009101 Bacteria 4607
717 Ga0114129_10000090 3300009147 Bacteria 86472
718 Ga0114129_10000606 3300009147 Bacteria 44322
719 Ga0114129_10001858 3300009147 Bacteria 28777
720 Ga0114129_10004397 3300009147 Bacteria 19875
721 Ga0114129_10008856 3300009147 Bacteria 14359
722 Ga0114129_10009242 3300009147 Bacteria 14060
723 Ga0114129_10013208 3300009147 Bacteria 11764
724 Ga0114129_10014509 3300009147 Bacteria 11229
725 Ga0114129_10019560 3300009147 Bacteria 9641
726 Ga0114129_10022060 3300009147 Bacteria 9036
727 Ga0114129_10028902 3300009147 Bacteria 7854
728 Ga0114129_10032990 3300009147 Bacteria 7318
729 Ga0114129_10033854 3300009147 Bacteria 7217
730 Ga0114129_10050829 3300009147 Bacteria 5821
731 Ga0114129_10063274 3300009147 Bacteria 5167
732 Ga0114129_10065657 3300009147 Bacteria 5064
733 Ga0114129_10068040 3300009147 Bacteria 4967
734 Ga0114129_10078210 3300009147 Bacteria 4601
735 Ga0114129_10084554 3300009147 Unclassified 4405
736 Ga0114129_10095112 3300009147 Bacteria 4126
737 Ga0114129_10113157 3300009147 Bacteria 3743
738 Ga0114129_10113892 3300009147 Bacteria 3729
739 Ga0114129_10116877 3300009147 Bacteria 3675
740 Ga0114129_10132695 3300009147 Bacteria 3419
741 Ga0114129_10137149 3300009147 Bacteria 3356
742 Ga0114129_10148624 3300009147 Bacteria 3208
743 Ga0114129_10151564 3300009147 Bacteria 3173
744 Ga0114129_10160235 3300009147 Bacteria 3074
745 Ga0114129_10197829 3300009147 Bacteria 2724
746 Ga0114129_10207838 3300009147 Bacteria 2648
747 Ga0114129_10231637 3300009147 Bacteria 2488
748 Ga0114129_10240530 3300009147 Bacteria 2434
749 Ga0114129_10256706 3300009147 Bacteria 2344
750 Ga0114129_10256877 3300009147 Bacteria 2344
751 Ga0114129_10277122 3300009147 Bacteria 2242
752 Ga0114129_10317493 3300009147 Bacteria 2072
753 Ga0114129_10329181 3300009147 Bacteria 2029
754 Ga0114129_10426595 3300009147 Bacteria 1743
755 Ga0114129_10458775 3300009147 Bacteria 1670
756 Ga0114129_10466245 3300009147 Bacteria 1655
757 Ga0114129_10484898 3300009147 Bacteria 1617
758 Ga0114129_10514016 3300009147 Bacteria 1562
759 Ga0114129_10540649 3300009147 Bacteria 1516
760 Ga0114129_10617927 3300009147 Bacteria 1402
761 Ga0114129_10631639 3300009147 Bacteria 1384
762 Ga0114129_10635044 3300009147 Bacteria 1380
763 Ga0114129_10686357 3300009147 Bacteria 1318
764 Ga0114129_10686808 3300009147 Bacteria 1317
765 Ga0114129_10713598 3300009147 Bacteria 1287
766 Ga0114129_10726586 3300009147 Bacteria 1274
767 Ga0114129_10730817 3300009147 Bacteria 1269
768 Ga0114129_10748705 3300009147 Bacteria 1251
769 Ga0114129_10890404 3300009147 Unclassified 1129
770 Ga0114129_11225878 3300009147 Bacteria 933
771 Ga0114129_11313267 3300009147 Bacteria 896
772 Ga0105243_10011341 3300009148 Bacteria 6745
773 Ga0105243_10045622 3300009148 Bacteria 3445
774 Ga0105243_10047264 3300009148 Bacteria 3387
775 Ga0105243_10215740 3300009148 Bacteria 1693
776 Ga0105241_10624456 3300009174 Bacteria 976
777 Ga0105241_10706205 3300009174 Bacteria 921
778 Ga0105241_10721167 3300009174 Bacteria 912
779 Ga0105242_10011679 3300009176 Bacteria 6758
780 Ga0105242_10028855 3300009176 Bacteria 4420
781 Ga0105242_10326886 3300009176 Bacteria 1408
782 Ga0105242_10448569 3300009176 Bacteria 1215
783 Ga0105248_10136159 3300009177 Bacteria 2770
784 Ga0105248_10157132 3300009177 Bacteria 2566
785 Ga0105248_10230881 3300009177 Bacteria 2083
786 Ga0105248_10243366 3300009177 Bacteria 2025
787 Ga0105248_10348796 3300009177 Bacteria 1666
788 Ga0105237_10151793 3300009545 Bacteria 2313
789 Ga0105237_10289692 3300009545 Bacteria 1640
790 Ga0105238_10110072 3300009551 Bacteria 2736
791 Ga0105238_10855443 3300009551 Bacteria 927
792 Ga0105238_10862891 3300009551 Bacteria 923
793 Ga0105249_10011729 3300009553 Bacteria 7707
794 Ga0105249_10026242 3300009553 Bacteria 5248
795 Ga0105249_10061604 3300009553 Bacteria 3444
796 Ga0105249_10064487 3300009553 Bacteria 3368
797 Ga0105249_10068337 3300009553 Bacteria 3277
798 Ga0105249_10103667 3300009553 Bacteria 2679
799 Ga0105249_10160450 3300009553 Bacteria 2172
800 Ga0105249_10213859 3300009553 Bacteria 1893
801 Ga0105249_10293206 3300009553 Bacteria 1629
802 Ga0105249_10601272 3300009553 Bacteria 1154
803 Ga0105249_10703950 3300009553 Bacteria 1070
804 Ga0105239_10044786 3300010375 Bacteria 4849
805 Ga0105239_10124783 3300010375 Bacteria 2861
806 Ga0105239_10585257 3300010375 Bacteria 1272
807 Ga0105239_10675803 3300010375 Bacteria 1180
808 Ga0105246_10026403 3300011119 Bacteria 3794
809 Ga0157371_10009856 3300013102 Bacteria 7486
810 Ga0157369_10035233 3300013105 Bacteria 5489
811 Ga0157369_10048474 3300013105 Bacteria 4610
812 Ga0157374_10161957 3300013296 Bacteria 2179
813 Ga0157374_10222929 3300013296 Bacteria 1851
814 Ga0157374_10301345 3300013296 Bacteria 1586
815 Ga0157378_10499246 3300013297 Bacteria 1215
816 Ga0163162_10044482 3300013306 Bacteria 4448
817 Ga0163162_10059786 3300013306 Bacteria 3844
818 Ga0163162_10065481 3300013306 Bacteria 3681
819 Ga0163162_10087881 3300013306 Bacteria 3188
820 Ga0163162_10242940 3300013306 Bacteria 1932
821 Ga0163162_10393092 3300013306 Bacteria 1519
822 Ga0163162_10643029 3300013306 Bacteria 1185
823 Ga0157372_10006388 3300013307 Bacteria 12539
824 Ga0157372_10096063 3300013307 Bacteria 3377
825 Ga0157372_10521349 3300013307 Bacteria 1385
826 Ga0157372_10894718 3300013307 Bacteria 1030
827 Ga0157375_10005887 3300013308 Bacteria 10680
828 Ga0157375_10146685 3300013308 Bacteria 2491
829 Ga0157375_10163011 3300013308 Bacteria 2373
830 Ga0157375_10389009 3300013308 Bacteria 1561
831 Ga0163163_10024178 3300014325 Bacteria 5780
832 Ga0163163_10033194 3300014325 Bacteria 4991
833 Ga0163163_10162779 3300014325 Bacteria 2277
834 Ga0163163_10783301 3300014325 Bacteria 1017
835 Ga0157380_10010539 3300014326 Bacteria 6651
836 Ga0157380_10017181 3300014326 Bacteria 5350
837 Ga0157380_10032889 3300014326 Bacteria 3991
838 Ga0157380_10062259 3300014326 Bacteria 2988
839 Ga0157380_10219941 3300014326 Bacteria 1698
840 Ga0157380_10248691 3300014326 Bacteria 1608
841 Ga0157380_10265910 3300014326 Bacteria 1560
842 Ga0157380_10405210 3300014326 Bacteria 1295
843 Ga0157380_10441415 3300014326 Bacteria 1247
844 Ga0157380_11028960 3300014326 Bacteria 859
845 Ga0182008_10135665 3300014497 Bacteria 1229
846 Ga0157377_10253759 3300014745 Bacteria 1141
847 Ga0157377_10412956 3300014745 Bacteria 922
848 Ga0157379_10007523 3300014968 Bacteria 9427
849 Ga0182007_10063031 3300015262 Bacteria 1215
850 Ga0163161_10011723 3300017792 Bacteria 6081
851 Ga0163161_10023824 3300017792 Bacteria 4320
852 Ga0163161_10026034 3300017792 Bacteria 4144
853 Ga0163161_10143889 3300017792 Bacteria 1807
854 Ga0163161_10370466 3300017792 Bacteria 1143
855 Ga0206356_10378591 3300020070 Bacteria 7080
856 Ga0206356_10727865 3300020070 Bacteria 2767
857 Ga0206349_1150188 3300020075 Bacteria 4920
858 Ga0206349_1493853 3300020075 Unclassified 1526
859 Ga0206351_10878113 3300020077 Bacteria 4939
860 Ga0206352_11141605 3300020078 Bacteria 2668
861 Ga0206350_10461530 3300020080 Bacteria 3850
862 Ga0206350_10558755 3300020080 Unclassified 1573
863 Ga0206350_11346923 3300020080 Bacteria 3787
864 Ga0154015_1132504 3300020610 Bacteria 1884
865 Ga0213872_10001214 3300021361 Bacteria 17438
866 Ga0213874_10040740 3300021377 Unclassified 1388
867 Ga0213876_10076820 3300021384 Bacteria 1764
868 Ga0224712_10003943 3300022467 Bacteria 3938
869 Ga0224712_10005506 3300022467 Bacteria 3533
870 Ga0224712_10043248 3300022467 Bacteria 1711
871 Ga0224712_10101473 3300022467 Unclassified 1221
872 Ga0207697_10004113 3300025315 Bacteria 7023
873 Ga0207697_10033864 3300025315 Bacteria 2091
874 Ga0207697_10070647 3300025315 Bacteria 1463
875 Ga0207653_10000702 3300025885 Bacteria 11493
876 Ga0207653_10001325 3300025885 Bacteria 8043
877 Ga0207653_10014527 3300025885 Bacteria 2472
878 Ga0207653_10033876 3300025885 Bacteria 1657
879 Ga0207653_10159632 3300025885 Bacteria 834
880 Ga0207682_10001937 3300025893 Bacteria 9407
881 Ga0207688_10000529 3300025901 Bacteria 18516
882 Ga0207688_10002175 3300025901 Bacteria 10557
883 Ga0207688_10004627 3300025901 Bacteria 7499
884 Ga0207680_10114424 3300025903 Bacteria 1755
885 Ga0207647_10247973 3300025904 Bacteria 1022
886 Ga0207699_10000062 3300025906 Bacteria 88201
887 Ga0207699_10138770 3300025906 Bacteria 1595
888 Ga0207699_10152748 3300025906 Bacteria 1529
889 Ga0207699_10157949 3300025906 Unclassified 1507
890 Ga0207645_10018622 3300025907 Bacteria 4562
891 Ga0207645_10044881 3300025907 Bacteria 2827
892 Ga0207645_10065603 3300025907 Bacteria 2321
893 Ga0207643_10000522 3300025908 Bacteria 24626
894 Ga0207643_10010456 3300025908 Bacteria 4998
895 Ga0207643_10020183 3300025908 Bacteria 3656
896 Ga0207643_10126811 3300025908 Bacteria 1516
897 Ga0207643_10193094 3300025908 Bacteria 1237
898 Ga0207684_10000001 3300025910 Bacteria 1115726
899 Ga0207684_10000006 3300025910 Bacteria 688605
900 Ga0207684_10000054 3300025910 Bacteria 220915
901 Ga0207684_10000095 3300025910 Bacteria 165210
902 Ga0207684_10000141 3300025910 Bacteria 129376
903 Ga0207684_10000369 3300025910 Bacteria 60835
904 Ga0207684_10001354 3300025910 Bacteria 26829
905 Ga0207684_10005238 3300025910 Bacteria 12034
906 Ga0207684_10009330 3300025910 Bacteria 8671
907 Ga0207684_10010788 3300025910 Bacteria 8018
908 Ga0207684_10035465 3300025910 Bacteria 4236
909 Ga0207684_10038071 3300025910 Bacteria 4081
910 Ga0207684_10040727 3300025910 Bacteria 3938
911 Ga0207684_10048846 3300025910 Bacteria 3589
912 Ga0207684_10064221 3300025910 Bacteria 3117
913 Ga0207684_10064718 3300025910 Bacteria 3104
914 Ga0207684_10066207 3300025910 Bacteria 3068
915 Ga0207684_10079239 3300025910 Bacteria 2794
916 Ga0207684_10084274 3300025910 Bacteria 2707
917 Ga0207684_10092069 3300025910 Bacteria 2584
918 Ga0207684_10109271 3300025910 Bacteria 2367
919 Ga0207684_10140010 3300025910 Bacteria 2079
920 Ga0207684_10151427 3300025910 Bacteria 1996
921 Ga0207684_10269495 3300025910 Bacteria 1469
922 Ga0207684_10301290 3300025910 Bacteria 1382
923 Ga0207684_10331381 3300025910 Bacteria 1311
924 Ga0207684_10398744 3300025910 Bacteria 1183
925 Ga0207684_10433887 3300025910 Bacteria 1128
926 Ga0207684_10465576 3300025910 Bacteria 1085
927 Ga0207684_10509118 3300025910 Bacteria 1032
928 Ga0207707_10072524 3300025912 Bacteria 3002
929 Ga0207695_10003284 3300025913 Bacteria 22984
930 Ga0207693_10031243 3300025915 Bacteria 4207
931 Ga0207693_10106582 3300025915 Bacteria 2199
932 Ga0207663_10029273 3300025916 Bacteria 3233
933 Ga0207663_10148615 3300025916 Bacteria 1641
934 Ga0207660_10058495 3300025917 Bacteria 2764
935 Ga0207660_10642750 3300025917 Bacteria 865
936 Ga0207662_10002157 3300025918 Bacteria 9804
937 Ga0207662_10035200 3300025918 Bacteria 2924
938 Ga0207662_10061322 3300025918 Bacteria 2258
939 Ga0207662_10126777 3300025918 Bacteria 1606
940 Ga0207662_10269559 3300025918 Bacteria 1123
941 Ga0207662_10424937 3300025918 Bacteria 905
942 Ga0207662_10496766 3300025918 Bacteria 840
943 Ga0207649_10042608 3300025920 Bacteria 2770
944 Ga0207649_10404160 3300025920 Bacteria 1022
945 Ga0207649_10408206 3300025920 Bacteria 1018
946 Ga0207649_10487079 3300025920 Bacteria 936
947 Ga0207646_10000027 3300025922 Bacteria 235383
948 Ga0207646_10000028 3300025922 Bacteria 227768
949 Ga0207646_10000034 3300025922 Bacteria 212493
950 Ga0207646_10000053 3300025922 Bacteria 160799
951 Ga0207646_10000150 3300025922 Bacteria 95482
952 Ga0207646_10000212 3300025922 Bacteria 79788
953 Ga0207646_10000267 3300025922 Bacteria 71176
954 Ga0207646_10000384 3300025922 Bacteria 59418
955 Ga0207646_10000519 3300025922 Bacteria 51444
956 Ga0207646_10000696 3300025922 Bacteria 43552
957 Ga0207646_10000959 3300025922 Bacteria 37166
958 Ga0207646_10002046 3300025922 Bacteria 24232
959 Ga0207646_10002126 3300025922 Bacteria 23685
960 Ga0207646_10002767 3300025922 Bacteria 20490
961 Ga0207646_10007062 3300025922 Bacteria 11488
962 Ga0207646_10014285 3300025922 Bacteria 7549
963 Ga0207646_10014388 3300025922 Bacteria 7518
964 Ga0207646_10017681 3300025922 Bacteria 6663
965 Ga0207646_10017806 3300025922 Bacteria 6636
966 Ga0207646_10019826 3300025922 Bacteria 6242
967 Ga0207646_10022169 3300025922 Bacteria 5855
968 Ga0207646_10028803 3300025922 Bacteria 5052
969 Ga0207646_10029783 3300025922 Bacteria 4956
970 Ga0207646_10031485 3300025922 Bacteria 4801
971 Ga0207646_10032828 3300025922 Bacteria 4696
972 Ga0207646_10034912 3300025922 Bacteria 4545
973 Ga0207646_10051096 3300025922 Bacteria 3699
974 Ga0207646_10051199 3300025922 Bacteria 3695
975 Ga0207646_10053429 3300025922 Bacteria 3614
976 Ga0207646_10053442 3300025922 Bacteria 3613
977 Ga0207646_10056592 3300025922 Bacteria 3504
978 Ga0207646_10066051 3300025922 Bacteria 3229
979 Ga0207646_10076116 3300025922 Bacteria 2999
980 Ga0207646_10079076 3300025922 Bacteria 2940
981 Ga0207646_10085502 3300025922 Bacteria 2822
982 Ga0207646_10086419 3300025922 Bacteria 2806
983 Ga0207646_10089728 3300025922 Bacteria 2751
984 Ga0207646_10091134 3300025922 Bacteria 2729
985 Ga0207646_10096453 3300025922 Bacteria 2649
986 Ga0207646_10102471 3300025922 Bacteria 2566
987 Ga0207646_10112448 3300025922 Unclassified 2444
988 Ga0207646_10113859 3300025922 Bacteria 2429
989 Ga0207646_10116991 3300025922 Bacteria 2394
990 Ga0207646_10128138 3300025922 Bacteria 2283
991 Ga0207646_10174374 3300025922 Bacteria 1942
992 Ga0207646_10187475 3300025922 Bacteria 1868
993 Ga0207646_10202523 3300025922 Bacteria 1793
994 Ga0207646_10237737 3300025922 Bacteria 1646
995 Ga0207646_10358751 3300025922 Bacteria 1317
996 Ga0207681_10009028 3300025923 Bacteria 6092
997 Ga0207681_10012394 3300025923 Bacteria 5261
998 Ga0207681_10032351 3300025923 Bacteria 3423
999 Ga0207681_10040254 3300025923 Bacteria 3109
1000 Ga0207681_10090069 3300025923 Bacteria 2189
1001 Ga0207681_10114598 3300025923 Bacteria 1967
1002 Ga0207681_10165821 3300025923 Bacteria 1670
1003 Ga0207650_10042254 3300025925 Bacteria 3344
1004 Ga0207650_10088774 3300025925 Bacteria 2358
1005 Ga0207659_10001803 3300025926 Bacteria 12669
1006 Ga0207659_10006313 3300025926 Bacteria 7253
1007 Ga0207659_10016712 3300025926 Bacteria 4781
1008 Ga0207659_10039418 3300025926 Bacteria 3295
1009 Ga0207659_10168875 3300025926 Bacteria 1724
1010 Ga0207659_10192880 3300025926 Bacteria 1622
1011 Ga0207687_10027928 3300025927 Bacteria 3788
1012 Ga0207687_10092851 3300025927 Bacteria 2205
1013 Ga0207687_10113657 3300025927 Bacteria 2014
1014 Ga0207687_10405665 3300025927 Bacteria 1122
1015 Ga0207700_10003852 3300025928 Bacteria 8768
1016 Ga0207700_10027193 3300025928 Bacteria 4002
1017 Ga0207700_10532306 3300025928 Bacteria 1042
1018 Ga0207664_10000322 3300025929 Bacteria 35563
1019 Ga0207664_10011171 3300025929 Bacteria 6366
1020 Ga0207664_10018041 3300025929 Bacteria 5185
1021 Ga0207664_10068886 3300025929 Unclassified 2844
1022 Ga0207664_10118135 3300025929 Bacteria 2215
1023 Ga0207664_10169444 3300025929 Bacteria 1868
1024 Ga0207664_10179323 3300025929 Bacteria 1818
1025 Ga0207664_10237204 3300025929 Bacteria 1587
1026 Ga0207664_10291478 3300025929 Bacteria 1434
1027 Ga0207644_10206907 3300025931 Bacteria 1550
1028 Ga0207644_10221683 3300025931 Bacteria 1499
1029 Ga0207644_10452171 3300025931 Bacteria 1055
1030 Ga0207690_10357947 3300025932 Bacteria 1155
1031 Ga0207706_10001923 3300025933 Bacteria 20399
1032 Ga0207706_10037703 3300025933 Bacteria 4291
1033 Ga0207706_10038413 3300025933 Bacteria 4247
1034 Ga0207706_10069543 3300025933 Bacteria 3097
1035 Ga0207706_10081865 3300025933 Bacteria 2837
1036 Ga0207706_10117429 3300025933 Bacteria 2340
1037 Ga0207706_10127589 3300025933 Bacteria 2237
1038 Ga0207706_10188276 3300025933 Bacteria 1812
1039 Ga0207706_10232069 3300025933 Bacteria 1614
1040 Ga0207686_10051912 3300025934 Bacteria 2556
1041 Ga0207686_10152767 3300025934 Bacteria 1609
1042 Ga0207686_10306290 3300025934 Bacteria 1182
1043 Ga0207709_10008103 3300025935 Bacteria 5821
1044 Ga0207709_10017550 3300025935 Bacteria 3995
1045 Ga0207709_10047631 3300025935 Bacteria 2607
1046 Ga0207709_10312741 3300025935 Unclassified 1172
1047 Ga0207670_10020287 3300025936 Bacteria 4081
1048 Ga0207670_10048755 3300025936 Bacteria 2828
1049 Ga0207670_10217969 3300025936 Bacteria 1459
1050 Ga0207669_10008443 3300025937 Bacteria 4837
1051 Ga0207704_10072620 3300025938 Bacteria 2188
1052 Ga0207704_10149065 3300025938 Bacteria 1648
1053 Ga0207704_10274540 3300025938 Bacteria 1278
1054 Ga0207704_10310962 3300025938 Bacteria 1211
1055 Ga0207665_10021158 3300025939 Bacteria 4275
1056 Ga0207665_10282458 3300025939 Unclassified 1236
1057 Ga0207665_10342952 3300025939 Bacteria 1126
1058 Ga0207691_10010420 3300025940 Bacteria 8920
1059 Ga0207691_10017419 3300025940 Bacteria 6814
1060 Ga0207691_10029048 3300025940 Bacteria 5172
1061 Ga0207691_10034893 3300025940 Bacteria 4673
1062 Ga0207691_10092038 3300025940 Bacteria 2716
1063 Ga0207691_10185134 3300025940 Bacteria 1818
1064 Ga0207691_10395064 3300025940 Bacteria 1180
1065 Ga0207711_10047316 3300025941 Bacteria 3677
1066 Ga0207711_10348799 3300025941 Bacteria 1370
1067 Ga0207711_10485902 3300025941 Bacteria 1150
1068 Ga0207689_10005477 3300025942 Bacteria 11359
1069 Ga0207689_10009037 3300025942 Bacteria 8628
1070 Ga0207689_10108532 3300025942 Bacteria 2281
1071 Ga0207689_10271888 3300025942 Bacteria 1403
1072 Ga0207689_10337423 3300025942 Bacteria 1252
1073 Ga0207689_10590901 3300025942 Bacteria 934
1074 Ga0207661_10027915 3300025944 Bacteria 4317
1075 Ga0207661_10035205 3300025944 Bacteria 3899
1076 Ga0207661_10039060 3300025944 Bacteria 3724
1077 Ga0207661_10118472 3300025944 Bacteria 2251
1078 Ga0207679_10012633 3300025945 Bacteria 5512
1079 Ga0207679_10028161 3300025945 Bacteria 3896
1080 Ga0207679_10060472 3300025945 Bacteria 2815
1081 Ga0207679_10276131 3300025945 Bacteria 1439
1082 Ga0207679_10433394 3300025945 Bacteria 1162
1083 Ga0207667_10039134 3300025949 Bacteria 5056
1084 Ga0207651_10029538 3300025960 Bacteria 3474
1085 Ga0207651_10714882 3300025960 Bacteria 883
1086 Ga0207651_10740975 3300025960 Bacteria 868
1087 Ga0207712_10011075 3300025961 Bacteria 5744
1088 Ga0207712_10014239 3300025961 Bacteria 5110
1089 Ga0207712_10031388 3300025961 Bacteria 3578
1090 Ga0207712_10085245 3300025961 Bacteria 2311
1091 Ga0207712_10089346 3300025961 Bacteria 2265
1092 Ga0207712_10134325 3300025961 Bacteria 1890
1093 Ga0207712_10272426 3300025961 Bacteria 1378
1094 Ga0207712_10289158 3300025961 Bacteria 1340
1095 Ga0207712_10579031 3300025961 Bacteria 969
1096 Ga0207712_10596016 3300025961 Bacteria 955
1097 Ga0207668_10010597 3300025972 Bacteria 5576
1098 Ga0207668_10044270 3300025972 Bacteria 3027
1099 Ga0207668_10052923 3300025972 Bacteria 2811
1100 Ga0207668_10085178 3300025972 Bacteria 2305
1101 Ga0207668_10093650 3300025972 Bacteria 2214
1102 Ga0207668_10196720 3300025972 Bacteria 1602
1103 Ga0207668_10381134 3300025972 Bacteria 1187
1104 Ga0207640_10057963 3300025981 Bacteria 2550
1105 Ga0207640_10353625 3300025981 Bacteria 1181
1106 Ga0207658_10055101 3300025986 Bacteria 2945
1107 Ga0207658_10208320 3300025986 Bacteria 1637
1108 Ga0207677_10042742 3300026023 Bacteria 3007
1109 Ga0207677_10069366 3300026023 Bacteria 2479
1110 Ga0207677_10173487 3300026023 Bacteria 1689
1111 Ga0207703_10158634 3300026035 Bacteria 1979
1112 Ga0207639_10041104 3300026041 Bacteria 3457
1113 Ga0207639_10120867 3300026041 Bacteria 2152
1114 Ga0207678_10017242 3300026067 Bacteria 6340
1115 Ga0207678_10086790 3300026067 Bacteria 2674
1116 Ga0207678_10138534 3300026067 Bacteria 2076
1117 Ga0207678_10431606 3300026067 Bacteria 1143
1118 Ga0207708_10000410 3300026075 Bacteria 33781
1119 Ga0207708_10014463 3300026075 Bacteria 5906
1120 Ga0207708_10089336 3300026075 Bacteria 2374
1121 Ga0207708_10111171 3300026075 Bacteria 2127
1122 Ga0207708_10173612 3300026075 Bacteria 1708
1123 Ga0207708_10277495 3300026075 Bacteria 1357
1124 Ga0207702_10004855 3300026078 Bacteria 11841
1125 Ga0207702_10072367 3300026078 Bacteria 2971
1126 Ga0207702_10173945 3300026078 Bacteria 1977
1127 Ga0207641_10017426 3300026088 Bacteria 5880
1128 Ga0207641_10040123 3300026088 Bacteria 3917
1129 Ga0207641_10087773 3300026088 Bacteria 2714
1130 Ga0207641_10133540 3300026088 Bacteria 2231
1131 Ga0207641_10384289 3300026088 Bacteria 1345
1132 Ga0207641_10631896 3300026088 Bacteria 1050
1133 Ga0207641_10715421 3300026088 Bacteria 987
1134 Ga0207648_10008240 3300026089 Bacteria 10118
1135 Ga0207648_10011193 3300026089 Bacteria 8459
1136 Ga0207648_10025537 3300026089 Bacteria 5261
1137 Ga0207648_10190229 3300026089 Bacteria 1818
1138 Ga0207648_10295453 3300026089 Bacteria 1451
1139 Ga0207648_10314387 3300026089 Bacteria 1406
1140 Ga0207676_10008005 3300026095 Bacteria 7514
1141 Ga0207676_10244117 3300026095 Bacteria 1613
1142 Ga0207676_10426937 3300026095 Bacteria 1244
1143 Ga0207676_10438975 3300026095 Bacteria 1228
1144 Ga0207674_10015431 3300026116 Bacteria 8393
1145 Ga0207674_10023829 3300026116 Bacteria 6550
1146 Ga0207674_10077473 3300026116 Bacteria 3330
1147 Ga0207674_10266388 3300026116 Bacteria 1661
1148 Ga0207675_100003908 3300026118 Bacteria 14486
1149 Ga0207675_100005342 3300026118 Bacteria 12344
1150 Ga0207675_100010076 3300026118 Bacteria 8861
1151 Ga0207675_100016874 3300026118 Bacteria 6822
1152 Ga0207675_100050995 3300026118 Bacteria 3862
1153 Ga0207675_100392377 3300026118 Bacteria 1367
1154 Ga0207675_100590434 3300026118 Bacteria 1113
1155 Ga0207683_10043064 3300026121 Bacteria 3944
1156 Ga0207683_10092889 3300026121 Bacteria 2689
1157 Ga0207683_10187969 3300026121 Bacteria 1874
1158 Ga0207683_10257205 3300026121 Bacteria 1594
1159 Ga0207698_10007219 3300026142 Bacteria 6959
1160 Ga0207698_10248712 3300026142 Bacteria 1625
1161 Ga0207698_10485291 3300026142 Bacteria 1199
1162 Ga0209969_1009002 3300027360 Bacteria 1419
1163 Ga0209967_1000872 3300027364 Bacteria 3876
1164 Ga0209981_1007501 3300027378 Bacteria 1472
1165 Ga0209996_1002534 3300027395 Bacteria 2262
1166 Ga0210000_1000741 3300027462 Bacteria 4525
1167 Ga0209968_1003008 3300027526 Bacteria 2528
1168 Ga0209999_1002412 3300027543 Bacteria 3300
1169 Ga0209982_1036167 3300027552 Bacteria 783
1170 Ga0209588_1000205 3300027671 Bacteria 15929
1171 Ga0209588_1000286 3300027671 Bacteria 13354
1172 Ga0209588_1002516 3300027671 Bacteria 4975
1173 Ga0209588_1003797 3300027671 Bacteria 4211
1174 Ga0209588_1003983 3300027671 Unclassified 4133
1175 Ga0209588_1027486 3300027671 Bacteria 1810
1176 Ga0209971_1005560 3300027682 Bacteria 2991
1177 Ga0209813_10147884 3300027866 Bacteria 839
1178 Ga0207428_10000839 3300027907 Bacteria 34605
1179 Ga0207428_10002093 3300027907 Bacteria 20115
1180 Ga0207428_10005110 3300027907 Bacteria 12316
1181 Ga0207428_10012831 3300027907 Bacteria 7347
1182 Ga0207428_10020337 3300027907 Bacteria 5640
1183 Ga0207428_10027679 3300027907 Bacteria 4718
1184 Ga0207428_10086155 3300027907 Bacteria 2445
1185 Ga0207428_10162354 3300027907 Bacteria 1696
1186 Ga0207428_10314828 3300027907 Bacteria 1156
1187 Ga0268266_10073101 3300028379 Bacteria 2975
1188 Ga0268265_10000767 3300028380 Bacteria 31011
1189 Ga0268265_10002690 3300028380 Bacteria 13168
1190 Ga0268265_10018200 3300028380 Bacteria 4866
1191 Ga0268265_10019126 3300028380 Bacteria 4754
1192 Ga0268265_10056069 3300028380 Unclassified 2997
1193 Ga0268265_10060859 3300028380 Bacteria 2895
1194 Ga0268265_10077660 3300028380 Bacteria 2608
1195 Ga0268265_10100075 3300028380 Bacteria 2339
1196 Ga0268265_10217273 3300028380 Bacteria 1670
1197 Ga0268265_10722497 3300028380 Bacteria 964
1198 Ga0268264_10007456 3300028381 Bacteria 9129
1199 Ga0268264_10052000 3300028381 Bacteria 3415
1200 Ga0268264_10081219 3300028381 Bacteria 2770
1201 Ga0268264_10088527 3300028381 Bacteria 2665
1202 Ga0268264_10635594 3300028381 Bacteria 1055
1203 Ga0307515_10001186 3300028794 Bacteria 59639
1204 Ga0316177_1122264 3300030731 Bacteria 2201
1205 Ga0316176_1055766 3300030732 Bacteria 2644
1206 Ga0314311_1014322 3300030733 Bacteria 2688
1207 Ga0265331_10163187 3300031250 Bacteria 1010
1208 Ga0265316_10021811 3300031344 Archaea 5414
1209 Ga0265316_10220502 3300031344 Bacteria 1400
1210 Ga0265316_10260183 3300031344 Unclassified 1272
1211 Ga0307408_100007288 3300031548 Bacteria 7318
1212 Ga0307408_100023491 3300031548 Bacteria 4200
1213 Ga0307408_100046024 3300031548 Bacteria 3119
1214 Ga0307408_100051979 3300031548 Bacteria 2954
1215 Ga0307408_100067271 3300031548 Bacteria 2634
1216 Ga0307408_100104056 3300031548 Bacteria 2168
1217 Ga0307408_100108693 3300031548 Bacteria 2126
1218 Ga0307408_100226196 3300031548 Bacteria 1529
1219 Ga0307408_100462758 3300031548 Bacteria 1103
1220 Ga0307408_100610156 3300031548 Bacteria 971
1221 Ga0307408_100622834 3300031548 Bacteria 961
1222 Ga0316575_10005365 3300031665 Bacteria 4567
1223 Ga0307516_10012394 3300031730 Bacteria 9193
1224 Ga0307516_10026185 3300031730 Bacteria 5926
1225 Ga0307516_10061606 3300031730 Bacteria 3639
1226 Ga0307405_10000417 3300031731 Bacteria 16027
1227 Ga0307405_10071664 3300031731 Bacteria 2230
1228 Ga0307405_10098271 3300031731 Bacteria 1956
1229 Ga0307405_10274132 3300031731 Bacteria 1266
1230 Ga0307405_10360036 3300031731 Bacteria 1125
1231 Ga0307405_10562669 3300031731 Bacteria 924
1232 Ga0307413_10033760 3300031824 Bacteria 2917
1233 Ga0307413_10068632 3300031824 Bacteria 2221
1234 Ga0307413_10104578 3300031824 Bacteria 1880
1235 Ga0307413_10106368 3300031824 Bacteria 1867
1236 Ga0307413_10112483 3300031824 Bacteria 1825
1237 Ga0307413_10230738 3300031824 Bacteria 1359
1238 Ga0307410_10001092 3300031852 Bacteria 11815
1239 Ga0307410_10004771 3300031852 Bacteria 7073
1240 Ga0307410_10012571 3300031852 Bacteria 4902
1241 Ga0307410_10129850 3300031852 Bacteria 1850
1242 Ga0307410_10522838 3300031852 Bacteria 979
1243 Ga0307410_10587514 3300031852 Bacteria 927
1244 Ga0326468_10000259 3300031889 Bacteria 5540
1245 Ga0307406_10000612 3300031901 Bacteria 20402
1246 Ga0307406_10000678 3300031901 Bacteria 19268
1247 Ga0307406_10001630 3300031901 Bacteria 12342
1248 Ga0307406_10003705 3300031901 Bacteria 8320
1249 Ga0307406_10027780 3300031901 Bacteria 3412
1250 Ga0307406_10051427 3300031901 Bacteria 2616
1251 Ga0307406_10073394 3300031901 Bacteria 2250
1252 Ga0307406_10114662 3300031901 Bacteria 1862
1253 Ga0307406_10165327 3300031901 Bacteria 1595
1254 Ga0307406_10478855 3300031901 Bacteria 1005
1255 Ga0307407_10000248 3300031903 Bacteria 16024
1256 Ga0307407_10012605 3300031903 Bacteria 4070
1257 Ga0307407_10029535 3300031903 Bacteria 2947
1258 Ga0307407_10106323 3300031903 Bacteria 1753
1259 Ga0307407_10184423 3300031903 Bacteria 1385
1260 Ga0307407_10245230 3300031903 Bacteria 1224
1261 Ga0307407_10288777 3300031903 Bacteria 1139
1262 Ga0307407_10323847 3300031903 Bacteria 1082
1263 Ga0307407_10363441 3300031903 Bacteria 1028
1264 Ga0307412_10009390 3300031911 Bacteria 5611
1265 Ga0307412_10061827 3300031911 Bacteria 2519
1266 Ga0307412_10130027 3300031911 Bacteria 1827
1267 Ga0307412_10192387 3300031911 Bacteria 1543
1268 Ga0307412_10206872 3300031911 Bacteria 1494
1269 Ga0307412_10481452 3300031911 Bacteria 1029
1270 Ga0307409_100000177 3300031995 Bacteria 24831
1271 Ga0307409_100000937 3300031995 Bacteria 13576
1272 Ga0307409_100029277 3300031995 Bacteria 3938
1273 Ga0307409_100038931 3300031995 Bacteria 3522
1274 Ga0307409_100039749 3300031995 Bacteria 3494
1275 Ga0307409_100179423 3300031995 Bacteria 1873
1276 Ga0307409_100183224 3300031995 Bacteria 1856
1277 Ga0307409_100211465 3300031995 Bacteria 1743
1278 Ga0307409_100319672 3300031995 Bacteria 1452
1279 Ga0307409_100396024 3300031995 Bacteria 1317
1280 Ga0307409_100409142 3300031995 Bacteria 1298
1281 Ga0307409_100426838 3300031995 Bacteria 1273
1282 Ga0307409_100494796 3300031995 Bacteria 1189
1283 Ga0307409_100534814 3300031995 Bacteria 1147
1284 Ga0307409_100575693 3300031995 Bacteria 1109
1285 Ga0307416_100000144 3300032002 Bacteria 41697
1286 Ga0307416_100000616 3300032002 Bacteria 18327
1287 Ga0307416_100005053 3300032002 Bacteria 8041
1288 Ga0307416_100006521 3300032002 Bacteria 7315
1289 Ga0307416_100013941 3300032002 Bacteria 5482
1290 Ga0307416_100033476 3300032002 Bacteria 3896
1291 Ga0307416_100062771 3300032002 Bacteria 3039
1292 Ga0307416_100074358 3300032002 Bacteria 2838
1293 Ga0307416_100080901 3300032002 Bacteria 2744
1294 Ga0307416_100097065 3300032002 Bacteria 2551
1295 Ga0307416_100106200 3300032002 Bacteria 2460
1296 Ga0307416_100158914 3300032002 Bacteria 2086
1297 Ga0307416_100314079 3300032002 Bacteria 1565
1298 Ga0307416_100325646 3300032002 Bacteria 1541
1299 Ga0307416_100695332 3300032002 Bacteria 1105
1300 Ga0307414_10010615 3300032004 Bacteria 5356
1301 Ga0307414_10011584 3300032004 Bacteria 5178
1302 Ga0307414_10018421 3300032004 Bacteria 4299
1303 Ga0307414_10036896 3300032004 Bacteria 3268
1304 Ga0307414_10052967 3300032004 Bacteria 2828
1305 Ga0307414_10132764 3300032004 Bacteria 1936
1306 Ga0307414_10471778 3300032004 Bacteria 1105
1307 Ga0307414_10624123 3300032004 Bacteria 969
1308 Ga0307411_10001453 3300032005 Bacteria 9696
1309 Ga0307411_10017783 3300032005 Bacteria 4063
1310 Ga0307411_10070569 3300032005 Bacteria 2364
1311 Ga0307411_10166661 3300032005 Bacteria 1657
1312 Ga0307411_10193232 3300032005 Bacteria 1556
1313 Ga0307411_10200013 3300032005 Bacteria 1533
1314 Ga0307411_10292178 3300032005 Bacteria 1303
1315 Ga0307411_10495044 3300032005 Bacteria 1032
1316 Ga0307411_10640920 3300032005 Bacteria 919
1317 Ga0307411_10704821 3300032005 Bacteria 880
1318 Ga0307415_100000923 3300032126 Bacteria 13447
1319 Ga0307415_100001280 3300032126 Bacteria 11851
1320 Ga0307415_100001381 3300032126 Bacteria 11577
1321 Ga0307415_100003687 3300032126 Bacteria 7838
1322 Ga0307415_100034563 3300032126 Bacteria 3293
1323 Ga0307415_100034630 3300032126 Bacteria 3290
1324 Ga0307415_100046659 3300032126 Bacteria 2911
1325 Ga0307415_100086002 3300032126 Bacteria 2261
1326 Ga0307415_100090019 3300032126 Bacteria 2218
1327 Ga0307415_100145150 3300032126 Bacteria 1818
1328 Ga0307415_100405597 3300032126 Bacteria 1165
1329 Ga0307415_100415597 3300032126 Bacteria 1152
1330 Ga0316593_10032304 3300032168 Bacteria 1709
1331 Ga0316593_10036407 3300032168 Unclassified 1622
1332 Ga0373958_0008548 3300034819 Bacteria 1662
1333 Ga0373949_0013896 3300035090 Bacteria 1790
1334 Ga0373952_0024498 3300035092 Bacteria 1296
1335 Ga0373923_0039365 3300035111 Bacteria 1941
1336 Ga0373923_0091776 3300035111 Bacteria 1329
1337 Ga0373932_0012249 3300035112 Bacteria 2109
1338 Ga0373939_0072791 3300035114 Bacteria 1123
1339 Ga0373941_0023506 3300035115 Bacteria 1761
1340 Ga0373954_0000673 3300035118 Bacteria 13097
1341 Ga0373954_0033755 3300035118 Bacteria 2368
1342 Ga0373957_0131485 3300035120 Bacteria 1019
1343 Ga0373943_0097238 3300035170 Bacteria 1534
1344 Ga0373955_0043399 3300035172 Bacteria 2419
1345 Ga0373942_0128000 3300035207 Bacteria 799
1346 Ga0316574_0037598 3300035398 Bacteria 2969
1347 Ga0373931_0335876 3300035691 Bacteria 942
1348 Ga0373935_0017799 3300035692 Bacteria 4317
1349 Ga0373935_0132093 3300035692 Bacteria 1678
1350 Ga0373927_0001660 3300035695 Bacteria 16642
1351 Ga0373927_0006739 3300035695 Bacteria 7818
1352 Ga0373927_0103334 3300035695 Bacteria 1854
1353 Ga0373933_0021031 3300035724 Bacteria 3702
1354 Ga0373947_0067758 3300035725 Bacteria 2181
1355 Ga0373947_0200814 3300035725 Bacteria 1304
1356 Ga0373947_0387713 3300035725 Bacteria 941
1357 Ga0373937_0055786 3300036401 Bacteria 3628
1358 Ga0373937_0075580 3300036401 Bacteria 3110
1359 Ga0373925_0127551 3300037068 Bacteria 1981
1360 Ga0373925_0442944 3300037068 Bacteria 1063
1361 Ga0373925_0502238 3300037068 Bacteria 996
1362 Ga0395899_0011072 3300037312 Bacteria 6908
1363 Ga0395899_0080145 3300037312 Bacteria 2377
1364 Ga0395899_0303998 3300037312 Bacteria 1079
1365 Ga0395900_0007289 3300037418 Bacteria 11445
1366 Ga0395900_0018254 3300037418 Bacteria 7156
1367 Ga0395900_0062535 3300037418 Bacteria 3827
1368 Ga0395900_0064941 3300037418 Bacteria 3749
1369 Ga0395900_0136722 3300037418 Bacteria 2511
1370 Ga0395900_0217814 3300037418 Bacteria 1926
1371 Ga0395900_0798534 3300037418 Bacteria 872
1372 Ga0395898_0010914 3300037466 Bacteria 9478
1373 Ga0395898_0019280 3300037466 Bacteria 6945
1374 Ga0395898_0067655 3300037466 Bacteria 3458
1375 Ga0395898_0089187 3300037466 Bacteria 2968
1376 Ga0395898_0112051 3300037466 Bacteria 2614
1377 Ga0395898_0124728 3300037466 Bacteria 2467
1378 Ga0395898_0165220 3300037466 Bacteria 2117
1379 Ga0395905_0007110 3300037471 Bacteria 11184
1380 Ga0395905_0310331 3300037471 Bacteria 1466
1381 Ga0436364_0406135 3300037853 Bacteria 1032
1382 Ga0436364_1323116 3300037853 Bacteria 1214
1383 Ga0395901_0003608 3300038443 Bacteria 15611
1384 Ga0395901_0021641 3300038443 Bacteria 6587
1385 Ga0395901_0037202 3300038443 Bacteria 5034
1386 Ga0395901_0040071 3300038443 Bacteria 4850
1387 Ga0395901_0042303 3300038443 Bacteria 4723
1388 Ga0395901_0066215 3300038443 Bacteria 3763
1389 Ga0395901_0156444 3300038443 Bacteria 2394
1390 Ga0395901_0329811 3300038443 Bacteria 1578
1391 Ga0395901_0411240 3300038443 Bacteria 1389
1392 Ga0395901_0583383 3300038443 Bacteria 1129
1393 Ga0436365_0512317 3300039437 Bacteria 1912
1394 Ga0436365_1577931 3300039437 Bacteria 1187
1395 Ga0436360_0030768 3300039438 Unclassified 1000
1396 Ga0436361_0238036 3300039447 Bacteria 1090
1397 Ga0436361_1097729 3300039447 Bacteria 95612
1398 Ga0436363_0181804 3300039450 Bacteria 6605
1399 Ga0436362_0259633 3300039453 Bacteria 4037
1400 Ga0436362_0376159 3300039453 Bacteria 3459
1401 Ga0436362_1179483 3300039453 Bacteria 5049
1402 Ga0439461_0001622 3300041410 Bacteria 3492
1403 Ga0439431_0019765 3300041997 Bacteria 1603
1404 Ga0439433_0026209 3300041999 Bacteria 1319
1405 Ga0439441_000323 3300042001 Bacteria 4847
1406 Ga0439442_018400 3300042002 Bacteria 1444
1407 Ga0439443_010845 3300042003 Bacteria 1328
1408 Ga0439445_0012878 3300042004 Bacteria 2017
1409 Ga0439448_0029645 3300042005 Bacteria 1733
1410 Ga0439450_026567 3300042008 Bacteria 1277
1411 Ga0439451_007644 3300042009 Bacteria 2199
1412 Ga0450888_009626 3300042126 Bacteria 1108
1413 Ga0439446_0010573 3300042156 Bacteria 2488
1414 Ga0439446_0039897 3300042156 Bacteria 1380
1415 Ga0439434_0008237 3300042435 Bacteria 3057
1416 Ga0439435_0004012 3300042436 Bacteria 3130
1417 Ga0439435_0010974 3300042436 Bacteria 2164
1418 Ga0439444_0014013 3300042437 Bacteria 1335
1419 Ga0439444_0018456 3300042437 Bacteria 1208
1420 Ga0439464_0005318 3300042439 Bacteria 3325
1421 Ga0439460_0043584 3300042461 Bacteria 1326
1422 Ga0439460_0057212 3300042461 Bacteria 1182
1423 Ga0450893_0024857 3300042532 Bacteria 1047
1424 Ga0451577_0000265 3300042876 Bacteria 103615
1425 Ga0451577_0007708 3300042876 Bacteria 10552
1426 Ga0451577_0211539 3300042876 Bacteria 1752
1427 Ga0451577_0307374 3300042876 Bacteria 1437
1428 Ga0451577_0433450 3300042876 Unclassified 1194
1429 Ga0451577_0509060 3300042876 Bacteria 1093
1430 Ga0451577_0688222 3300042876 Bacteria 926
1431 Ga0451577_0802253 3300042876 Bacteria 850
1432 Ga0439440_0002452 3300042993 Bacteria 3506
1433 Ga0439440_0006687 3300042993 Unclassified 2327
1434 Ga0439440_0008644 3300042993 Bacteria 2095
1435 Ga0466972_0030558 3300044658 Bacteria 2651
1436 Ga0453683_0000228 3300044673 Bacteria 75066
1437 Ga0453683_0000844 3300044673 Bacteria 29655
1438 Ga0453683_0003575 3300044673 Bacteria 11423
1439 Ga0453683_0004655 3300044673 Bacteria 9683
1440 Ga0453683_0005122 3300044673 Bacteria 9190
1441 Ga0453683_0011486 3300044673 Bacteria 5834
1442 Ga0453683_0016818 3300044673 Bacteria 4715
1443 Ga0453683_0019199 3300044673 Bacteria 4379
1444 Ga0453683_0023477 3300044673 Bacteria 3931
1445 Ga0453683_0067582 3300044673 Bacteria 2234
1446 Ga0453683_0087348 3300044673 Bacteria 1954
1447 Ga0453683_0168909 3300044673 Bacteria 1385
1448 Ga0453683_0275499 3300044673 Bacteria 1074
1449 Ga0466965_0007794 3300044683 Bacteria 4932
1450 Ga0466964_0152787 3300044706 Bacteria 1072
1451 Ga0453684_0001198 3300044712 Bacteria 80046
1452 Ga0453684_0002572 3300044712 Bacteria 43567
1453 Ga0453684_0035165 3300044712 Bacteria 6931
1454 Ga0453684_0053830 3300044712 Bacteria 5249
1455 Ga0453684_0062591 3300044712 Bacteria 4765
1456 Ga0453684_0067738 3300044712 Bacteria 4538
1457 Ga0453684_0090617 3300044712 Unclassified 3778
1458 Ga0453684_0097456 3300044712 Bacteria 3609
1459 Ga0453684_0115496 3300044712 Bacteria 3252
1460 Ga0453684_0164172 3300044712 Bacteria 2624
1461 Ga0453684_0196003 3300044712 Bacteria 2359
1462 Ga0453684_0205568 3300044712 Bacteria 2292
1463 Ga0453684_0276240 3300044712 Bacteria 1918
1464 Ga0453684_0353264 3300044712 Bacteria 1657
1465 Ga0453684_0634918 3300044712 Unclassified 1167
1466 Ga0466968_0179269 3300044735 Bacteria 985
1467 Ga0466970_0061433 3300044765 Bacteria 2013
1468 Ga0466960_0009554 3300044901 Bacteria 4002
1469 Ga0466959_0454028 3300045049 Bacteria 869
1470 Ga0451576_0002971 3300045051 Bacteria 24017
1471 Ga0451576_0008841 3300045051 Bacteria 11764
1472 Ga0451576_0063913 3300045051 Bacteria 3835
1473 Ga0451576_0072636 3300045051 Bacteria 3580
1474 Ga0451576_0121878 3300045051 Bacteria 2715
1475 Ga0451576_0183921 3300045051 Bacteria 2182
1476 Ga0451576_0203376 3300045051 Bacteria 2068
1477 Ga0451576_0217380 3300045051 Bacteria 1996
1478 Ga0451576_0265773 3300045051 Bacteria 1793
1479 Ga0451576_0507499 3300045051 Bacteria 1267
1480 Ga0466958_0022078 3300045836 Bacteria 3724
1481 Ga0466958_0106808 3300045836 Bacteria 1746
1482 Ga0466967_0011489 3300045976 Bacteria 6711
1483 Ga0466967_0019154 3300045976 Bacteria 5495
1484 Ga0466967_0970512 3300045976 Bacteria 846
1485 Ga0495641_0077027 3300046461 Bacteria 1495
1486 Ga0495651_0072809 3300046462 Bacteria 2609
1487 Ga0495580_0003398 3300046472 Bacteria 13588
1488 Ga0495580_0068385 3300046472 Bacteria 2484
1489 Ga0495582_0030782 3300046473 Bacteria 2948
1490 Ga0495639_0027153 3300046475 Bacteria 2533
1491 Ga0495639_0068411 3300046475 Bacteria 1637
1492 Ga0495664_0025260 3300046477 Bacteria 3458
1493 Ga0495664_0061600 3300046477 Bacteria 2234
1494 Ga0495664_0068338 3300046477 Bacteria 2120
1495 Ga0495584_0010109 3300046491 Bacteria 4845
1496 Ga0495594_0077043 3300046499 Bacteria 1860
1497 Ga0495620_0021621 3300046515 Bacteria 3121
1498 Ga0495631_0081100 3300046518 Bacteria 1400
1499 Ga0495637_0128135 3300046520 Bacteria 971
1500 Ga0495644_0038050 3300046523 Bacteria 1815
1501 Ga0495642_0091952 3300046528 Bacteria 1285
1502 Ga0495665_0136259 3300046531 Bacteria 1284
1503 Ga0495640_0172624 3300046533 Bacteria 1381
1504 Ga0495587_0357196 3300046536 Unclassified 814
1505 Ga0495598_0009253 3300046537 Bacteria 2323
1506 Ga0495609_0083012 3300046538 Bacteria 1399
1507 Ga0495621_0137667 3300046539 Bacteria 954
1508 Ga0495645_0233137 3300046543 Bacteria 1232
1509 Ga0495633_0020997 3300046558 Bacteria 3273
1510 Ga0495635_0084545 3300046663 Bacteria 2171
1511 Ga0495635_0209850 3300046663 Bacteria 1319
1512 Ga0495659_0028976 3300046664 Bacteria 1919
1513 Ga0495659_0041413 3300046664 Bacteria 1645
1514 Ga0495588_0301322 3300046674 Bacteria 844
1515 Ga0495658_0111578 3300046683 Bacteria 1645
1516 Ga0495613_0367592 3300046689 Bacteria 985
1517 Ga0495670_0068520 3300046691 Bacteria 1793
1518 Ga0495581_0049143 3300047315 Bacteria 2435
1519 Ga0495581_0148042 3300047315 Bacteria 1371
1520 Ga0495636_0021969 3300047318 Bacteria 2578
1521 Ga0495636_0162205 3300047318 Bacteria 1008
1522 Ga0495674_0072563 3300047319 Bacteria 2969
1523 Ga0495674_0608601 3300047319 Bacteria 865
1524 Ga0495680_0057735 3300047322 Bacteria 3000
1525 Ga0495677_0046678 3300047445 Bacteria 1590
1526 Ga0495677_0148152 3300047445 Bacteria 903
1527 Ga0495684_0080859 3300047471 Bacteria 2466
1528 Ga0495602_0091861 3300048088 Bacteria 2516
1529 Ga0496100_0201056 3300048903 Bacteria 1452
1530 Ga0496101_0039175 3300048904 Bacteria 3369
1531 Ga0496101_0112506 3300048904 Bacteria 2051
1532 Ga0496102_0017749 3300048905 Bacteria 6237
1533 Ga0496102_0040143 3300048905 Bacteria 4232
1534 Ga0496102_0109934 3300048905 Bacteria 2569
1535 Ga0496102_0218684 3300048905 Bacteria 1795
1536 Ga0496102_0273408 3300048905 Bacteria 1593
1537 Ga0496102_0398911 3300048905 Bacteria 1293
1538 Ga0496103_0005184 3300048906 Bacteria 7840
1539 Ga0496104_0019326 3300048907 Bacteria 6230
1540 Ga0496104_0052027 3300048907 Bacteria 3867
1541 Ga0496105_0045521 3300048908 Bacteria 3620
1542 Ga0496106_0194500 3300048909 Bacteria 1613
1543 Ga0496106_0277954 3300048909 Bacteria 1341
1544 Ga0496106_0303040 3300048909 Bacteria 1282
1545 Ga0496107_0509159 3300048910 Bacteria 893
1546 Ga0496108_0008599 3300048911 Bacteria 8278
1547 Ga0496108_0012808 3300048911 Bacteria 6830
1548 Ga0496108_0040551 3300048911 Bacteria 3882
1549 Ga0496108_0223852 3300048911 Bacteria 1635
1550 Ga0496108_0608562 3300048911 Bacteria 952
1551 Ga0496109_0000050 3300048912 Bacteria 126918
1552 Ga0496109_0001065 3300048912 Bacteria 22723
1553 Ga0496109_0075942 3300048912 Bacteria 3090
1554 Ga0496109_0150850 3300048912 Bacteria 2176
1555 Ga0496110_0011283 3300048913 Bacteria 7304
1556 Ga0496110_0066640 3300048913 Bacteria 3184
1557 Ga0496110_0263794 3300048913 Bacteria 1568
1558 Ga0496110_0290409 3300048913 Bacteria 1489
1559 Ga0496110_0591290 3300048913 Bacteria 1007
1560 Ga0496110_0612056 3300048913 Bacteria 988
1561 Ga0496111_0009102 3300048914 Bacteria 6609
1562 Ga0496112_0015588 3300048915 Bacteria 7099
1563 Ga0496112_0206583 3300048915 Bacteria 1922
1564 Ga0496112_0268788 3300048915 Bacteria 1653
1565 Ga0496113_0102013 3300048916 Bacteria 2225
1566 Ga0496113_0154893 3300048916 Bacteria 1809
1567 Ga0496114_0025015 3300048917 Bacteria 4877
1568 Ga0496114_0353676 3300048917 Bacteria 1299
1569 Ga0496115_0000485 3300048918 Bacteria 31503
1570 Ga0496115_0100268 3300048918 Bacteria 2374
1571 Ga0496115_0128528 3300048918 Bacteria 2088
1572 Ga0501291_009163 3300049514 Bacteria 1383
1573 Ga0501031_0000153 3300049568 Bacteria 39050
1574 Ga0501031_0044815 3300049568 Bacteria 2886
1575 Ga0501031_0113074 3300049568 Bacteria 1773
1576 Ga0501032_0000456 3300049569 Bacteria 32973
1577 Ga0501032_0003839 3300049569 Bacteria 11411
1578 Ga0501032_0055076 3300049569 Bacteria 2676
1579 Ga0501032_0094597 3300049569 Bacteria 1981
1580 Ga0501033_0001929 3300049570 Bacteria 18066
1581 Ga0501033_0184012 3300049570 Bacteria 1497
1582 Ga0501033_0419523 3300049570 Bacteria 932
1583 Ga0501034_0003820 3300049571 Bacteria 16974
1584 Ga0501034_0043619 3300049571 Bacteria 4538
1585 Ga0501036_0000662 3300049572 Bacteria 25288
1586 Ga0501036_0005418 3300049572 Bacteria 10338
1587 Ga0501036_0007161 3300049572 Bacteria 9086
1588 Ga0501036_0020888 3300049572 Bacteria 5499
1589 Ga0501036_0030168 3300049572 Bacteria 4581
1590 Ga0501036_0116490 3300049572 Bacteria 2257
1591 Ga0501036_0238858 3300049572 Bacteria 1524
1592 Ga0501036_0347494 3300049572 Bacteria 1239
1593 Ga0501036_0549779 3300049572 Bacteria 959
1594 Ga0501037_0000189 3300049573 Bacteria 57204
1595 Ga0501037_0000343 3300049573 Bacteria 39227
1596 Ga0501037_0062264 3300049573 Bacteria 2720
1597 Ga0501037_0101284 3300049573 Bacteria 2079
1598 Ga0501037_0134138 3300049573 Bacteria 1774
1599 Ga0501037_0295785 3300049573 Bacteria 1125
1600 Ga0501038_0000714 3300049574 Bacteria 29677
1601 Ga0501038_0007320 3300049574 Bacteria 10183
1602 Ga0501038_0016613 3300049574 Bacteria 6672
1603 Ga0501038_0020455 3300049574 Bacteria 5949
1604 Ga0501038_0025145 3300049574 Bacteria 5309
1605 Ga0501039_0000599 3300049575 Bacteria 26075
1606 Ga0501039_0008975 3300049575 Bacteria 7616
1607 Ga0501039_0035986 3300049575 Bacteria 3819
1608 Ga0501039_0037252 3300049575 Bacteria 3753
1609 Ga0501039_0049733 3300049575 Bacteria 3242
1610 Ga0501039_0364964 3300049575 Bacteria 1134
1611 Ga0501039_0390260 3300049575 Bacteria 1093
1612 Ga0501040_0000994 3300049576 Bacteria 17940
1613 Ga0501040_0005227 3300049576 Bacteria 8390
1614 Ga0501040_0005549 3300049576 Bacteria 8168
1615 Ga0501040_0013594 3300049576 Bacteria 5353
1616 Ga0501040_0068394 3300049576 Bacteria 2449
1617 Ga0501040_0138604 3300049576 Bacteria 1713
1618 Ga0501040_0246535 3300049576 Bacteria 1274
1619 Ga0501040_0333901 3300049576 Bacteria 1085
1620 Ga0501040_0407372 3300049576 Bacteria 977
1621 Ga0501041_0000630 3300049577 Bacteria 18415
1622 Ga0501041_0013030 3300049577 Bacteria 4926
1623 Ga0501041_0029239 3300049577 Bacteria 3324
1624 Ga0501041_0041494 3300049577 Bacteria 2795
1625 Ga0501041_0051808 3300049577 Bacteria 2502
1626 Ga0501041_0101070 3300049577 Bacteria 1785
1627 Ga0501041_0306920 3300049577 Bacteria 1000
1628 Ga0501041_0355054 3300049577 Bacteria 927
1629 Ga0501042_0003456 3300049578 Bacteria 9923
1630 Ga0501042_0022185 3300049578 Bacteria 4434
1631 Ga0501042_0029679 3300049578 Bacteria 3857
1632 Ga0501042_0054202 3300049578 Bacteria 2860
1633 Ga0501042_0344346 3300049578 Bacteria 1078
1634 Ga0501043_0000764 3300049579 Bacteria 28593
1635 Ga0501043_0001090 3300049579 Bacteria 23858
1636 Ga0501043_0251003 3300049579 Bacteria 1363
1637 Ga0501046_0000677 3300049580 Bacteria 33065
1638 Ga0501046_0010313 3300049580 Bacteria 8036
1639 Ga0501046_0153230 3300049580 Bacteria 1738
1640 Ga0501046_0190381 3300049580 Bacteria 1530
1641 Ga0501046_0510022 3300049580 Bacteria 861
1642 Ga0501047_0001076 3300049581 Bacteria 27193
1643 Ga0501048_0001959 3300049582 Bacteria 15649
1644 Ga0501048_0004707 3300049582 Bacteria 10391
1645 Ga0501048_0012339 3300049582 Bacteria 6357
1646 Ga0501048_0028059 3300049582 Bacteria 4088
1647 Ga0501048_0037620 3300049582 Bacteria 3475
1648 Ga0501048_0046358 3300049582 Bacteria 3103
1649 Ga0501048_0169430 3300049582 Bacteria 1547
1650 Ga0501048_0185976 3300049582 Bacteria 1472
1651 Ga0501067_0002431 3300049583 Bacteria 10289
1652 Ga0501067_0061280 3300049583 Bacteria 2083
1653 Ga0501067_0161998 3300049583 Bacteria 1245
1654 Ga0501068_0137885 3300049584 Bacteria 1528
1655 Ga0501068_0323122 3300049584 Bacteria 989
1656 Ga0501069_0000436 3300049585 Bacteria 18984
1657 Ga0501070_0000684 3300049586 Bacteria 31074
1658 Ga0501070_0014222 3300049586 Bacteria 6697
1659 Ga0501070_0523910 3300049586 Bacteria 951
1660 Ga0501071_0006317 3300049587 Bacteria 7687
1661 Ga0501071_0009131 3300049587 Bacteria 6586
1662 Ga0501071_0092053 3300049587 Bacteria 2228
1663 Ga0501071_0123355 3300049587 Bacteria 1921
1664 Ga0501071_0283309 3300049587 Bacteria 1254
1665 Ga0501071_0319366 3300049587 Bacteria 1179
1666 Ga0501071_0609845 3300049587 Bacteria 839
1667 Ga0501072_0004225 3300049588 Bacteria 10894
1668 Ga0501072_0006479 3300049588 Bacteria 8915
1669 Ga0501072_0016507 3300049588 Bacteria 5672
1670 Ga0501072_0045453 3300049588 Bacteria 3453
1671 Ga0501072_0052257 3300049588 Bacteria 3217
1672 Ga0501072_0068066 3300049588 Bacteria 2811
1673 Ga0501072_0106193 3300049588 Bacteria 2233
1674 Ga0501072_0163414 3300049588 Bacteria 1776
1675 Ga0501072_0186860 3300049588 Bacteria 1653
1676 Ga0501072_0484223 3300049588 Bacteria 979
1677 Ga0501072_0624593 3300049588 Bacteria 849
1678 Ga0501073_0037603 3300049589 Bacteria 3435
1679 Ga0501073_0241251 3300049589 Bacteria 1248
1680 Ga0501074_0000629 3300049590 Bacteria 21882
1681 Ga0501074_0027537 3300049590 Bacteria 4121
1682 Ga0501074_0037612 3300049590 Bacteria 3508
1683 Ga0501074_0044507 3300049590 Bacteria 3213
1684 Ga0501074_0070920 3300049590 Bacteria 2505
1685 Ga0501074_0141411 3300049590 Bacteria 1721
1686 Ga0501075_0000258 3300049591 Bacteria 28848
1687 Ga0501075_0001991 3300049591 Bacteria 13485
1688 Ga0501075_0003411 3300049591 Bacteria 10629
1689 Ga0501075_0008717 3300049591 Bacteria 7071
1690 Ga0501075_0022246 3300049591 Bacteria 4629
1691 Ga0501075_0044913 3300049591 Bacteria 3315
1692 Ga0501075_0047349 3300049591 Bacteria 3231
1693 Ga0501075_0081372 3300049591 Bacteria 2452
1694 Ga0501075_0192896 3300049591 Bacteria 1554
1695 Ga0501075_0193075 3300049591 Bacteria 1553
1696 Ga0501075_0404881 3300049591 Bacteria 1040
1697 Ga0501075_0470749 3300049591 Bacteria 958
1698 Ga0501076_0000004 3300049592 Bacteria 149972
1699 Ga0501076_0001619 3300049592 Bacteria 15188
1700 Ga0501076_0003432 3300049592 Bacteria 11118
1701 Ga0501076_0006583 3300049592 Bacteria 8427
1702 Ga0501076_0017499 3300049592 Bacteria 5449
1703 Ga0501076_0039133 3300049592 Bacteria 3723
1704 Ga0501076_0054228 3300049592 Bacteria 3177
1705 Ga0501076_0074668 3300049592 Bacteria 2717
1706 Ga0501077_0022460 3300049593 Bacteria 3996
1707 Ga0501077_0073390 3300049593 Bacteria 2168
1708 Ga0501077_0179645 3300049593 Bacteria 1345
1709 Ga0501077_0215417 3300049593 Bacteria 1221
1710 Ga0501202_006749 3300049652 Bacteria 2062
1711 Ga0501208_029401 3300049655 Bacteria 960
1712 Ga0501217_033241 3300049661 Bacteria 1280
1713 Ga0501233_062228 3300049668 Bacteria 929
1714 Ga0501259_008240 3300049688 Bacteria 1676
1715 Ga0501260_010412 3300049689 Bacteria 933
1716 Ga0501225_0015866 3300049705 Bacteria 2094
1717 Ga0501225_0075878 3300049705 Bacteria 960
1718 Ga0501245_039018 3300049708 Bacteria 811
1719 Ga0501079_0010825 3300049741 Bacteria 6947
1720 Ga0501079_0017544 3300049741 Bacteria 5467
1721 Ga0501079_0059052 3300049741 Bacteria 2959
1722 Ga0501079_0079645 3300049741 Bacteria 2533
1723 Ga0501079_0119678 3300049741 Bacteria 2048
1724 Ga0501079_0185733 3300049741 Bacteria 1623
1725 Ga0501079_0288257 3300049741 Bacteria 1284
1726 Ga0501079_0321143 3300049741 Bacteria 1212
1727 Ga0501079_0360054 3300049741 Bacteria 1140
1728 Ga0501079_0441561 3300049741 Bacteria 1022
1729 Ga0501080_0000676 3300049742 Bacteria 27213
1730 Ga0501080_0037497 3300049742 Bacteria 4528
1731 Ga0501080_0057180 3300049742 Bacteria 3632
1732 Ga0501080_0132436 3300049742 Bacteria 2308
1733 Ga0501080_0207392 3300049742 Bacteria 1797
1734 Ga0501080_0419700 3300049742 Bacteria 1202
1735 Ga0501081_0001388 3300049743 Bacteria 14782
1736 Ga0501081_0006918 3300049743 Bacteria 7369
1737 Ga0501081_0011002 3300049743 Bacteria 5915
1738 Ga0501081_0040047 3300049743 Bacteria 3208
1739 Ga0501081_0064280 3300049743 Bacteria 2548
1740 Ga0501081_0137975 3300049743 Bacteria 1746
1741 Ga0501081_0278704 3300049743 Bacteria 1224
1742 Ga0501083_0002389 3300049744 Bacteria 12862
1743 Ga0501083_0188637 3300049744 Bacteria 1346
1744 Ga0501083_0192280 3300049744 Bacteria 1332
1745 Ga0501083_0365986 3300049744 Bacteria 938
1746 Ga0501268_011682 3300049765 Bacteria 1391
1747 Ga0501283_005455 3300049779 Unclassified 1749
1748 Ga0501035_0001492 3300049822 Bacteria 23978
1749 Ga0501035_0030500 3300049822 Bacteria 4914
1750 Ga0501035_0052628 3300049822 Bacteria 3643
1751 Ga0501035_0157416 3300049822 Bacteria 1968
1752 Ga0501035_0163915 3300049822 Bacteria 1923
1753 Ga0501044_0051856 3300049823 Bacteria 4230
1754 Ga0501044_0137035 3300049823 Bacteria 2438
1755 Ga0501045_0003185 3300049824 Bacteria 11223
1756 Ga0501045_0005706 3300049824 Bacteria 8614
1757 Ga0501045_0027290 3300049824 Bacteria 4113
1758 Ga0501045_0035734 3300049824 Bacteria 3608
1759 Ga0501045_0051104 3300049824 Bacteria 3016
1760 Ga0501045_0154947 3300049824 Bacteria 1705
1761 Ga0501045_0180053 3300049824 Bacteria 1575
1762 Ga0501045_0202232 3300049824 Bacteria 1480
1763 Ga0501045_0331829 3300049824 Bacteria 1132
1764 nmdc:mga03683_39850_c1 3300050489 Bacteria 1924
1765 nmdc:mga03n38_275865_c1 3300050490 Bacteria 896
1766 nmdc:mga03n38_6543_c1 3300050490 Bacteria 4056
1767 nmdc:mga00v17_176345_c1 3300050491 Bacteria 1378
1768 nmdc:mga00v17_73915_c1 3300050491 Bacteria 2117
1769 nmdc:mga00v17_78258_c1 3300050491 Bacteria 2060
1770 nmdc:mga00v17_90502_c1 3300050491 Bacteria 1921
1771 nmdc:mga0yw44_70036_c1 3300050492 Bacteria 2174
1772 nmdc:mga06z11_11927_c1 3300050494 Bacteria 3765
1773 nmdc:mga06z11_151760_c1 3300050494 Bacteria 1318
1774 nmdc:mga04h51_13668_c1 3300050495 Bacteria 2303
1775 nmdc:mga05p37_104663_c1 3300050507 Bacteria 3482
1776 nmdc:mga05p37_112818_c1 3300050507 Bacteria 3343
1777 nmdc:mga05p37_11385_c1 3300050507 Bacteria 10586
1778 nmdc:mga05p37_119344_c1 3300050507 Bacteria 3240
1779 nmdc:mga05p37_131061_c1 3300050507 Bacteria 3076
1780 nmdc:mga05p37_15016_c1 3300050507 Bacteria 9297
1781 nmdc:mga05p37_158676_c1 3300050507 Bacteria 1294
1782 nmdc:mga05p37_161131_c1 3300050507 Bacteria 2740
1783 nmdc:mga05p37_175785_c1 3300050507 Bacteria 2608
1784 nmdc:mga05p37_176876_c1 3300050507 Bacteria 2599
1785 nmdc:mga05p37_182040_c1 3300050507 Bacteria 2556
1786 nmdc:mga05p37_211555_c1 3300050507 Bacteria 2344
1787 nmdc:mga05p37_236783_c1 3300050507 Bacteria 2197
1788 nmdc:mga05p37_2691_c1 3300050507 Bacteria 20669
1789 nmdc:mga05p37_270607_c1 3300050507 Bacteria 2030
1790 nmdc:mga05p37_270750_c1 3300050507 Bacteria 2029
1791 nmdc:mga05p37_300749_c1 3300050507 Bacteria 1906
1792 nmdc:mga05p37_304359_c1 3300050507 Bacteria 1892
1793 nmdc:mga05p37_30634_c1 3300050507 Bacteria 6565
1794 nmdc:mga05p37_32178_c1 3300050507 Bacteria 6413
1795 nmdc:mga05p37_337421_c1 3300050507 Bacteria 1778
1796 nmdc:mga05p37_35820_c1 3300050507 Bacteria 6087
1797 nmdc:mga05p37_3604_c1 3300050507 Bacteria 18090
1798 nmdc:mga05p37_392201_c1 3300050507 Bacteria 1623
1799 nmdc:mga05p37_39341_c2 3300050507 Bacteria 5322
1800 nmdc:mga05p37_396384_c1 3300050507 Bacteria 1613
1801 nmdc:mga05p37_404530_c1 3300050507 Bacteria 1593
1802 nmdc:mga05p37_4063_c1 3300050507 Bacteria 17103
1803 nmdc:mga05p37_41017_c1 3300050507 Bacteria 5684
1804 nmdc:mga05p37_47105_c1 3300050507 Bacteria 5302
1805 nmdc:mga05p37_47698_c1 3300050507 Bacteria 5267
1806 nmdc:mga05p37_47819_c1 3300050507 Bacteria 5260
1807 nmdc:mga05p37_489091_c1 3300050507 Bacteria 1415
1808 nmdc:mga05p37_504870_c1 3300050507 Bacteria 1387
1809 nmdc:mga05p37_51362_c1 3300050507 Bacteria 3620
1810 nmdc:mga05p37_53498_c1 3300050507 Bacteria 4964
1811 nmdc:mga05p37_5582_c1 3300050507 Bacteria 14790
1812 nmdc:mga05p37_568302_c1 3300050507 Bacteria 1287
1813 nmdc:mga05p37_571348_c1 3300050507 Bacteria 1283
1814 nmdc:mga05p37_587111_c1 3300050507 Bacteria 1260
1815 nmdc:mga05p37_693777_c1 3300050507 Bacteria 1132
1816 nmdc:mga05p37_78941_c1 3300050507 Bacteria 4053
1817 nmdc:mga05p37_81212_c1 3300050507 Bacteria 3993
1818 nmdc:mga05p37_8249_c1 3300050507 Bacteria 12317
1819 nmdc:mga05p37_980_c1 3300050507 Bacteria 32442
1820 nmdc:mga09592_104060_c1 3300050508 Bacteria 2433
1821 nmdc:mga09592_131906_c1 3300050508 Bacteria 2150
1822 nmdc:mga09592_14575_c1 3300050508 Bacteria 6417
1823 nmdc:mga09592_1479_c1 3300050508 Bacteria 18879
1824 nmdc:mga09592_168532_c1 3300050508 Bacteria 1893
1825 nmdc:mga09592_192900_c1 3300050508 Bacteria 1763
1826 nmdc:mga09592_194768_c1 3300050508 Bacteria 1754
1827 nmdc:mga09592_204332_c1 3300050508 Bacteria 1711
1828 nmdc:mga09592_218248_c1 3300050508 Bacteria 1653
1829 nmdc:mga09592_222684_c1 3300050508 Bacteria 1634
1830 nmdc:mga09592_223295_c1 3300050508 Bacteria 1632
1831 nmdc:mga09592_256946_c1 3300050508 Bacteria 1515
1832 nmdc:mga09592_270639_c1 3300050508 Bacteria 1473
1833 nmdc:mga09592_30797_c1 3300050508 Bacteria 4466
1834 nmdc:mga09592_3133_c1 3300050508 Bacteria 13432
1835 nmdc:mga09592_338601_c1 3300050508 Bacteria 1302
1836 nmdc:mga09592_38678_c1 3300050508 Bacteria 4005
1837 nmdc:mga09592_42592_c1 3300050508 Bacteria 3819
1838 nmdc:mga09592_47301_c1 3300050508 Bacteria 3626
1839 nmdc:mga09592_523696_c1 3300050508 Bacteria 1019
1840 nmdc:mga09592_5401_c1 3300050508 Bacteria 10389
1841 nmdc:mga09592_552859_c1 3300050508 Bacteria 989
1842 nmdc:mga09592_72550_c1 3300050508 Bacteria 2923
1843 nmdc:mga09592_99257_c1 3300050508 Bacteria 2493
1844 nmdc:mga0qj67_127781_c1 3300050509 Bacteria 2057
1845 nmdc:mga0qj67_159172_c1 3300050509 Bacteria 1833
1846 nmdc:mga0qj67_1629_c1 3300050509 Bacteria 15787
1847 nmdc:mga0qj67_212106_c1 3300050509 Bacteria 1573
1848 nmdc:mga0qj67_212656_c1 3300050509 Bacteria 1570
1849 nmdc:mga0qj67_247896_c1 3300050509 Bacteria 1445
1850 nmdc:mga0qj67_247951_c1 3300050509 Bacteria 1445
1851 nmdc:mga0qj67_28940_c1 3300050509 Bacteria 4301
1852 nmdc:mga0qj67_326714_c1 3300050509 Unclassified 1241
1853 nmdc:mga0qj67_34059_c1 3300050509 Bacteria 3977
1854 nmdc:mga0qj67_35483_c1 3300050509 Bacteria 3899
1855 nmdc:mga0qj67_407974_c1 3300050509 Bacteria 1096
1856 nmdc:mga0qj67_40979_c1 3300050509 Bacteria 3641
1857 nmdc:mga0qj67_44850_c1 3300050509 Bacteria 3487
1858 nmdc:mga0qj67_48580_c1 3300050509 Bacteria 3352
1859 nmdc:mga0qj67_55891_c1 3300050509 Bacteria 3128
1860 nmdc:mga0qj67_63281_c1 3300050509 Bacteria 2942
1861 nmdc:mga0qj67_8138_c1 3300050509 Bacteria 7765
1862 nmdc:mga0qj67_8393_c1 3300050509 Bacteria 7659
1863 nmdc:mga0qj67_84_c1 3300050509 Bacteria 13745
1864 nmdc:mga06r32_1014_c1 3300050510 Bacteria 25210
1865 nmdc:mga06r32_117004_c1 3300050510 Bacteria 2627
1866 nmdc:mga06r32_120215_c1 3300050510 Bacteria 2591
1867 nmdc:mga06r32_128387_c1 3300050510 Bacteria 2505
1868 nmdc:mga06r32_13371_c1 3300050510 Bacteria 7433
1869 nmdc:mga06r32_175071_c1 3300050510 Bacteria 2130
1870 nmdc:mga06r32_188605_c1 3300050510 Bacteria 2049
1871 nmdc:mga06r32_195290_c1 3300050510 Bacteria 2011
1872 nmdc:mga06r32_203328_c1 3300050510 Unclassified 1968
1873 nmdc:mga06r32_22024_c1 3300050510 Bacteria 5886
1874 nmdc:mga06r32_24139_c1 3300050510 Bacteria 5638
1875 nmdc:mga06r32_25601_c1 3300050510 Bacteria 5491
1876 nmdc:mga06r32_275490_c1 3300050510 Bacteria 1670
1877 nmdc:mga06r32_28159_c1 3300050510 Bacteria 5255
1878 nmdc:mga06r32_29046_c1 3300050510 Bacteria 5178
1879 nmdc:mga06r32_328025_c1 3300050510 Bacteria 1516
1880 nmdc:mga06r32_360892_c1 3300050510 Unclassified 1437
1881 nmdc:mga06r32_3791_c1 3300050510 Bacteria 13530
1882 nmdc:mga06r32_396270_c1 3300050510 Unclassified 1363
1883 nmdc:mga06r32_397356_c1 3300050510 Bacteria 1361
1884 nmdc:mga06r32_41101_c1 3300050510 Bacteria 4392
1885 nmdc:mga06r32_53274_c1 3300050510 Bacteria 3876
1886 nmdc:mga06r32_544817_c1 3300050510 Bacteria 1134
1887 nmdc:mga06r32_5485_c1 3300050510 Bacteria 11422
1888 nmdc:mga06r32_5573_c1 3300050510 Bacteria 11331
1889 nmdc:mga06r32_5738_c1 3300050510 Bacteria 11177
1890 nmdc:mga06r32_77040_c1 3300050510 Bacteria 3238
1891 nmdc:mga06r32_77465_c1 3300050510 Bacteria 3230
1892 nmdc:mga06r32_92770_c1 3300050510 Bacteria 2952
1893 nmdc:mga08y16_148424_c1 3300050511 Bacteria 2437
1894 nmdc:mga08y16_1650_c1 3300050511 Bacteria 22607
1895 nmdc:mga08y16_191546_c1 3300050511 Bacteria 2121
1896 nmdc:mga08y16_1990_c1 3300050511 Bacteria 20866
1897 nmdc:mga08y16_265986_c1 3300050511 Bacteria 1770
1898 nmdc:mga08y16_29760_c1 3300050511 Bacteria 5750
1899 nmdc:mga08y16_417904_c1 3300050511 Bacteria 1371
1900 nmdc:mga08y16_481541_c1 3300050511 Bacteria 1263
1901 nmdc:mga08y16_5098_c1 3300050511 Bacteria 13727
1902 nmdc:mga08y16_53384_c1 3300050511 Bacteria 4226
1903 nmdc:mga08y16_604068_c1 3300050511 Bacteria 1105
1904 nmdc:mga08y16_63108_c1 3300050511 Bacteria 3869
1905 nmdc:mga08y16_674242_c1 3300050511 Bacteria 1036
1906 nmdc:mga08y16_95107_c1 3300050511 Bacteria 3103
1907 nmdc:mga0n895_10044_c1 3300050512 Bacteria 8330
1908 nmdc:mga0n895_15064_c1 3300050512 Bacteria 7046
1909 nmdc:mga0n895_152444_c1 3300050512 Bacteria 2342
1910 nmdc:mga0n895_1625_c1 3300050512 Bacteria 16963
1911 nmdc:mga0n895_16637_c1 3300050512 Bacteria 6755
1912 nmdc:mga0n895_168770_c1 3300050512 Bacteria 2220
1913 nmdc:mga0n895_245062_c1 3300050512 Bacteria 1819
1914 nmdc:mga0n895_25298_c1 3300050512 Bacteria 5607
1915 nmdc:mga0n895_279289_c1 3300050512 Bacteria 1694
1916 nmdc:mga0n895_28700_c1 3300050512 Bacteria 5296
1917 nmdc:mga0n895_289631_c1 3300050512 Bacteria 1660
1918 nmdc:mga0n895_3321_c1 3300050512 Bacteria 12929
1919 nmdc:mga0n895_38577_c1 3300050512 Bacteria 4630
1920 nmdc:mga0n895_461882_c1 3300050512 Bacteria 1281
1921 nmdc:mga0n895_464915_c1 3300050512 Bacteria 1277
1922 nmdc:mga0n895_53375_c1 3300050512 Bacteria 3972
1923 nmdc:mga0n895_5938_c1 3300050512 Bacteria 10268
1924 nmdc:mga0n895_610959_c1 3300050512 Bacteria 1092
1925 nmdc:mga0n895_65033_c1 3300050512 Bacteria 3609
1926 nmdc:mga0n895_685889_c1 3300050512 Bacteria 1021
1927 nmdc:mga0n895_94998_c1 3300050512 Bacteria 2986
1928 nmdc:mga0rr50_10189_c1 3300050513 Bacteria 5951
1929 nmdc:mga0rr50_102279_c1 3300050513 Bacteria 2253
1930 nmdc:mga0rr50_142340_c1 3300050513 Bacteria 1931
1931 nmdc:mga0rr50_17600_c1 3300050513 Bacteria 4776
1932 nmdc:mga0rr50_183080_c1 3300050513 Bacteria 1713
1933 nmdc:mga0rr50_261382_c1 3300050513 Bacteria 1440
1934 nmdc:mga0rr50_35967_c1 3300050513 Bacteria 3562
1935 nmdc:mga0rr50_4285_c1 3300050513 Bacteria 8351
1936 nmdc:mga0rr50_545394_c1 3300050513 Bacteria 987
1937 nmdc:mga0rr50_7066_c1 3300050513 Bacteria 6892
1938 nmdc:mga0rr50_7764_c1 3300050513 Bacteria 6646
1939 nmdc:mga08x19_100708_c1 3300050514 Bacteria 1917
1940 nmdc:mga08x19_105758_c1 3300050514 Bacteria 1872
1941 nmdc:mga08x19_1109_c1 3300050514 Bacteria 16795
1942 nmdc:mga08x19_11403_c1 3300050514 Bacteria 5351
1943 nmdc:mga08x19_12656_c1 3300050514 Bacteria 5087
1944 nmdc:mga08x19_140837_c1 3300050514 Bacteria 1629
1945 nmdc:mga08x19_14102_c1 3300050514 Bacteria 4843
1946 nmdc:mga08x19_15256_c1 3300050514 Bacteria 4673
1947 nmdc:mga08x19_20236_c1 3300050514 Bacteria 4097
1948 nmdc:mga08x19_21433_c1 3300050514 Bacteria 3989
1949 nmdc:mga08x19_3323_c1 3300050514 Bacteria 9619
1950 nmdc:mga08x19_356503_c1 3300050514 Bacteria 1022
1951 nmdc:mga08x19_39979_c1 3300050514 Bacteria 2984
1952 nmdc:mga08x19_5646_c1 3300050514 Bacteria 7392
1953 nmdc:mga08x19_57756_c1 3300050514 Bacteria 2509
1954 nmdc:mga0a205_10147_c1 3300050515 Bacteria 8648
1955 nmdc:mga0a205_10679_c2 3300050515 Bacteria 4930
1956 nmdc:mga0a205_114564_c1 3300050515 Bacteria 2595
1957 nmdc:mga0a205_12575_c1 3300050515 Bacteria 7834
1958 nmdc:mga0a205_125886_c1 3300050515 Bacteria 2462
1959 nmdc:mga0a205_12825_c1 3300050515 Bacteria 7773
1960 nmdc:mga0a205_14335_c2 3300050515 Bacteria 5216
1961 nmdc:mga0a205_15863_c1 3300050515 Bacteria 7047
1962 nmdc:mga0a205_168069_c1 3300050515 Bacteria 2089
1963 nmdc:mga0a205_17063_c2 3300050515 Bacteria 3208
1964 nmdc:mga0a205_25047_c1 3300050515 Bacteria 5680
1965 nmdc:mga0a205_252839_c1 3300050515 Bacteria 1641
1966 nmdc:mga0a205_25703_c1 3300050515 Bacteria 5612
1967 nmdc:mga0a205_267738_c1 3300050515 Bacteria 1586
1968 nmdc:mga0a205_28145_c1 3300050515 Bacteria 5372
1969 nmdc:mga0a205_283406_c1 3300050515 Bacteria 1532
1970 nmdc:mga0a205_3049_c1 3300050515 Bacteria 14855
1971 nmdc:mga0a205_31365_c1 3300050515 Bacteria 5092
1972 nmdc:mga0a205_369237_c1 3300050515 Bacteria 1301
1973 nmdc:mga0a205_51452_c1 3300050515 Bacteria 3977
1974 nmdc:mga0a205_547409_c1 3300050515 Bacteria 1012
1975 nmdc:mga0a205_637359_c1 3300050515 Bacteria 917
1976 nmdc:mga0a205_705616_c1 3300050515 Bacteria 859
1977 nmdc:mga0a205_7197_c1 3300050515 Bacteria 10059
1978 nmdc:mga0a205_8823_c1 3300050515 Bacteria 9183
1979 Ga0500555_002338 3300053103 Bacteria 5519
1980 Ga0500592_013294 3300053116 Bacteria 1320
1981 Ga0500600_0114294 3300053149 Bacteria 1402
1982 Ga0500645_000154 3300053730 Bacteria 53453
1983 Ga0501084_0007725 3300054114 Bacteria 8856
1984 Ga0501084_0009367 3300054114 Bacteria 8102
1985 Ga0501084_0009487 3300054114 Bacteria 8054
1986 Ga0501084_0010302 3300054114 Bacteria 7735
1987 Ga0501084_0055443 3300054114 Bacteria 3316
1988 Ga0501084_0055621 3300054114 Bacteria 3310
1989 Ga0501084_0076423 3300054114 Bacteria 2807
1990 Ga0501084_0090762 3300054114 Bacteria 2565
1991 Ga0501084_0172245 3300054114 Bacteria 1827
1992 Ga0501084_0242182 3300054114 Bacteria 1522
1993 Ga0501084_0368626 3300054114 Bacteria 1213
1994 Ga0501084_0514631 3300054114 Bacteria 1012
1995 Ga0590071_001059 3300059421 Bacteria 7449
1996 Ga0590075_000123 3300059424 Bacteria 19905
1997 Ga0590077_000109 3300059426 Bacteria 21950
1998 Ga0590077_039028 3300059426 Bacteria 1052
1999 Ga0587073_0001563 3300059492 Bacteria 2714
2000 Ga0587111_0015792 3300060346 Bacteria 1385
2001 Ga0501082_0010040 3300060353 Bacteria 8159
2002 Ga0501082_0018439 3300060353 Bacteria 6011
2003 Ga0501082_0020025 3300060353 Bacteria 5765
2004 Ga0501082_0063091 3300060353 Bacteria 3191
2005 Ga0501082_0100668 3300060353 Bacteria 2500
2006 Ga0501082_0110590 3300060353 Bacteria 2378
2007 Ga0501082_0113609 3300060353 Bacteria 2345
2008 Ga0501082_0178841 3300060353 Bacteria 1845
2009 Ga0501082_0418534 3300060353 Bacteria 1170
2010 Ga0501082_0538927 3300060353 Bacteria 1021
2011 Ga0530510_0000005 3300061734 Bacteria 198759
2012 Ga0530510_0000170 3300061734 Bacteria 39521
2013 Ga0530510_0001471 3300061734 Bacteria 15808
2014 Ga0530510_0002805 3300061734 Bacteria 11981
2015 Ga0530510_0018370 3300061734 Bacteria 4958
2016 Ga0530510_0035479 3300061734 Bacteria 3594
2017 Ga0530510_0044622 3300061734 Bacteria 3203
2018 Ga0530510_0098542 3300061734 Bacteria 2137
2019 Ga0530510_0122141 3300061734 Bacteria 1912
2020 Ga0530510_0134908 3300061734 Bacteria 1817
2021 Ga0530510_0321585 3300061734 Bacteria 1160
2022 Ga0530510_0571243 3300061734 Bacteria 859

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300042876 Ga0451577_0433450 Ga0451577_0433450_415_1134 211
2 3300046536 Ga0495587_0357196 Ga0495587_0357196_23_718 211
3 3300049573 Ga0501037_0101284 Ga0501037_0101284_1426_2064 211
4 3300044712 Ga0453684_0634918 Ga0453684_0634918_229_984 223
5 3300005435 Ga0070714_100050179 Ga0070714_1000501791 225
6 3300025929 Ga0207664_10000322 Ga0207664_100003224 225
7 3300005353 Ga0070669_100658037 Ga0070669_1006580371 227
8 3300005445 Ga0070708_100026906 Ga0070708_1000269064 227
9 3300005467 Ga0070706_100000221 Ga0070706_1000002216 227
10 3300005471 Ga0070698_100023686 Ga0070698_1000236866 227
11 3300005518 Ga0070699_100002329 Ga0070699_1000023292 227
12 3300005536 Ga0070697_100206358 Ga0070697_1002063582 227
13 3300006058 Ga0075432_10019506 Ga0075432_100195062 227
14 3300007265 Ga0099794_10011400 Ga0099794_100114004 227
15 3300009094 Ga0111539_10056002 Ga0111539_100560022 227
16 3300025910 Ga0207684_10000006 Ga0207684_10000006567 227
17 3300025910 Ga0207684_10048846 Ga0207684_100488464 227
18 3300025922 Ga0207646_10000150 Ga0207646_1000015027 227
19 3300025922 Ga0207646_10116991 Ga0207646_101169914 227
20 3300025923 Ga0207681_10114598 Ga0207681_101145981 227
21 3300042436 Ga0439435_0010974 Ga0439435_0010974_1000_1743 227
22 3300042461 Ga0439460_0043584 Ga0439460_0043584_459_1202 227
23 3300046674 Ga0495588_0301322 Ga0495588_0301322_22_768 228
24 3300050514 nmdc:mga08x19_100708_c1 nmdc:mga08x19_100708_c1_298_1047 228
25 3300006871 Ga0075434_100043193 Ga0075434_1000431937 229
26 3300050512 nmdc:mga0n895_15064_c1 nmdc:mga0n895_15064_c1_2830_3522 229
27 3300050513 nmdc:mga0rr50_545394_c1 nmdc:mga0rr50_545394_c1_187_879 229
28 3300003203 JGI25406J46586_10041485 JGI25406J46586_100414852 230
29 3300005937 Ga0081455_10013302 Ga0081455_100133024 230
30 3300005985 Ga0081539_10001453 Ga0081539_1000145322 230
31 3300006844 Ga0075428_100029571 Ga0075428_1000295715 230
32 3300006844 Ga0075428_100081203 Ga0075428_1000812034 230
33 3300006846 Ga0075430_100081703 Ga0075430_1000817032 230
34 3300006847 Ga0075431_100038040 Ga0075431_1000380401 230
35 3300007788 Ga0099795_10123680 Ga0099795_101236802 230
36 3300009147 Ga0114129_10113892 Ga0114129_101138923 230
37 3300009174 Ga0105241_10624456 Ga0105241_106244562 230
38 3300009177 Ga0105248_10348796 Ga0105248_103487962 230
39 3300009553 Ga0105249_10064487 Ga0105249_100644872 230
40 3300013296 Ga0157374_10301345 Ga0157374_103013454 230
41 3300013307 Ga0157372_10096063 Ga0157372_100960632 230
42 3300014325 Ga0163163_10024178 Ga0163163_100241784 230
43 3300014326 Ga0157380_10017181 Ga0157380_100171815 230
44 3300014745 Ga0157377_10253759 Ga0157377_102537592 230
45 3300031548 Ga0307408_100007288 Ga0307408_1000072885 230
46 3300031548 Ga0307408_100108693 Ga0307408_1001086932 230
47 3300031731 Ga0307405_10098271 Ga0307405_100982712 230
48 3300031731 Ga0307405_10562669 Ga0307405_105626691 230
49 3300031824 Ga0307413_10033760 Ga0307413_100337603 230
50 3300031824 Ga0307413_10112483 Ga0307413_101124832 230
51 3300031852 Ga0307410_10004771 Ga0307410_100047712 230
52 3300031901 Ga0307406_10001630 Ga0307406_1000163016 230
53 3300031901 Ga0307406_10027780 Ga0307406_100277805 230
54 3300031903 Ga0307407_10012605 Ga0307407_100126054 230
55 3300031911 Ga0307412_10130027 Ga0307412_101300272 230
56 3300031995 Ga0307409_100038931 Ga0307409_1000389312 230
57 3300032002 Ga0307416_100005053 Ga0307416_1000050535 230
58 3300032002 Ga0307416_100106200 Ga0307416_1001062002 230
59 3300032004 Ga0307414_10010615 Ga0307414_100106153 230
60 3300032004 Ga0307414_10011584 Ga0307414_100115842 230
61 3300032005 Ga0307411_10070569 Ga0307411_100705692 230
62 3300032005 Ga0307411_10200013 Ga0307411_102000132 230
63 3300032126 Ga0307415_100003687 Ga0307415_1000036875 230
64 3300032126 Ga0307415_100046659 Ga0307415_1000466592 230
65 3300037068 Ga0373925_0502238 Ga0373925_0502238_86_826 230
66 3300042437 Ga0439444_0014013 Ga0439444_0014013_238_978 230
67 3300042993 Ga0439440_0002452 Ga0439440_0002452_577_1317 230
68 3300042993 Ga0439440_0006687 Ga0439440_0006687_1492_2232 230
69 3300046515 Ga0495620_0021621 Ga0495620_0021621_2362_3105 230
70 3300046523 Ga0495644_0038050 Ga0495644_0038050_336_1079 230
71 3300048911 Ga0496108_0040551 Ga0496108_0040551_1074_1766 230
72 3300048913 Ga0496110_0290409 Ga0496110_0290409_301_993 230
73 3300048917 Ga0496114_0353676 Ga0496114_0353676_556_1248 230
74 3300049705 Ga0501225_0075878 Ga0501225_0075878_123_863 230
75 3300049765 Ga0501268_011682 Ga0501268_011682_431_1171 230
76 3300050507 nmdc:mga05p37_571348_c1 nmdc:mga05p37_571348_c1_501_1241 230
77 3300050508 nmdc:mga09592_131906_c1 nmdc:mga09592_131906_c1_1356_2096 230
78 3300050509 nmdc:mga0qj67_212106_c1 nmdc:mga0qj67_212106_c1_468_1208 230
79 3300050510 nmdc:mga06r32_120215_c1 nmdc:mga06r32_120215_c1_158_898 230
80 3300050511 nmdc:mga08y16_265986_c1 nmdc:mga08y16_265986_c1_957_1649 230
81 3300005347 Ga0070668_100111180 Ga0070668_1001111801 231
82 3300005366 Ga0070659_100014895 Ga0070659_1000148956 231
83 3300005445 Ga0070708_100540475 Ga0070708_1005404752 231
84 3300005457 Ga0070662_100409798 Ga0070662_1004097981 231
85 3300005459 Ga0068867_100387332 Ga0068867_1003873322 231
86 3300005467 Ga0070706_100263910 Ga0070706_1002639103 231
87 3300005467 Ga0070706_100408884 Ga0070706_1004088842 231
88 3300005518 Ga0070699_100000984 Ga0070699_1000009845 231
89 3300005536 Ga0070697_100000001 Ga0070697_100000001610 231
90 3300005539 Ga0068853_100044095 Ga0068853_1000440952 231
91 3300005719 Ga0068861_100016484 Ga0068861_1000164845 231
92 3300005843 Ga0068860_100237678 Ga0068860_1002376782 231
93 3300005844 Ga0068862_100767709 Ga0068862_1007677091 231
94 3300005937 Ga0081455_10000117 Ga0081455_1000011774 231
95 3300005937 Ga0081455_10028601 Ga0081455_100286014 231
96 3300005937 Ga0081455_10052051 Ga0081455_100520512 231
97 3300006058 Ga0075432_10000605 Ga0075432_100006056 231
98 3300006844 Ga0075428_100050891 Ga0075428_1000508912 231
99 3300006852 Ga0075433_10002577 Ga0075433_100025777 231
100 3300006871 Ga0075434_100004645 Ga0075434_10000464510 231
101 3300006880 Ga0075429_100048430 Ga0075429_1000484302 231
102 3300006881 Ga0068865_100027436 Ga0068865_1000274365 231
103 3300007076 Ga0075435_100004207 Ga0075435_1000042073 231
104 3300009094 Ga0111539_10044490 Ga0111539_100444903 231
105 3300009098 Ga0105245_10022829 Ga0105245_100228292 231
106 3300009147 Ga0114129_10028902 Ga0114129_100289027 231
107 3300009148 Ga0105243_10045622 Ga0105243_100456222 231
108 3300009176 Ga0105242_10448569 Ga0105242_104485692 231
109 3300009545 Ga0105237_10151793 Ga0105237_101517934 231
110 3300009551 Ga0105238_10110072 Ga0105238_101100722 231
111 3300009553 Ga0105249_10068337 Ga0105249_100683375 231
112 3300010375 Ga0105239_10124783 Ga0105239_101247832 231
113 3300013306 Ga0163162_10044482 Ga0163162_100444822 231
114 3300013307 Ga0157372_10521349 Ga0157372_105213492 231
115 3300017792 Ga0163161_10023824 Ga0163161_100238243 231
116 3300025910 Ga0207684_10301290 Ga0207684_103012902 231
117 3300025910 Ga0207684_10509118 Ga0207684_105091181 231
118 3300025922 Ga0207646_10019826 Ga0207646_100198267 231
119 3300025927 Ga0207687_10405665 Ga0207687_104056652 231
120 3300025933 Ga0207706_10038413 Ga0207706_100384133 231
121 3300025934 Ga0207686_10306290 Ga0207686_103062902 231
122 3300025961 Ga0207712_10134325 Ga0207712_101343253 231
123 3300025972 Ga0207668_10085178 Ga0207668_100851782 231
124 3300026041 Ga0207639_10120867 Ga0207639_101208673 231
125 3300026089 Ga0207648_10314387 Ga0207648_103143873 231
126 3300026118 Ga0207675_100005342 Ga0207675_10000534210 231
127 3300027907 Ga0207428_10005110 Ga0207428_100051108 231
128 3300028380 Ga0268265_10722497 Ga0268265_107224971 231
129 3300028381 Ga0268264_10088527 Ga0268264_100885274 231
130 3300035691 Ga0373931_0335876 Ga0373931_0335876_128_871 231
131 3300042126 Ga0450888_009626 Ga0450888_009626_134_877 231
132 3300046691 Ga0495670_0068520 Ga0495670_0068520_350_1093 231
133 3300050507 nmdc:mga05p37_30634_c1 nmdc:mga05p37_30634_c1_1997_2740 231
134 3300050508 nmdc:mga09592_5401_c1 nmdc:mga09592_5401_c1_6633_7376 231
135 3300050510 nmdc:mga06r32_13371_c1 nmdc:mga06r32_13371_c1_3658_4401 231
136 3300050511 nmdc:mga08y16_29760_c1 nmdc:mga08y16_29760_c1_1193_1936 231
137 3300050513 nmdc:mga0rr50_7764_c1 nmdc:mga0rr50_7764_c1_3558_4301 231
138 3300050515 nmdc:mga0a205_25703_c1 nmdc:mga0a205_25703_c1_3707_4450 231
139 3300031731 Ga0307405_10360036 Ga0307405_103600361 233
140 3300031824 Ga0307413_10106368 Ga0307413_101063682 233
141 3300031995 Ga0307409_100426838 Ga0307409_1004268383 233
142 3300032002 Ga0307416_100006521 Ga0307416_1000065212 233
143 3300005445 Ga0070708_100002575 Ga0070708_1000025753 234
144 3300005468 Ga0070707_100000047 Ga0070707_10000004768 234
145 3300005468 Ga0070707_100063077 Ga0070707_1000630776 234
146 3300005536 Ga0070697_100010423 Ga0070697_1000104233 234
147 3300007265 Ga0099794_10000234 Ga0099794_1000023419 234
148 3300025922 Ga0207646_10000028 Ga0207646_1000002841 234
149 3300025922 Ga0207646_10029783 Ga0207646_100297832 234
150 3300027671 Ga0209588_1000205 Ga0209588_10002052 234
151 3300050515 nmdc:mga0a205_637359_c1 nmdc:mga0a205_637359_c1_119_865 234
152 3300005436 Ga0070713_100190933 Ga0070713_1001909332 235
153 3300005468 Ga0070707_100055469 Ga0070707_1000554692 235
154 3300025922 Ga0207646_10056592 Ga0207646_100565922 235
155 3300025928 Ga0207700_10532306 Ga0207700_105323062 235
156 3300025929 Ga0207664_10237204 Ga0207664_102372043 235
157 3300025934 Ga0207686_10152767 Ga0207686_101527672 235
158 3300026023 Ga0207677_10173487 Ga0207677_101734871 235
159 3300050512 nmdc:mga0n895_610959_c1 nmdc:mga0n895_610959_c1_105_845 235
160 3300005338 Ga0068868_100141117 Ga0068868_1001411172 236
161 3300005347 Ga0070668_100209529 Ga0070668_1002095292 236
162 3300005457 Ga0070662_100051609 Ga0070662_1000516092 236
163 3300005459 Ga0068867_100159666 Ga0068867_1001596662 236
164 3300005563 Ga0068855_100260247 Ga0068855_1002602472 236
165 3300005578 Ga0068854_100215186 Ga0068854_1002151862 236
166 3300005615 Ga0070702_100205120 Ga0070702_1002051201 236
167 3300005718 Ga0068866_10112345 Ga0068866_101123452 236
168 3300005719 Ga0068861_100006765 Ga0068861_1000067659 236
169 3300005844 Ga0068862_100241030 Ga0068862_1002410302 236
170 3300006028 Ga0070717_10006234 Ga0070717_100062345 236
171 3300006914 Ga0075436_100266771 Ga0075436_1002667712 236
172 3300009098 Ga0105245_10071039 Ga0105245_100710394 236
173 3300009148 Ga0105243_10011341 Ga0105243_100113416 236
174 3300009176 Ga0105242_10011679 Ga0105242_100116799 236
175 3300009545 Ga0105237_10289692 Ga0105237_102896921 236
176 3300009553 Ga0105249_10026242 Ga0105249_100262425 236
177 3300013306 Ga0163162_10242940 Ga0163162_102429402 236
178 3300013307 Ga0157372_10006388 Ga0157372_100063882 236
179 3300014326 Ga0157380_10062259 Ga0157380_100622595 236
180 3300025901 Ga0207688_10000529 Ga0207688_100005292 236
181 3300025927 Ga0207687_10027928 Ga0207687_100279284 236
182 3300025933 Ga0207706_10069543 Ga0207706_100695434 236
183 3300025935 Ga0207709_10008103 Ga0207709_100081036 236
184 3300025942 Ga0207689_10337423 Ga0207689_103374232 236
185 3300025961 Ga0207712_10089346 Ga0207712_100893462 236
186 3300025981 Ga0207640_10353625 Ga0207640_103536252 236
187 3300026118 Ga0207675_100003908 Ga0207675_1000039085 236
188 3300031548 Ga0307408_100046024 Ga0307408_1000460242 236
189 3300031731 Ga0307405_10071664 Ga0307405_100716642 236
190 3300031852 Ga0307410_10012571 Ga0307410_100125714 236
191 3300031901 Ga0307406_10000612 Ga0307406_1000061214 236
192 3300031903 Ga0307407_10029535 Ga0307407_100295351 236
193 3300031995 Ga0307409_100000177 Ga0307409_1000001779 236
194 3300032002 Ga0307416_100000144 Ga0307416_10000014414 236
195 3300032004 Ga0307414_10036896 Ga0307414_100368961 236
196 3300032126 Ga0307415_100000923 Ga0307415_10000092310 236
197 3300035207 Ga0373942_0128000 Ga0373942_0128000_44_787 236
198 3300050514 nmdc:mga08x19_140837_c1 nmdc:mga08x19_140837_c1_611_1324 236
199 3300050514 nmdc:mga08x19_356503_c1 nmdc:mga08x19_356503_c1_94_834 236
200 3300009147 Ga0114129_10466245 Ga0114129_104662451 237
201 3300031901 Ga0307406_10073394 Ga0307406_100733942 237
202 3300046520 Ga0495637_0128135 Ga0495637_0128135_90_833 237
203 3300049572 Ga0501036_0238858 Ga0501036_0238858_343_1059 237
204 3300049577 Ga0501041_0101070 Ga0501041_0101070_504_1220 237
205 3300049588 Ga0501072_0045453 Ga0501072_0045453_2137_2853 237
206 3300049742 Ga0501080_0419700 Ga0501080_0419700_191_907 237
207 3300050507 nmdc:mga05p37_392201_c1 nmdc:mga05p37_392201_c1_836_1579 237
208 3300050510 nmdc:mga06r32_360892_c1 nmdc:mga06r32_360892_c1_301_1017 237
209 3300060353 Ga0501082_0063091 Ga0501082_0063091_2175_2891 237
210 3300005445 Ga0070708_100056583 Ga0070708_1000565832 238
211 3300005467 Ga0070706_100031835 Ga0070706_1000318354 238
212 3300005468 Ga0070707_100081806 Ga0070707_1000818062 238
213 3300005468 Ga0070707_100578428 Ga0070707_1005784282 238
214 3300005518 Ga0070699_100230738 Ga0070699_1002307382 238
215 3300025904 Ga0207647_10247973 Ga0207647_102479732 238
216 3300025922 Ga0207646_10187475 Ga0207646_101874752 238
217 3300046461 Ga0495641_0077027 Ga0495641_0077027_277_996 238
218 3300048903 Ga0496100_0201056 Ga0496100_0201056_442_1161 238
219 3300048913 Ga0496110_0612056 Ga0496110_0612056_46_765 238
220 3300005334 Ga0068869_100012011 Ga0068869_1000120115 239
221 3300006058 Ga0075432_10000257 Ga0075432_1000025713 239
222 3300006852 Ga0075433_10000376 Ga0075433_1000037617 239
223 3300006871 Ga0075434_100001579 Ga0075434_1000015795 239
224 3300006914 Ga0075436_100000378 Ga0075436_10000037819 239
225 3300009094 Ga0111539_10002609 Ga0111539_1000260914 239
226 3300009147 Ga0114129_10635044 Ga0114129_106350442 239
227 3300009147 Ga0114129_10748705 Ga0114129_107487052 239
228 3300013306 Ga0163162_10393092 Ga0163162_103930922 239
229 3300014497 Ga0182008_10135665 Ga0182008_101356652 239
230 3300027907 Ga0207428_10002093 Ga0207428_1000209313 239
231 3300032005 Ga0307411_10704821 Ga0307411_107048211 239
232 3300045976 Ga0466967_0970512 Ga0466967_0970512_16_741 239
233 3300050509 nmdc:mga0qj67_212656_c1 nmdc:mga0qj67_212656_c1_573_1295 239
234 3300050511 nmdc:mga08y16_1650_c1 nmdc:mga08y16_1650_c1_12252_12995 239
235 3300050512 nmdc:mga0n895_1625_c1 nmdc:mga0n895_1625_c1_135_878 239
236 3300050514 nmdc:mga08x19_3323_c1 nmdc:mga08x19_3323_c1_6135_6878 239
237 3300050515 nmdc:mga0a205_10147_c1 nmdc:mga0a205_10147_c1_4696_5439 239
238 3300005339 Ga0070660_100064130 Ga0070660_1000641302 240
239 3300005457 Ga0070662_100278177 Ga0070662_1002781772 240
240 3300005467 Ga0070706_100119496 Ga0070706_1001194962 240
241 3300005518 Ga0070699_100000028 Ga0070699_100000028135 240
242 3300005536 Ga0070697_100588632 Ga0070697_1005886321 240
243 3300006844 Ga0075428_100033433 Ga0075428_1000334332 240
244 3300006847 Ga0075431_100059967 Ga0075431_1000599676 240
245 3300009147 Ga0114129_10240530 Ga0114129_102405303 240
246 3300010375 Ga0105239_10585257 Ga0105239_105852571 240
247 3300025910 Ga0207684_10066207 Ga0207684_100662074 240
248 3300028380 Ga0268265_10056069 Ga0268265_100560693 240
249 3300031344 Ga0265316_10021811 Ga0265316_100218114 240
250 3300031344 Ga0265316_10220502 Ga0265316_102205022 240
251 3300031344 Ga0265316_10260183 Ga0265316_102601832 240
252 3300032168 Ga0316593_10032304 Ga0316593_100323042 240
253 3300032168 Ga0316593_10036407 Ga0316593_100364071 240
254 3300042001 Ga0439441_000323 Ga0439441_000323_140_865 240
255 3300042009 Ga0439451_007644 Ga0439451_007644_1456_2181 240
256 3300042461 Ga0439460_0057212 Ga0439460_0057212_139_864 240
257 3300044712 Ga0453684_0115496 Ga0453684_0115496_1542_2372 240
258 3300044712 Ga0453684_0196003 Ga0453684_0196003_76_906 240
259 3300045051 Ga0451576_0217380 Ga0451576_0217380_698_1528 240
260 3300050510 nmdc:mga06r32_544817_c1 nmdc:mga06r32_544817_c1_377_1102 240
261 3300005436 Ga0070713_100037445 Ga0070713_1000374452 241
262 3300005438 Ga0070701_10247097 Ga0070701_102470972 241
263 3300005471 Ga0070698_100086725 Ga0070698_1000867253 241
264 3300006028 Ga0070717_10000663 Ga0070717_100006635 241
265 3300006871 Ga0075434_100027245 Ga0075434_1000272452 241
266 3300009147 Ga0114129_10540649 Ga0114129_105406492 241
267 3300032005 Ga0307411_10166661 Ga0307411_101666613 241
268 3300039437 Ga0436365_1577931 Ga0436365_1577931_137_868 241
269 3300045836 Ga0466958_0022078 Ga0466958_0022078_1482_2222 241
270 3300049572 Ga0501036_0549779 Ga0501036_0549779_64_792 241
271 3300049576 Ga0501040_0000994 Ga0501040_0000994_177_905 241
272 3300049576 Ga0501040_0246535 Ga0501040_0246535_214_942 241
273 3300049577 Ga0501041_0013030 Ga0501041_0013030_1780_2508 241
274 3300049578 Ga0501042_0054202 Ga0501042_0054202_1189_1917 241
275 3300049582 Ga0501048_0012339 Ga0501048_0012339_4553_5281 241
276 3300049583 Ga0501067_0161998 Ga0501067_0161998_412_1137 241
277 3300049587 Ga0501071_0123355 Ga0501071_0123355_602_1330 241
278 3300049588 Ga0501072_0004225 Ga0501072_0004225_3256_3984 241
279 3300049589 Ga0501073_0241251 Ga0501073_0241251_216_944 241
280 3300049590 Ga0501074_0037612 Ga0501074_0037612_464_1192 241
281 3300049591 Ga0501075_0000258 Ga0501075_0000258_24820_25548 241
282 3300049592 Ga0501076_0001619 Ga0501076_0001619_3053_3781 241
283 3300049741 Ga0501079_0010825 Ga0501079_0010825_3225_3953 241
284 3300049742 Ga0501080_0037497 Ga0501080_0037497_1311_2039 241
285 3300049743 Ga0501081_0006918 Ga0501081_0006918_1261_1989 241
286 3300049744 Ga0501083_0188637 Ga0501083_0188637_145_873 241
287 3300049822 Ga0501035_0030500 Ga0501035_0030500_1510_2238 241
288 3300049824 Ga0501045_0005706 Ga0501045_0005706_4101_4829 241
289 3300050508 nmdc:mga09592_204332_c1 nmdc:mga09592_204332_c1_633_1463 241
290 3300050512 nmdc:mga0n895_25298_c1 nmdc:mga0n895_25298_c1_2993_3727 241
291 3300050514 nmdc:mga08x19_1109_c1 nmdc:mga08x19_1109_c1_10623_11363 241
292 3300050514 nmdc:mga08x19_20236_c1 nmdc:mga08x19_20236_c1_2948_3688 241
293 3300054114 Ga0501084_0010302 Ga0501084_0010302_2934_3662 241
294 3300060353 Ga0501082_0010040 Ga0501082_0010040_5772_6500 241
295 3300061734 Ga0530510_0000170 Ga0530510_0000170_25480_26208 241
296 3300005347 Ga0070668_100000665 Ga0070668_1000006655 242
297 3300005434 Ga0070709_10076746 Ga0070709_100767462 242
298 3300005435 Ga0070714_100315216 Ga0070714_1003152162 242
299 3300005444 Ga0070694_100254370 Ga0070694_1002543702 242
300 3300005445 Ga0070708_100000121 Ga0070708_10000012119 242
301 3300005445 Ga0070708_100002396 Ga0070708_10000239612 242
302 3300005445 Ga0070708_100004526 Ga0070708_1000045269 242
303 3300005445 Ga0070708_100006577 Ga0070708_1000065778 242
304 3300005445 Ga0070708_100025794 Ga0070708_1000257946 242
305 3300005445 Ga0070708_100156842 Ga0070708_1001568424 242
306 3300005467 Ga0070706_100000021 Ga0070706_100000021168 242
307 3300005467 Ga0070706_100000184 Ga0070706_10000018432 242
308 3300005467 Ga0070706_100000201 Ga0070706_10000020172 242
309 3300005467 Ga0070706_100000771 Ga0070706_10000077126 242
310 3300005467 Ga0070706_100020429 Ga0070706_1000204292 242
311 3300005467 Ga0070706_100081043 Ga0070706_1000810435 242
312 3300005468 Ga0070707_100000105 Ga0070707_10000010512 242
313 3300005468 Ga0070707_100000169 Ga0070707_10000016940 242
314 3300005468 Ga0070707_100007825 Ga0070707_1000078256 242
315 3300005468 Ga0070707_100008508 Ga0070707_1000085087 242
316 3300005468 Ga0070707_100054421 Ga0070707_1000544212 242
317 3300005468 Ga0070707_100062709 Ga0070707_1000627092 242
318 3300005468 Ga0070707_100104656 Ga0070707_1001046561 242
319 3300005468 Ga0070707_100117334 Ga0070707_1001173342 242
320 3300005468 Ga0070707_100119216 Ga0070707_1001192162 242
321 3300005468 Ga0070707_100421078 Ga0070707_1004210782 242
322 3300005471 Ga0070698_100017587 Ga0070698_1000175874 242
323 3300005471 Ga0070698_100039929 Ga0070698_1000399292 242
324 3300005471 Ga0070698_100074897 Ga0070698_1000748975 242
325 3300005518 Ga0070699_100000212 Ga0070699_10000021246 242
326 3300005518 Ga0070699_100000258 Ga0070699_10000025852 242
327 3300005518 Ga0070699_100125553 Ga0070699_1001255534 242
328 3300005518 Ga0070699_100202740 Ga0070699_1002027402 242
329 3300005536 Ga0070697_100013408 Ga0070697_1000134084 242
330 3300005536 Ga0070697_100020758 Ga0070697_1000207583 242
331 3300005536 Ga0070697_100063797 Ga0070697_1000637972 242
332 3300005536 Ga0070697_100206578 Ga0070697_1002065782 242
333 3300005545 Ga0070695_100027378 Ga0070695_1000273782 242
334 3300005546 Ga0070696_100264521 Ga0070696_1002645212 242
335 3300005546 Ga0070696_100383090 Ga0070696_1003830902 242
336 3300005549 Ga0070704_100035495 Ga0070704_1000354954 242
337 3300005549 Ga0070704_100316595 Ga0070704_1003165953 242
338 3300005844 Ga0068862_100054238 Ga0068862_1000542383 242
339 3300005844 Ga0068862_100064273 Ga0068862_1000642733 242
340 3300006028 Ga0070717_10000474 Ga0070717_1000047422 242
341 3300006028 Ga0070717_10001305 Ga0070717_1000130512 242
342 3300006058 Ga0075432_10020674 Ga0075432_100206742 242
343 3300006173 Ga0070716_100029466 Ga0070716_1000294662 242
344 3300006844 Ga0075428_100296912 Ga0075428_1002969123 242
345 3300006852 Ga0075433_10008229 Ga0075433_100082298 242
346 3300006852 Ga0075433_10273274 Ga0075433_102732742 242
347 3300006852 Ga0075433_10425106 Ga0075433_104251062 242
348 3300006871 Ga0075434_100027032 Ga0075434_1000270324 242
349 3300006880 Ga0075429_100157714 Ga0075429_1001577144 242
350 3300006914 Ga0075436_100014189 Ga0075436_1000141892 242
351 3300006914 Ga0075436_100283675 Ga0075436_1002836751 242
352 3300007076 Ga0075435_100041444 Ga0075435_1000414442 242
353 3300007076 Ga0075435_100174944 Ga0075435_1001749442 242
354 3300007265 Ga0099794_10003901 Ga0099794_100039012 242
355 3300007788 Ga0099795_10021648 Ga0099795_100216482 242
356 3300009094 Ga0111539_10092847 Ga0111539_100928473 242
357 3300009147 Ga0114129_10329181 Ga0114129_103291812 242
358 3300025885 Ga0207653_10000702 Ga0207653_1000070212 242
359 3300025885 Ga0207653_10001325 Ga0207653_100013253 242
360 3300025906 Ga0207699_10138770 Ga0207699_101387702 242
361 3300025910 Ga0207684_10000001 Ga0207684_1000000117 242
362 3300025910 Ga0207684_10000054 Ga0207684_10000054197 242
363 3300025910 Ga0207684_10000095 Ga0207684_1000009520 242
364 3300025910 Ga0207684_10000141 Ga0207684_10000141132 242
365 3300025910 Ga0207684_10000369 Ga0207684_1000036938 242
366 3300025910 Ga0207684_10035465 Ga0207684_100354656 242
367 3300025910 Ga0207684_10038071 Ga0207684_100380716 242
368 3300025910 Ga0207684_10151427 Ga0207684_101514274 242
369 3300025917 Ga0207660_10642750 Ga0207660_106427501 242
370 3300025922 Ga0207646_10000027 Ga0207646_1000002728 242
371 3300025922 Ga0207646_10000034 Ga0207646_10000034232 242
372 3300025922 Ga0207646_10000053 Ga0207646_1000005312 242
373 3300025922 Ga0207646_10000212 Ga0207646_1000021247 242
374 3300025922 Ga0207646_10000384 Ga0207646_1000038462 242
375 3300025922 Ga0207646_10000696 Ga0207646_1000069647 242
376 3300025922 Ga0207646_10007062 Ga0207646_1000706214 242
377 3300025922 Ga0207646_10014388 Ga0207646_100143882 242
378 3300025922 Ga0207646_10017681 Ga0207646_100176814 242
379 3300025922 Ga0207646_10028803 Ga0207646_100288039 242
380 3300025922 Ga0207646_10034912 Ga0207646_100349122 242
381 3300025922 Ga0207646_10051199 Ga0207646_100511994 242
382 3300025922 Ga0207646_10053442 Ga0207646_100534424 242
383 3300025922 Ga0207646_10202523 Ga0207646_102025232 242
384 3300025922 Ga0207646_10358751 Ga0207646_103587512 242
385 3300025929 Ga0207664_10291478 Ga0207664_102914782 242
386 3300025939 Ga0207665_10021158 Ga0207665_100211582 242
387 3300025939 Ga0207665_10342952 Ga0207665_103429522 242
388 3300025972 Ga0207668_10010597 Ga0207668_100105975 242
389 3300027671 Ga0209588_1000286 Ga0209588_10002866 242
390 3300028380 Ga0268265_10018200 Ga0268265_100182006 242
391 3300028380 Ga0268265_10060859 Ga0268265_100608592 242
392 3300030731 Ga0316177_1122264 Ga0316177_11222642 242
393 3300030732 Ga0316176_1055766 Ga0316176_10557662 242
394 3300030733 Ga0314311_1014322 Ga0314311_10143223 242
395 3300044673 Ga0453683_0019199 Ga0453683_0019199_3262_4005 242
396 3300044712 Ga0453684_0062591 Ga0453684_0062591_3756_4583 242
397 3300044712 Ga0453684_0090617 Ga0453684_0090617_2868_3689 242
398 3300044712 Ga0453684_0164172 Ga0453684_0164172_1246_2067 242
399 3300050507 nmdc:mga05p37_175785_c1 nmdc:mga05p37_175785_c1_350_1090 242
400 3300050508 nmdc:mga09592_552859_c1 nmdc:mga09592_552859_c1_113_853 242
401 3300050510 nmdc:mga06r32_397356_c1 nmdc:mga06r32_397356_c1_485_1225 242
402 3300050512 nmdc:mga0n895_10044_c1 nmdc:mga0n895_10044_c1_5698_6438 242
403 3300050513 nmdc:mga0rr50_142340_c1 nmdc:mga0rr50_142340_c1_510_1250 242
404 3300050514 nmdc:mga08x19_12656_c1 nmdc:mga08x19_12656_c1_3114_3854 242
405 3300050514 nmdc:mga08x19_21433_c1 nmdc:mga08x19_21433_c1_306_1046 242
406 3300050514 nmdc:mga08x19_39979_c1 nmdc:mga08x19_39979_c1_857_1600 242
407 3300050514 nmdc:mga08x19_57756_c1 nmdc:mga08x19_57756_c1_629_1369 242
408 3300050515 nmdc:mga0a205_168069_c1 nmdc:mga0a205_168069_c1_281_1021 242
409 3300050515 nmdc:mga0a205_369237_c1 nmdc:mga0a205_369237_c1_433_1173 242
410 3300059426 Ga0590077_039028 Ga0590077_039028_208_939 242
411 iso_pu_bacteria 2738541264 2738666505 242
412 iso_pu_bacteria 2738541356 2739146429 242
413 iso_pu_bacteria 2868088558 2868091301 242
414 iso_pu_bacteria 2939582691 2939585320 242
415 3300005289 Ga0065704_10197022 Ga0065704_101970221 243
416 3300032002 Ga0307416_100097065 Ga0307416_1000970652 243
417 3300042876 Ga0451577_0000265 Ga0451577_0000265_19009_19746 243
418 3300042876 Ga0451577_0688222 Ga0451577_0688222_95_832 243
419 3300044673 Ga0453683_0000844 Ga0453683_0000844_8102_8941 243
420 3300044673 Ga0453683_0004655 Ga0453683_0004655_28_870 243
421 3300044673 Ga0453683_0023477 Ga0453683_0023477_1767_2504 243
422 3300044712 Ga0453684_0001198 Ga0453684_0001198_24990_25727 243
423 3300044712 Ga0453684_0002572 Ga0453684_0002572_24190_25023 243
424 3300044712 Ga0453684_0035165 Ga0453684_0035165_2392_3225 243
425 3300044712 Ga0453684_0097456 Ga0453684_0097456_909_1742 243
426 3300044712 Ga0453684_0353264 Ga0453684_0353264_321_1058 243
427 3300045051 Ga0451576_0002971 Ga0451576_0002971_15966_16805 243
428 3300045051 Ga0451576_0008841 Ga0451576_0008841_2947_3684 243
429 3300049577 Ga0501041_0306920 Ga0501041_0306920_76_921 243
430 3300049590 Ga0501074_0027537 Ga0501074_0027537_580_1419 243
431 3300049591 Ga0501075_0047349 Ga0501075_0047349_218_1057 243
432 3300049591 Ga0501075_0193075 Ga0501075_0193075_393_1238 243
433 3300049592 Ga0501076_0003432 Ga0501076_0003432_7284_8123 243
434 3300049592 Ga0501076_0074668 Ga0501076_0074668_531_1376 243
435 3300049741 Ga0501079_0017544 Ga0501079_0017544_1120_1959 243
436 3300049743 Ga0501081_0011002 Ga0501081_0011002_2735_3574 243
437 3300049779 Ga0501283_005455 Ga0501283_005455_827_1666 243
438 3300061734 Ga0530510_0035479 Ga0530510_0035479_1588_2427 243
439 iso_pu_bacteria 2622736605 2623499050 243
440 iso_pu_bacteria 2883821847 2883824098 243
441 3300005290 Ga0065712_10173497 Ga0065712_101734972 244
442 3300005295 Ga0065707_10272934 Ga0065707_102729342 244
443 3300005336 Ga0070680_100030862 Ga0070680_1000308626 244
444 3300005340 Ga0070689_100204671 Ga0070689_1002046713 244
445 3300005345 Ga0070692_10012817 Ga0070692_100128177 244
446 3300005356 Ga0070674_100176911 Ga0070674_1001769111 244
447 3300005435 Ga0070714_100029593 Ga0070714_1000295935 244
448 3300005435 Ga0070714_100197537 Ga0070714_1001975371 244
449 3300005440 Ga0070705_100009674 Ga0070705_1000096743 244
450 3300005444 Ga0070694_100009334 Ga0070694_10000933410 244
451 3300005518 Ga0070699_100428429 Ga0070699_1004284292 244
452 3300005536 Ga0070697_100002259 Ga0070697_1000022592 244
453 3300005536 Ga0070697_100006224 Ga0070697_1000062246 244
454 3300005536 Ga0070697_100143714 Ga0070697_1001437142 244
455 3300005546 Ga0070696_100014635 Ga0070696_1000146355 244
456 3300005546 Ga0070696_100143531 Ga0070696_1001435312 244
457 3300005549 Ga0070704_100006725 Ga0070704_1000067252 244
458 3300005563 Ga0068855_100015199 Ga0068855_1000151995 244
459 3300005577 Ga0068857_100102344 Ga0068857_1001023444 244
460 3300005615 Ga0070702_100248560 Ga0070702_1002485602 244
461 3300005617 Ga0068859_100236238 Ga0068859_1002362382 244
462 3300006173 Ga0070716_100111105 Ga0070716_1001111052 244
463 3300006844 Ga0075428_100059236 Ga0075428_1000592364 244
464 3300006844 Ga0075428_100100894 Ga0075428_1001008942 244
465 3300006844 Ga0075428_100410494 Ga0075428_1004104941 244
466 3300006847 Ga0075431_100071494 Ga0075431_1000714946 244
467 3300006880 Ga0075429_100280883 Ga0075429_1002808832 244
468 3300006914 Ga0075436_100003944 Ga0075436_1000039448 244
469 3300006914 Ga0075436_100061810 Ga0075436_1000618102 244
470 3300006931 Ga0097620_100236233 Ga0097620_1002362332 244
471 3300007265 Ga0099794_10003489 Ga0099794_100034898 244
472 3300007265 Ga0099794_10046086 Ga0099794_100460862 244
473 3300009093 Ga0105240_10012393 Ga0105240_100123939 244
474 3300009147 Ga0114129_10730817 Ga0114129_107308171 244
475 3300009553 Ga0105249_10293206 Ga0105249_102932062 244
476 3300020070 Ga0206356_10727865 Ga0206356_107278652 244
477 3300020075 Ga0206349_1493853 Ga0206349_14938532 244
478 3300020078 Ga0206352_11141605 Ga0206352_111416052 244
479 3300020080 Ga0206350_11346923 Ga0206350_113469233 244
480 3300021377 Ga0213874_10040740 Ga0213874_100407401 244
481 3300021384 Ga0213876_10076820 Ga0213876_100768202 244
482 3300022467 Ga0224712_10003943 Ga0224712_100039433 244
483 3300022467 Ga0224712_10101473 Ga0224712_101014731 244
484 3300025906 Ga0207699_10157949 Ga0207699_101579492 244
485 3300025913 Ga0207695_10003284 Ga0207695_1000328419 244
486 3300025917 Ga0207660_10058495 Ga0207660_100584955 244
487 3300025918 Ga0207662_10269559 Ga0207662_102695592 244
488 3300025922 Ga0207646_10112448 Ga0207646_101124482 244
489 3300025929 Ga0207664_10068886 Ga0207664_100688863 244
490 3300025929 Ga0207664_10169444 Ga0207664_101694442 244
491 3300025935 Ga0207709_10312741 Ga0207709_103127412 244
492 3300025939 Ga0207665_10282458 Ga0207665_102824582 244
493 3300025940 Ga0207691_10092038 Ga0207691_100920382 244
494 3300025949 Ga0207667_10039134 Ga0207667_100391342 244
495 3300025961 Ga0207712_10085245 Ga0207712_100852454 244
496 3300026118 Ga0207675_100590434 Ga0207675_1005904342 244
497 3300027395 Ga0209996_1002534 Ga0209996_10025342 244
498 3300027671 Ga0209588_1003983 Ga0209588_10039834 244
499 3300035695 Ga0373927_0103334 Ga0373927_0103334_690_1430 244
500 3300035725 Ga0373947_0387713 Ga0373947_0387713_80_820 244
501 3300037068 Ga0373925_0127551 Ga0373925_0127551_1133_1873 244
502 3300037418 Ga0395900_0136722 Ga0395900_0136722_1056_1799 244
503 3300037853 Ga0436364_1323116 Ga0436364_1323116_408_1148 244
504 3300039437 Ga0436365_0512317 Ga0436365_0512317_503_1282 244
505 3300039438 Ga0436360_0030768 Ga0436360_0030768_160_900 244
506 3300039450 Ga0436363_0181804 Ga0436363_0181804_2559_3335 244
507 3300039453 Ga0436362_0259633 Ga0436362_0259633_2990_3766 244
508 3300039453 Ga0436362_0376159 Ga0436362_0376159_2507_3247 244
509 3300039453 Ga0436362_1179483 Ga0436362_1179483_873_1652 244
510 3300042876 Ga0451577_0007708 Ga0451577_0007708_1971_2813 244
511 3300042876 Ga0451577_0211539 Ga0451577_0211539_737_1591 244
512 3300042876 Ga0451577_0307374 Ga0451577_0307374_443_1285 244
513 3300044683 Ga0466965_0007794 Ga0466965_0007794_1581_2348 244
514 3300044712 Ga0453684_0276240 Ga0453684_0276240_570_1412 244
515 3300044765 Ga0466970_0061433 Ga0466970_0061433_1131_1898 244
516 3300045051 Ga0451576_0072636 Ga0451576_0072636_1872_2612 244
517 3300046499 Ga0495594_0077043 Ga0495594_0077043_837_1577 244
518 3300046533 Ga0495640_0172624 Ga0495640_0172624_183_923 244
519 3300047322 Ga0495680_0057735 Ga0495680_0057735_471_1211 244
520 3300048918 Ga0496115_0000485 Ga0496115_0000485_13498_14241 244
521 3300049568 Ga0501031_0000153 Ga0501031_0000153_15228_16007 244
522 3300049569 Ga0501032_0000456 Ga0501032_0000456_9079_9858 244
523 3300049570 Ga0501033_0001929 Ga0501033_0001929_2052_2831 244
524 3300049571 Ga0501034_0003820 Ga0501034_0003820_15228_16007 244
525 3300049572 Ga0501036_0000662 Ga0501036_0000662_9391_10170 244
526 3300049573 Ga0501037_0000343 Ga0501037_0000343_23225_24004 244
527 3300049574 Ga0501038_0000714 Ga0501038_0000714_15165_15944 244
528 3300049575 Ga0501039_0000599 Ga0501039_0000599_11648_12427 244
529 3300049579 Ga0501043_0000764 Ga0501043_0000764_15829_16608 244
530 3300049580 Ga0501046_0000677 Ga0501046_0000677_15144_15923 244
531 3300049581 Ga0501047_0001076 Ga0501047_0001076_11162_11941 244
532 3300049582 Ga0501048_0004707 Ga0501048_0004707_222_1001 244
533 3300049583 Ga0501067_0002431 Ga0501067_0002431_6327_7106 244
534 3300049585 Ga0501069_0000436 Ga0501069_0000436_341_1120 244
535 3300049586 Ga0501070_0000684 Ga0501070_0000684_14176_14955 244
536 3300049589 Ga0501073_0037603 Ga0501073_0037603_1109_1888 244
537 3300049590 Ga0501074_0000629 Ga0501074_0000629_20822_21601 244
538 3300049742 Ga0501080_0000676 Ga0501080_0000676_8132_8911 244
539 3300049744 Ga0501083_0002389 Ga0501083_0002389_1271_2050 244
540 3300049822 Ga0501035_0001492 Ga0501035_0001492_793_1572 244
541 3300049823 Ga0501044_0137035 Ga0501044_0137035_665_1444 244
542 3300050507 nmdc:mga05p37_587111_c1 nmdc:mga05p37_587111_c1_68_811 244
543 3300050508 nmdc:mga09592_270639_c1 nmdc:mga09592_270639_c1_140_988 244
544 3300050510 nmdc:mga06r32_24139_c1 nmdc:mga06r32_24139_c1_2002_2742 244
545 3300053103 Ga0500555_002338 Ga0500555_002338_4045_4794 244
546 3300053730 Ga0500645_000154 Ga0500645_000154_36932_37681 244
547 3300054114 Ga0501084_0009487 Ga0501084_0009487_6378_7157 244
548 3300059492 Ga0587073_0001563 Ga0587073_0001563_1946_2686 244
549 3300060346 Ga0587111_0015792 Ga0587111_0015792_602_1342 244
550 3300060353 Ga0501082_0538927 Ga0501082_0538927_180_959 244
551 iso_pu_bacteria 2738543011 2739235417 244
552 iso_pu_bacteria 2889300758 2889301583 244
553 iso_pu_bacteria 2939743619 2939747691 244
554 3300005289 Ga0065704_10186240 Ga0065704_101862402 245
555 3300005290 Ga0065712_10076054 Ga0065712_100760544 245
556 3300005293 Ga0065715_10042756 Ga0065715_100427562 245
557 3300005328 Ga0070676_10058092 Ga0070676_100580922 245
558 3300005330 Ga0070690_100016860 Ga0070690_1000168602 245
559 3300005330 Ga0070690_100162400 Ga0070690_1001624002 245
560 3300005331 Ga0070670_100092414 Ga0070670_1000924142 245
561 3300005334 Ga0068869_100155695 Ga0068869_1001556951 245
562 3300005334 Ga0068869_100220452 Ga0068869_1002204521 245
563 3300005334 Ga0068869_100308095 Ga0068869_1003080952 245
564 3300005336 Ga0070680_100498316 Ga0070680_1004983161 245
565 3300005337 Ga0070682_100212472 Ga0070682_1002124722 245
566 3300005340 Ga0070689_100029345 Ga0070689_1000293452 245
567 3300005343 Ga0070687_100035368 Ga0070687_1000353684 245
568 3300005343 Ga0070687_100069904 Ga0070687_1000699042 245
569 3300005343 Ga0070687_100073033 Ga0070687_1000730332 245
570 3300005345 Ga0070692_10067167 Ga0070692_100671673 245
571 3300005347 Ga0070668_100104516 Ga0070668_1001045162 245
572 3300005347 Ga0070668_100224337 Ga0070668_1002243371 245
573 3300005353 Ga0070669_100133179 Ga0070669_1001331794 245
574 3300005353 Ga0070669_100739707 Ga0070669_1007397071 245
575 3300005354 Ga0070675_100000359 Ga0070675_10000035914 245
576 3300005354 Ga0070675_100008632 Ga0070675_1000086325 245
577 3300005354 Ga0070675_100177035 Ga0070675_1001770352 245
578 3300005355 Ga0070671_100065628 Ga0070671_1000656284 245
579 3300005356 Ga0070674_100022163 Ga0070674_1000221632 245
580 3300005356 Ga0070674_100168347 Ga0070674_1001683472 245
581 3300005364 Ga0070673_100218525 Ga0070673_1002185252 245
582 3300005365 Ga0070688_100060790 Ga0070688_1000607904 245
583 3300005365 Ga0070688_100257194 Ga0070688_1002571942 245
584 3300005366 Ga0070659_100096073 Ga0070659_1000960733 245
585 3300005367 Ga0070667_100005271 Ga0070667_1000052714 245
586 3300005438 Ga0070701_10074247 Ga0070701_100742472 245
587 3300005440 Ga0070705_100000208 Ga0070705_10000020815 245
588 3300005440 Ga0070705_100017050 Ga0070705_1000170504 245
589 3300005440 Ga0070705_100039254 Ga0070705_1000392545 245
590 3300005440 Ga0070705_100108732 Ga0070705_1001087323 245
591 3300005441 Ga0070700_100023961 Ga0070700_1000239613 245
592 3300005441 Ga0070700_100416692 Ga0070700_1004166921 245
593 3300005444 Ga0070694_100003476 Ga0070694_10000347610 245
594 3300005444 Ga0070694_100037547 Ga0070694_1000375475 245
595 3300005444 Ga0070694_100039591 Ga0070694_1000395911 245
596 3300005444 Ga0070694_100080034 Ga0070694_1000800342 245
597 3300005444 Ga0070694_100104108 Ga0070694_1001041083 245
598 3300005444 Ga0070694_100392995 Ga0070694_1003929951 245
599 3300005445 Ga0070708_100135719 Ga0070708_1001357192 245
600 3300005445 Ga0070708_100552864 Ga0070708_1005528641 245
601 3300005457 Ga0070662_100325382 Ga0070662_1003253822 245
602 3300005458 Ga0070681_10253256 Ga0070681_102532562 245
603 3300005459 Ga0068867_100011302 Ga0068867_1000113024 245
604 3300005466 Ga0070685_10045738 Ga0070685_100457384 245
605 3300005467 Ga0070706_100053224 Ga0070706_1000532245 245
606 3300005467 Ga0070706_100123818 Ga0070706_1001238184 245
607 3300005467 Ga0070706_100173188 Ga0070706_1001731882 245
608 3300005468 Ga0070707_100018229 Ga0070707_10001822910 245
609 3300005468 Ga0070707_100047494 Ga0070707_1000474942 245
610 3300005468 Ga0070707_100100232 Ga0070707_1001002322 245
611 3300005468 Ga0070707_100128345 Ga0070707_1001283451 245
612 3300005468 Ga0070707_100180863 Ga0070707_1001808633 245
613 3300005468 Ga0070707_100222748 Ga0070707_1002227482 245
614 3300005468 Ga0070707_100230588 Ga0070707_1002305882 245
615 3300005471 Ga0070698_100006725 Ga0070698_1000067252 245
616 3300005471 Ga0070698_100007640 Ga0070698_1000076405 245
617 3300005471 Ga0070698_100008829 Ga0070698_10000882912 245
618 3300005471 Ga0070698_100050580 Ga0070698_1000505804 245
619 3300005471 Ga0070698_100113656 Ga0070698_1001136562 245
620 3300005471 Ga0070698_100578803 Ga0070698_1005788032 245
621 3300005518 Ga0070699_100000176 Ga0070699_1000001769 245
622 3300005518 Ga0070699_100008116 Ga0070699_1000081164 245
623 3300005518 Ga0070699_100127223 Ga0070699_1001272234 245
624 3300005536 Ga0070697_100002209 Ga0070697_1000022097 245
625 3300005536 Ga0070697_100035412 Ga0070697_1000354124 245
626 3300005536 Ga0070697_100050391 Ga0070697_1000503913 245
627 3300005536 Ga0070697_100076439 Ga0070697_1000764394 245
628 3300005543 Ga0070672_100006373 Ga0070672_1000063738 245
629 3300005543 Ga0070672_100133077 Ga0070672_1001330772 245
630 3300005543 Ga0070672_100158254 Ga0070672_1001582544 245
631 3300005544 Ga0070686_100067204 Ga0070686_1000672044 245
632 3300005545 Ga0070695_100000437 Ga0070695_10000043720 245
633 3300005545 Ga0070695_100210403 Ga0070695_1002104031 245
634 3300005545 Ga0070695_100230044 Ga0070695_1002300442 245
635 3300005546 Ga0070696_100001386 Ga0070696_1000013869 245
636 3300005546 Ga0070696_100008934 Ga0070696_1000089344 245
637 3300005546 Ga0070696_100075706 Ga0070696_1000757061 245
638 3300005546 Ga0070696_100537052 Ga0070696_1005370521 245
639 3300005548 Ga0070665_100080619 Ga0070665_1000806192 245
640 3300005549 Ga0070704_100018059 Ga0070704_1000180594 245
641 3300005549 Ga0070704_100026276 Ga0070704_1000262766 245
642 3300005549 Ga0070704_100032125 Ga0070704_1000321253 245
643 3300005549 Ga0070704_100099383 Ga0070704_1000993832 245
644 3300005549 Ga0070704_100162036 Ga0070704_1001620362 245
645 3300005549 Ga0070704_100171176 Ga0070704_1001711761 245
646 3300005549 Ga0070704_100298245 Ga0070704_1002982453 245
647 3300005564 Ga0070664_100017097 Ga0070664_1000170975 245
648 3300005577 Ga0068857_100072347 Ga0068857_1000723474 245
649 3300005578 Ga0068854_100084491 Ga0068854_1000844912 245
650 3300005615 Ga0070702_100005985 Ga0070702_1000059852 245
651 3300005617 Ga0068859_100005674 Ga0068859_1000056747 245
652 3300005617 Ga0068859_100006934 Ga0068859_1000069345 245
653 3300005617 Ga0068859_100114717 Ga0068859_1001147171 245
654 3300005617 Ga0068859_100291337 Ga0068859_1002913372 245
655 3300005618 Ga0068864_100011322 Ga0068864_1000113226 245
656 3300005618 Ga0068864_100064424 Ga0068864_1000644242 245
657 3300005719 Ga0068861_100127531 Ga0068861_1001275312 245
658 3300005719 Ga0068861_100137584 Ga0068861_1001375842 245
659 3300005840 Ga0068870_10000557 Ga0068870_100005577 245
660 3300005840 Ga0068870_10006514 Ga0068870_100065144 245
661 3300005840 Ga0068870_10072886 Ga0068870_100728862 245
662 3300005841 Ga0068863_100002178 Ga0068863_10000217812 245
663 3300005842 Ga0068858_100380985 Ga0068858_1003809851 245
664 3300005843 Ga0068860_100013045 Ga0068860_10001304512 245
665 3300005843 Ga0068860_100107227 Ga0068860_1001072274 245
666 3300005844 Ga0068862_100008127 Ga0068862_1000081272 245
667 3300005844 Ga0068862_100017981 Ga0068862_1000179816 245
668 3300005937 Ga0081455_10008160 Ga0081455_1000816013 245
669 3300005981 Ga0081538_10006724 Ga0081538_100067247 245
670 3300005985 Ga0081539_10066143 Ga0081539_100661434 245
671 3300006028 Ga0070717_10069708 Ga0070717_100697086 245
672 3300006058 Ga0075432_10017643 Ga0075432_100176434 245
673 3300006058 Ga0075432_10122241 Ga0075432_101222412 245
674 3300006358 Ga0068871_100107850 Ga0068871_1001078501 245
675 3300006844 Ga0075428_100004044 Ga0075428_10000404416 245
676 3300006844 Ga0075428_100005176 Ga0075428_10000517611 245
677 3300006844 Ga0075428_100021003 Ga0075428_1000210038 245
678 3300006844 Ga0075428_100023949 Ga0075428_1000239494 245
679 3300006844 Ga0075428_100081513 Ga0075428_1000815133 245
680 3300006844 Ga0075428_100130992 Ga0075428_1001309924 245
681 3300006844 Ga0075428_100295291 Ga0075428_1002952912 245
682 3300006846 Ga0075430_100002680 Ga0075430_1000026807 245
683 3300006846 Ga0075430_100036140 Ga0075430_1000361405 245
684 3300006846 Ga0075430_100054190 Ga0075430_1000541902 245
685 3300006846 Ga0075430_100090787 Ga0075430_1000907874 245
686 3300006847 Ga0075431_100000365 Ga0075431_1000003657 245
687 3300006847 Ga0075431_100005031 Ga0075431_10000503111 245
688 3300006847 Ga0075431_100008304 Ga0075431_1000083042 245
689 3300006847 Ga0075431_100118150 Ga0075431_1001181502 245
690 3300006847 Ga0075431_100394543 Ga0075431_1003945431 245
691 3300006852 Ga0075433_10007197 Ga0075433_100071979 245
692 3300006852 Ga0075433_10010783 Ga0075433_100107838 245
693 3300006852 Ga0075433_10024370 Ga0075433_100243705 245
694 3300006852 Ga0075433_10028207 Ga0075433_100282072 245
695 3300006852 Ga0075433_10039083 Ga0075433_100390833 245
696 3300006852 Ga0075433_10119880 Ga0075433_101198804 245
697 3300006852 Ga0075433_10158428 Ga0075433_101584282 245
698 3300006871 Ga0075434_100007556 Ga0075434_1000075562 245
699 3300006871 Ga0075434_100011377 Ga0075434_1000113778 245
700 3300006871 Ga0075434_100076878 Ga0075434_1000768782 245
701 3300006871 Ga0075434_100115001 Ga0075434_1001150012 245
702 3300006871 Ga0075434_100133541 Ga0075434_1001335412 245
703 3300006871 Ga0075434_100135347 Ga0075434_1001353472 245
704 3300006871 Ga0075434_100146243 Ga0075434_1001462432 245
705 3300006871 Ga0075434_100186619 Ga0075434_1001866194 245
706 3300006871 Ga0075434_100468816 Ga0075434_1004688162 245
707 3300006871 Ga0075434_100717819 Ga0075434_1007178191 245
708 3300006871 Ga0075434_100744941 Ga0075434_1007449412 245
709 3300006880 Ga0075429_100006488 Ga0075429_10000648811 245
710 3300006880 Ga0075429_100013336 Ga0075429_1000133368 245
711 3300006880 Ga0075429_100031310 Ga0075429_1000313105 245
712 3300006880 Ga0075429_100052001 Ga0075429_1000520012 245
713 3300006880 Ga0075429_100073644 Ga0075429_1000736445 245
714 3300006880 Ga0075429_100079930 Ga0075429_1000799304 245
715 3300006880 Ga0075429_100135232 Ga0075429_1001352323 245
716 3300006880 Ga0075429_100191635 Ga0075429_1001916352 245
717 3300006880 Ga0075429_100231116 Ga0075429_1002311163 245
718 3300006880 Ga0075429_100477922 Ga0075429_1004779221 245
719 3300006880 Ga0075429_100633535 Ga0075429_1006335351 245
720 3300006881 Ga0068865_100384515 Ga0068865_1003845151 245
721 3300006914 Ga0075436_100026276 Ga0075436_1000262763 245
722 3300006914 Ga0075436_100037362 Ga0075436_1000373622 245
723 3300006931 Ga0097620_100005674 Ga0097620_1000056747 245
724 3300006931 Ga0097620_100006935 Ga0097620_1000069358 245
725 3300006931 Ga0097620_100114716 Ga0097620_1001147161 245
726 3300006931 Ga0097620_100291349 Ga0097620_1002913492 245
727 3300007076 Ga0075435_100025191 Ga0075435_1000251913 245
728 3300009094 Ga0111539_10009519 Ga0111539_100095192 245
729 3300009094 Ga0111539_10152112 Ga0111539_101521124 245
730 3300009094 Ga0111539_10263737 Ga0111539_102637373 245
731 3300009094 Ga0111539_10412118 Ga0111539_104121182 245
732 3300009094 Ga0111539_10460640 Ga0111539_104606402 245
733 3300009147 Ga0114129_10000090 Ga0114129_100000906 245
734 3300009147 Ga0114129_10004397 Ga0114129_1000439712 245
735 3300009147 Ga0114129_10013208 Ga0114129_1001320813 245
736 3300009147 Ga0114129_10019560 Ga0114129_100195603 245
737 3300009147 Ga0114129_10022060 Ga0114129_100220608 245
738 3300009147 Ga0114129_10065657 Ga0114129_100656576 245
739 3300009147 Ga0114129_10084554 Ga0114129_100845545 245
740 3300009147 Ga0114129_10113157 Ga0114129_101131575 245
741 3300009147 Ga0114129_10116877 Ga0114129_101168772 245
742 3300009147 Ga0114129_10132695 Ga0114129_101326952 245
743 3300009147 Ga0114129_10137149 Ga0114129_101371495 245
744 3300009147 Ga0114129_10256877 Ga0114129_102568772 245
745 3300009147 Ga0114129_10484898 Ga0114129_104848982 245
746 3300009147 Ga0114129_10617927 Ga0114129_106179272 245
747 3300009147 Ga0114129_10713598 Ga0114129_107135981 245
748 3300009147 Ga0114129_10890404 Ga0114129_108904041 245
749 3300009148 Ga0105243_10047264 Ga0105243_100472642 245
750 3300009174 Ga0105241_10706205 Ga0105241_107062051 245
751 3300009176 Ga0105242_10028855 Ga0105242_100288552 245
752 3300009177 Ga0105248_10157132 Ga0105248_101571325 245
753 3300011119 Ga0105246_10026403 Ga0105246_100264033 245
754 3300013296 Ga0157374_10222929 Ga0157374_102229293 245
755 3300013297 Ga0157378_10499246 Ga0157378_104992462 245
756 3300013306 Ga0163162_10065481 Ga0163162_100654815 245
757 3300013308 Ga0157375_10163011 Ga0157375_101630114 245
758 3300014326 Ga0157380_10032889 Ga0157380_100328892 245
759 3300014326 Ga0157380_10441415 Ga0157380_104414152 245
760 3300017792 Ga0163161_10011723 Ga0163161_100117234 245
761 3300022467 Ga0224712_10043248 Ga0224712_100432482 245
762 3300025315 Ga0207697_10004113 Ga0207697_100041132 245
763 3300025885 Ga0207653_10014527 Ga0207653_100145273 245
764 3300025885 Ga0207653_10033876 Ga0207653_100338762 245
765 3300025885 Ga0207653_10159632 Ga0207653_101596321 245
766 3300025893 Ga0207682_10001937 Ga0207682_100019374 245
767 3300025901 Ga0207688_10002175 Ga0207688_100021751 245
768 3300025907 Ga0207645_10044881 Ga0207645_100448814 245
769 3300025907 Ga0207645_10065603 Ga0207645_100656033 245
770 3300025908 Ga0207643_10000522 Ga0207643_1000052215 245
771 3300025908 Ga0207643_10020183 Ga0207643_100201834 245
772 3300025910 Ga0207684_10001354 Ga0207684_1000135421 245
773 3300025910 Ga0207684_10398744 Ga0207684_103987442 245
774 3300025910 Ga0207684_10433887 Ga0207684_104338872 245
775 3300025912 Ga0207707_10072524 Ga0207707_100725244 245
776 3300025918 Ga0207662_10035200 Ga0207662_100352002 245
777 3300025918 Ga0207662_10061322 Ga0207662_100613224 245
778 3300025918 Ga0207662_10126777 Ga0207662_101267771 245
779 3300025918 Ga0207662_10496766 Ga0207662_104967661 245
780 3300025920 Ga0207649_10404160 Ga0207649_104041602 245
781 3300025922 Ga0207646_10002767 Ga0207646_1000276711 245
782 3300025922 Ga0207646_10031485 Ga0207646_100314856 245
783 3300025922 Ga0207646_10053429 Ga0207646_100534292 245
784 3300025922 Ga0207646_10076116 Ga0207646_100761162 245
785 3300025922 Ga0207646_10086419 Ga0207646_100864193 245
786 3300025922 Ga0207646_10113859 Ga0207646_101138593 245
787 3300025923 Ga0207681_10009028 Ga0207681_100090285 245
788 3300025923 Ga0207681_10032351 Ga0207681_100323512 245
789 3300025925 Ga0207650_10088774 Ga0207650_100887742 245
790 3300025926 Ga0207659_10001803 Ga0207659_1000180312 245
791 3300025926 Ga0207659_10006313 Ga0207659_100063134 245
792 3300025926 Ga0207659_10192880 Ga0207659_101928802 245
793 3300025933 Ga0207706_10037703 Ga0207706_100377032 245
794 3300025933 Ga0207706_10127589 Ga0207706_101275892 245
795 3300025935 Ga0207709_10047631 Ga0207709_100476312 245
796 3300025936 Ga0207670_10020287 Ga0207670_100202872 245
797 3300025936 Ga0207670_10048755 Ga0207670_100487553 245
798 3300025936 Ga0207670_10217969 Ga0207670_102179692 245
799 3300025940 Ga0207691_10034893 Ga0207691_100348935 245
800 3300025940 Ga0207691_10185134 Ga0207691_101851342 245
801 3300025941 Ga0207711_10348799 Ga0207711_103487992 245
802 3300025942 Ga0207689_10009037 Ga0207689_100090378 245
803 3300025942 Ga0207689_10108532 Ga0207689_101085322 245
804 3300025942 Ga0207689_10271888 Ga0207689_102718881 245
805 3300025942 Ga0207689_10590901 Ga0207689_105909011 245
806 3300025945 Ga0207679_10060472 Ga0207679_100604722 245
807 3300025945 Ga0207679_10433394 Ga0207679_104333942 245
808 3300025960 Ga0207651_10029538 Ga0207651_100295384 245
809 3300025961 Ga0207712_10011075 Ga0207712_100110752 245
810 3300025972 Ga0207668_10093650 Ga0207668_100936504 245
811 3300025981 Ga0207640_10057963 Ga0207640_100579632 245
812 3300026023 Ga0207677_10069366 Ga0207677_100693662 245
813 3300026035 Ga0207703_10158634 Ga0207703_101586342 245
814 3300026067 Ga0207678_10138534 Ga0207678_101385342 245
815 3300026075 Ga0207708_10089336 Ga0207708_100893364 245
816 3300026075 Ga0207708_10173612 Ga0207708_101736123 245
817 3300026075 Ga0207708_10277495 Ga0207708_102774951 245
818 3300026088 Ga0207641_10133540 Ga0207641_101335403 245
819 3300026089 Ga0207648_10008240 Ga0207648_100082408 245
820 3300026089 Ga0207648_10025537 Ga0207648_100255376 245
821 3300026095 Ga0207676_10426937 Ga0207676_104269372 245
822 3300026095 Ga0207676_10438975 Ga0207676_104389753 245
823 3300026116 Ga0207674_10023829 Ga0207674_100238294 245
824 3300026116 Ga0207674_10266388 Ga0207674_102663883 245
825 3300026121 Ga0207683_10043064 Ga0207683_100430642 245
826 3300026121 Ga0207683_10187969 Ga0207683_101879692 245
827 3300027360 Ga0209969_1009002 Ga0209969_10090022 245
828 3300027364 Ga0209967_1000872 Ga0209967_10008725 245
829 3300027378 Ga0209981_1007501 Ga0209981_10075012 245
830 3300027462 Ga0210000_1000741 Ga0210000_10007412 245
831 3300027526 Ga0209968_1003008 Ga0209968_10030081 245
832 3300027543 Ga0209999_1002412 Ga0209999_10024125 245
833 3300027552 Ga0209982_1036167 Ga0209982_10361671 245
834 3300027682 Ga0209971_1005560 Ga0209971_10055605 245
835 3300027907 Ga0207428_10012831 Ga0207428_100128311 245
836 3300027907 Ga0207428_10027679 Ga0207428_100276795 245
837 3300027907 Ga0207428_10162354 Ga0207428_101623542 245
838 3300028380 Ga0268265_10000767 Ga0268265_100007676 245
839 3300028380 Ga0268265_10019126 Ga0268265_100191264 245
840 3300028380 Ga0268265_10217273 Ga0268265_102172734 245
841 3300028381 Ga0268264_10007456 Ga0268264_100074563 245
842 3300028381 Ga0268264_10081219 Ga0268264_100812193 245
843 3300031250 Ga0265331_10163187 Ga0265331_101631872 245
844 3300031665 Ga0316575_10005365 Ga0316575_100053652 245
845 3300032002 Ga0307416_100158914 Ga0307416_1001589142 245
846 3300034819 Ga0373958_0008548 Ga0373958_0008548_696_1436 245
847 3300035092 Ga0373952_0024498 Ga0373952_0024498_269_1009 245
848 3300035112 Ga0373932_0012249 Ga0373932_0012249_1352_2092 245
849 3300035114 Ga0373939_0072791 Ga0373939_0072791_162_902 245
850 3300035115 Ga0373941_0023506 Ga0373941_0023506_629_1369 245
851 3300035398 Ga0316574_0037598 Ga0316574_0037598_668_1411 245
852 3300035695 Ga0373927_0006739 Ga0373927_0006739_2252_2992 245
853 3300039447 Ga0436361_0238036 Ga0436361_0238036_92_835 245
854 3300041410 Ga0439461_0001622 Ga0439461_0001622_1488_2225 245
855 3300041997 Ga0439431_0019765 Ga0439431_0019765_499_1236 245
856 3300041999 Ga0439433_0026209 Ga0439433_0026209_351_1094 245
857 3300042002 Ga0439442_018400 Ga0439442_018400_303_1040 245
858 3300042003 Ga0439443_010845 Ga0439443_010845_257_1003 245
859 3300042004 Ga0439445_0012878 Ga0439445_0012878_54_791 245
860 3300042156 Ga0439446_0010573 Ga0439446_0010573_313_1056 245
861 3300042156 Ga0439446_0039897 Ga0439446_0039897_584_1321 245
862 3300042435 Ga0439434_0008237 Ga0439434_0008237_2150_2887 245
863 3300042436 Ga0439435_0004012 Ga0439435_0004012_1916_2659 245
864 3300042437 Ga0439444_0018456 Ga0439444_0018456_393_1133 245
865 3300042876 Ga0451577_0802253 Ga0451577_0802253_10_750 245
866 3300045049 Ga0466959_0454028 Ga0466959_0454028_35_784 245
867 3300045051 Ga0451576_0265773 Ga0451576_0265773_1043_1783 245
868 3300045051 Ga0451576_0507499 Ga0451576_0507499_98_838 245
869 3300045976 Ga0466967_0019154 Ga0466967_0019154_4166_4915 245
870 3300046472 Ga0495580_0068385 Ga0495580_0068385_84_881 245
871 3300046475 Ga0495639_0068411 Ga0495639_0068411_662_1459 245
872 3300046477 Ga0495664_0061600 Ga0495664_0061600_169_966 245
873 3300046491 Ga0495584_0010109 Ga0495584_0010109_224_964 245
874 3300046531 Ga0495665_0136259 Ga0495665_0136259_310_1107 245
875 3300046537 Ga0495598_0009253 Ga0495598_0009253_1362_2102 245
876 3300046538 Ga0495609_0083012 Ga0495609_0083012_267_1007 245
877 3300046539 Ga0495621_0137667 Ga0495621_0137667_53_793 245
878 3300046558 Ga0495633_0020997 Ga0495633_0020997_265_1005 245
879 3300046663 Ga0495635_0209850 Ga0495635_0209850_72_869 245
880 3300046664 Ga0495659_0028976 Ga0495659_0028976_1144_1884 245
881 3300046664 Ga0495659_0041413 Ga0495659_0041413_866_1606 245
882 3300047315 Ga0495581_0049143 Ga0495581_0049143_1539_2336 245
883 3300047318 Ga0495636_0021969 Ga0495636_0021969_396_1136 245
884 3300047318 Ga0495636_0162205 Ga0495636_0162205_10_759 245
885 3300047445 Ga0495677_0046678 Ga0495677_0046678_708_1448 245
886 3300048904 Ga0496101_0039175 Ga0496101_0039175_1499_2239 245
887 3300048905 Ga0496102_0040143 Ga0496102_0040143_1341_2081 245
888 3300048910 Ga0496107_0509159 Ga0496107_0509159_57_797 245
889 3300048911 Ga0496108_0223852 Ga0496108_0223852_44_784 245
890 3300048912 Ga0496109_0150850 Ga0496109_0150850_689_1429 245
891 3300048915 Ga0496112_0015588 Ga0496112_0015588_328_1068 245
892 3300048916 Ga0496113_0102013 Ga0496113_0102013_1104_1844 245
893 3300049568 Ga0501031_0113074 Ga0501031_0113074_821_1561 245
894 3300049569 Ga0501032_0003839 Ga0501032_0003839_9135_9887 245
895 3300049571 Ga0501034_0043619 Ga0501034_0043619_2649_3401 245
896 3300049572 Ga0501036_0005418 Ga0501036_0005418_3674_4414 245
897 3300049573 Ga0501037_0000189 Ga0501037_0000189_22604_23356 245
898 3300049573 Ga0501037_0062264 Ga0501037_0062264_721_1461 245
899 3300049574 Ga0501038_0016613 Ga0501038_0016613_1901_2653 245
900 3300049574 Ga0501038_0020455 Ga0501038_0020455_4997_5737 245
901 3300049575 Ga0501039_0008975 Ga0501039_0008975_5092_5844 245
902 3300049575 Ga0501039_0037252 Ga0501039_0037252_1460_2200 245
903 3300049576 Ga0501040_0333901 Ga0501040_0333901_90_833 245
904 3300049577 Ga0501041_0041494 Ga0501041_0041494_179_919 245
905 3300049579 Ga0501043_0001090 Ga0501043_0001090_17639_18391 245
906 3300049580 Ga0501046_0010313 Ga0501046_0010313_1435_2175 245
907 3300049582 Ga0501048_0028059 Ga0501048_0028059_1258_1998 245
908 3300049582 Ga0501048_0185976 Ga0501048_0185976_71_811 245
909 3300049584 Ga0501068_0137885 Ga0501068_0137885_213_953 245
910 3300049586 Ga0501070_0014222 Ga0501070_0014222_3554_4306 245
911 3300049587 Ga0501071_0609845 Ga0501071_0609845_40_780 245
912 3300049590 Ga0501074_0044507 Ga0501074_0044507_200_940 245
913 3300049591 Ga0501075_0008717 Ga0501075_0008717_4881_5621 245
914 3300049591 Ga0501075_0044913 Ga0501075_0044913_503_1243 245
915 3300049591 Ga0501075_0081372 Ga0501075_0081372_182_922 245
916 3300049592 Ga0501076_0054228 Ga0501076_0054228_1931_2671 245
917 3300049593 Ga0501077_0022460 Ga0501077_0022460_787_1527 245
918 3300049593 Ga0501077_0215417 Ga0501077_0215417_356_1099 245
919 3300049741 Ga0501079_0079645 Ga0501079_0079645_436_1176 245
920 3300049741 Ga0501079_0441561 Ga0501079_0441561_218_961 245
921 3300049742 Ga0501080_0207392 Ga0501080_0207392_579_1319 245
922 3300049743 Ga0501081_0064280 Ga0501081_0064280_268_1008 245
923 3300049822 Ga0501035_0052628 Ga0501035_0052628_2750_3490 245
924 3300049823 Ga0501044_0051856 Ga0501044_0051856_2527_3279 245
925 3300049824 Ga0501045_0051104 Ga0501045_0051104_1630_2370 245
926 3300049824 Ga0501045_0154947 Ga0501045_0154947_391_1131 245
927 3300050491 nmdc:mga00v17_73915_c1 nmdc:mga00v17_73915_c1_274_1023 245
928 3300050507 nmdc:mga05p37_112818_c1 nmdc:mga05p37_112818_c1_1728_2468 245
929 3300050507 nmdc:mga05p37_119344_c1 nmdc:mga05p37_119344_c1_86_826 245
930 3300050507 nmdc:mga05p37_161131_c1 nmdc:mga05p37_161131_c1_802_1542 245
931 3300050507 nmdc:mga05p37_182040_c1 nmdc:mga05p37_182040_c1_218_958 245
932 3300050507 nmdc:mga05p37_211555_c1 nmdc:mga05p37_211555_c1_439_1179 245
933 3300050507 nmdc:mga05p37_2691_c1 nmdc:mga05p37_2691_c1_18639_19379 245
934 3300050507 nmdc:mga05p37_32178_c1 nmdc:mga05p37_32178_c1_3313_4053 245
935 3300050507 nmdc:mga05p37_337421_c1 nmdc:mga05p37_337421_c1_821_1561 245
936 3300050507 nmdc:mga05p37_3604_c1 nmdc:mga05p37_3604_c1_15576_16316 245
937 3300050507 nmdc:mga05p37_47105_c1 nmdc:mga05p37_47105_c1_749_1492 245
938 3300050507 nmdc:mga05p37_51362_c1 nmdc:mga05p37_51362_c1_2166_2909 245
939 3300050507 nmdc:mga05p37_53498_c1 nmdc:mga05p37_53498_c1_28_768 245
940 3300050507 nmdc:mga05p37_568302_c1 nmdc:mga05p37_568302_c1_480_1223 245
941 3300050507 nmdc:mga05p37_980_c1 nmdc:mga05p37_980_c1_4728_5471 245
942 3300050508 nmdc:mga09592_14575_c1 nmdc:mga09592_14575_c1_117_857 245
943 3300050508 nmdc:mga09592_168532_c1 nmdc:mga09592_168532_c1_777_1517 245
944 3300050508 nmdc:mga09592_192900_c1 nmdc:mga09592_192900_c1_350_1093 245
945 3300050508 nmdc:mga09592_194768_c1 nmdc:mga09592_194768_c1_190_933 245
946 3300050508 nmdc:mga09592_218248_c1 nmdc:mga09592_218248_c1_69_812 245
947 3300050508 nmdc:mga09592_3133_c1 nmdc:mga09592_3133_c1_9933_10676 245
948 3300050508 nmdc:mga09592_42592_c1 nmdc:mga09592_42592_c1_263_1003 245
949 3300050508 nmdc:mga09592_47301_c1 nmdc:mga09592_47301_c1_1649_2389 245
950 3300050508 nmdc:mga09592_523696_c1 nmdc:mga09592_523696_c1_62_802 245
951 3300050508 nmdc:mga09592_72550_c1 nmdc:mga09592_72550_c1_2084_2824 245
952 3300050509 nmdc:mga0qj67_159172_c1 nmdc:mga0qj67_159172_c1_108_851 245
953 3300050509 nmdc:mga0qj67_1629_c1 nmdc:mga0qj67_1629_c1_14541_15281 245
954 3300050509 nmdc:mga0qj67_28940_c1 nmdc:mga0qj67_28940_c1_974_1717 245
955 3300050509 nmdc:mga0qj67_48580_c1 nmdc:mga0qj67_48580_c1_1092_1835 245
956 3300050509 nmdc:mga0qj67_55891_c1 nmdc:mga0qj67_55891_c1_1131_1871 245
957 3300050510 nmdc:mga06r32_1014_c1 nmdc:mga06r32_1014_c1_3811_4554 245
958 3300050510 nmdc:mga06r32_188605_c1 nmdc:mga06r32_188605_c1_376_1119 245
959 3300050510 nmdc:mga06r32_22024_c1 nmdc:mga06r32_22024_c1_363_1106 245
960 3300050510 nmdc:mga06r32_29046_c1 nmdc:mga06r32_29046_c1_3164_3904 245
961 3300050510 nmdc:mga06r32_328025_c1 nmdc:mga06r32_328025_c1_488_1228 245
962 3300050510 nmdc:mga06r32_53274_c1 nmdc:mga06r32_53274_c1_2758_3501 245
963 3300050510 nmdc:mga06r32_5738_c1 nmdc:mga06r32_5738_c1_10346_11086 245
964 3300050510 nmdc:mga06r32_77040_c1 nmdc:mga06r32_77040_c1_1029_1769 245
965 3300050510 nmdc:mga06r32_92770_c1 nmdc:mga06r32_92770_c1_1269_2009 245
966 3300050511 nmdc:mga08y16_148424_c1 nmdc:mga08y16_148424_c1_847_1587 245
967 3300050511 nmdc:mga08y16_1990_c1 nmdc:mga08y16_1990_c1_2991_3731 245
968 3300050511 nmdc:mga08y16_417904_c1 nmdc:mga08y16_417904_c1_345_1085 245
969 3300050511 nmdc:mga08y16_63108_c1 nmdc:mga08y16_63108_c1_754_1494 245
970 3300050512 nmdc:mga0n895_152444_c1 nmdc:mga0n895_152444_c1_1333_2073 245
971 3300050512 nmdc:mga0n895_279289_c1 nmdc:mga0n895_279289_c1_702_1445 245
972 3300050512 nmdc:mga0n895_38577_c1 nmdc:mga0n895_38577_c1_1552_2292 245
973 3300050512 nmdc:mga0n895_464915_c1 nmdc:mga0n895_464915_c1_340_1080 245
974 3300050512 nmdc:mga0n895_65033_c1 nmdc:mga0n895_65033_c1_811_1551 245
975 3300050512 nmdc:mga0n895_685889_c1 nmdc:mga0n895_685889_c1_169_912 245
976 3300050513 nmdc:mga0rr50_10189_c1 nmdc:mga0rr50_10189_c1_3381_4124 245
977 3300050513 nmdc:mga0rr50_102279_c1 nmdc:mga0rr50_102279_c1_1380_2120 245
978 3300050513 nmdc:mga0rr50_7066_c1 nmdc:mga0rr50_7066_c1_6041_6781 245
979 3300050514 nmdc:mga08x19_105758_c1 nmdc:mga08x19_105758_c1_955_1695 245
980 3300050514 nmdc:mga08x19_11403_c1 nmdc:mga08x19_11403_c1_2200_2943 245
981 3300050514 nmdc:mga08x19_14102_c1 nmdc:mga08x19_14102_c1_639_1379 245
982 3300050515 nmdc:mga0a205_114564_c1 nmdc:mga0a205_114564_c1_883_1626 245
983 3300050515 nmdc:mga0a205_12575_c1 nmdc:mga0a205_12575_c1_5963_6703 245
984 3300050515 nmdc:mga0a205_14335_c2 nmdc:mga0a205_14335_c2_256_996 245
985 3300050515 nmdc:mga0a205_15863_c1 nmdc:mga0a205_15863_c1_2950_3690 245
986 3300050515 nmdc:mga0a205_28145_c1 nmdc:mga0a205_28145_c1_1839_2579 245
987 3300050515 nmdc:mga0a205_283406_c1 nmdc:mga0a205_283406_c1_153_911 245
988 3300050515 nmdc:mga0a205_51452_c1 nmdc:mga0a205_51452_c1_2552_3292 245
989 3300050515 nmdc:mga0a205_705616_c1 nmdc:mga0a205_705616_c1_61_801 245
990 3300054114 Ga0501084_0076423 Ga0501084_0076423_736_1476 245
991 3300054114 Ga0501084_0514631 Ga0501084_0514631_94_837 245
992 3300060353 Ga0501082_0110590 Ga0501082_0110590_179_919 245
993 3300061734 Ga0530510_0002805 Ga0530510_0002805_9653_10396 245
994 3300061734 Ga0530510_0044622 Ga0530510_0044622_326_1066 245
995 3300061734 Ga0530510_0321585 Ga0530510_0321585_155_895 245
996 3300003203 JGI25406J46586_10008281 JGI25406J46586_100082814 246
997 3300003203 JGI25406J46586_10013787 JGI25406J46586_100137872 246
998 3300003203 JGI25406J46586_10041197 JGI25406J46586_100411971 246
999 3300003373 JGI25407J50210_10055027 JGI25407J50210_100550272 246
1000 3300005288 Ga0065714_10100146 Ga0065714_101001462 246
1001 3300005289 Ga0065704_10266112 Ga0065704_102661121 246
1002 3300005290 Ga0065712_10069913 Ga0065712_100699134 246
1003 3300005293 Ga0065715_10089458 Ga0065715_100894586 246
1004 3300005295 Ga0065707_10140802 Ga0065707_101408023 246
1005 3300005295 Ga0065707_10174049 Ga0065707_101740493 246
1006 3300005295 Ga0065707_10233834 Ga0065707_102338341 246
1007 3300005328 Ga0070676_10014798 Ga0070676_100147983 246
1008 3300005329 Ga0070683_100034253 Ga0070683_1000342536 246
1009 3300005329 Ga0070683_100035235 Ga0070683_1000352352 246
1010 3300005329 Ga0070683_100086957 Ga0070683_1000869574 246
1011 3300005329 Ga0070683_100193940 Ga0070683_1001939402 246
1012 3300005329 Ga0070683_100801969 Ga0070683_1008019691 246
1013 3300005330 Ga0070690_100048038 Ga0070690_1000480382 246
1014 3300005330 Ga0070690_100054679 Ga0070690_1000546792 246
1015 3300005331 Ga0070670_100006991 Ga0070670_1000069913 246
1016 3300005331 Ga0070670_100010250 Ga0070670_1000102505 246
1017 3300005331 Ga0070670_100027666 Ga0070670_1000276664 246
1018 3300005334 Ga0068869_100034559 Ga0068869_1000345592 246
1019 3300005335 Ga0070666_10024219 Ga0070666_100242195 246
1020 3300005338 Ga0068868_100020679 Ga0068868_1000206793 246
1021 3300005339 Ga0070660_100144673 Ga0070660_1001446732 246
1022 3300005340 Ga0070689_100014096 Ga0070689_1000140966 246
1023 3300005343 Ga0070687_100003460 Ga0070687_1000034603 246
1024 3300005344 Ga0070661_100047638 Ga0070661_1000476381 246
1025 3300005344 Ga0070661_100059110 Ga0070661_1000591102 246
1026 3300005347 Ga0070668_100006733 Ga0070668_1000067334 246
1027 3300005347 Ga0070668_100012784 Ga0070668_1000127842 246
1028 3300005347 Ga0070668_100368861 Ga0070668_1003688612 246
1029 3300005347 Ga0070668_100518537 Ga0070668_1005185372 246
1030 3300005353 Ga0070669_100002826 Ga0070669_1000028269 246
1031 3300005353 Ga0070669_100013613 Ga0070669_1000136132 246
1032 3300005353 Ga0070669_100043577 Ga0070669_1000435773 246
1033 3300005353 Ga0070669_100093161 Ga0070669_1000931612 246
1034 3300005354 Ga0070675_100014038 Ga0070675_1000140387 246
1035 3300005354 Ga0070675_100025228 Ga0070675_1000252283 246
1036 3300005355 Ga0070671_100049850 Ga0070671_1000498502 246
1037 3300005355 Ga0070671_100248710 Ga0070671_1002487103 246
1038 3300005355 Ga0070671_100256693 Ga0070671_1002566933 246
1039 3300005356 Ga0070674_100298199 Ga0070674_1002981992 246
1040 3300005367 Ga0070667_100009111 Ga0070667_1000091114 246
1041 3300005367 Ga0070667_100109969 Ga0070667_1001099692 246
1042 3300005434 Ga0070709_10339796 Ga0070709_103397961 246
1043 3300005434 Ga0070709_10619569 Ga0070709_106195691 246
1044 3300005435 Ga0070714_100005586 Ga0070714_1000055864 246
1045 3300005436 Ga0070713_100000605 Ga0070713_10000060510 246
1046 3300005438 Ga0070701_10001683 Ga0070701_100016834 246
1047 3300005438 Ga0070701_10009062 Ga0070701_100090626 246
1048 3300005439 Ga0070711_100003300 Ga0070711_10000330011 246
1049 3300005439 Ga0070711_100191567 Ga0070711_1001915671 246
1050 3300005440 Ga0070705_100031097 Ga0070705_1000310972 246
1051 3300005441 Ga0070700_100041068 Ga0070700_1000410685 246
1052 3300005441 Ga0070700_100064579 Ga0070700_1000645792 246
1053 3300005444 Ga0070694_100096896 Ga0070694_1000968962 246
1054 3300005444 Ga0070694_100147694 Ga0070694_1001476943 246
1055 3300005444 Ga0070694_100367354 Ga0070694_1003673541 246
1056 3300005445 Ga0070708_100000271 Ga0070708_1000002716 246
1057 3300005445 Ga0070708_100004143 Ga0070708_1000041437 246
1058 3300005445 Ga0070708_100014589 Ga0070708_1000145894 246
1059 3300005445 Ga0070708_100014715 Ga0070708_1000147158 246
1060 3300005445 Ga0070708_100014915 Ga0070708_1000149152 246
1061 3300005445 Ga0070708_100019210 Ga0070708_1000192102 246
1062 3300005445 Ga0070708_100024450 Ga0070708_1000244502 246
1063 3300005445 Ga0070708_100053857 Ga0070708_1000538572 246
1064 3300005445 Ga0070708_100069344 Ga0070708_1000693441 246
1065 3300005445 Ga0070708_100078733 Ga0070708_1000787334 246
1066 3300005445 Ga0070708_100097719 Ga0070708_1000977192 246
1067 3300005445 Ga0070708_100159890 Ga0070708_1001598903 246
1068 3300005445 Ga0070708_100214855 Ga0070708_1002148551 246
1069 3300005445 Ga0070708_100443051 Ga0070708_1004430512 246
1070 3300005445 Ga0070708_100454296 Ga0070708_1004542961 246
1071 3300005455 Ga0070663_100156246 Ga0070663_1001562462 246
1072 3300005455 Ga0070663_100161190 Ga0070663_1001611903 246
1073 3300005457 Ga0070662_100005310 Ga0070662_1000053104 246
1074 3300005457 Ga0070662_100085252 Ga0070662_1000852524 246
1075 3300005457 Ga0070662_100191158 Ga0070662_1001911582 246
1076 3300005457 Ga0070662_100510823 Ga0070662_1005108231 246
1077 3300005459 Ga0068867_100249043 Ga0068867_1002490432 246
1078 3300005466 Ga0070685_10079380 Ga0070685_100793803 246
1079 3300005467 Ga0070706_100033625 Ga0070706_1000336252 246
1080 3300005467 Ga0070706_100039738 Ga0070706_1000397383 246
1081 3300005467 Ga0070706_100075207 Ga0070706_1000752072 246
1082 3300005467 Ga0070706_100080795 Ga0070706_1000807952 246
1083 3300005467 Ga0070706_100086093 Ga0070706_1000860933 246
1084 3300005467 Ga0070706_100090556 Ga0070706_1000905562 246
1085 3300005467 Ga0070706_100109090 Ga0070706_1001090903 246
1086 3300005467 Ga0070706_100129256 Ga0070706_1001292564 246
1087 3300005467 Ga0070706_100153270 Ga0070706_1001532702 246
1088 3300005467 Ga0070706_100159428 Ga0070706_1001594282 246
1089 3300005467 Ga0070706_100195865 Ga0070706_1001958652 246
1090 3300005467 Ga0070706_100309063 Ga0070706_1003090632 246
1091 3300005467 Ga0070706_100471557 Ga0070706_1004715572 246
1092 3300005468 Ga0070707_100000561 Ga0070707_10000056123 246
1093 3300005468 Ga0070707_100002097 Ga0070707_10000209715 246
1094 3300005468 Ga0070707_100005665 Ga0070707_1000056655 246
1095 3300005468 Ga0070707_100015581 Ga0070707_1000155816 246
1096 3300005468 Ga0070707_100017537 Ga0070707_1000175373 246
1097 3300005468 Ga0070707_100022162 Ga0070707_1000221622 246
1098 3300005468 Ga0070707_100025413 Ga0070707_1000254132 246
1099 3300005468 Ga0070707_100048491 Ga0070707_1000484914 246
1100 3300005468 Ga0070707_100059758 Ga0070707_1000597582 246
1101 3300005468 Ga0070707_100071471 Ga0070707_1000714712 246
1102 3300005468 Ga0070707_100195775 Ga0070707_1001957753 246
1103 3300005468 Ga0070707_100208476 Ga0070707_1002084763 246
1104 3300005468 Ga0070707_100219862 Ga0070707_1002198623 246
1105 3300005468 Ga0070707_100232953 Ga0070707_1002329532 246
1106 3300005468 Ga0070707_100243786 Ga0070707_1002437863 246
1107 3300005468 Ga0070707_100371473 Ga0070707_1003714732 246
1108 3300005468 Ga0070707_100437359 Ga0070707_1004373592 246
1109 3300005468 Ga0070707_100657884 Ga0070707_1006578842 246
1110 3300005471 Ga0070698_100005186 Ga0070698_1000051861 246
1111 3300005471 Ga0070698_100056226 Ga0070698_1000562265 246
1112 3300005471 Ga0070698_100066812 Ga0070698_1000668122 246
1113 3300005471 Ga0070698_100112963 Ga0070698_1001129631 246
1114 3300005471 Ga0070698_100125676 Ga0070698_1001256762 246
1115 3300005471 Ga0070698_100126044 Ga0070698_1001260444 246
1116 3300005471 Ga0070698_100293557 Ga0070698_1002935572 246
1117 3300005518 Ga0070699_100024912 Ga0070699_1000249125 246
1118 3300005518 Ga0070699_100029727 Ga0070699_1000297274 246
1119 3300005518 Ga0070699_100094019 Ga0070699_1000940192 246
1120 3300005518 Ga0070699_100105998 Ga0070699_1001059982 246
1121 3300005518 Ga0070699_100131132 Ga0070699_1001311323 246
1122 3300005518 Ga0070699_100134084 Ga0070699_1001340842 246
1123 3300005518 Ga0070699_100387881 Ga0070699_1003878812 246
1124 3300005518 Ga0070699_100400623 Ga0070699_1004006232 246
1125 3300005535 Ga0070684_100004503 Ga0070684_10000450310 246
1126 3300005535 Ga0070684_100034910 Ga0070684_1000349104 246
1127 3300005535 Ga0070684_100038444 Ga0070684_1000384442 246
1128 3300005535 Ga0070684_100358881 Ga0070684_1003588812 246
1129 3300005536 Ga0070697_100020988 Ga0070697_1000209886 246
1130 3300005536 Ga0070697_100023502 Ga0070697_1000235022 246
1131 3300005536 Ga0070697_100040579 Ga0070697_1000405792 246
1132 3300005536 Ga0070697_100045077 Ga0070697_1000450772 246
1133 3300005536 Ga0070697_100105371 Ga0070697_1001053712 246
1134 3300005536 Ga0070697_100122756 Ga0070697_1001227562 246
1135 3300005536 Ga0070697_100164015 Ga0070697_1001640152 246
1136 3300005536 Ga0070697_100173200 Ga0070697_1001732002 246
1137 3300005536 Ga0070697_100257719 Ga0070697_1002577192 246
1138 3300005536 Ga0070697_100768933 Ga0070697_1007689331 246
1139 3300005539 Ga0068853_100007035 Ga0068853_1000070358 246
1140 3300005543 Ga0070672_100016504 Ga0070672_1000165043 246
1141 3300005543 Ga0070672_100025350 Ga0070672_1000253504 246
1142 3300005544 Ga0070686_100261013 Ga0070686_1002610132 246
1143 3300005545 Ga0070695_100197894 Ga0070695_1001978942 246
1144 3300005545 Ga0070695_100333606 Ga0070695_1003336062 246
1145 3300005546 Ga0070696_100024924 Ga0070696_1000249245 246
1146 3300005546 Ga0070696_100235450 Ga0070696_1002354502 246
1147 3300005548 Ga0070665_100402375 Ga0070665_1004023752 246
1148 3300005549 Ga0070704_100127661 Ga0070704_1001276613 246
1149 3300005563 Ga0068855_100559086 Ga0068855_1005590862 246
1150 3300005564 Ga0070664_100017131 Ga0070664_1000171312 246
1151 3300005564 Ga0070664_100038318 Ga0070664_1000383184 246
1152 3300005564 Ga0070664_100172266 Ga0070664_1001722662 246
1153 3300005577 Ga0068857_100014484 Ga0068857_1000144849 246
1154 3300005577 Ga0068857_100083638 Ga0068857_1000836382 246
1155 3300005577 Ga0068857_100379247 Ga0068857_1003792472 246
1156 3300005577 Ga0068857_100647812 Ga0068857_1006478122 246
1157 3300005614 Ga0068856_100002182 Ga0068856_10000218211 246
1158 3300005614 Ga0068856_100213537 Ga0068856_1002135372 246
1159 3300005615 Ga0070702_100001770 Ga0070702_1000017707 246
1160 3300005615 Ga0070702_100187386 Ga0070702_1001873862 246
1161 3300005615 Ga0070702_100234665 Ga0070702_1002346651 246
1162 3300005616 Ga0068852_100286152 Ga0068852_1002861522 246
1163 3300005617 Ga0068859_100032628 Ga0068859_1000326285 246
1164 3300005617 Ga0068859_100177118 Ga0068859_1001771182 246
1165 3300005617 Ga0068859_100255757 Ga0068859_1002557571 246
1166 3300005618 Ga0068864_100002153 Ga0068864_1000021534 246
1167 3300005618 Ga0068864_100379613 Ga0068864_1003796132 246
1168 3300005718 Ga0068866_10045017 Ga0068866_100450172 246
1169 3300005718 Ga0068866_10124801 Ga0068866_101248012 246
1170 3300005719 Ga0068861_100004172 Ga0068861_1000041727 246
1171 3300005840 Ga0068870_10009111 Ga0068870_100091117 246
1172 3300005840 Ga0068870_10118420 Ga0068870_101184202 246
1173 3300005840 Ga0068870_10159185 Ga0068870_101591852 246
1174 3300005841 Ga0068863_100074444 Ga0068863_1000744444 246
1175 3300005841 Ga0068863_100420346 Ga0068863_1004203462 246
1176 3300005841 Ga0068863_100423778 Ga0068863_1004237783 246
1177 3300005842 Ga0068858_100013286 Ga0068858_1000132862 246
1178 3300005842 Ga0068858_100197737 Ga0068858_1001977373 246
1179 3300005843 Ga0068860_100047726 Ga0068860_1000477264 246
1180 3300005843 Ga0068860_100588625 Ga0068860_1005886252 246
1181 3300005844 Ga0068862_100003736 Ga0068862_1000037369 246
1182 3300005844 Ga0068862_100031803 Ga0068862_1000318034 246
1183 3300005844 Ga0068862_100114304 Ga0068862_1001143044 246
1184 3300005937 Ga0081455_10026852 Ga0081455_100268525 246
1185 3300005937 Ga0081455_10058940 Ga0081455_100589402 246
1186 3300005937 Ga0081455_10068856 Ga0081455_100688565 246
1187 3300005981 Ga0081538_10001519 Ga0081538_100015198 246
1188 3300005981 Ga0081538_10017184 Ga0081538_100171845 246
1189 3300005981 Ga0081538_10021239 Ga0081538_100212393 246
1190 3300005981 Ga0081538_10025235 Ga0081538_100252353 246
1191 3300005981 Ga0081538_10125338 Ga0081538_101253382 246
1192 3300005983 Ga0081540_1002404 Ga0081540_100240412 246
1193 3300005983 Ga0081540_1048898 Ga0081540_10488982 246
1194 3300005983 Ga0081540_1067717 Ga0081540_10677172 246
1195 3300005983 Ga0081540_1085559 Ga0081540_10855592 246
1196 3300005985 Ga0081539_10000661 Ga0081539_1000066130 246
1197 3300005985 Ga0081539_10001109 Ga0081539_1000110931 246
1198 3300005985 Ga0081539_10005512 Ga0081539_100055126 246
1199 3300005985 Ga0081539_10012499 Ga0081539_100124995 246
1200 3300005985 Ga0081539_10043657 Ga0081539_100436573 246
1201 3300005985 Ga0081539_10056670 Ga0081539_100566704 246
1202 3300005985 Ga0081539_10071202 Ga0081539_100712022 246
1203 3300006028 Ga0070717_10000455 Ga0070717_1000045513 246
1204 3300006028 Ga0070717_10004710 Ga0070717_1000471014 246
1205 3300006028 Ga0070717_10019190 Ga0070717_100191903 246
1206 3300006028 Ga0070717_10322195 Ga0070717_103221952 246
1207 3300006028 Ga0070717_10342567 Ga0070717_103425672 246
1208 3300006175 Ga0070712_100043532 Ga0070712_1000435322 246
1209 3300006175 Ga0070712_100105520 Ga0070712_1001055204 246
1210 3300006195 Ga0075366_10083875 Ga0075366_100838752 246
1211 3300006237 Ga0097621_100345089 Ga0097621_1003450892 246
1212 3300006237 Ga0097621_100636857 Ga0097621_1006368572 246
1213 3300006358 Ga0068871_100273256 Ga0068871_1002732563 246
1214 3300006844 Ga0075428_100004057 Ga0075428_10000405713 246
1215 3300006844 Ga0075428_100004979 Ga0075428_1000049792 246
1216 3300006844 Ga0075428_100005945 Ga0075428_1000059458 246
1217 3300006844 Ga0075428_100020165 Ga0075428_1000201657 246
1218 3300006844 Ga0075428_100030809 Ga0075428_1000308092 246
1219 3300006844 Ga0075428_100110686 Ga0075428_1001106864 246
1220 3300006844 Ga0075428_100196055 Ga0075428_1001960552 246
1221 3300006844 Ga0075428_100208825 Ga0075428_1002088252 246
1222 3300006844 Ga0075428_100449133 Ga0075428_1004491332 246
1223 3300006844 Ga0075428_100469036 Ga0075428_1004690361 246
1224 3300006844 Ga0075428_100472117 Ga0075428_1004721172 246
1225 3300006846 Ga0075430_100009788 Ga0075430_1000097889 246
1226 3300006846 Ga0075430_100015860 Ga0075430_1000158607 246
1227 3300006846 Ga0075430_100016591 Ga0075430_1000165915 246
1228 3300006846 Ga0075430_100019558 Ga0075430_1000195584 246
1229 3300006846 Ga0075430_100019595 Ga0075430_1000195953 246
1230 3300006846 Ga0075430_100027885 Ga0075430_1000278856 246
1231 3300006846 Ga0075430_100033393 Ga0075430_1000333932 246
1232 3300006846 Ga0075430_100035876 Ga0075430_1000358765 246
1233 3300006846 Ga0075430_100341442 Ga0075430_1003414422 246
1234 3300006847 Ga0075431_100002302 Ga0075431_10000230211 246
1235 3300006847 Ga0075431_100008223 Ga0075431_1000082235 246
1236 3300006847 Ga0075431_100016368 Ga0075431_1000163687 246
1237 3300006847 Ga0075431_100022587 Ga0075431_1000225874 246
1238 3300006847 Ga0075431_100043250 Ga0075431_1000432504 246
1239 3300006847 Ga0075431_100069085 Ga0075431_1000690854 246
1240 3300006847 Ga0075431_100074281 Ga0075431_1000742813 246
1241 3300006847 Ga0075431_100104748 Ga0075431_1001047484 246
1242 3300006847 Ga0075431_100192008 Ga0075431_1001920082 246
1243 3300006847 Ga0075431_100216808 Ga0075431_1002168082 246
1244 3300006847 Ga0075431_100229350 Ga0075431_1002293502 246
1245 3300006847 Ga0075431_100236249 Ga0075431_1002362493 246
1246 3300006847 Ga0075431_100290843 Ga0075431_1002908432 246
1247 3300006852 Ga0075433_10004697 Ga0075433_100046978 246
1248 3300006852 Ga0075433_10006409 Ga0075433_100064097 246
1249 3300006852 Ga0075433_10024132 Ga0075433_100241325 246
1250 3300006852 Ga0075433_10048992 Ga0075433_100489922 246
1251 3300006852 Ga0075433_10052614 Ga0075433_100526143 246
1252 3300006852 Ga0075433_10060745 Ga0075433_100607457 246
1253 3300006852 Ga0075433_10090919 Ga0075433_100909194 246
1254 3300006852 Ga0075433_10275182 Ga0075433_102751822 246
1255 3300006852 Ga0075433_10287315 Ga0075433_102873152 246
1256 3300006871 Ga0075434_100007992 Ga0075434_10000799210 246
1257 3300006871 Ga0075434_100019500 Ga0075434_1000195004 246
1258 3300006871 Ga0075434_100032985 Ga0075434_1000329854 246
1259 3300006871 Ga0075434_100036602 Ga0075434_1000366024 246
1260 3300006871 Ga0075434_100039325 Ga0075434_1000393252 246
1261 3300006871 Ga0075434_100118683 Ga0075434_1001186832 246
1262 3300006871 Ga0075434_100147708 Ga0075434_1001477082 246
1263 3300006871 Ga0075434_100167568 Ga0075434_1001675682 246
1264 3300006871 Ga0075434_100744964 Ga0075434_1007449642 246
1265 3300006880 Ga0075429_100001630 Ga0075429_10000163011 246
1266 3300006880 Ga0075429_100008200 Ga0075429_1000082007 246
1267 3300006880 Ga0075429_100025841 Ga0075429_1000258414 246
1268 3300006880 Ga0075429_100032280 Ga0075429_1000322804 246
1269 3300006880 Ga0075429_100051809 Ga0075429_1000518094 246
1270 3300006880 Ga0075429_100125977 Ga0075429_1001259772 246
1271 3300006880 Ga0075429_100136642 Ga0075429_1001366422 246
1272 3300006880 Ga0075429_100253861 Ga0075429_1002538613 246
1273 3300006880 Ga0075429_100372263 Ga0075429_1003722632 246
1274 3300006880 Ga0075429_100654144 Ga0075429_1006541442 246
1275 3300006881 Ga0068865_100396643 Ga0068865_1003966432 246
1276 3300006914 Ga0075436_100011097 Ga0075436_1000110976 246
1277 3300006914 Ga0075436_100011395 Ga0075436_10001139510 246
1278 3300006931 Ga0097620_100032630 Ga0097620_1000326305 246
1279 3300006931 Ga0097620_100177111 Ga0097620_1001771112 246
1280 3300006931 Ga0097620_100255770 Ga0097620_1002557701 246
1281 3300007076 Ga0075435_100002839 Ga0075435_1000028394 246
1282 3300007076 Ga0075435_100008343 Ga0075435_1000083434 246
1283 3300007076 Ga0075435_100174000 Ga0075435_1001740001 246
1284 3300007265 Ga0099794_10001438 Ga0099794_100014385 246
1285 3300007265 Ga0099794_10001892 Ga0099794_100018922 246
1286 3300007265 Ga0099794_10014370 Ga0099794_100143705 246
1287 3300007265 Ga0099794_10028151 Ga0099794_100281513 246
1288 3300007265 Ga0099794_10040249 Ga0099794_100402493 246
1289 3300007265 Ga0099794_10112145 Ga0099794_101121452 246
1290 3300007265 Ga0099794_10182848 Ga0099794_101828482 246
1291 3300009094 Ga0111539_10033335 Ga0111539_100333357 246
1292 3300009094 Ga0111539_10049129 Ga0111539_100491296 246
1293 3300009094 Ga0111539_10073734 Ga0111539_100737346 246
1294 3300009094 Ga0111539_10193113 Ga0111539_101931132 246
1295 3300009094 Ga0111539_10294627 Ga0111539_102946271 246
1296 3300009094 Ga0111539_10437985 Ga0111539_104379852 246
1297 3300009094 Ga0111539_11066035 Ga0111539_110660352 246
1298 3300009098 Ga0105245_10012084 Ga0105245_100120843 246
1299 3300009098 Ga0105245_10091412 Ga0105245_100914122 246
1300 3300009098 Ga0105245_10501335 Ga0105245_105013351 246
1301 3300009101 Ga0105247_10015245 Ga0105247_100152454 246
1302 3300009147 Ga0114129_10000606 Ga0114129_1000060617 246
1303 3300009147 Ga0114129_10001858 Ga0114129_1000185821 246
1304 3300009147 Ga0114129_10008856 Ga0114129_100088568 246
1305 3300009147 Ga0114129_10009242 Ga0114129_100092428 246
1306 3300009147 Ga0114129_10014509 Ga0114129_100145096 246
1307 3300009147 Ga0114129_10032990 Ga0114129_100329908 246
1308 3300009147 Ga0114129_10033854 Ga0114129_100338544 246
1309 3300009147 Ga0114129_10050829 Ga0114129_100508293 246
1310 3300009147 Ga0114129_10063274 Ga0114129_100632746 246
1311 3300009147 Ga0114129_10068040 Ga0114129_100680404 246
1312 3300009147 Ga0114129_10078210 Ga0114129_100782103 246
1313 3300009147 Ga0114129_10095112 Ga0114129_100951124 246
1314 3300009147 Ga0114129_10148624 Ga0114129_101486242 246
1315 3300009147 Ga0114129_10151564 Ga0114129_101515642 246
1316 3300009147 Ga0114129_10160235 Ga0114129_101602352 246
1317 3300009147 Ga0114129_10197829 Ga0114129_101978294 246
1318 3300009147 Ga0114129_10207838 Ga0114129_102078382 246
1319 3300009147 Ga0114129_10231637 Ga0114129_102316372 246
1320 3300009147 Ga0114129_10256706 Ga0114129_102567062 246
1321 3300009147 Ga0114129_10277122 Ga0114129_102771222 246
1322 3300009147 Ga0114129_10317493 Ga0114129_103174934 246
1323 3300009147 Ga0114129_10426595 Ga0114129_104265952 246
1324 3300009147 Ga0114129_10458775 Ga0114129_104587752 246
1325 3300009147 Ga0114129_10514016 Ga0114129_105140162 246
1326 3300009147 Ga0114129_10631639 Ga0114129_106316391 246
1327 3300009147 Ga0114129_10686357 Ga0114129_106863572 246
1328 3300009147 Ga0114129_10686808 Ga0114129_106868082 246
1329 3300009147 Ga0114129_10726586 Ga0114129_107265862 246
1330 3300009147 Ga0114129_11225878 Ga0114129_112258781 246
1331 3300009147 Ga0114129_11313267 Ga0114129_113132671 246
1332 3300009148 Ga0105243_10215740 Ga0105243_102157402 246
1333 3300009176 Ga0105242_10326886 Ga0105242_103268861 246
1334 3300009177 Ga0105248_10136159 Ga0105248_101361593 246
1335 3300009177 Ga0105248_10230881 Ga0105248_102308811 246
1336 3300009177 Ga0105248_10243366 Ga0105248_102433664 246
1337 3300009551 Ga0105238_10855443 Ga0105238_108554432 246
1338 3300009551 Ga0105238_10862891 Ga0105238_108628912 246
1339 3300009553 Ga0105249_10011729 Ga0105249_100117294 246
1340 3300009553 Ga0105249_10061604 Ga0105249_100616043 246
1341 3300009553 Ga0105249_10103667 Ga0105249_101036672 246
1342 3300009553 Ga0105249_10160450 Ga0105249_101604504 246
1343 3300009553 Ga0105249_10213859 Ga0105249_102138594 246
1344 3300009553 Ga0105249_10703950 Ga0105249_107039501 246
1345 3300010375 Ga0105239_10044786 Ga0105239_100447863 246
1346 3300010375 Ga0105239_10675803 Ga0105239_106758032 246
1347 3300013102 Ga0157371_10009856 Ga0157371_100098567 246
1348 3300013105 Ga0157369_10035233 Ga0157369_100352336 246
1349 3300013296 Ga0157374_10161957 Ga0157374_101619574 246
1350 3300013306 Ga0163162_10059786 Ga0163162_100597867 246
1351 3300013306 Ga0163162_10087881 Ga0163162_100878812 246
1352 3300013306 Ga0163162_10643029 Ga0163162_106430292 246
1353 3300013308 Ga0157375_10005887 Ga0157375_100058872 246
1354 3300013308 Ga0157375_10146685 Ga0157375_101466854 246
1355 3300013308 Ga0157375_10389009 Ga0157375_103890092 246
1356 3300014325 Ga0163163_10033194 Ga0163163_100331944 246
1357 3300014325 Ga0163163_10162779 Ga0163163_101627792 246
1358 3300014325 Ga0163163_10783301 Ga0163163_107833012 246
1359 3300014326 Ga0157380_10010539 Ga0157380_100105397 246
1360 3300014326 Ga0157380_10219941 Ga0157380_102199412 246
1361 3300014326 Ga0157380_10405210 Ga0157380_104052102 246
1362 3300014326 Ga0157380_11028960 Ga0157380_110289601 246
1363 3300014745 Ga0157377_10412956 Ga0157377_104129561 246
1364 3300014968 Ga0157379_10007523 Ga0157379_100075238 246
1365 3300015262 Ga0182007_10063031 Ga0182007_100630312 246
1366 3300017792 Ga0163161_10026034 Ga0163161_100260345 246
1367 3300017792 Ga0163161_10143889 Ga0163161_101438892 246
1368 3300017792 Ga0163161_10370466 Ga0163161_103704661 246
1369 3300020070 Ga0206356_10378591 Ga0206356_103785914 246
1370 3300020075 Ga0206349_1150188 Ga0206349_11501886 246
1371 3300020077 Ga0206351_10878113 Ga0206351_108781132 246
1372 3300020080 Ga0206350_10461530 Ga0206350_104615306 246
1373 3300020080 Ga0206350_10558755 Ga0206350_105587552 246
1374 3300021361 Ga0213872_10001214 Ga0213872_1000121411 246
1375 3300022467 Ga0224712_10005506 Ga0224712_100055064 246
1376 3300025315 Ga0207697_10033864 Ga0207697_100338642 246
1377 3300025315 Ga0207697_10070647 Ga0207697_100706473 246
1378 3300025903 Ga0207680_10114424 Ga0207680_101144242 246
1379 3300025906 Ga0207699_10000062 Ga0207699_1000006230 246
1380 3300025906 Ga0207699_10152748 Ga0207699_101527482 246
1381 3300025907 Ga0207645_10018622 Ga0207645_100186223 246
1382 3300025908 Ga0207643_10010456 Ga0207643_100104562 246
1383 3300025908 Ga0207643_10126811 Ga0207643_101268112 246
1384 3300025910 Ga0207684_10005238 Ga0207684_1000523820 246
1385 3300025910 Ga0207684_10009330 Ga0207684_100093303 246
1386 3300025910 Ga0207684_10010788 Ga0207684_100107888 246
1387 3300025910 Ga0207684_10040727 Ga0207684_100407274 246
1388 3300025910 Ga0207684_10064221 Ga0207684_100642212 246
1389 3300025910 Ga0207684_10064718 Ga0207684_100647182 246
1390 3300025910 Ga0207684_10079239 Ga0207684_100792392 246
1391 3300025910 Ga0207684_10084274 Ga0207684_100842742 246
1392 3300025910 Ga0207684_10092069 Ga0207684_100920692 246
1393 3300025910 Ga0207684_10109271 Ga0207684_101092712 246
1394 3300025910 Ga0207684_10140010 Ga0207684_101400104 246
1395 3300025910 Ga0207684_10269495 Ga0207684_102694952 246
1396 3300025910 Ga0207684_10331381 Ga0207684_103313812 246
1397 3300025910 Ga0207684_10465576 Ga0207684_104655762 246
1398 3300025915 Ga0207693_10031243 Ga0207693_100312432 246
1399 3300025915 Ga0207693_10106582 Ga0207693_101065824 246
1400 3300025916 Ga0207663_10029273 Ga0207663_100292733 246
1401 3300025916 Ga0207663_10148615 Ga0207663_101486153 246
1402 3300025918 Ga0207662_10002157 Ga0207662_100021575 246
1403 3300025918 Ga0207662_10424937 Ga0207662_104249372 246
1404 3300025920 Ga0207649_10042608 Ga0207649_100426082 246
1405 3300025920 Ga0207649_10408206 Ga0207649_104082062 246
1406 3300025920 Ga0207649_10487079 Ga0207649_104870792 246
1407 3300025922 Ga0207646_10000267 Ga0207646_1000026723 246
1408 3300025922 Ga0207646_10000519 Ga0207646_100005194 246
1409 3300025922 Ga0207646_10000959 Ga0207646_1000095922 246
1410 3300025922 Ga0207646_10002046 Ga0207646_1000204623 246
1411 3300025922 Ga0207646_10002126 Ga0207646_100021267 246
1412 3300025922 Ga0207646_10014285 Ga0207646_100142854 246
1413 3300025922 Ga0207646_10017806 Ga0207646_100178068 246
1414 3300025922 Ga0207646_10022169 Ga0207646_100221696 246
1415 3300025922 Ga0207646_10032828 Ga0207646_100328284 246
1416 3300025922 Ga0207646_10051096 Ga0207646_100510962 246
1417 3300025922 Ga0207646_10066051 Ga0207646_100660511 246
1418 3300025922 Ga0207646_10079076 Ga0207646_100790764 246
1419 3300025922 Ga0207646_10085502 Ga0207646_100855022 246
1420 3300025922 Ga0207646_10089728 Ga0207646_100897283 246
1421 3300025922 Ga0207646_10091134 Ga0207646_100911342 246
1422 3300025922 Ga0207646_10096453 Ga0207646_100964534 246
1423 3300025922 Ga0207646_10102471 Ga0207646_101024713 246
1424 3300025922 Ga0207646_10128138 Ga0207646_101281381 246
1425 3300025922 Ga0207646_10174374 Ga0207646_101743743 246
1426 3300025922 Ga0207646_10237737 Ga0207646_102377372 246
1427 3300025923 Ga0207681_10012394 Ga0207681_100123945 246
1428 3300025923 Ga0207681_10040254 Ga0207681_100402542 246
1429 3300025923 Ga0207681_10090069 Ga0207681_100900692 246
1430 3300025923 Ga0207681_10165821 Ga0207681_101658212 246
1431 3300025925 Ga0207650_10042254 Ga0207650_100422542 246
1432 3300025926 Ga0207659_10016712 Ga0207659_100167123 246
1433 3300025926 Ga0207659_10039418 Ga0207659_100394183 246
1434 3300025926 Ga0207659_10168875 Ga0207659_101688752 246
1435 3300025927 Ga0207687_10092851 Ga0207687_100928512 246
1436 3300025928 Ga0207700_10003852 Ga0207700_1000385211 246
1437 3300025928 Ga0207700_10027193 Ga0207700_100271934 246
1438 3300025929 Ga0207664_10011171 Ga0207664_100111714 246
1439 3300025929 Ga0207664_10018041 Ga0207664_100180415 246
1440 3300025929 Ga0207664_10118135 Ga0207664_101181352 246
1441 3300025929 Ga0207664_10179323 Ga0207664_101793232 246
1442 3300025931 Ga0207644_10206907 Ga0207644_102069072 246
1443 3300025931 Ga0207644_10221683 Ga0207644_102216832 246
1444 3300025931 Ga0207644_10452171 Ga0207644_104521712 246
1445 3300025933 Ga0207706_10001923 Ga0207706_1000192314 246
1446 3300025933 Ga0207706_10081865 Ga0207706_100818654 246
1447 3300025933 Ga0207706_10117429 Ga0207706_101174292 246
1448 3300025933 Ga0207706_10188276 Ga0207706_101882762 246
1449 3300025933 Ga0207706_10232069 Ga0207706_102320692 246
1450 3300025934 Ga0207686_10051912 Ga0207686_100519122 246
1451 3300025935 Ga0207709_10017550 Ga0207709_100175503 246
1452 3300025938 Ga0207704_10072620 Ga0207704_100726202 246
1453 3300025938 Ga0207704_10149065 Ga0207704_101490653 246
1454 3300025938 Ga0207704_10274540 Ga0207704_102745402 246
1455 3300025940 Ga0207691_10010420 Ga0207691_100104206 246
1456 3300025940 Ga0207691_10029048 Ga0207691_100290485 246
1457 3300025940 Ga0207691_10395064 Ga0207691_103950642 246
1458 3300025941 Ga0207711_10047316 Ga0207711_100473163 246
1459 3300025942 Ga0207689_10005477 Ga0207689_100054772 246
1460 3300025944 Ga0207661_10027915 Ga0207661_100279153 246
1461 3300025944 Ga0207661_10039060 Ga0207661_100390605 246
1462 3300025945 Ga0207679_10012633 Ga0207679_100126336 246
1463 3300025945 Ga0207679_10028161 Ga0207679_100281613 246
1464 3300025945 Ga0207679_10276131 Ga0207679_102761312 246
1465 3300025960 Ga0207651_10714882 Ga0207651_107148821 246
1466 3300025960 Ga0207651_10740975 Ga0207651_107409751 246
1467 3300025961 Ga0207712_10014239 Ga0207712_100142392 246
1468 3300025961 Ga0207712_10031388 Ga0207712_100313885 246
1469 3300025961 Ga0207712_10272426 Ga0207712_102724262 246
1470 3300025961 Ga0207712_10289158 Ga0207712_102891582 246
1471 3300025961 Ga0207712_10579031 Ga0207712_105790311 246
1472 3300025961 Ga0207712_10596016 Ga0207712_105960162 246
1473 3300025972 Ga0207668_10044270 Ga0207668_100442703 246
1474 3300025972 Ga0207668_10052923 Ga0207668_100529233 246
1475 3300025972 Ga0207668_10196720 Ga0207668_101967202 246
1476 3300025972 Ga0207668_10381134 Ga0207668_103811342 246
1477 3300025986 Ga0207658_10055101 Ga0207658_100551012 246
1478 3300025986 Ga0207658_10208320 Ga0207658_102083203 246
1479 3300026041 Ga0207639_10041104 Ga0207639_100411044 246
1480 3300026067 Ga0207678_10017242 Ga0207678_100172425 246
1481 3300026067 Ga0207678_10086790 Ga0207678_100867904 246
1482 3300026075 Ga0207708_10014463 Ga0207708_100144634 246
1483 3300026075 Ga0207708_10111171 Ga0207708_101111711 246
1484 3300026078 Ga0207702_10004855 Ga0207702_1000485511 246
1485 3300026078 Ga0207702_10072367 Ga0207702_100723673 246
1486 3300026088 Ga0207641_10017426 Ga0207641_100174263 246
1487 3300026088 Ga0207641_10040123 Ga0207641_100401233 246
1488 3300026088 Ga0207641_10087773 Ga0207641_100877732 246
1489 3300026088 Ga0207641_10384289 Ga0207641_103842892 246
1490 3300026088 Ga0207641_10631896 Ga0207641_106318962 246
1491 3300026088 Ga0207641_10715421 Ga0207641_107154212 246
1492 3300026089 Ga0207648_10190229 Ga0207648_101902292 246
1493 3300026089 Ga0207648_10295453 Ga0207648_102954532 246
1494 3300026095 Ga0207676_10008005 Ga0207676_100080054 246
1495 3300026095 Ga0207676_10244117 Ga0207676_102441172 246
1496 3300026116 Ga0207674_10015431 Ga0207674_100154319 246
1497 3300026116 Ga0207674_10077473 Ga0207674_100774732 246
1498 3300026118 Ga0207675_100010076 Ga0207675_1000100765 246
1499 3300026118 Ga0207675_100050995 Ga0207675_1000509952 246
1500 3300026118 Ga0207675_100392377 Ga0207675_1003923771 246
1501 3300026121 Ga0207683_10092889 Ga0207683_100928893 246
1502 3300026142 Ga0207698_10485291 Ga0207698_104852912 246
1503 3300027671 Ga0209588_1002516 Ga0209588_10025165 246
1504 3300027671 Ga0209588_1003797 Ga0209588_10037974 246
1505 3300027671 Ga0209588_1027486 Ga0209588_10274862 246
1506 3300027907 Ga0207428_10000839 Ga0207428_1000083928 246
1507 3300027907 Ga0207428_10020337 Ga0207428_100203374 246
1508 3300027907 Ga0207428_10086155 Ga0207428_100861554 246
1509 3300027907 Ga0207428_10314828 Ga0207428_103148282 246
1510 3300028379 Ga0268266_10073101 Ga0268266_100731012 246
1511 3300028380 Ga0268265_10002690 Ga0268265_100026909 246
1512 3300028380 Ga0268265_10077660 Ga0268265_100776602 246
1513 3300028380 Ga0268265_10100075 Ga0268265_101000753 246
1514 3300028381 Ga0268264_10052000 Ga0268264_100520002 246
1515 3300028381 Ga0268264_10635594 Ga0268264_106355942 246
1516 3300028794 Ga0307515_10001186 Ga0307515_1000118611 246
1517 3300031548 Ga0307408_100023491 Ga0307408_1000234914 246
1518 3300031548 Ga0307408_100051979 Ga0307408_1000519793 246
1519 3300031548 Ga0307408_100067271 Ga0307408_1000672712 246
1520 3300031548 Ga0307408_100226196 Ga0307408_1002261962 246
1521 3300031548 Ga0307408_100622834 Ga0307408_1006228341 246
1522 3300031730 Ga0307516_10012394 Ga0307516_100123947 246
1523 3300031730 Ga0307516_10026185 Ga0307516_100261852 246
1524 3300031730 Ga0307516_10061606 Ga0307516_100616065 246
1525 3300031731 Ga0307405_10000417 Ga0307405_100004177 246
1526 3300031824 Ga0307413_10068632 Ga0307413_100686322 246
1527 3300031852 Ga0307410_10001092 Ga0307410_1000109210 246
1528 3300031852 Ga0307410_10129850 Ga0307410_101298502 246
1529 3300031889 Ga0326468_10000259 Ga0326468_100002594 246
1530 3300031901 Ga0307406_10000678 Ga0307406_100006789 246
1531 3300031901 Ga0307406_10003705 Ga0307406_100037056 246
1532 3300031901 Ga0307406_10051427 Ga0307406_100514272 246
1533 3300031903 Ga0307407_10000248 Ga0307407_100002489 246
1534 3300031903 Ga0307407_10106323 Ga0307407_101063232 246
1535 3300031903 Ga0307407_10245230 Ga0307407_102452302 246
1536 3300031903 Ga0307407_10288777 Ga0307407_102887772 246
1537 3300031911 Ga0307412_10009390 Ga0307412_100093903 246
1538 3300031911 Ga0307412_10481452 Ga0307412_104814522 246
1539 3300031995 Ga0307409_100000937 Ga0307409_1000009372 246
1540 3300031995 Ga0307409_100183224 Ga0307409_1001832242 246
1541 3300031995 Ga0307409_100211465 Ga0307409_1002114652 246
1542 3300031995 Ga0307409_100319672 Ga0307409_1003196721 246
1543 3300031995 Ga0307409_100494796 Ga0307409_1004947961 246
1544 3300032002 Ga0307416_100000616 Ga0307416_10000061619 246
1545 3300032002 Ga0307416_100013941 Ga0307416_1000139413 246
1546 3300032002 Ga0307416_100033476 Ga0307416_1000334762 246
1547 3300032004 Ga0307414_10018421 Ga0307414_100184212 246
1548 3300032004 Ga0307414_10471778 Ga0307414_104717782 246
1549 3300032005 Ga0307411_10001453 Ga0307411_100014537 246
1550 3300032005 Ga0307411_10017783 Ga0307411_100177833 246
1551 3300032005 Ga0307411_10292178 Ga0307411_102921782 246
1552 3300032005 Ga0307411_10495044 Ga0307411_104950442 246
1553 3300032126 Ga0307415_100001381 Ga0307415_1000013817 246
1554 3300032126 Ga0307415_100034563 Ga0307415_1000345635 246
1555 3300035090 Ga0373949_0013896 Ga0373949_0013896_353_1096 246
1556 3300035111 Ga0373923_0039365 Ga0373923_0039365_692_1435 246
1557 3300035111 Ga0373923_0091776 Ga0373923_0091776_180_923 246
1558 3300035118 Ga0373954_0000673 Ga0373954_0000673_8387_9130 246
1559 3300035118 Ga0373954_0033755 Ga0373954_0033755_477_1220 246
1560 3300035120 Ga0373957_0131485 Ga0373957_0131485_244_987 246
1561 3300035170 Ga0373943_0097238 Ga0373943_0097238_161_904 246
1562 3300035172 Ga0373955_0043399 Ga0373955_0043399_1170_1913 246
1563 3300035692 Ga0373935_0017799 Ga0373935_0017799_2143_2886 246
1564 3300035692 Ga0373935_0132093 Ga0373935_0132093_726_1469 246
1565 3300035695 Ga0373927_0001660 Ga0373927_0001660_11659_12402 246
1566 3300035724 Ga0373933_0021031 Ga0373933_0021031_1027_1770 246
1567 3300035725 Ga0373947_0067758 Ga0373947_0067758_122_865 246
1568 3300035725 Ga0373947_0200814 Ga0373947_0200814_539_1282 246
1569 3300036401 Ga0373937_0055786 Ga0373937_0055786_2770_3513 246
1570 3300036401 Ga0373937_0075580 Ga0373937_0075580_525_1268 246
1571 3300037068 Ga0373925_0442944 Ga0373925_0442944_17_760 246
1572 3300037312 Ga0395899_0011072 Ga0395899_0011072_6070_6813 246
1573 3300037312 Ga0395899_0080145 Ga0395899_0080145_1341_2096 246
1574 3300037418 Ga0395900_0007289 Ga0395900_0007289_1108_1851 246
1575 3300037418 Ga0395900_0018254 Ga0395900_0018254_783_1538 246
1576 3300037418 Ga0395900_0217814 Ga0395900_0217814_80_847 246
1577 3300037418 Ga0395900_0798534 Ga0395900_0798534_41_784 246
1578 3300037466 Ga0395898_0010914 Ga0395898_0010914_8036_8782 246
1579 3300037466 Ga0395898_0067655 Ga0395898_0067655_2646_3389 246
1580 3300037466 Ga0395898_0112051 Ga0395898_0112051_100_843 246
1581 3300037466 Ga0395898_0165220 Ga0395898_0165220_1227_1970 246
1582 3300037471 Ga0395905_0007110 Ga0395905_0007110_2844_3590 246
1583 3300037471 Ga0395905_0310331 Ga0395905_0310331_577_1320 246
1584 3300037853 Ga0436364_0406135 Ga0436364_0406135_37_780 246
1585 3300038443 Ga0395901_0021641 Ga0395901_0021641_3027_3770 246
1586 3300038443 Ga0395901_0037202 Ga0395901_0037202_1587_2333 246
1587 3300038443 Ga0395901_0040071 Ga0395901_0040071_3311_4069 246
1588 3300038443 Ga0395901_0042303 Ga0395901_0042303_875_1630 246
1589 3300038443 Ga0395901_0066215 Ga0395901_0066215_242_985 246
1590 3300038443 Ga0395901_0329811 Ga0395901_0329811_307_1050 246
1591 3300039447 Ga0436361_1097729 Ga0436361_1097729_38705_39448 246
1592 3300042005 Ga0439448_0029645 Ga0439448_0029645_565_1308 246
1593 3300042008 Ga0439450_026567 Ga0439450_026567_32_784 246
1594 3300042439 Ga0439464_0005318 Ga0439464_0005318_325_1068 246
1595 3300042532 Ga0450893_0024857 Ga0450893_0024857_127_870 246
1596 3300042876 Ga0451577_0509060 Ga0451577_0509060_301_1044 246
1597 3300044658 Ga0466972_0030558 Ga0466972_0030558_992_1774 246
1598 3300044673 Ga0453683_0000228 Ga0453683_0000228_56126_56872 246
1599 3300044673 Ga0453683_0003575 Ga0453683_0003575_6761_7504 246
1600 3300044673 Ga0453683_0005122 Ga0453683_0005122_624_1367 246
1601 3300044673 Ga0453683_0011486 Ga0453683_0011486_2306_3049 246
1602 3300044673 Ga0453683_0016818 Ga0453683_0016818_2291_3034 246
1603 3300044673 Ga0453683_0067582 Ga0453683_0067582_1309_2061 246
1604 3300044673 Ga0453683_0087348 Ga0453683_0087348_713_1456 246
1605 3300044673 Ga0453683_0168909 Ga0453683_0168909_603_1355 246
1606 3300044673 Ga0453683_0275499 Ga0453683_0275499_207_950 246
1607 3300044712 Ga0453684_0053830 Ga0453684_0053830_1309_2052 246
1608 3300044712 Ga0453684_0067738 Ga0453684_0067738_3408_4151 246
1609 3300044712 Ga0453684_0205568 Ga0453684_0205568_355_1098 246
1610 3300044901 Ga0466960_0009554 Ga0466960_0009554_623_1378 246
1611 3300045051 Ga0451576_0063913 Ga0451576_0063913_2099_2842 246
1612 3300045051 Ga0451576_0121878 Ga0451576_0121878_1623_2366 246
1613 3300045051 Ga0451576_0183921 Ga0451576_0183921_933_1676 246
1614 3300045051 Ga0451576_0203376 Ga0451576_0203376_1143_1886 246
1615 3300046462 Ga0495651_0072809 Ga0495651_0072809_937_1680 246
1616 3300046472 Ga0495580_0003398 Ga0495580_0003398_10718_11461 246
1617 3300046473 Ga0495582_0030782 Ga0495582_0030782_167_910 246
1618 3300046475 Ga0495639_0027153 Ga0495639_0027153_913_1656 246
1619 3300046477 Ga0495664_0025260 Ga0495664_0025260_748_1491 246
1620 3300046477 Ga0495664_0068338 Ga0495664_0068338_1038_1781 246
1621 3300046528 Ga0495642_0091952 Ga0495642_0091952_456_1199 246
1622 3300046543 Ga0495645_0233137 Ga0495645_0233137_477_1220 246
1623 3300046663 Ga0495635_0084545 Ga0495635_0084545_1011_1754 246
1624 3300046683 Ga0495658_0111578 Ga0495658_0111578_217_993 246
1625 3300046689 Ga0495613_0367592 Ga0495613_0367592_72_815 246
1626 3300047315 Ga0495581_0148042 Ga0495581_0148042_222_965 246
1627 3300047319 Ga0495674_0608601 Ga0495674_0608601_112_855 246
1628 3300047445 Ga0495677_0148152 Ga0495677_0148152_80_823 246
1629 3300047471 Ga0495684_0080859 Ga0495684_0080859_1394_2137 246
1630 3300048088 Ga0495602_0091861 Ga0495602_0091861_116_868 246
1631 3300048904 Ga0496101_0112506 Ga0496101_0112506_237_980 246
1632 3300048905 Ga0496102_0017749 Ga0496102_0017749_4016_4771 246
1633 3300048905 Ga0496102_0109934 Ga0496102_0109934_951_1721 246
1634 3300048905 Ga0496102_0218684 Ga0496102_0218684_262_1029 246
1635 3300048905 Ga0496102_0273408 Ga0496102_0273408_366_1109 246
1636 3300048905 Ga0496102_0398911 Ga0496102_0398911_78_821 246
1637 3300048906 Ga0496103_0005184 Ga0496103_0005184_6554_7309 246
1638 3300048907 Ga0496104_0019326 Ga0496104_0019326_5167_5910 246
1639 3300048907 Ga0496104_0052027 Ga0496104_0052027_1937_2680 246
1640 3300048908 Ga0496105_0045521 Ga0496105_0045521_1854_2597 246
1641 3300048909 Ga0496106_0194500 Ga0496106_0194500_29_772 246
1642 3300048909 Ga0496106_0277954 Ga0496106_0277954_68_811 246
1643 3300048909 Ga0496106_0303040 Ga0496106_0303040_228_971 246
1644 3300048911 Ga0496108_0008599 Ga0496108_0008599_2400_3143 246
1645 3300048911 Ga0496108_0012808 Ga0496108_0012808_2844_3587 246
1646 3300048911 Ga0496108_0608562 Ga0496108_0608562_183_926 246
1647 3300048912 Ga0496109_0000050 Ga0496109_0000050_25135_25878 246
1648 3300048912 Ga0496109_0001065 Ga0496109_0001065_18744_19487 246
1649 3300048912 Ga0496109_0075942 Ga0496109_0075942_680_1423 246
1650 3300048913 Ga0496110_0011283 Ga0496110_0011283_3390_4133 246
1651 3300048913 Ga0496110_0066640 Ga0496110_0066640_777_1520 246
1652 3300048914 Ga0496111_0009102 Ga0496111_0009102_2751_3494 246
1653 3300048915 Ga0496112_0268788 Ga0496112_0268788_258_1001 246
1654 3300048916 Ga0496113_0154893 Ga0496113_0154893_72_815 246
1655 3300048917 Ga0496114_0025015 Ga0496114_0025015_2560_3315 246
1656 3300048918 Ga0496115_0100268 Ga0496115_0100268_304_1059 246
1657 3300048918 Ga0496115_0128528 Ga0496115_0128528_87_857 246
1658 3300049514 Ga0501291_009163 Ga0501291_009163_74_817 246
1659 3300049568 Ga0501031_0044815 Ga0501031_0044815_886_1629 246
1660 3300049569 Ga0501032_0094597 Ga0501032_0094597_956_1699 246
1661 3300049570 Ga0501033_0184012 Ga0501033_0184012_97_840 246
1662 3300049570 Ga0501033_0419523 Ga0501033_0419523_129_872 246
1663 3300049572 Ga0501036_0007161 Ga0501036_0007161_5051_5794 246
1664 3300049572 Ga0501036_0020888 Ga0501036_0020888_450_1193 246
1665 3300049573 Ga0501037_0134138 Ga0501037_0134138_916_1659 246
1666 3300049574 Ga0501038_0025145 Ga0501038_0025145_3998_4741 246
1667 3300049575 Ga0501039_0035986 Ga0501039_0035986_2427_3170 246
1668 3300049575 Ga0501039_0390260 Ga0501039_0390260_54_797 246
1669 3300049576 Ga0501040_0005227 Ga0501040_0005227_6219_6962 246
1670 3300049576 Ga0501040_0013594 Ga0501040_0013594_2880_3623 246
1671 3300049576 Ga0501040_0138604 Ga0501040_0138604_130_873 246
1672 3300049576 Ga0501040_0407372 Ga0501040_0407372_32_775 246
1673 3300049577 Ga0501041_0000630 Ga0501041_0000630_10639_11382 246
1674 3300049577 Ga0501041_0051808 Ga0501041_0051808_1232_1975 246
1675 3300049578 Ga0501042_0022185 Ga0501042_0022185_292_1035 246
1676 3300049578 Ga0501042_0029679 Ga0501042_0029679_2412_3155 246
1677 3300049580 Ga0501046_0153230 Ga0501046_0153230_736_1479 246
1678 3300049580 Ga0501046_0190381 Ga0501046_0190381_274_1017 246
1679 3300049580 Ga0501046_0510022 Ga0501046_0510022_22_765 246
1680 3300049582 Ga0501048_0037620 Ga0501048_0037620_827_1570 246
1681 3300049582 Ga0501048_0046358 Ga0501048_0046358_1815_2558 246
1682 3300049587 Ga0501071_0006317 Ga0501071_0006317_2903_3646 246
1683 3300049587 Ga0501071_0009131 Ga0501071_0009131_2467_3210 246
1684 3300049587 Ga0501071_0283309 Ga0501071_0283309_136_879 246
1685 3300049588 Ga0501072_0016507 Ga0501072_0016507_61_804 246
1686 3300049588 Ga0501072_0052257 Ga0501072_0052257_2110_2853 246
1687 3300049588 Ga0501072_0106193 Ga0501072_0106193_1059_1802 246
1688 3300049588 Ga0501072_0163414 Ga0501072_0163414_923_1666 246
1689 3300049588 Ga0501072_0624593 Ga0501072_0624593_74_817 246
1690 3300049591 Ga0501075_0001991 Ga0501075_0001991_9026_9769 246
1691 3300049591 Ga0501075_0003411 Ga0501075_0003411_3874_4617 246
1692 3300049591 Ga0501075_0022246 Ga0501075_0022246_2264_3007 246
1693 3300049591 Ga0501075_0192896 Ga0501075_0192896_389_1132 246
1694 3300049592 Ga0501076_0000004 Ga0501076_0000004_132995_133738 246
1695 3300049592 Ga0501076_0006583 Ga0501076_0006583_5722_6465 246
1696 3300049592 Ga0501076_0039133 Ga0501076_0039133_2108_2851 246
1697 3300049593 Ga0501077_0179645 Ga0501077_0179645_426_1169 246
1698 3300049652 Ga0501202_006749 Ga0501202_006749_159_902 246
1699 3300049655 Ga0501208_029401 Ga0501208_029401_192_935 246
1700 3300049661 Ga0501217_033241 Ga0501217_033241_408_1151 246
1701 3300049668 Ga0501233_062228 Ga0501233_062228_87_830 246
1702 3300049688 Ga0501259_008240 Ga0501259_008240_819_1562 246
1703 3300049689 Ga0501260_010412 Ga0501260_010412_171_914 246
1704 3300049705 Ga0501225_0015866 Ga0501225_0015866_450_1193 246
1705 3300049708 Ga0501245_039018 Ga0501245_039018_45_788 246
1706 3300049741 Ga0501079_0059052 Ga0501079_0059052_535_1278 246
1707 3300049741 Ga0501079_0119678 Ga0501079_0119678_1096_1839 246
1708 3300049741 Ga0501079_0288257 Ga0501079_0288257_94_837 246
1709 3300049741 Ga0501079_0360054 Ga0501079_0360054_339_1082 246
1710 3300049742 Ga0501080_0132436 Ga0501080_0132436_341_1084 246
1711 3300049743 Ga0501081_0001388 Ga0501081_0001388_6792_7535 246
1712 3300049743 Ga0501081_0040047 Ga0501081_0040047_307_1050 246
1713 3300049743 Ga0501081_0278704 Ga0501081_0278704_179_922 246
1714 3300049744 Ga0501083_0192280 Ga0501083_0192280_362_1105 246
1715 3300049822 Ga0501035_0163915 Ga0501035_0163915_399_1142 246
1716 3300049824 Ga0501045_0003185 Ga0501045_0003185_8759_9502 246
1717 3300049824 Ga0501045_0035734 Ga0501045_0035734_625_1368 246
1718 3300049824 Ga0501045_0202232 Ga0501045_0202232_518_1261 246
1719 3300050490 nmdc:mga03n38_275865_c1 nmdc:mga03n38_275865_c1_75_818 246
1720 3300050491 nmdc:mga00v17_78258_c1 nmdc:mga00v17_78258_c1_455_1198 246
1721 3300050507 nmdc:mga05p37_104663_c1 nmdc:mga05p37_104663_c1_432_1175 246
1722 3300050507 nmdc:mga05p37_11385_c1 nmdc:mga05p37_11385_c1_4415_5158 246
1723 3300050507 nmdc:mga05p37_131061_c1 nmdc:mga05p37_131061_c1_636_1379 246
1724 3300050507 nmdc:mga05p37_15016_c1 nmdc:mga05p37_15016_c1_988_1731 246
1725 3300050507 nmdc:mga05p37_158676_c1 nmdc:mga05p37_158676_c1_438_1181 246
1726 3300050507 nmdc:mga05p37_176876_c1 nmdc:mga05p37_176876_c1_406_1200 246
1727 3300050507 nmdc:mga05p37_236783_c1 nmdc:mga05p37_236783_c1_34_777 246
1728 3300050507 nmdc:mga05p37_270607_c1 nmdc:mga05p37_270607_c1_263_1006 246
1729 3300050507 nmdc:mga05p37_270750_c1 nmdc:mga05p37_270750_c1_884_1627 246
1730 3300050507 nmdc:mga05p37_300749_c1 nmdc:mga05p37_300749_c1_186_1037 246
1731 3300050507 nmdc:mga05p37_304359_c1 nmdc:mga05p37_304359_c1_81_827 246
1732 3300050507 nmdc:mga05p37_35820_c1 nmdc:mga05p37_35820_c1_1021_1764 246
1733 3300050507 nmdc:mga05p37_39341_c2 nmdc:mga05p37_39341_c2_1567_2313 246
1734 3300050507 nmdc:mga05p37_396384_c1 nmdc:mga05p37_396384_c1_559_1302 246
1735 3300050507 nmdc:mga05p37_404530_c1 nmdc:mga05p37_404530_c1_76_819 246
1736 3300050507 nmdc:mga05p37_4063_c1 nmdc:mga05p37_4063_c1_2925_3668 246
1737 3300050507 nmdc:mga05p37_41017_c1 nmdc:mga05p37_41017_c1_2157_2900 246
1738 3300050507 nmdc:mga05p37_47698_c1 nmdc:mga05p37_47698_c1_1862_2605 246
1739 3300050507 nmdc:mga05p37_47819_c1 nmdc:mga05p37_47819_c1_2862_3608 246
1740 3300050507 nmdc:mga05p37_489091_c1 nmdc:mga05p37_489091_c1_285_1028 246
1741 3300050507 nmdc:mga05p37_504870_c1 nmdc:mga05p37_504870_c1_273_1016 246
1742 3300050507 nmdc:mga05p37_5582_c1 nmdc:mga05p37_5582_c1_11559_12302 246
1743 3300050507 nmdc:mga05p37_693777_c1 nmdc:mga05p37_693777_c1_37_780 246
1744 3300050507 nmdc:mga05p37_78941_c1 nmdc:mga05p37_78941_c1_1594_2337 246
1745 3300050507 nmdc:mga05p37_81212_c1 nmdc:mga05p37_81212_c1_1066_1809 246
1746 3300050507 nmdc:mga05p37_8249_c1 nmdc:mga05p37_8249_c1_4625_5368 246
1747 3300050508 nmdc:mga09592_104060_c1 nmdc:mga09592_104060_c1_1464_2207 246
1748 3300050508 nmdc:mga09592_1479_c1 nmdc:mga09592_1479_c1_11497_12240 246
1749 3300050508 nmdc:mga09592_222684_c1 nmdc:mga09592_222684_c1_870_1613 246
1750 3300050508 nmdc:mga09592_223295_c1 nmdc:mga09592_223295_c1_696_1439 246
1751 3300050508 nmdc:mga09592_256946_c1 nmdc:mga09592_256946_c1_680_1423 246
1752 3300050508 nmdc:mga09592_30797_c1 nmdc:mga09592_30797_c1_497_1240 246
1753 3300050508 nmdc:mga09592_338601_c1 nmdc:mga09592_338601_c1_148_891 246
1754 3300050508 nmdc:mga09592_38678_c1 nmdc:mga09592_38678_c1_1745_2488 246
1755 3300050508 nmdc:mga09592_99257_c1 nmdc:mga09592_99257_c1_1336_2079 246
1756 3300050509 nmdc:mga0qj67_127781_c1 nmdc:mga0qj67_127781_c1_1230_1973 246
1757 3300050509 nmdc:mga0qj67_247896_c1 nmdc:mga0qj67_247896_c1_527_1270 246
1758 3300050509 nmdc:mga0qj67_247951_c1 nmdc:mga0qj67_247951_c1_330_1079 246
1759 3300050509 nmdc:mga0qj67_326714_c1 nmdc:mga0qj67_326714_c1_39_782 246
1760 3300050509 nmdc:mga0qj67_34059_c1 nmdc:mga0qj67_34059_c1_2821_3564 246
1761 3300050509 nmdc:mga0qj67_35483_c1 nmdc:mga0qj67_35483_c1_646_1389 246
1762 3300050509 nmdc:mga0qj67_407974_c1 nmdc:mga0qj67_407974_c1_337_1080 246
1763 3300050509 nmdc:mga0qj67_40979_c1 nmdc:mga0qj67_40979_c1_827_1570 246
1764 3300050509 nmdc:mga0qj67_44850_c1 nmdc:mga0qj67_44850_c1_1961_2704 246
1765 3300050509 nmdc:mga0qj67_63281_c1 nmdc:mga0qj67_63281_c1_1320_2063 246
1766 3300050509 nmdc:mga0qj67_8138_c1 nmdc:mga0qj67_8138_c1_2544_3287 246
1767 3300050509 nmdc:mga0qj67_8393_c1 nmdc:mga0qj67_8393_c1_4851_5594 246
1768 3300050509 nmdc:mga0qj67_84_c1 nmdc:mga0qj67_84_c1_6413_7156 246
1769 3300050510 nmdc:mga06r32_117004_c1 nmdc:mga06r32_117004_c1_843_1586 246
1770 3300050510 nmdc:mga06r32_128387_c1 nmdc:mga06r32_128387_c1_673_1416 246
1771 3300050510 nmdc:mga06r32_175071_c1 nmdc:mga06r32_175071_c1_1297_2043 246
1772 3300050510 nmdc:mga06r32_195290_c1 nmdc:mga06r32_195290_c1_1109_1852 246
1773 3300050510 nmdc:mga06r32_203328_c1 nmdc:mga06r32_203328_c1_433_1179 246
1774 3300050510 nmdc:mga06r32_25601_c1 nmdc:mga06r32_25601_c1_203_946 246
1775 3300050510 nmdc:mga06r32_275490_c1 nmdc:mga06r32_275490_c1_564_1307 246
1776 3300050510 nmdc:mga06r32_28159_c1 nmdc:mga06r32_28159_c1_1327_2070 246
1777 3300050510 nmdc:mga06r32_3791_c1 nmdc:mga06r32_3791_c1_7828_8571 246
1778 3300050510 nmdc:mga06r32_396270_c1 nmdc:mga06r32_396270_c1_282_1025 246
1779 3300050510 nmdc:mga06r32_41101_c1 nmdc:mga06r32_41101_c1_1305_2048 246
1780 3300050510 nmdc:mga06r32_5485_c1 nmdc:mga06r32_5485_c1_3037_3780 246
1781 3300050510 nmdc:mga06r32_5573_c1 nmdc:mga06r32_5573_c1_8058_8801 246
1782 3300050510 nmdc:mga06r32_77465_c1 nmdc:mga06r32_77465_c1_1802_2545 246
1783 3300050511 nmdc:mga08y16_191546_c1 nmdc:mga08y16_191546_c1_1227_1973 246
1784 3300050511 nmdc:mga08y16_481541_c1 nmdc:mga08y16_481541_c1_267_1010 246
1785 3300050511 nmdc:mga08y16_5098_c1 nmdc:mga08y16_5098_c1_54_797 246
1786 3300050511 nmdc:mga08y16_53384_c1 nmdc:mga08y16_53384_c1_451_1194 246
1787 3300050511 nmdc:mga08y16_604068_c1 nmdc:mga08y16_604068_c1_278_1036 246
1788 3300050511 nmdc:mga08y16_674242_c1 nmdc:mga08y16_674242_c1_263_1006 246
1789 3300050511 nmdc:mga08y16_95107_c1 nmdc:mga08y16_95107_c1_1661_2404 246
1790 3300050512 nmdc:mga0n895_16637_c1 nmdc:mga0n895_16637_c1_3657_4406 246
1791 3300050512 nmdc:mga0n895_168770_c1 nmdc:mga0n895_168770_c1_676_1419 246
1792 3300050512 nmdc:mga0n895_245062_c1 nmdc:mga0n895_245062_c1_529_1272 246
1793 3300050512 nmdc:mga0n895_28700_c1 nmdc:mga0n895_28700_c1_4332_5075 246
1794 3300050512 nmdc:mga0n895_289631_c1 nmdc:mga0n895_289631_c1_394_1137 246
1795 3300050512 nmdc:mga0n895_3321_c1 nmdc:mga0n895_3321_c1_3825_4568 246
1796 3300050512 nmdc:mga0n895_461882_c1 nmdc:mga0n895_461882_c1_420_1163 246
1797 3300050512 nmdc:mga0n895_53375_c1 nmdc:mga0n895_53375_c1_1446_2189 246
1798 3300050512 nmdc:mga0n895_5938_c1 nmdc:mga0n895_5938_c1_1339_2088 246
1799 3300050512 nmdc:mga0n895_94998_c1 nmdc:mga0n895_94998_c1_1145_1888 246
1800 3300050513 nmdc:mga0rr50_17600_c1 nmdc:mga0rr50_17600_c1_3374_4117 246
1801 3300050513 nmdc:mga0rr50_183080_c1 nmdc:mga0rr50_183080_c1_409_1152 246
1802 3300050513 nmdc:mga0rr50_261382_c1 nmdc:mga0rr50_261382_c1_19_762 246
1803 3300050513 nmdc:mga0rr50_35967_c1 nmdc:mga0rr50_35967_c1_2439_3188 246
1804 3300050513 nmdc:mga0rr50_4285_c1 nmdc:mga0rr50_4285_c1_5706_6449 246
1805 3300050514 nmdc:mga08x19_15256_c1 nmdc:mga08x19_15256_c1_602_1345 246
1806 3300050514 nmdc:mga08x19_5646_c1 nmdc:mga08x19_5646_c1_1960_2709 246
1807 3300050515 nmdc:mga0a205_10679_c2 nmdc:mga0a205_10679_c2_788_1537 246
1808 3300050515 nmdc:mga0a205_125886_c1 nmdc:mga0a205_125886_c1_1366_2112 246
1809 3300050515 nmdc:mga0a205_12825_c1 nmdc:mga0a205_12825_c1_2456_3199 246
1810 3300050515 nmdc:mga0a205_17063_c2 nmdc:mga0a205_17063_c2_1850_2593 246
1811 3300050515 nmdc:mga0a205_25047_c1 nmdc:mga0a205_25047_c1_314_1057 246
1812 3300050515 nmdc:mga0a205_252839_c1 nmdc:mga0a205_252839_c1_752_1495 246
1813 3300050515 nmdc:mga0a205_267738_c1 nmdc:mga0a205_267738_c1_329_1072 246
1814 3300050515 nmdc:mga0a205_3049_c1 nmdc:mga0a205_3049_c1_3737_4486 246
1815 3300050515 nmdc:mga0a205_31365_c1 nmdc:mga0a205_31365_c1_2258_3001 246
1816 3300050515 nmdc:mga0a205_547409_c1 nmdc:mga0a205_547409_c1_101_844 246
1817 3300050515 nmdc:mga0a205_7197_c1 nmdc:mga0a205_7197_c1_7906_8649 246
1818 3300050515 nmdc:mga0a205_8823_c1 nmdc:mga0a205_8823_c1_2267_3010 246
1819 3300053116 Ga0500592_013294 Ga0500592_013294_357_1109 246
1820 3300053149 Ga0500600_0114294 Ga0500600_0114294_426_1172 246
1821 3300054114 Ga0501084_0007725 Ga0501084_0007725_6497_7240 246
1822 3300054114 Ga0501084_0055443 Ga0501084_0055443_1922_2665 246
1823 3300054114 Ga0501084_0055621 Ga0501084_0055621_2222_2965 246
1824 3300054114 Ga0501084_0090762 Ga0501084_0090762_1694_2437 246
1825 3300054114 Ga0501084_0242182 Ga0501084_0242182_145_888 246
1826 3300054114 Ga0501084_0368626 Ga0501084_0368626_306_1049 246
1827 3300059421 Ga0590071_001059 Ga0590071_001059_913_1656 246
1828 3300059424 Ga0590075_000123 Ga0590075_000123_18370_19113 246
1829 3300059426 Ga0590077_000109 Ga0590077_000109_16870_17613 246
1830 3300060353 Ga0501082_0018439 Ga0501082_0018439_1941_2684 246
1831 3300060353 Ga0501082_0020025 Ga0501082_0020025_2930_3673 246
1832 3300060353 Ga0501082_0100668 Ga0501082_0100668_268_1011 246
1833 3300060353 Ga0501082_0113609 Ga0501082_0113609_1549_2292 246
1834 3300061734 Ga0530510_0000005 Ga0530510_0000005_174572_175315 246
1835 3300061734 Ga0530510_0001471 Ga0530510_0001471_9544_10287 246
1836 3300061734 Ga0530510_0018370 Ga0530510_0018370_345_1088 246
1837 3300061734 Ga0530510_0098542 Ga0530510_0098542_1125_1868 246
1838 3300061734 Ga0530510_0122141 Ga0530510_0122141_1112_1855 246
1839 3300061734 Ga0530510_0571243 Ga0530510_0571243_100_843 246
1840 3300000549 LJQas_1000420 LJQas_10004209 247
1841 3300000549 LJQas_1008308 LJQas_10083082 247
1842 3300001990 JGI24737J22298_10036815 JGI24737J22298_100368151 247
1843 3300002075 JGI24738J21930_10003088 JGI24738J21930_100030885 247
1844 3300003373 JGI25407J50210_10004889 JGI25407J50210_100048894 247
1845 3300005327 Ga0070658_10244362 Ga0070658_102443621 247
1846 3300005329 Ga0070683_100084185 Ga0070683_1000841855 247
1847 3300005329 Ga0070683_100110296 Ga0070683_1001102962 247
1848 3300005329 Ga0070683_100525473 Ga0070683_1005254731 247
1849 3300005329 Ga0070683_100724624 Ga0070683_1007246242 247
1850 3300005337 Ga0070682_100014272 Ga0070682_1000142723 247
1851 3300005338 Ga0068868_100013869 Ga0068868_1000138695 247
1852 3300005340 Ga0070689_100266552 Ga0070689_1002665522 247
1853 3300005341 Ga0070691_10099193 Ga0070691_100991931 247
1854 3300005343 Ga0070687_100181605 Ga0070687_1001816052 247
1855 3300005343 Ga0070687_100214502 Ga0070687_1002145022 247
1856 3300005345 Ga0070692_10006201 Ga0070692_100062014 247
1857 3300005354 Ga0070675_100031708 Ga0070675_1000317084 247
1858 3300005356 Ga0070674_100031806 Ga0070674_1000318064 247
1859 3300005441 Ga0070700_100008927 Ga0070700_1000089274 247
1860 3300005441 Ga0070700_100079585 Ga0070700_1000795852 247
1861 3300005455 Ga0070663_100416139 Ga0070663_1004161392 247
1862 3300005457 Ga0070662_100530953 Ga0070662_1005309532 247
1863 3300005468 Ga0070707_100079201 Ga0070707_1000792012 247
1864 3300005471 Ga0070698_100002013 Ga0070698_10000201317 247
1865 3300005530 Ga0070679_100159818 Ga0070679_1001598182 247
1866 3300005535 Ga0070684_100115293 Ga0070684_1001152932 247
1867 3300005535 Ga0070684_100646047 Ga0070684_1006460471 247
1868 3300005539 Ga0068853_100271795 Ga0068853_1002717951 247
1869 3300005543 Ga0070672_100012407 Ga0070672_1000124075 247
1870 3300005544 Ga0070686_100013356 Ga0070686_1000133566 247
1871 3300005614 Ga0068856_100279633 Ga0068856_1002796333 247
1872 3300005615 Ga0070702_100008423 Ga0070702_1000084232 247
1873 3300005616 Ga0068852_100020835 Ga0068852_1000208352 247
1874 3300005718 Ga0068866_10022809 Ga0068866_100228093 247
1875 3300005719 Ga0068861_100036905 Ga0068861_1000369052 247
1876 3300005981 Ga0081538_10011267 Ga0081538_100112675 247
1877 3300005985 Ga0081539_10023501 Ga0081539_100235014 247
1878 3300006038 Ga0075365_10028966 Ga0075365_100289665 247
1879 3300006042 Ga0075368_10000654 Ga0075368_100006545 247
1880 3300006048 Ga0075363_100004116 Ga0075363_1000041165 247
1881 3300006051 Ga0075364_10119852 Ga0075364_101198522 247
1882 3300006058 Ga0075432_10077002 Ga0075432_100770021 247
1883 3300006178 Ga0075367_10003476 Ga0075367_100034766 247
1884 3300006178 Ga0075367_10014792 Ga0075367_100147925 247
1885 3300006353 Ga0075370_10105583 Ga0075370_101055832 247
1886 3300006881 Ga0068865_100042278 Ga0068865_1000422784 247
1887 3300009098 Ga0105245_10204557 Ga0105245_102045573 247
1888 3300009098 Ga0105245_10648864 Ga0105245_106488642 247
1889 3300009174 Ga0105241_10721167 Ga0105241_107211671 247
1890 3300009553 Ga0105249_10601272 Ga0105249_106012722 247
1891 3300013105 Ga0157369_10048474 Ga0157369_100484744 247
1892 3300013307 Ga0157372_10894718 Ga0157372_108947182 247
1893 3300014326 Ga0157380_10248691 Ga0157380_102486912 247
1894 3300014326 Ga0157380_10265910 Ga0157380_102659102 247
1895 3300020610 Ga0154015_1132504 Ga0154015_11325042 247
1896 3300025901 Ga0207688_10004627 Ga0207688_100046274 247
1897 3300025908 Ga0207643_10193094 Ga0207643_101930942 247
1898 3300025927 Ga0207687_10113657 Ga0207687_101136572 247
1899 3300025932 Ga0207690_10357947 Ga0207690_103579472 247
1900 3300025937 Ga0207669_10008443 Ga0207669_100084432 247
1901 3300025938 Ga0207704_10310962 Ga0207704_103109622 247
1902 3300025940 Ga0207691_10017419 Ga0207691_100174192 247
1903 3300025941 Ga0207711_10485902 Ga0207711_104859022 247
1904 3300025944 Ga0207661_10035205 Ga0207661_100352052 247
1905 3300025944 Ga0207661_10118472 Ga0207661_101184721 247
1906 3300026023 Ga0207677_10042742 Ga0207677_100427422 247
1907 3300026067 Ga0207678_10431606 Ga0207678_104316061 247
1908 3300026075 Ga0207708_10000410 Ga0207708_100004105 247
1909 3300026078 Ga0207702_10173945 Ga0207702_101739454 247
1910 3300026089 Ga0207648_10011193 Ga0207648_100111936 247
1911 3300026118 Ga0207675_100016874 Ga0207675_1000168748 247
1912 3300026121 Ga0207683_10257205 Ga0207683_102572052 247
1913 3300026142 Ga0207698_10007219 Ga0207698_100072193 247
1914 3300026142 Ga0207698_10248712 Ga0207698_102487121 247
1915 3300027866 Ga0209813_10147884 Ga0209813_101478841 247
1916 3300031548 Ga0307408_100104056 Ga0307408_1001040561 247
1917 3300031548 Ga0307408_100462758 Ga0307408_1004627582 247
1918 3300031548 Ga0307408_100610156 Ga0307408_1006101562 247
1919 3300031731 Ga0307405_10274132 Ga0307405_102741322 247
1920 3300031824 Ga0307413_10104578 Ga0307413_101045781 247
1921 3300031824 Ga0307413_10230738 Ga0307413_102307381 247
1922 3300031852 Ga0307410_10522838 Ga0307410_105228382 247
1923 3300031852 Ga0307410_10587514 Ga0307410_105875142 247
1924 3300031901 Ga0307406_10114662 Ga0307406_101146624 247
1925 3300031901 Ga0307406_10165327 Ga0307406_101653272 247
1926 3300031901 Ga0307406_10478855 Ga0307406_104788552 247
1927 3300031903 Ga0307407_10184423 Ga0307407_101844232 247
1928 3300031903 Ga0307407_10323847 Ga0307407_103238471 247
1929 3300031903 Ga0307407_10363441 Ga0307407_103634412 247
1930 3300031911 Ga0307412_10061827 Ga0307412_100618272 247
1931 3300031911 Ga0307412_10192387 Ga0307412_101923872 247
1932 3300031911 Ga0307412_10206872 Ga0307412_102068722 247
1933 3300031995 Ga0307409_100029277 Ga0307409_1000292772 247
1934 3300031995 Ga0307409_100039749 Ga0307409_1000397496 247
1935 3300031995 Ga0307409_100179423 Ga0307409_1001794232 247
1936 3300031995 Ga0307409_100396024 Ga0307409_1003960242 247
1937 3300031995 Ga0307409_100409142 Ga0307409_1004091422 247
1938 3300031995 Ga0307409_100534814 Ga0307409_1005348142 247
1939 3300031995 Ga0307409_100575693 Ga0307409_1005756932 247
1940 3300032002 Ga0307416_100062771 Ga0307416_1000627712 247
1941 3300032002 Ga0307416_100074358 Ga0307416_1000743586 247
1942 3300032002 Ga0307416_100080901 Ga0307416_1000809012 247
1943 3300032002 Ga0307416_100314079 Ga0307416_1003140792 247
1944 3300032002 Ga0307416_100325646 Ga0307416_1003256463 247
1945 3300032002 Ga0307416_100695332 Ga0307416_1006953321 247
1946 3300032004 Ga0307414_10052967 Ga0307414_100529672 247
1947 3300032004 Ga0307414_10132764 Ga0307414_101327644 247
1948 3300032004 Ga0307414_10624123 Ga0307414_106241231 247
1949 3300032005 Ga0307411_10193232 Ga0307411_101932322 247
1950 3300032005 Ga0307411_10640920 Ga0307411_106409201 247
1951 3300032126 Ga0307415_100001280 Ga0307415_10000128014 247
1952 3300032126 Ga0307415_100034630 Ga0307415_1000346302 247
1953 3300032126 Ga0307415_100086002 Ga0307415_1000860021 247
1954 3300032126 Ga0307415_100090019 Ga0307415_1000900192 247
1955 3300032126 Ga0307415_100145150 Ga0307415_1001451503 247
1956 3300032126 Ga0307415_100405597 Ga0307415_1004055972 247
1957 3300032126 Ga0307415_100415597 Ga0307415_1004155972 247
1958 3300037312 Ga0395899_0303998 Ga0395899_0303998_62_805 247
1959 3300037418 Ga0395900_0062535 Ga0395900_0062535_2346_3095 247
1960 3300037418 Ga0395900_0064941 Ga0395900_0064941_2139_2888 247
1961 3300037466 Ga0395898_0019280 Ga0395898_0019280_515_1276 247
1962 3300037466 Ga0395898_0089187 Ga0395898_0089187_697_1446 247
1963 3300037466 Ga0395898_0124728 Ga0395898_0124728_734_1483 247
1964 3300038443 Ga0395901_0003608 Ga0395901_0003608_11501_12262 247
1965 3300038443 Ga0395901_0156444 Ga0395901_0156444_1516_2277 247
1966 3300038443 Ga0395901_0411240 Ga0395901_0411240_337_1086 247
1967 3300038443 Ga0395901_0583383 Ga0395901_0583383_80_823 247
1968 3300042993 Ga0439440_0008644 Ga0439440_0008644_1096_1839 247
1969 3300044706 Ga0466964_0152787 Ga0466964_0152787_101_850 247
1970 3300044735 Ga0466968_0179269 Ga0466968_0179269_153_902 247
1971 3300045836 Ga0466958_0106808 Ga0466958_0106808_489_1238 247
1972 3300045976 Ga0466967_0011489 Ga0466967_0011489_3617_4378 247
1973 3300046518 Ga0495631_0081100 Ga0495631_0081100_472_1221 247
1974 3300047319 Ga0495674_0072563 Ga0495674_0072563_91_843 247
1975 3300048913 Ga0496110_0263794 Ga0496110_0263794_71_814 247
1976 3300048913 Ga0496110_0591290 Ga0496110_0591290_244_993 247
1977 3300048915 Ga0496112_0206583 Ga0496112_0206583_883_1644 247
1978 3300049569 Ga0501032_0055076 Ga0501032_0055076_122_886 247
1979 3300049572 Ga0501036_0030168 Ga0501036_0030168_2909_3673 247
1980 3300049572 Ga0501036_0116490 Ga0501036_0116490_85_828 247
1981 3300049572 Ga0501036_0347494 Ga0501036_0347494_28_777 247
1982 3300049573 Ga0501037_0295785 Ga0501037_0295785_63_806 247
1983 3300049574 Ga0501038_0007320 Ga0501038_0007320_2077_2841 247
1984 3300049575 Ga0501039_0049733 Ga0501039_0049733_1454_2218 247
1985 3300049575 Ga0501039_0364964 Ga0501039_0364964_142_888 247
1986 3300049576 Ga0501040_0005549 Ga0501040_0005549_4637_5401 247
1987 3300049576 Ga0501040_0068394 Ga0501040_0068394_339_1085 247
1988 3300049577 Ga0501041_0029239 Ga0501041_0029239_1921_2685 247
1989 3300049577 Ga0501041_0355054 Ga0501041_0355054_112_855 247
1990 3300049578 Ga0501042_0003456 Ga0501042_0003456_1803_2567 247
1991 3300049578 Ga0501042_0344346 Ga0501042_0344346_196_939 247
1992 3300049579 Ga0501043_0251003 Ga0501043_0251003_113_877 247
1993 3300049582 Ga0501048_0001959 Ga0501048_0001959_7527_8291 247
1994 3300049582 Ga0501048_0169430 Ga0501048_0169430_390_1142 247
1995 3300049583 Ga0501067_0061280 Ga0501067_0061280_792_1535 247
1996 3300049584 Ga0501068_0323122 Ga0501068_0323122_26_769 247
1997 3300049586 Ga0501070_0523910 Ga0501070_0523910_28_789 247
1998 3300049587 Ga0501071_0092053 Ga0501071_0092053_1056_1808 247
1999 3300049587 Ga0501071_0319366 Ga0501071_0319366_130_891 247
2000 3300049588 Ga0501072_0006479 Ga0501072_0006479_810_1574 247
2001 3300049588 Ga0501072_0068066 Ga0501072_0068066_1282_2028 247
2002 3300049588 Ga0501072_0186860 Ga0501072_0186860_559_1311 247
2003 3300049588 Ga0501072_0484223 Ga0501072_0484223_112_873 247
2004 3300049590 Ga0501074_0070920 Ga0501074_0070920_1214_1960 247
2005 3300049590 Ga0501074_0141411 Ga0501074_0141411_631_1395 247
2006 3300049591 Ga0501075_0404881 Ga0501075_0404881_164_925 247
2007 3300049591 Ga0501075_0470749 Ga0501075_0470749_194_940 247
2008 3300049592 Ga0501076_0017499 Ga0501076_0017499_1918_2682 247
2009 3300049593 Ga0501077_0073390 Ga0501077_0073390_803_1567 247
2010 3300049741 Ga0501079_0185733 Ga0501079_0185733_451_1212 247
2011 3300049741 Ga0501079_0321143 Ga0501079_0321143_365_1111 247
2012 3300049742 Ga0501080_0057180 Ga0501080_0057180_1692_2456 247
2013 3300049743 Ga0501081_0137975 Ga0501081_0137975_862_1626 247
2014 3300049744 Ga0501083_0365986 Ga0501083_0365986_102_851 247
2015 3300049822 Ga0501035_0157416 Ga0501035_0157416_690_1454 247
2016 3300049824 Ga0501045_0027290 Ga0501045_0027290_2837_3583 247
2017 3300049824 Ga0501045_0180053 Ga0501045_0180053_346_1110 247
2018 3300049824 Ga0501045_0331829 Ga0501045_0331829_112_864 247
2019 3300050489 nmdc:mga03683_39850_c1 nmdc:mga03683_39850_c1_647_1393 247
2020 3300050490 nmdc:mga03n38_6543_c1 nmdc:mga03n38_6543_c1_3236_3979 247
2021 3300050491 nmdc:mga00v17_176345_c1 nmdc:mga00v17_176345_c1_93_860 247
2022 3300050491 nmdc:mga00v17_90502_c1 nmdc:mga00v17_90502_c1_701_1447 247
2023 3300050492 nmdc:mga0yw44_70036_c1 nmdc:mga0yw44_70036_c1_596_1339 247
2024 3300050494 nmdc:mga06z11_11927_c1 nmdc:mga06z11_11927_c1_2601_3344 247
2025 3300050494 nmdc:mga06z11_151760_c1 nmdc:mga06z11_151760_c1_344_1111 247
2026 3300050495 nmdc:mga04h51_13668_c1 nmdc:mga04h51_13668_c1_49_816 247
2027 3300054114 Ga0501084_0009367 Ga0501084_0009367_10_774 247
2028 3300054114 Ga0501084_0172245 Ga0501084_0172245_618_1379 247
2029 3300060353 Ga0501082_0178841 Ga0501082_0178841_594_1346 247
2030 3300060353 Ga0501082_0418534 Ga0501082_0418534_330_1076 247
2031 3300061734 Ga0530510_0134908 Ga0530510_0134908_801_1565 247
2032 iso_pu_bacteria 8054609563 8054610253 247

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13085

Fer2_3

2Fe-2S iron-sulfur cluster binding domain

11

116

0.96

PF13237

Fer4_10

4Fe-4S dicluster domain

146

221

0.96

PF00037

Fer4

4Fe-4S binding domain

147

170

0.89

PF13183

Fer4_8

4Fe-4S dicluster domain

150

224

0.83

PF13534

Fer4_17

4Fe-4S dicluster domain

153

225

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
1kf6-assembly1.cif.gz_B e. coli quinol-fumarate reductase with bound inhibitor hqno 0.9548 4 244
5c3j-assembly1.cif.gz_B crystal structure of mitochondrial rhodoquinol-fumarate reductase from ascaris suum with ubiquinone-1 0.9439 3 235
3abv-assembly1.cif.gz_B crystal structure of porcine heart mitochondrial complex ii bound with n-biphenyl-3-yl-2-trifluoromethyl-benzamide 0.9417 3 233
1yq3-assembly1.cif.gz_B avian respiratory complex ii with oxaloacetate and ubiquinone 0.9406 1 233
8gs8-assembly1.cif.gz_B cryo-em structure of the human respiratory complex ii 0.9375 1 234
ID Description Score Start End Superfamily
4kx6N01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.979 4 105 3.10.20.30
4kx6N01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9423 4 105 3.10.20.30
af_O53669_2_103_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9421 4 105 3.10.20.30
af_Q57557_1_93_3.10.20.30 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9358 5 105 3.10.20.30
2wdqB01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9215 4 105 3.10.20.30
ID Description Score Start End GO Terms
AF-A0A4U2EWQ0-F1-model_v4 Succinate dehydrogenase iron-sulfur subunit (EC 1.3.5.1) 0.9891 4 94 GO:0006099
GO:0009055
GO:0016491
GO:0022904
GO:0051537
AF-A0A1M5BHI5-F1-model_v4 Succinate dehydrogenase iron-sulfur subunit (EC 1.3.5.1) 0.9886 4 105 GO:0006099
GO:0009055
GO:0016491
GO:0022904
GO:0051537
AF-A0A522C4A3-F1-model_v4 Succinate dehydrogenase iron-sulfur subunit 0.9744 4 97 GO:0006099
GO:0009055
GO:0016491
GO:0022904
GO:0051536
AF-A0A7V8SZG6-F1-model_v4 succinate dehydrogenase (EC 1.3.5.1) 0.9724 1 186 GO:0006099
GO:0009055
GO:0016491
GO:0022904
GO:0046872
GO:0051537
GO:0051538
GO:0051539
AF-A0A127T6Y1-F1-model_v4 DhsB: succinate dehydrogenase and fumarate reductase iron-sulfur protein 0.9699 4 126 GO:0005886
GO:0006099
GO:0009055
GO:0016491
GO:0022904
GO:0046872
GO:0051537
GO:0051538
GO:0051539

Feature Viewer

pLDDT pTM Quality
92.93 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map