F496214

General Info

Members Datasets Scaffolds Average Seq Length
1992 753 1817 105

Family's Representative Sequence

Representative Sequence 3300041492|Ga0451835_0589013|Ga0451835_0589013_138_515
Length 125
Sequence MASALINVPAKAKRGDIIEIKTLMSHIMEPGYRHMASGELVPRDIITGFICRFNGTEIFRADLFPAIAANPFMSFFTTATESGKFEFEWTGDKGFLETASASIIVRRSVKTQAASTPPRVIAVRP

Samples

Sample ID Description Type Environment
1 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
2 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
3 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
4 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
5 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
6 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
7 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
8 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
9 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
10 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
11 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
12 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
13 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
14 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
15 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
16 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
17 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
18 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
19 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
20 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
21 2791355199
22 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
23 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
24 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
25 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
26 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
27 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
28 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
29 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
30 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
31 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
32 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
33 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
34 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
35 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
36 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
37 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
38 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
39 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
40 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
41 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
42 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
43 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
44 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
45 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
46 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
47 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
48 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
49 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
50 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
51 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
52 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
53 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
54 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
55 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
56 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
57 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
58 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
59 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
60 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
61 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
62 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
63 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
64 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
65 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
66 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
67 2904699407
68 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
69 2906610324
70 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
71 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
72 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
73 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
74 2922368715
75 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
76 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
77 2922425934
78 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
79 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
80 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
81 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
82 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
83 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
84 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
85 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
86 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
87 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
88 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
89 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
90 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
91 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
92 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
93 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
94 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
95 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
96 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
97 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
98 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
99 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
100 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
101 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
102 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
103 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
104 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
105 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
106 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
107 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
108 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
109 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
110 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
111 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
112 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
113 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
114 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
115 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
116 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
117 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
118 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
119 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
120 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
121 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
122 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
123 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
124 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
125 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
126 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
127 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
128 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
129 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
130 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
131 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
132 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
133 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
134 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
135 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
136 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
137 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
138 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
139 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
140 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
141 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
142 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
143 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
144 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
145 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
146 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
147 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
148 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
149 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
150 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
151 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
152 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
153 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
154 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
155 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
156 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
157 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
158 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
159 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
160 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
161 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
162 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
163 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
164 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
165 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
166 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
167 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
168 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
169 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
170 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
171 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
172 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
173 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
174 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
175 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
176 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
177 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
178 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
179 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
180 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
181 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
182 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
183 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
184 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
185 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
186 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
187 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
188 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
189 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
190 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
191 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
192 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
193 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
194 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
195 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
196 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
197 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
198 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
199 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
200 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
201 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
202 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
203 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
204 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
205 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
206 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
207 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
208 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
209 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
210 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
211 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
212 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
213 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
214 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
215 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
216 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
217 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
218 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
219 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
220 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
221 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
222 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
223 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
224 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
225 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
226 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
227 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
228 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
229 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
230 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
231 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
232 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
233 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
234 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
235 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
236 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
237 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
238 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
239 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
240 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
241 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
242 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
243 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
244 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
245 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
246 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
247 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
248 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
249 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
250 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
251 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
252 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
253 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
254 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
255 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
256 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
257 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
258 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
259 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
260 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
261 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
262 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
263 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
264 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
265 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
266 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
267 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
268 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
269 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
270 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
271 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
272 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
273 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
274 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
275 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
276 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
277 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
278 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
279 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
280 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
281 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
282 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
283 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
284 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
285 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
286 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
287 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
288 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
289 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
290 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
291 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
292 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
293 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
294 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
295 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
296 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
297 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
298 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
299 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
300 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
301 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
302 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
303 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
304 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
305 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
306 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
307 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
308 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
309 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
310 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
311 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
312 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
313 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
314 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
315 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
316 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
317 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
318 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
319 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
320 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
321 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
322 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
323 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
324 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
325 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
326 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
327 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
328 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
329 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
330 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
331 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
332 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
333 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
334 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
335 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
336 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
337 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
338 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
339 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
340 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
341 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
342 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
343 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
344 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
345 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
346 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
347 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
348 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
349 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
350 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
351 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
352 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
353 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
354 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
355 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
356 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
357 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
358 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
359 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
360 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
361 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
362 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
363 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
364 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
365 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
366 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
367 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
368 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
369 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
370 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
371 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
372 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
373 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
374 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
375 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
376 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
377 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
378 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
379 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
380 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
381 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
382 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
383 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
384 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
385 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
386 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
387 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
388 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
389 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
390 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
391 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
392 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
393 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
394 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
395 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
396 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
397 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
398 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
399 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
400 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
401 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
402 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
403 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
404 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
405 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
406 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
407 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
408 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
409 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
410 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
411 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
412 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
413 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
414 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
415 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
416 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
417 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
418 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
419 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
420 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
421 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
422 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
423 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
424 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
425 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
426 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
427 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
428 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
429 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
430 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
431 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
432 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
433 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
434 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
435 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
436 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
437 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
438 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
439 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
440 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
441 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
442 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
443 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
444 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
445 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
446 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
447 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
448 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
449 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
450 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
451 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
452 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
453 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
454 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
455 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
456 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
457 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
458 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
459 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
460 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
461 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
462 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
463 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
464 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
465 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
466 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
467 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
468 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
469 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
470 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
471 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
472 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
473 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
474 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
475 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
476 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
477 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
478 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
479 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
480 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
481 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
482 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
483 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
484 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
485 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
486 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
487 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
488 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
489 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
490 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
491 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
492 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
493 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
494 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
495 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
496 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
497 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
498 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
499 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
500 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
501 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
502 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
503 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
504 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
505 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
506 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
507 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
508 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
509 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
510 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
511 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
512 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
513 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
514 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
515 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
516 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
517 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
518 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
519 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
520 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
521 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
522 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
523 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
524 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
525 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
526 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
527 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
528 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
529 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
530 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
531 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
532 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
533 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
534 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
535 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
536 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
537 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
538 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
539 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
540 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
541 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
542 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
543 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
544 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
545 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
546 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
547 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
548 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
549 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
550 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
551 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
552 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
553 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
554 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
555 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
556 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
557 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
558 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
559 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
560 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
561 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
562 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
563 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
564 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
565 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
566 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
567 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
568 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
569 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
570 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
571 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
572 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
573 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
574 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
575 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
576 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
577 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
578 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
579 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
580 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
581 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
582 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
583 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
584 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
585 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
586 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
587 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
588 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
589 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
590 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
591 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
592 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
593 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
594 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
595 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
596 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
597 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
598 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
599 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
600 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
601 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
602 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
603 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
604 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
605 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
606 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
607 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
608 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
609 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
610 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
611 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
612 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
613 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
614 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
615 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
616 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
617 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
618 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
619 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
620 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
621 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
622 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
623 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
624 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
625 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
626 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
627 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
628 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
629 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
630 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
631 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
632 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
633 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
634 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
635 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
636 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
637 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
638 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
639 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
640 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
641 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
642 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
643 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
644 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
645 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
646 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
647 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
648 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
649 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
650 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
651 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
652 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
653 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
654 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
655 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
656 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
657 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
658 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
659 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
660 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
661 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
662 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
663 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
664 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
665 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
666 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
667 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
668 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
669 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
670 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
671 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
672 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
673 3300053106 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 endosphere Metagenome Endosphere
674 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
675 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
676 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
677 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
678 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
679 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
680 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
681 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
682 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
683 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
684 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
685 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
686 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
687 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
688 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
689 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
690 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
691 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
692 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
693 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
694 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
695 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
696 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
697 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
698 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
699 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
700 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
701 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
702 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
703 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
704 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
705 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
706 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
707 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
708 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
709 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
710 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
711 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
712 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
713 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
714 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
715 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
716 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
717 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
718 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
719 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
720 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
721 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
722 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
723 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
724 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
725 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
726 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
727 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
728 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
729 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
730 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
731 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
732 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
733 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
734 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
735 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
736 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
737 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
738 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
739 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
740 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
741 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
742 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
743 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
744 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
745 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
746 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
747 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
748 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
749 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
750 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
751 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
752 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
753 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 91.34
Metatranscriptomes 0.1
Isolates 8.56

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.05
Nodule 7.73
Rhizoplane 7.13
Rhizosphere 65.06
Stem 0
Stem Tuber 0
Unclassified 7.03

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10116025 3300001989 Bacteria 802
2 JGI24739J22299_10116862 3300001989 Bacteria 798
3 JGI24034J26672_10029778 3300002239 Bacteria 885
4 JGI25406J46586_10014944 3300003203 Bacteria 3287
5 JGI25406J46586_10095467 3300003203 Bacteria 892
6 JGI25153J46596_10000317 3300003215 Bacteria 35509
7 JGI25153J46596_10004814 3300003215 Bacteria 7190
8 JGI25153J46596_10005866 3300003215 Bacteria 6357
9 JGI25153J46596_10007843 3300003215 Bacteria 5184
10 JGI25153J46596_10012385 3300003215 Bacteria 3683
11 rootH2_10065932 3300003320 Bacteria 1410
12 rootH2_10191834 3300003320 Bacteria 1576
13 rootH1_10061598 3300003323 Bacteria 1256
14 JGI25160J50197_1002533 3300003354 Bacteria 8470
15 JGI25160J50197_1007102 3300003354 Bacteria 4422
16 JGI25404J52841_10000871 3300003659 Bacteria 4882
17 JGI25404J52841_10007910 3300003659 Bacteria 2256
18 JGI25404J52841_10008582 3300003659 Bacteria 2178
19 JGI25404J52841_10025548 3300003659 Bacteria 1272
20 JGI25404J52841_10029100 3300003659 Bacteria 1185
21 JGI25404J52841_10037822 3300003659 Bacteria 1025
22 JGI25404J52841_10042107 3300003659 Bacteria 966
23 JGI25404J52841_10052353 3300003659 Bacteria 857
24 JGI25404J52841_10083583 3300003659 Bacteria 667
25 Ga0055539_1012434 3300003752 Bacteria 1046
26 Ga0055542_1006210 3300003762 Bacteria 2583
27 JGI25405J52794_10076813 3300003911 Bacteria 732
28 Ga0055543_1014610 3300004625 Bacteria 1528
29 Ga0055543_1024903 3300004625 Bacteria 1072
30 Ga0065165_1000747 3300005262 Bacteria 44635
31 Ga0065165_1028625 3300005262 Bacteria 1796
32 Ga0065712_10415587 3300005290 Bacteria 717
33 Ga0065715_10644930 3300005293 Bacteria 682
34 Ga0065715_11024783 3300005293 Bacteria 539
35 Ga0065707_10276170 3300005295 Bacteria 1059
36 Ga0070658_10136673 3300005327 Bacteria 2045
37 Ga0070676_10133797 3300005328 Bacteria 1571
38 Ga0070676_11115087 3300005328 Bacteria 597
39 Ga0070683_100076181 3300005329 Bacteria 3135
40 Ga0070683_100315205 3300005329 Bacteria 1488
41 Ga0070683_100649752 3300005329 Bacteria 1010
42 Ga0070683_100856652 3300005329 Bacteria 871
43 Ga0070670_100380916 3300005331 Bacteria 1243
44 Ga0070670_100772361 3300005331 Bacteria 867
45 Ga0068869_100029055 3300005334 Bacteria 3869
46 Ga0068869_100074710 3300005334 Bacteria 2516
47 Ga0068869_100217523 3300005334 Bacteria 1513
48 Ga0068869_100645898 3300005334 Bacteria 898
49 Ga0068869_101079417 3300005334 Bacteria 702
50 Ga0068869_101242578 3300005334 Bacteria 656
51 Ga0070666_11078737 3300005335 Bacteria 597
52 Ga0070666_11515301 3300005335 Bacteria 502
53 Ga0070680_100023775 3300005336 Bacteria 4891
54 Ga0070680_100064981 3300005336 Bacteria 2990
55 Ga0070680_100119741 3300005336 Bacteria 2197
56 Ga0070680_100142232 3300005336 Bacteria 2012
57 Ga0070682_100064502 3300005337 Bacteria 2325
58 Ga0070682_101571997 3300005337 Bacteria 568
59 Ga0068868_100048941 3300005338 Bacteria 3317
60 Ga0068868_100232925 3300005338 Bacteria 1545
61 Ga0068868_100491401 3300005338 Bacteria 1074
62 Ga0068868_100860479 3300005338 Bacteria 822
63 Ga0070660_100037797 3300005339 Bacteria 3660
64 Ga0070660_100360751 3300005339 Bacteria 1198
65 Ga0070660_100421791 3300005339 Bacteria 1105
66 Ga0070660_101269811 3300005339 Bacteria 625
67 Ga0070689_100282595 3300005340 Bacteria 1377
68 Ga0070691_10108586 3300005341 Bacteria 1386
69 Ga0070691_10920039 3300005341 Bacteria 541
70 Ga0070691_11016258 3300005341 Bacteria 518
71 Ga0070687_100176927 3300005343 Bacteria 1275
72 Ga0070687_101111280 3300005343 Bacteria 579
73 Ga0070661_100104163 3300005344 Bacteria 2113
74 Ga0070661_100191217 3300005344 Bacteria 1561
75 Ga0070668_100027260 3300005347 Bacteria 4337
76 Ga0070668_100101314 3300005347 Bacteria 2282
77 Ga0070668_100113621 3300005347 Bacteria 2157
78 Ga0070668_100125736 3300005347 Bacteria 2053
79 Ga0070668_100645654 3300005347 Bacteria 929
80 Ga0070668_100990526 3300005347 Unclassified 755
81 Ga0070668_101164617 3300005347 Bacteria 697
82 Ga0070668_101569422 3300005347 Bacteria 603
83 Ga0070668_101569955 3300005347 Bacteria 602
84 Ga0070668_102132827 3300005347 Bacteria 518
85 Ga0070669_100156285 3300005353 Bacteria 1769
86 Ga0070675_100734767 3300005354 Bacteria 900
87 Ga0070675_101601728 3300005354 Bacteria 601
88 Ga0070671_100044655 3300005355 Bacteria 3682
89 Ga0070671_100104083 3300005355 Bacteria 2382
90 Ga0070671_100250472 3300005355 Bacteria 1505
91 Ga0070671_100460904 3300005355 Bacteria 1091
92 Ga0070674_100046227 3300005356 Bacteria 2977
93 Ga0070674_100297571 3300005356 Bacteria 1285
94 Ga0070674_101485558 3300005356 Bacteria 609
95 Ga0070673_100350114 3300005364 Bacteria 1311
96 Ga0070673_100660418 3300005364 Bacteria 958
97 Ga0070673_100748112 3300005364 Bacteria 900
98 Ga0070688_100738557 3300005365 Bacteria 765
99 Ga0070659_100201438 3300005366 Bacteria 1639
100 Ga0070659_100263299 3300005366 Bacteria 1431
101 Ga0070659_100908230 3300005366 Bacteria 770
102 Ga0070659_101897469 3300005366 Bacteria 534
103 Ga0070667_100146893 3300005367 Bacteria 2069
104 Ga0070667_100437851 3300005367 Bacteria 1193
105 Ga0070667_100566634 3300005367 Bacteria 1045
106 Ga0070667_100606564 3300005367 Bacteria 1009
107 Ga0070667_100955227 3300005367 Bacteria 799
108 Ga0070667_100960770 3300005367 Bacteria 796
109 Ga0070703_10120652 3300005406 Bacteria 951
110 Ga0070709_10002197 3300005434 Bacteria 10578
111 Ga0070709_10036355 3300005434 Bacteria 2999
112 Ga0070709_10250031 3300005434 Bacteria 1277
113 Ga0070709_10571818 3300005434 Bacteria 867
114 Ga0070709_11437574 3300005434 Bacteria 559
115 Ga0070714_100002801 3300005435 Bacteria 12865
116 Ga0070714_100107849 3300005435 Bacteria 2462
117 Ga0070714_100468732 3300005435 Bacteria 1198
118 Ga0070713_100101308 3300005436 Bacteria 2495
119 Ga0070713_100257137 3300005436 Bacteria 1595
120 Ga0070713_100532737 3300005436 Bacteria 1111
121 Ga0070713_101947650 3300005436 Bacteria 570
122 Ga0070710_10000678 3300005437 Bacteria 16149
123 Ga0070710_10040951 3300005437 Bacteria 2555
124 Ga0070710_10213194 3300005437 Bacteria 1225
125 Ga0070710_10676579 3300005437 Bacteria 726
126 Ga0070701_10245988 3300005438 Bacteria 1078
127 Ga0070711_100012735 3300005439 Bacteria 5264
128 Ga0070711_100030578 3300005439 Bacteria 3566
129 Ga0070711_100287231 3300005439 Bacteria 1304
130 Ga0070711_100518087 3300005439 Bacteria 985
131 Ga0070711_101333064 3300005439 Unclassified 623
132 Ga0070700_100107452 3300005441 Bacteria 1849
133 Ga0070700_100141268 3300005441 Bacteria 1637
134 Ga0070708_100962523 3300005445 Bacteria 801
135 Ga0070708_101800275 3300005445 Unclassified 568
136 Ga0070663_100008949 3300005455 Bacteria 6183
137 Ga0070663_100034033 3300005455 Bacteria 3525
138 Ga0070663_100047641 3300005455 Bacteria 3036
139 Ga0070663_100053262 3300005455 Bacteria 2888
140 Ga0070663_100186548 3300005455 Bacteria 1612
141 Ga0070663_100451553 3300005455 Bacteria 1059
142 Ga0070663_100616170 3300005455 Bacteria 914
143 Ga0070663_100877351 3300005455 Bacteria 774
144 Ga0070663_101697054 3300005455 Bacteria 565
145 Ga0070678_100094705 3300005456 Bacteria 2299
146 Ga0070678_100095574 3300005456 Bacteria 2290
147 Ga0070678_100235114 3300005456 Bacteria 1529
148 Ga0070678_100563910 3300005456 Bacteria 1012
149 Ga0070678_101067052 3300005456 Bacteria 745
150 Ga0070678_101327549 3300005456 Bacteria 670
151 Ga0070678_101742792 3300005456 Bacteria 587
152 Ga0070678_102016410 3300005456 Bacteria 546
153 Ga0070662_100044307 3300005457 Bacteria 3186
154 Ga0070662_100049683 3300005457 Bacteria 3025
155 Ga0070662_100237999 3300005457 Bacteria 1459
156 Ga0070662_100262055 3300005457 Bacteria 1393
157 Ga0070662_100808928 3300005457 Bacteria 797
158 Ga0070662_101115648 3300005457 Bacteria 677
159 Ga0070681_10022753 3300005458 Bacteria 6298
160 Ga0070681_10090364 3300005458 Bacteria 3013
161 Ga0070681_10304038 3300005458 Bacteria 1504
162 Ga0070681_10390344 3300005458 Bacteria 1303
163 Ga0068867_100280406 3300005459 Bacteria 1366
164 Ga0068867_101700612 3300005459 Bacteria 592
165 Ga0070685_10428649 3300005466 Bacteria 922
166 Ga0070685_10594279 3300005466 Bacteria 796
167 Ga0070706_100141178 3300005467 Bacteria 2249
168 Ga0070707_100602760 3300005468 Bacteria 1061
169 Ga0070698_100291619 3300005471 Bacteria 1562
170 Ga0070699_100326955 3300005518 Bacteria 1379
171 Ga0070699_100963944 3300005518 Bacteria 782
172 Ga0070679_100106692 3300005530 Bacteria 2787
173 Ga0070679_100645170 3300005530 Bacteria 1001
174 Ga0070679_100750704 3300005530 Bacteria 918
175 Ga0070679_101075727 3300005530 Bacteria 749
176 Ga0070679_101397953 3300005530 Bacteria 646
177 Ga0070684_100009391 3300005535 Bacteria 7700
178 Ga0070684_100065826 3300005535 Bacteria 3181
179 Ga0070684_100156524 3300005535 Bacteria 2066
180 Ga0070684_100559927 3300005535 Bacteria 1061
181 Ga0068853_100207247 3300005539 Bacteria 1786
182 Ga0068853_100211567 3300005539 Bacteria 1768
183 Ga0068853_100252508 3300005539 Bacteria 1619
184 Ga0068853_100483256 3300005539 Bacteria 1168
185 Ga0068853_100810353 3300005539 Bacteria 897
186 Ga0068853_101776561 3300005539 Bacteria 598
187 Ga0070672_100065744 3300005543 Bacteria 2869
188 Ga0070672_100143728 3300005543 Bacteria 1970
189 Ga0070672_100831430 3300005543 Bacteria 813
190 Ga0070672_101204135 3300005543 Bacteria 675
191 Ga0070686_101043113 3300005544 Bacteria 673
192 Ga0070695_100189432 3300005545 Bacteria 1463
193 Ga0070695_100290061 3300005545 Bacteria 1206
194 Ga0070696_100525428 3300005546 Bacteria 945
195 Ga0070696_100691291 3300005546 Bacteria 831
196 Ga0070696_100998809 3300005546 Bacteria 699
197 Ga0070693_100448625 3300005547 Bacteria 905
198 Ga0070693_100468175 3300005547 Bacteria 888
199 Ga0070693_100894844 3300005547 Bacteria 665
200 Ga0070665_100023384 3300005548 Bacteria 6222
201 Ga0070665_100051490 3300005548 Bacteria 4129
202 Ga0070665_100078654 3300005548 Bacteria 3304
203 Ga0070665_100099122 3300005548 Bacteria 2918
204 Ga0070665_100123917 3300005548 Bacteria 2586
205 Ga0070665_100134445 3300005548 Bacteria 2475
206 Ga0070665_100349116 3300005548 Bacteria 1485
207 Ga0070665_100401676 3300005548 Bacteria 1378
208 Ga0070665_100572960 3300005548 Bacteria 1142
209 Ga0070665_100790620 3300005548 Bacteria 962
210 Ga0070665_100819186 3300005548 Bacteria 944
211 Ga0070665_101546117 3300005548 Bacteria 672
212 Ga0070665_101985406 3300005548 Bacteria 587
213 Ga0070704_100319412 3300005549 Bacteria 1300
214 Ga0068855_100176362 3300005563 Bacteria 2418
215 Ga0068855_100181159 3300005563 Bacteria 2382
216 Ga0068855_100392661 3300005563 Bacteria 1522
217 Ga0068855_100925958 3300005563 Bacteria 919
218 Ga0070664_100084031 3300005564 Bacteria 2747
219 Ga0070664_100107954 3300005564 Bacteria 2427
220 Ga0070664_101567630 3300005564 Bacteria 624
221 Ga0070664_102022727 3300005564 Bacteria 547
222 Ga0068857_100037748 3300005577 Bacteria 4280
223 Ga0068857_100059974 3300005577 Bacteria 3380
224 Ga0068857_100276573 3300005577 Bacteria 1544
225 Ga0068857_100404371 3300005577 Bacteria 1271
226 Ga0068857_101130912 3300005577 Bacteria 757
227 Ga0068854_100097953 3300005578 Bacteria 2193
228 Ga0068854_100475090 3300005578 Bacteria 1049
229 Ga0068854_100838820 3300005578 Bacteria 804
230 Ga0068854_100878265 3300005578 Bacteria 787
231 Ga0068854_101242383 3300005578 Bacteria 669
232 Ga0068854_102089291 3300005578 Bacteria 523
233 Ga0068856_100079699 3300005614 Bacteria 3247
234 Ga0068856_100335083 3300005614 Bacteria 1531
235 Ga0068856_101378005 3300005614 Bacteria 720
236 Ga0068856_101595278 3300005614 Bacteria 666
237 Ga0068856_101728746 3300005614 Bacteria 638
238 Ga0068852_100006452 3300005616 Bacteria 8474
239 Ga0068852_100038198 3300005616 Bacteria 4033
240 Ga0068852_100133040 3300005616 Bacteria 2292
241 Ga0068852_100406063 3300005616 Bacteria 1341
242 Ga0068852_100426524 3300005616 Bacteria 1309
243 Ga0068852_100455793 3300005616 Bacteria 1267
244 Ga0068852_100470076 3300005616 Bacteria 1248
245 Ga0068852_100873214 3300005616 Bacteria 916
246 Ga0068852_101718998 3300005616 Bacteria 650
247 Ga0068852_101734815 3300005616 Bacteria 647
248 Ga0068852_102086375 3300005616 Bacteria 589
249 Ga0068859_100103545 3300005617 Bacteria 2904
250 Ga0068859_100181183 3300005617 Bacteria 2189
251 Ga0068859_100357364 3300005617 Bacteria 1556
252 Ga0068859_102157565 3300005617 Bacteria 615
253 Ga0068864_100058929 3300005618 Bacteria 3320
254 Ga0068864_100278065 3300005618 Bacteria 1562
255 Ga0068864_100300154 3300005618 Bacteria 1503
256 Ga0068866_10020120 3300005718 Bacteria 3052
257 Ga0068866_10121670 3300005718 Bacteria 1471
258 Ga0068861_100045277 3300005719 Bacteria 3312
259 Ga0068861_100248218 3300005719 Bacteria 1517
260 Ga0068861_100577234 3300005719 Bacteria 1029
261 Ga0068861_100652866 3300005719 Bacteria 972
262 Ga0068861_100920044 3300005719 Bacteria 830
263 Ga0068861_101560093 3300005719 Bacteria 649
264 Ga0068861_102049992 3300005719 Unclassified 571
265 Ga0068861_102242785 3300005719 Bacteria 547
266 Ga0068851_10082500 3300005834 Bacteria 1681
267 Ga0068851_10118916 3300005834 Bacteria 1418
268 Ga0068851_10311032 3300005834 Bacteria 908
269 Ga0068870_10277692 3300005840 Bacteria 1049
270 Ga0068870_10779871 3300005840 Bacteria 666
271 Ga0068870_11421920 3300005840 Bacteria 509
272 Ga0068863_100234737 3300005841 Bacteria 1770
273 Ga0068863_101347047 3300005841 Bacteria 721
274 Ga0068863_101352050 3300005841 Bacteria 720
275 Ga0068858_100119984 3300005842 Bacteria 2458
276 Ga0068858_100578938 3300005842 Bacteria 1088
277 Ga0068858_100727093 3300005842 Bacteria 966
278 Ga0068858_101185028 3300005842 Bacteria 751
279 Ga0068858_102590619 3300005842 Bacteria 501
280 Ga0068860_100153207 3300005843 Bacteria 2220
281 Ga0068860_100190322 3300005843 Bacteria 1986
282 Ga0068860_100388574 3300005843 Bacteria 1378
283 Ga0068860_101836220 3300005843 Bacteria 628
284 Ga0068862_100034594 3300005844 Bacteria 4276
285 Ga0068862_100215475 3300005844 Bacteria 1736
286 Ga0068862_100345350 3300005844 Bacteria 1379
287 Ga0068862_100809320 3300005844 Bacteria 915
288 Ga0068862_100959577 3300005844 Bacteria 844
289 Ga0068862_101260260 3300005844 Bacteria 739
290 Ga0068862_101709618 3300005844 Bacteria 638
291 Ga0081455_10030485 3300005937 Bacteria 4897
292 Ga0081455_10045444 3300005937 Bacteria 3821
293 Ga0081455_10056270 3300005937 Bacteria 3341
294 Ga0081455_10066759 3300005937 Bacteria 3002
295 Ga0081455_10248694 3300005937 Bacteria 1302
296 Ga0081455_10544844 3300005937 Bacteria 769
297 Ga0081455_10709519 3300005937 Bacteria 640
298 Ga0081455_10729471 3300005937 Bacteria 628
299 Ga0081538_10101414 3300005981 Bacteria 1448
300 Ga0081538_10172578 3300005981 Bacteria 940
301 Ga0081540_1003418 3300005983 Bacteria 12554
302 Ga0081540_1012000 3300005983 Bacteria 5740
303 Ga0081540_1014330 3300005983 Bacteria 5086
304 Ga0081540_1021006 3300005983 Bacteria 3906
305 Ga0081540_1021049 3300005983 Bacteria 3901
306 Ga0081540_1043950 3300005983 Bacteria 2286
307 Ga0081540_1064372 3300005983 Bacteria 1730
308 Ga0081540_1076996 3300005983 Bacteria 1518
309 Ga0081540_1083694 3300005983 Bacteria 1427
310 Ga0081540_1088582 3300005983 Bacteria 1368
311 Ga0081540_1088921 3300005983 Bacteria 1364
312 Ga0081539_10000220 3300005985 Bacteria 133834
313 Ga0081539_10010808 3300005985 Bacteria 7344
314 Ga0081539_10198019 3300005985 Bacteria 930
315 Ga0070717_10001656 3300006028 Bacteria 15473
316 Ga0070717_10344845 3300006028 Bacteria 1331
317 Ga0070717_10382104 3300006028 Bacteria 1263
318 Ga0075365_10024652 3300006038 Bacteria 3798
319 Ga0075365_10055451 3300006038 Bacteria 2631
320 Ga0075365_10093391 3300006038 Bacteria 2052
321 Ga0075365_10229899 3300006038 Bacteria 1302
322 Ga0075365_10490264 3300006038 Bacteria 868
323 Ga0075365_10950937 3300006038 Bacteria 606
324 Ga0075368_10011424 3300006042 Bacteria 3231
325 Ga0075368_10107462 3300006042 Bacteria 1149
326 Ga0075368_10164131 3300006042 Bacteria 932
327 Ga0075368_10395373 3300006042 Bacteria 607
328 Ga0075363_100002488 3300006048 Bacteria 7545
329 Ga0075363_100026304 3300006048 Bacteria 2976
330 Ga0075363_100181370 3300006048 Bacteria 1198
331 Ga0075363_100218521 3300006048 Bacteria 1092
332 Ga0075363_101056800 3300006048 Bacteria 502
333 Ga0075364_10024940 3300006051 Bacteria 3802
334 Ga0075364_10080988 3300006051 Bacteria 2147
335 Ga0075364_10109723 3300006051 Bacteria 1840
336 Ga0075364_10181953 3300006051 Bacteria 1422
337 Ga0070715_10398856 3300006163 Bacteria 764
338 Ga0070716_100047412 3300006173 Bacteria 2424
339 Ga0070716_100334574 3300006173 Bacteria 1066
340 Ga0070716_100405951 3300006173 Bacteria 981
341 Ga0070716_100736766 3300006173 Bacteria 757
342 Ga0070716_100743603 3300006173 Bacteria 754
343 Ga0070716_100807535 3300006173 Bacteria 727
344 Ga0070716_101681669 3300006173 Unclassified 523
345 Ga0070716_101726546 3300006173 Bacteria 517
346 Ga0070712_100022680 3300006175 Bacteria 4138
347 Ga0070712_100207598 3300006175 Bacteria 1543
348 Ga0070712_100228436 3300006175 Bacteria 1477
349 Ga0070712_100581041 3300006175 Bacteria 947
350 Ga0070712_100946375 3300006175 Bacteria 744
351 Ga0070712_101179742 3300006175 Bacteria 666
352 Ga0075362_10052802 3300006177 Bacteria 1823
353 Ga0075362_10155294 3300006177 Bacteria 1100
354 Ga0075367_10121791 3300006178 Bacteria 1608
355 Ga0075367_10453376 3300006178 Bacteria 813
356 Ga0075367_10508126 3300006178 Bacteria 765
357 Ga0075367_10537583 3300006178 Bacteria 742
358 Ga0075367_10765861 3300006178 Bacteria 614
359 Ga0075367_11026376 3300006178 Bacteria 527
360 Ga0075369_10032260 3300006186 Bacteria 2215
361 Ga0075369_10086614 3300006186 Bacteria 1394
362 Ga0075369_10240110 3300006186 Bacteria 840
363 Ga0075369_10508923 3300006186 Bacteria 573
364 Ga0075366_10033470 3300006195 Bacteria 3027
365 Ga0075366_10066567 3300006195 Bacteria 2143
366 Ga0075366_10129971 3300006195 Bacteria 1519
367 Ga0075366_10211076 3300006195 Bacteria 1182
368 Ga0075366_10332512 3300006195 Bacteria 931
369 Ga0075366_10482800 3300006195 Bacteria 766
370 Ga0097621_100099480 3300006237 Bacteria 2444
371 Ga0097621_100143816 3300006237 Bacteria 2040
372 Ga0075370_10031839 3300006353 Bacteria 2945
373 Ga0075370_10082329 3300006353 Bacteria 1851
374 Ga0075370_10149538 3300006353 Bacteria 1368
375 Ga0075370_10461448 3300006353 Bacteria 765
376 Ga0075370_10912744 3300006353 Bacteria 537
377 Ga0068871_100069423 3300006358 Bacteria 2894
378 Ga0068871_100072638 3300006358 Bacteria 2834
379 Ga0068871_100525777 3300006358 Bacteria 1069
380 Ga0068871_100686759 3300006358 Bacteria 937
381 Ga0068871_101530444 3300006358 Bacteria 631
382 Ga0075428_100208936 3300006844 Bacteria 2110
383 Ga0075428_100341471 3300006844 Bacteria 1608
384 Ga0075431_100682133 3300006847 Bacteria 1006
385 Ga0075433_11206381 3300006852 Unclassified 657
386 Ga0075434_100006763 3300006871 Bacteria 10537
387 Ga0075434_100559189 3300006871 Bacteria 1164
388 Ga0075434_101393912 3300006871 Bacteria 711
389 Ga0075429_100227680 3300006880 Bacteria 1633
390 Ga0068865_100124324 3300006881 Bacteria 1923
391 Ga0068865_100190154 3300006881 Bacteria 1587
392 Ga0068865_100541348 3300006881 Bacteria 976
393 Ga0068865_100603271 3300006881 Bacteria 928
394 Ga0075436_100247577 3300006914 Bacteria 1269
395 Ga0075436_100614745 3300006914 Bacteria 801
396 Ga0097620_100103547 3300006931 Bacteria 2904
397 Ga0097620_100181187 3300006931 Bacteria 2189
398 Ga0097620_100357379 3300006931 Bacteria 1556
399 Ga0097620_102157218 3300006931 Bacteria 615
400 Ga0099824_1011502 3300006942 Bacteria 9987
401 Ga0099823_1053057 3300006944 Bacteria 2392
402 Ga0099823_1142403 3300006944 Bacteria 542
403 Ga0075435_100034806 3300007076 Bacteria 3993
404 Ga0075435_100129312 3300007076 Bacteria 2113
405 Ga0099794_10106117 3300007265 Bacteria 1405
406 Ga0099795_10096020 3300007788 Bacteria 1156
407 Ga0099795_10177988 3300007788 Bacteria 887
408 Ga0099795_10490110 3300007788 Bacteria 572
409 Ga0105251_10067654 3300009011 Bacteria 1668
410 Ga0105250_10156739 3300009092 Bacteria 949
411 Ga0105250_10339527 3300009092 Bacteria 656
412 Ga0105240_10024721 3300009093 Bacteria 7912
413 Ga0105240_10084695 3300009093 Bacteria 3887
414 Ga0105240_10171825 3300009093 Bacteria 2566
415 Ga0105240_10379621 3300009093 Bacteria 1596
416 Ga0105240_11049920 3300009093 Bacteria 869
417 Ga0111539_10010769 3300009094 Bacteria 11512
418 Ga0111539_11209150 3300009094 Bacteria 878
419 Ga0105245_10137591 3300009098 Bacteria 2297
420 Ga0105245_10154818 3300009098 Bacteria 2170
421 Ga0105245_10260588 3300009098 Bacteria 1687
422 Ga0105245_10461621 3300009098 Bacteria 1280
423 Ga0105245_10665505 3300009098 Bacteria 1072
424 Ga0105245_10669428 3300009098 Bacteria 1069
425 Ga0105245_11828939 3300009098 Bacteria 660
426 Ga0105247_10034754 3300009101 Bacteria 3070
427 Ga0105247_10045941 3300009101 Bacteria 2680
428 Ga0105247_10100789 3300009101 Bacteria 1846
429 Ga0105247_10136111 3300009101 Bacteria 1605
430 Ga0105247_10225649 3300009101 Bacteria 1270
431 Ga0105247_10259138 3300009101 Bacteria 1192
432 Ga0105247_10810728 3300009101 Bacteria 715
433 Ga0114129_10368158 3300009147 Bacteria 1900
434 Ga0105243_10205446 3300009148 Bacteria 1730
435 Ga0105243_10387430 3300009148 Bacteria 1295
436 Ga0105243_10587780 3300009148 Bacteria 1070
437 Ga0105243_11106187 3300009148 Bacteria 801
438 Ga0105243_11544772 3300009148 Bacteria 689
439 Ga0105241_10029756 3300009174 Bacteria 4077
440 Ga0105241_10050318 3300009174 Bacteria 3175
441 Ga0105241_10073114 3300009174 Bacteria 2666
442 Ga0105241_10100450 3300009174 Bacteria 2299
443 Ga0105241_10232984 3300009174 Bacteria 1553
444 Ga0105241_10435013 3300009174 Bacteria 1157
445 Ga0105241_11213549 3300009174 Bacteria 715
446 Ga0105241_11479025 3300009174 Bacteria 653
447 Ga0105241_11859194 3300009174 Bacteria 589
448 Ga0105242_10165539 3300009176 Bacteria 1939
449 Ga0105242_10457511 3300009176 Bacteria 1204
450 Ga0105242_10467047 3300009176 Bacteria 1193
451 Ga0105248_10167112 3300009177 Bacteria 2479
452 Ga0105248_10194824 3300009177 Bacteria 2283
453 Ga0105248_10260394 3300009177 Bacteria 1953
454 Ga0105248_10265805 3300009177 Bacteria 1931
455 Ga0105248_10633494 3300009177 Bacteria 1206
456 Ga0105248_11249221 3300009177 Bacteria 840
457 Ga0105248_12510190 3300009177 Bacteria 587
458 Ga0105237_10009950 3300009545 Bacteria 10145
459 Ga0105237_10047158 3300009545 Bacteria 4332
460 Ga0105237_10113776 3300009545 Bacteria 2698
461 Ga0105237_10159241 3300009545 Bacteria 2255
462 Ga0105237_10503464 3300009545 Bacteria 1218
463 Ga0105237_10536312 3300009545 Bacteria 1177
464 Ga0105237_10578153 3300009545 Bacteria 1130
465 Ga0105237_10679083 3300009545 Bacteria 1037
466 Ga0105237_10750872 3300009545 Bacteria 982
467 Ga0105237_10822256 3300009545 Bacteria 936
468 Ga0105238_10135316 3300009551 Bacteria 2442
469 Ga0105238_10151847 3300009551 Bacteria 2291
470 Ga0105238_10331334 3300009551 Bacteria 1509
471 Ga0105238_10473029 3300009551 Bacteria 1252
472 Ga0105238_11083676 3300009551 Bacteria 823
473 Ga0105238_11716973 3300009551 Bacteria 659
474 Ga0105238_11778765 3300009551 Bacteria 648
475 Ga0105238_12219693 3300009551 Bacteria 584
476 Ga0105249_10263615 3300009553 Bacteria 1713
477 Ga0105249_10551819 3300009553 Bacteria 1203
478 Ga0105249_10575784 3300009553 Bacteria 1179
479 Ga0105249_11036827 3300009553 Bacteria 889
480 Ga0105249_11198226 3300009553 Bacteria 830
481 Ga0105249_11767243 3300009553 Bacteria 691
482 Ga0105249_12489584 3300009553 Bacteria 590
483 Ga0099796_10100427 3300010159 Bacteria 1088
484 Ga0105239_10066752 3300010375 Bacteria 3951
485 Ga0105239_10084742 3300010375 Bacteria 3492
486 Ga0105239_10127564 3300010375 Bacteria 2829
487 Ga0105239_10139452 3300010375 Bacteria 2701
488 Ga0105239_10159171 3300010375 Bacteria 2522
489 Ga0105239_10218055 3300010375 Bacteria 2139
490 Ga0105239_10235661 3300010375 Bacteria 2054
491 Ga0105239_10292556 3300010375 Bacteria 1834
492 Ga0105239_10387551 3300010375 Bacteria 1580
493 Ga0105239_10578048 3300010375 Bacteria 1281
494 Ga0105239_10685943 3300010375 Bacteria 1171
495 Ga0105239_10693422 3300010375 Bacteria 1164
496 Ga0105239_10920011 3300010375 Bacteria 1004
497 Ga0105239_10964339 3300010375 Bacteria 980
498 Ga0105239_11988113 3300010375 Bacteria 675
499 Ga0105239_12374053 3300010375 Bacteria 617
500 Ga0105246_10013775 3300011119 Bacteria 5074
501 Ga0105246_10045998 3300011119 Bacteria 2975
502 Ga0105246_10104444 3300011119 Bacteria 2069
503 Ga0105246_10266822 3300011119 Bacteria 1366
504 Ga0105246_10268572 3300011119 Bacteria 1362
505 Ga0105246_11041962 3300011119 Bacteria 743
506 Ga0157326_1040953 3300012513 Bacteria 649
507 Ga0157370_10057618 3300013104 Bacteria 3693
508 Ga0157370_10178217 3300013104 Bacteria 1975
509 Ga0157370_10917221 3300013104 Bacteria 795
510 Ga0157369_10012423 3300013105 Bacteria 9667
511 Ga0157369_11869759 3300013105 Bacteria 609
512 Ga0157369_11939108 3300013105 Bacteria 598
513 Ga0157374_10024785 3300013296 Bacteria 5379
514 Ga0157374_10040321 3300013296 Bacteria 4299
515 Ga0157374_12210038 3300013296 Bacteria 577
516 Ga0157374_12505836 3300013296 Bacteria 543
517 Ga0157378_10004961 3300013297 Bacteria 11667
518 Ga0157378_10133315 3300013297 Bacteria 2302
519 Ga0157378_10278553 3300013297 Bacteria 1611
520 Ga0157378_10662215 3300013297 Bacteria 1060
521 Ga0163162_10060239 3300013306 Bacteria 3831
522 Ga0163162_10062895 3300013306 Bacteria 3752
523 Ga0163162_10163138 3300013306 Bacteria 2351
524 Ga0163162_10184729 3300013306 Bacteria 2212
525 Ga0163162_10847605 3300013306 Bacteria 1029
526 Ga0163162_11199143 3300013306 Bacteria 861
527 Ga0163162_12465624 3300013306 Bacteria 598
528 Ga0163162_12912457 3300013306 Bacteria 551
529 Ga0157372_10577521 3300013307 Bacteria 1310
530 Ga0157375_10063269 3300013308 Bacteria 3680
531 Ga0157375_10105710 3300013308 Bacteria 2906
532 Ga0157375_10644025 3300013308 Bacteria 1216
533 Ga0163163_10060452 3300014325 Bacteria 3752
534 Ga0163163_10060614 3300014325 Bacteria 3747
535 Ga0163163_10124811 3300014325 Bacteria 2611
536 Ga0163163_10177238 3300014325 Bacteria 2178
537 Ga0163163_10352566 3300014325 Bacteria 1528
538 Ga0163163_10512413 3300014325 Bacteria 1262
539 Ga0163163_11668809 3300014325 Bacteria 698
540 Ga0163163_12797247 3300014325 Bacteria 544
541 Ga0157380_10052368 3300014326 Bacteria 3232
542 Ga0157380_10245136 3300014326 Bacteria 1618
543 Ga0157380_10271597 3300014326 Bacteria 1546
544 Ga0157380_10592277 3300014326 Bacteria 1095
545 Ga0157380_11825509 3300014326 Bacteria 667
546 Ga0157380_13065113 3300014326 Bacteria 533
547 Ga0182008_10281973 3300014497 Bacteria 865
548 Ga0157379_10092888 3300014968 Bacteria 2707
549 Ga0157379_10286016 3300014968 Bacteria 1501
550 Ga0157379_10860877 3300014968 Bacteria 858
551 Ga0157379_11332319 3300014968 Bacteria 694
552 Ga0157379_11430515 3300014968 Bacteria 671
553 Ga0157376_10053421 3300014969 Bacteria 3364
554 Ga0157376_10160876 3300014969 Bacteria 2035
555 Ga0157376_11490889 3300014969 Bacteria 709
556 Ga0182006_1166909 3300015261 Bacteria 739
557 Ga0182007_10339427 3300015262 Bacteria 561
558 Ga0163161_10049743 3300017792 Bacteria 3031
559 Ga0163161_10217819 3300017792 Bacteria 1477
560 Ga0163161_10546613 3300017792 Bacteria 949
561 Ga0163161_10651123 3300017792 Bacteria 873
562 Ga0163161_10986892 3300017792 Bacteria 718
563 Ga0163161_11152346 3300017792 Bacteria 668
564 Ga0206352_10451840 3300020078 Bacteria 815
565 Ga0214544_1000001 3300021320 Bacteria 783667
566 Ga0214544_1048277 3300021320 Bacteria 740
567 Ga0214542_1001925 3300021321 Bacteria 42950
568 Ga0214542_1052937 3300021321 Bacteria 739
569 Ga0214545_1000003 3300021324 Bacteria 720274
570 Ga0214545_1028006 3300021324 Bacteria 2774
571 Ga0214543_1000002 3300021327 Bacteria 712733
572 Ga0214543_1053896 3300021327 Bacteria 739
573 Ga0213876_10161332 3300021384 Bacteria 1192
574 Ga0213875_10000033 3300021388 Bacteria 170944
575 Ga0209563_100325 3300025230 Bacteria 18742
576 Ga0209026_1057755 3300025250 Bacteria 547
577 Ga0209026_1062214 3300025250 Bacteria 524
578 Ga0209677_102346 3300025253 Bacteria 7251
579 Ga0209677_105663 3300025253 Bacteria 3196
580 Ga0209148_1000812 3300025254 Bacteria 22632
581 Ga0209233_1002884 3300025261 Bacteria 6146
582 Ga0209233_1003610 3300025261 Bacteria 5425
583 Ga0209233_1017593 3300025261 Bacteria 1944
584 Ga0209233_1056447 3300025261 Bacteria 775
585 Ga0209233_1057131 3300025261 Bacteria 767
586 Ga0209455_1010982 3300025272 Bacteria 2261
587 Ga0209455_1015698 3300025272 Bacteria 1654
588 Ga0209564_1005325 3300025295 Bacteria 7407
589 Ga0209564_1016531 3300025295 Bacteria 2929
590 Ga0209758_1000011 3300025297 Bacteria 1049685
591 Ga0209758_1000120 3300025297 Bacteria 192212
592 Ga0209758_1000435 3300025297 Bacteria 70539
593 Ga0209758_1001848 3300025297 Bacteria 23245
594 Ga0209758_1002526 3300025297 Bacteria 18502
595 Ga0209758_1002848 3300025297 Bacteria 16788
596 Ga0209758_1008838 3300025297 Bacteria 6412
597 Ga0209758_1018387 3300025297 Bacteria 3426
598 Ga0209758_1060706 3300025297 Bacteria 1249
599 Ga0209758_1068657 3300025297 Bacteria 1127
600 Ga0209758_1069994 3300025297 Bacteria 1109
601 Ga0209758_1075221 3300025297 Bacteria 1045
602 Ga0209758_1091302 3300025297 Bacteria 891
603 Ga0209758_1119965 3300025297 Bacteria 711
604 Ga0209256_1010441 3300025299 Bacteria 3886
605 Ga0209256_1040226 3300025299 Bacteria 1196
606 Ga0209256_1083055 3300025299 Bacteria 696
607 Ga0207426_1000458 3300025302 Bacteria 64019
608 Ga0207426_1006703 3300025302 Bacteria 4942
609 Ga0207426_1014805 3300025302 Bacteria 2849
610 Ga0207426_1066486 3300025302 Bacteria 1018
611 Ga0207426_1093383 3300025302 Bacteria 792
612 Ga0209257_1001101 3300025304 Bacteria 35153
613 Ga0209257_1030664 3300025304 Bacteria 1732
614 Ga0209257_1063837 3300025304 Bacteria 992
615 Ga0207697_10144965 3300025315 Bacteria 1031
616 Ga0207656_10107837 3300025321 Bacteria 1284
617 Ga0207656_10277907 3300025321 Bacteria 825
618 Ga0207696_1082712 3300025711 Bacteria 885
619 Ga0207713_1090303 3300025735 Bacteria 1078
620 Ga0207682_10121272 3300025893 Bacteria 1160
621 Ga0207692_10000797 3300025898 Bacteria 11223
622 Ga0207692_10040116 3300025898 Bacteria 2309
623 Ga0207642_10636227 3300025899 Bacteria 667
624 Ga0207710_10115478 3300025900 Bacteria 1278
625 Ga0207710_10150701 3300025900 Bacteria 1128
626 Ga0207710_10161530 3300025900 Bacteria 1092
627 Ga0207688_10059834 3300025901 Bacteria 2145
628 Ga0207688_10062400 3300025901 Bacteria 2101
629 Ga0207688_10266632 3300025901 Bacteria 1041
630 Ga0207688_10465579 3300025901 Bacteria 789
631 Ga0207680_10737398 3300025903 Bacteria 706
632 Ga0207647_10008820 3300025904 Bacteria 7199
633 Ga0207647_10077783 3300025904 Bacteria 1994
634 Ga0207685_10690692 3300025905 Bacteria 555
635 Ga0207699_10001610 3300025906 Bacteria 10719
636 Ga0207699_10085855 3300025906 Bacteria 1964
637 Ga0207699_10530763 3300025906 Bacteria 852
638 Ga0207699_11168749 3300025906 Bacteria 570
639 Ga0207645_10132858 3300025907 Bacteria 1620
640 Ga0207645_10770504 3300025907 Bacteria 654
641 Ga0207643_10104196 3300025908 Bacteria 1666
642 Ga0207643_10471403 3300025908 Bacteria 800
643 Ga0207643_10487165 3300025908 Bacteria 787
644 Ga0207705_10195132 3300025909 Bacteria 1532
645 Ga0207705_11014313 3300025909 Bacteria 641
646 Ga0207705_11068360 3300025909 Bacteria 622
647 Ga0207705_11120616 3300025909 Bacteria 606
648 Ga0207684_10372915 3300025910 Bacteria 1228
649 Ga0207684_10832422 3300025910 Bacteria 779
650 Ga0207654_10020891 3300025911 Bacteria 3476
651 Ga0207654_10029833 3300025911 Bacteria 2990
652 Ga0207654_10119575 3300025911 Bacteria 1652
653 Ga0207654_10397877 3300025911 Bacteria 957
654 Ga0207654_10444023 3300025911 Bacteria 909
655 Ga0207654_10499062 3300025911 Bacteria 859
656 Ga0207707_10000886 3300025912 Bacteria 29266
657 Ga0207707_10031075 3300025912 Bacteria 4672
658 Ga0207707_10518469 3300025912 Bacteria 1015
659 Ga0207707_10563285 3300025912 Bacteria 967
660 Ga0207707_10783900 3300025912 Bacteria 795
661 Ga0207707_11528242 3300025912 Bacteria 528
662 Ga0207695_10000163 3300025913 Bacteria 197030
663 Ga0207695_10306738 3300025913 Bacteria 1478
664 Ga0207695_10415311 3300025913 Bacteria 1230
665 Ga0207695_10458658 3300025913 Bacteria 1158
666 Ga0207671_10056823 3300025914 Bacteria 2900
667 Ga0207671_10058973 3300025914 Bacteria 2846
668 Ga0207671_10110956 3300025914 Bacteria 2087
669 Ga0207671_10347827 3300025914 Bacteria 1175
670 Ga0207671_10378502 3300025914 Bacteria 1124
671 Ga0207671_10694687 3300025914 Bacteria 809
672 Ga0207671_10799111 3300025914 Bacteria 748
673 Ga0207671_10860590 3300025914 Bacteria 718
674 Ga0207671_11074707 3300025914 Bacteria 633
675 Ga0207671_11269545 3300025914 Bacteria 574
676 Ga0207693_10034047 3300025915 Bacteria 4019
677 Ga0207693_10203094 3300025915 Bacteria 1558
678 Ga0207693_10370390 3300025915 Bacteria 1120
679 Ga0207693_10501300 3300025915 Bacteria 948
680 Ga0207693_10810939 3300025915 Bacteria 721
681 Ga0207663_10121345 3300025916 Bacteria 1790
682 Ga0207663_10627550 3300025916 Bacteria 846
683 Ga0207663_11276049 3300025916 Unclassified 592
684 Ga0207660_10010388 3300025917 Bacteria 6040
685 Ga0207660_10022287 3300025917 Bacteria 4267
686 Ga0207660_10027535 3300025917 Bacteria 3880
687 Ga0207660_10256833 3300025917 Bacteria 1380
688 Ga0207660_10510935 3300025917 Bacteria 975
689 Ga0207660_10516702 3300025917 Bacteria 969
690 Ga0207662_10177795 3300025918 Bacteria 1368
691 Ga0207657_10008437 3300025919 Bacteria 10455
692 Ga0207657_10319838 3300025919 Bacteria 1227
693 Ga0207657_11262655 3300025919 Bacteria 559
694 Ga0207649_10163987 3300025920 Bacteria 1542
695 Ga0207649_11209315 3300025920 Bacteria 597
696 Ga0207649_11283566 3300025920 Bacteria 579
697 Ga0207649_11663260 3300025920 Bacteria 505
698 Ga0207652_10105158 3300025921 Bacteria 2498
699 Ga0207652_10118636 3300025921 Bacteria 2352
700 Ga0207652_10446869 3300025921 Bacteria 1165
701 Ga0207652_10948233 3300025921 Bacteria 758
702 Ga0207646_10656333 3300025922 Bacteria 939
703 Ga0207646_11585676 3300025922 Bacteria 565
704 Ga0207681_10036681 3300025923 Bacteria 3236
705 Ga0207681_10208829 3300025923 Bacteria 1504
706 Ga0207681_10293023 3300025923 Bacteria 1285
707 Ga0207681_10818262 3300025923 Bacteria 778
708 Ga0207694_10143224 3300025924 Bacteria 1923
709 Ga0207694_10203424 3300025924 Bacteria 1611
710 Ga0207694_10208299 3300025924 Bacteria 1592
711 Ga0207694_10230767 3300025924 Bacteria 1511
712 Ga0207694_10282251 3300025924 Bacteria 1364
713 Ga0207694_10471864 3300025924 Bacteria 1049
714 Ga0207694_10825971 3300025924 Bacteria 783
715 Ga0207694_10859654 3300025924 Bacteria 767
716 Ga0207694_11089264 3300025924 Bacteria 676
717 Ga0207694_11132784 3300025924 Bacteria 662
718 Ga0207694_11483488 3300025924 Bacteria 572
719 Ga0207694_11520128 3300025924 Bacteria 565
720 Ga0207694_11741407 3300025924 Bacteria 524
721 Ga0207650_10527525 3300025925 Bacteria 988
722 Ga0207650_10840672 3300025925 Bacteria 779
723 Ga0207659_11071392 3300025926 Bacteria 694
724 Ga0207687_10218131 3300025927 Bacteria 1500
725 Ga0207687_10280699 3300025927 Bacteria 1335
726 Ga0207687_10327438 3300025927 Bacteria 1242
727 Ga0207687_10842430 3300025927 Bacteria 783
728 Ga0207700_10007466 3300025928 Bacteria 6681
729 Ga0207700_10052174 3300025928 Bacteria 3056
730 Ga0207700_10612413 3300025928 Bacteria 969
731 Ga0207700_10756811 3300025928 Bacteria 868
732 Ga0207700_10761249 3300025928 Bacteria 865
733 Ga0207664_10007788 3300025929 Bacteria 7438
734 Ga0207664_10267241 3300025929 Bacteria 1497
735 Ga0207664_10628867 3300025929 Bacteria 964
736 Ga0207664_12004164 3300025929 Unclassified 502
737 Ga0207644_10188346 3300025931 Bacteria 1621
738 Ga0207644_10396610 3300025931 Bacteria 1127
739 Ga0207644_10573103 3300025931 Bacteria 936
740 Ga0207644_11573672 3300025931 Bacteria 551
741 Ga0207690_10014466 3300025932 Bacteria 4767
742 Ga0207690_10100093 3300025932 Bacteria 2068
743 Ga0207690_11290918 3300025932 Bacteria 610
744 Ga0207706_10059649 3300025933 Bacteria 3360
745 Ga0207706_10321227 3300025933 Bacteria 1347
746 Ga0207706_11078484 3300025933 Bacteria 672
747 Ga0207706_11296498 3300025933 Bacteria 602
748 Ga0207686_10089706 3300025934 Bacteria 2027
749 Ga0207686_10103845 3300025934 Bacteria 1902
750 Ga0207686_10340382 3300025934 Bacteria 1126
751 Ga0207686_10390090 3300025934 Bacteria 1058
752 Ga0207709_10040013 3300025935 Bacteria 2804
753 Ga0207709_10446371 3300025935 Bacteria 999
754 Ga0207709_11200635 3300025935 Bacteria 625
755 Ga0207709_11255427 3300025935 Bacteria 611
756 Ga0207670_10372014 3300025936 Bacteria 1136
757 Ga0207670_10470731 3300025936 Bacteria 1016
758 Ga0207669_10005298 3300025937 Bacteria 5770
759 Ga0207669_10157627 3300025937 Bacteria 1599
760 Ga0207704_10175381 3300025938 Bacteria 1543
761 Ga0207704_10222242 3300025938 Bacteria 1398
762 Ga0207704_10267067 3300025938 Bacteria 1293
763 Ga0207704_10343707 3300025938 Bacteria 1159
764 Ga0207704_10543832 3300025938 Bacteria 943
765 Ga0207704_11010744 3300025938 Bacteria 704
766 Ga0207704_11704287 3300025938 Bacteria 542
767 Ga0207665_10065508 3300025939 Bacteria 2471
768 Ga0207665_10116671 3300025939 Bacteria 1882
769 Ga0207665_10210186 3300025939 Bacteria 1421
770 Ga0207665_10335289 3300025939 Unclassified 1138
771 Ga0207665_10596888 3300025939 Bacteria 862
772 Ga0207665_10733330 3300025939 Bacteria 778
773 Ga0207665_10767086 3300025939 Bacteria 761
774 Ga0207691_10025303 3300025940 Bacteria 5574
775 Ga0207691_10148496 3300025940 Bacteria 2062
776 Ga0207691_10546478 3300025940 Bacteria 982
777 Ga0207691_10585505 3300025940 Bacteria 945
778 Ga0207711_10420248 3300025941 Bacteria 1243
779 Ga0207711_10496565 3300025941 Bacteria 1137
780 Ga0207711_10864244 3300025941 Bacteria 841
781 Ga0207711_11043965 3300025941 Bacteria 757
782 Ga0207689_10019353 3300025942 Bacteria 5738
783 Ga0207689_10036827 3300025942 Bacteria 4060
784 Ga0207689_10117631 3300025942 Bacteria 2185
785 Ga0207689_10861500 3300025942 Bacteria 765
786 Ga0207689_10896718 3300025942 Bacteria 748
787 Ga0207661_10018951 3300025944 Bacteria 5120
788 Ga0207661_10040025 3300025944 Bacteria 3683
789 Ga0207661_10254792 3300025944 Bacteria 1561
790 Ga0207661_10779078 3300025944 Bacteria 880
791 Ga0207679_10336118 3300025945 Bacteria 1312
792 Ga0207679_11479639 3300025945 Bacteria 623
793 Ga0207667_10019974 3300025949 Bacteria 7463
794 Ga0207667_10113813 3300025949 Bacteria 2789
795 Ga0207667_10172122 3300025949 Bacteria 2225
796 Ga0207667_10189492 3300025949 Bacteria 2111
797 Ga0207667_10356397 3300025949 Bacteria 1492
798 Ga0207667_10474438 3300025949 Bacteria 1270
799 Ga0207651_10810511 3300025960 Bacteria 830
800 Ga0207651_11457764 3300025960 Bacteria 616
801 Ga0207651_11547555 3300025960 Bacteria 597
802 Ga0207712_10082756 3300025961 Bacteria 2341
803 Ga0207712_10337782 3300025961 Bacteria 1248
804 Ga0207712_10675449 3300025961 Bacteria 900
805 Ga0207712_10829072 3300025961 Bacteria 814
806 Ga0207712_11063109 3300025961 Bacteria 719
807 Ga0207668_10030855 3300025972 Bacteria 3525
808 Ga0207668_10064631 3300025972 Bacteria 2586
809 Ga0207668_10069258 3300025972 Bacteria 2511
810 Ga0207668_10108642 3300025972 Bacteria 2076
811 Ga0207668_10119579 3300025972 Bacteria 1992
812 Ga0207668_10151383 3300025972 Bacteria 1796
813 Ga0207668_10318838 3300025972 Bacteria 1289
814 Ga0207668_10826765 3300025972 Bacteria 821
815 Ga0207640_10103726 3300025981 Bacteria 2000
816 Ga0207640_10187043 3300025981 Bacteria 1558
817 Ga0207640_10371814 3300025981 Bacteria 1155
818 Ga0207640_10569523 3300025981 Bacteria 954
819 Ga0207640_10769184 3300025981 Bacteria 832
820 Ga0207640_11678143 3300025981 Bacteria 573
821 Ga0207658_10059201 3300025986 Bacteria 2854
822 Ga0207658_10109147 3300025986 Bacteria 2184
823 Ga0207658_10609077 3300025986 Bacteria 982
824 Ga0207658_10935166 3300025986 Bacteria 790
825 Ga0207658_11089706 3300025986 Bacteria 729
826 Ga0207677_10073769 3300026023 Bacteria 2418
827 Ga0207677_10348208 3300026023 Bacteria 1240
828 Ga0207677_11013682 3300026023 Bacteria 753
829 Ga0207677_11040851 3300026023 Unclassified 744
830 Ga0207677_11763024 3300026023 Bacteria 574
831 Ga0207703_10127440 3300026035 Bacteria 2193
832 Ga0207703_10129128 3300026035 Bacteria 2180
833 Ga0207703_10406199 3300026035 Bacteria 1264
834 Ga0207703_10725421 3300026035 Bacteria 946
835 Ga0207639_10034032 3300026041 Bacteria 3763
836 Ga0207639_10151261 3300026041 Bacteria 1944
837 Ga0207639_10519278 3300026041 Bacteria 1090
838 Ga0207639_10768729 3300026041 Bacteria 896
839 Ga0207639_10782080 3300026041 Bacteria 889
840 Ga0207639_10786226 3300026041 Bacteria 886
841 Ga0207639_10929280 3300026041 Bacteria 813
842 Ga0207639_11324289 3300026041 Bacteria 676
843 Ga0207639_11389984 3300026041 Bacteria 659
844 Ga0207678_10017857 3300026067 Bacteria 6231
845 Ga0207678_10022393 3300026067 Bacteria 5534
846 Ga0207678_10026311 3300026067 Bacteria 5076
847 Ga0207678_10033211 3300026067 Bacteria 4496
848 Ga0207678_10034200 3300026067 Bacteria 4427
849 Ga0207678_10035164 3300026067 Bacteria 4362
850 Ga0207678_10050960 3300026067 Bacteria 3575
851 Ga0207678_10647530 3300026067 Bacteria 928
852 Ga0207678_11035574 3300026067 Bacteria 727
853 Ga0207708_10062133 3300026075 Bacteria 2853
854 Ga0207702_10087083 3300026078 Bacteria 2725
855 Ga0207702_11011113 3300026078 Bacteria 825
856 Ga0207702_11183444 3300026078 Bacteria 759
857 Ga0207702_11638785 3300026078 Bacteria 636
858 Ga0207641_10203963 3300026088 Bacteria 1825
859 Ga0207641_10575879 3300026088 Bacteria 1100
860 Ga0207641_10622795 3300026088 Bacteria 1058
861 Ga0207641_10646257 3300026088 Bacteria 1039
862 Ga0207641_11294181 3300026088 Bacteria 729
863 Ga0207648_10032340 3300026089 Bacteria 4619
864 Ga0207648_10372821 3300026089 Unclassified 1289
865 Ga0207648_11121351 3300026089 Bacteria 738
866 Ga0207676_10068020 3300026095 Bacteria 2847
867 Ga0207676_10125942 3300026095 Bacteria 2170
868 Ga0207676_10177406 3300026095 Bacteria 1862
869 Ga0207676_10209105 3300026095 Bacteria 1730
870 Ga0207676_10440842 3300026095 Bacteria 1226
871 Ga0207676_12061563 3300026095 Bacteria 569
872 Ga0207676_12587968 3300026095 Bacteria 504
873 Ga0207674_10007720 3300026116 Bacteria 12520
874 Ga0207674_10078663 3300026116 Bacteria 3303
875 Ga0207674_10167564 3300026116 Bacteria 2150
876 Ga0207674_10200587 3300026116 Bacteria 1944
877 Ga0207675_100048212 3300026118 Bacteria 3977
878 Ga0207675_100058719 3300026118 Bacteria 3590
879 Ga0207675_100293273 3300026118 Bacteria 1582
880 Ga0207675_100763214 3300026118 Bacteria 979
881 Ga0207675_101916778 3300026118 Bacteria 611
882 Ga0207675_102016267 3300026118 Unclassified 594
883 Ga0207675_102215922 3300026118 Bacteria 564
884 Ga0207675_102742402 3300026118 Bacteria 501
885 Ga0207683_10003797 3300026121 Bacteria 13083
886 Ga0207683_10068301 3300026121 Bacteria 3137
887 Ga0207683_10091282 3300026121 Bacteria 2713
888 Ga0207683_10469443 3300026121 Bacteria 1161
889 Ga0207683_10508077 3300026121 Bacteria 1113
890 Ga0207683_10594051 3300026121 Bacteria 1024
891 Ga0207683_11198547 3300026121 Bacteria 704
892 Ga0207683_11373039 3300026121 Bacteria 653
893 Ga0207698_10025911 3300026142 Bacteria 4140
894 Ga0207698_10132646 3300026142 Bacteria 2132
895 Ga0207698_10138196 3300026142 Bacteria 2094
896 Ga0207698_10365103 3300026142 Bacteria 1368
897 Ga0207698_10390739 3300026142 Bacteria 1326
898 Ga0207698_10432956 3300026142 Bacteria 1265
899 Ga0207698_10726837 3300026142 Bacteria 990
900 Ga0207698_11388057 3300026142 Bacteria 717
901 Ga0209389_1000043 3300027296 Bacteria 123224
902 Ga0209389_1000077 3300027296 Bacteria 91273
903 Ga0209589_1000047 3300027357 Bacteria 118659
904 Ga0209489_100075 3300027361 Bacteria 136991
905 Ga0209489_100251 3300027361 Bacteria 91273
906 Ga0209700_100271 3300027363 Bacteria 91215
907 Ga0209813_10013523 3300027866 Bacteria 2181
908 Ga0209813_10046981 3300027866 Bacteria 1335
909 Ga0209813_10259960 3300027866 Bacteria 662
910 Ga0209813_10270504 3300027866 Bacteria 651
911 Ga0209813_10357414 3300027866 Bacteria 580
912 Ga0207428_10255880 3300027907 Bacteria 1305
913 Ga0268266_10007625 3300028379 Bacteria 9734
914 Ga0268266_10020198 3300028379 Bacteria 5678
915 Ga0268266_10022295 3300028379 Bacteria 5397
916 Ga0268266_10043720 3300028379 Bacteria 3829
917 Ga0268266_10056470 3300028379 Bacteria 3377
918 Ga0268266_10128490 3300028379 Bacteria 2264
919 Ga0268266_10492373 3300028379 Bacteria 1170
920 Ga0268266_10759427 3300028379 Bacteria 936
921 Ga0268266_10796398 3300028379 Bacteria 913
922 Ga0268266_11098647 3300028379 Bacteria 769
923 Ga0268266_11853262 3300028379 Bacteria 577
924 Ga0268266_12271841 3300028379 Bacteria 514
925 Ga0268265_10054843 3300028380 Bacteria 3026
926 Ga0268265_10170480 3300028380 Bacteria 1859
927 Ga0268265_10192843 3300028380 Bacteria 1761
928 Ga0268265_10487539 3300028380 Bacteria 1159
929 Ga0268265_10603329 3300028380 Bacteria 1049
930 Ga0268265_10791405 3300028380 Bacteria 923
931 Ga0268265_11019108 3300028380 Bacteria 818
932 Ga0268264_10140299 3300028381 Bacteria 2154
933 Ga0268264_10334994 3300028381 Bacteria 1435
934 Ga0268264_11563372 3300028381 Bacteria 670
935 Ga0268264_12471887 3300028381 Bacteria 525
936 Ga0265337_1006171 3300028556 Bacteria 4658
937 Ga0265326_10028694 3300028558 Bacteria 1585
938 Ga0265319_1011253 3300028563 Bacteria 3676
939 Ga0265334_10010046 3300028573 Bacteria 3999
940 Ga0265318_10108290 3300028577 Bacteria 1021
941 Ga0265318_10389161 3300028577 Bacteria 509
942 Ga0265323_10000434 3300028653 Bacteria 23913
943 Ga0265322_10017119 3300028654 Bacteria 2089
944 Ga0265336_10000649 3300028666 Bacteria 18964
945 Ga0307517_10623476 3300028786 Bacteria 528
946 Ga0307515_10651065 3300028794 Bacteria 666
947 Ga0265338_10000280 3300028800 Bacteria 91942
948 Ga0265324_10108602 3300029957 Bacteria 942
949 Ga0265330_10006697 3300031235 Bacteria 5683
950 Ga0265330_10016700 3300031235 Bacteria 3384
951 Ga0265332_10013075 3300031238 Bacteria 3679
952 Ga0265328_10170447 3300031239 Bacteria 822
953 Ga0265325_10434418 3300031241 Bacteria 573
954 Ga0265329_10054722 3300031242 Bacteria 1267
955 Ga0265340_10017751 3300031247 Bacteria 3681
956 Ga0265340_10140965 3300031247 Bacteria 1102
957 Ga0265340_10412045 3300031247 Bacteria 596
958 Ga0265339_10023730 3300031249 Bacteria 3543
959 Ga0265339_10179779 3300031249 Bacteria 1054
960 Ga0265339_10228397 3300031249 Bacteria 908
961 Ga0265339_10233447 3300031249 Bacteria 896
962 Ga0265316_10136483 3300031344 Bacteria 1845
963 Ga0307513_10220308 3300031456 Bacteria 1719
964 Ga0307513_10419191 3300031456 Bacteria 1069
965 Ga0307513_10668572 3300031456 Bacteria 745
966 Ga0307509_10098111 3300031507 Bacteria 2976
967 Ga0307509_10674880 3300031507 Bacteria 701
968 Ga0307408_101409927 3300031548 Bacteria 656
969 Ga0265313_10240158 3300031595 Bacteria 742
970 Ga0307508_10003532 3300031616 Bacteria 15752
971 Ga0307508_10111858 3300031616 Bacteria 2331
972 Ga0307508_10340520 3300031616 Bacteria 1091
973 Ga0307514_10317603 3300031649 Bacteria 858
974 Ga0265314_10031072 3300031711 Bacteria 3947
975 Ga0265314_10169805 3300031711 Bacteria 1318
976 Ga0265342_10062949 3300031712 Bacteria 2182
977 Ga0265342_10439243 3300031712 Bacteria 671
978 Ga0307516_10126545 3300031730 Bacteria 2339
979 Ga0307516_10964627 3300031730 Bacteria 523
980 Ga0307405_10756220 3300031731 Bacteria 810
981 Ga0307413_10784291 3300031824 Bacteria 799
982 Ga0307410_10623428 3300031852 Bacteria 902
983 Ga0307407_10520668 3300031903 Bacteria 875
984 Ga0307412_10379263 3300031911 Bacteria 1144
985 Ga0307412_11475254 3300031911 Bacteria 618
986 Ga0307409_100267344 3300031995 Bacteria 1573
987 Ga0307409_100320888 3300031995 Bacteria 1449
988 Ga0307409_100649072 3300031995 Bacteria 1049
989 Ga0307409_101827303 3300031995 Bacteria 637
990 Ga0307416_100179356 3300032002 Bacteria 1983
991 Ga0307416_101155366 3300032002 Bacteria 879
992 Ga0307416_101484597 3300032002 Bacteria 784
993 Ga0307416_101899462 3300032002 Bacteria 699
994 Ga0307414_10797793 3300032004 Bacteria 861
995 Ga0307414_10924211 3300032004 Bacteria 801
996 Ga0307411_10727436 3300032005 Bacteria 867
997 Ga0307415_100233281 3300032126 Bacteria 1483
998 Ga0307415_101320124 3300032126 Bacteria 684
999 Ga0307507_10329935 3300033179 Bacteria 912
1000 Ga0307510_10006305 3300033180 Bacteria 14151
1001 Ga0307510_10032835 3300033180 Bacteria 5843
1002 Ga0307510_10041581 3300033180 Bacteria 5022
1003 Ga0307510_10264795 3300033180 Bacteria 1198
1004 Ga0307510_10331321 3300033180 Bacteria 977
1005 Ga0373926_0044210 3300035083 Bacteria 1595
1006 Ga0373934_0035852 3300035086 Bacteria 1953
1007 Ga0373949_0208963 3300035090 Bacteria 589
1008 Ga0373923_0051442 3300035111 Bacteria 1728
1009 Ga0373923_0266431 3300035111 Bacteria 805
1010 Ga0373936_0348066 3300035113 Bacteria 674
1011 Ga0373939_0175170 3300035114 Bacteria 797
1012 Ga0373941_0028234 3300035115 Bacteria 1646
1013 Ga0373945_0101883 3300035116 Bacteria 1124
1014 Ga0373945_0497283 3300035116 Bacteria 543
1015 Ga0373953_0003406 3300035117 Bacteria 4946
1016 Ga0373953_0163712 3300035117 Bacteria 956
1017 Ga0373953_0286993 3300035117 Bacteria 717
1018 Ga0373954_0005974 3300035118 Bacteria 5295
1019 Ga0373956_0056434 3300035119 Bacteria 1773
1020 Ga0373956_0160729 3300035119 Bacteria 1058
1021 Ga0373957_0022105 3300035120 Bacteria 2263
1022 Ga0373960_0170797 3300035121 Bacteria 754
1023 Ga0373943_0153691 3300035170 Bacteria 1248
1024 Ga0373943_0324958 3300035170 Bacteria 878
1025 Ga0373946_0210640 3300035171 Bacteria 935
1026 Ga0373955_0159501 3300035172 Bacteria 1330
1027 Ga0373955_0198644 3300035172 Bacteria 1193
1028 Ga0373942_0032763 3300035207 Bacteria 1382
1029 Ga0373942_0348462 3300035207 Bacteria 523
1030 Ga0373961_0368075 3300035241 Bacteria 545
1031 Ga0373961_0398268 3300035241 Bacteria 528
1032 Ga0373962_0251592 3300035242 Bacteria 614
1033 Ga0373924_0017906 3300035410 Bacteria 2724
1034 Ga0373924_0232802 3300035410 Bacteria 814
1035 Ga0373931_0023469 3300035691 Bacteria 3114
1036 Ga0373931_0561197 3300035691 Bacteria 743
1037 Ga0373935_0394890 3300035692 Bacteria 992
1038 Ga0373935_1514796 3300035692 Bacteria 502
1039 Ga0373927_0039104 3300035695 Bacteria 3078
1040 Ga0373927_0110471 3300035695 Bacteria 1791
1041 Ga0373927_0162932 3300035695 Bacteria 1461
1042 Ga0373927_0173896 3300035695 Bacteria 1412
1043 Ga0373927_0180032 3300035695 Bacteria 1386
1044 Ga0373927_0652777 3300035695 Bacteria 695
1045 Ga0373933_0001821 3300035724 Bacteria 12354
1046 Ga0373933_0053328 3300035724 Bacteria 2422
1047 Ga0373947_0032481 3300035725 Bacteria 3076
1048 Ga0373947_0171304 3300035725 Bacteria 1409
1049 Ga0373937_0142169 3300036401 Bacteria 2245
1050 Ga0373937_0177094 3300036401 Bacteria 2002
1051 Ga0373937_0297000 3300036401 Bacteria 1526
1052 Ga0372808_002915 3300036459 Bacteria 2037
1053 Ga0373925_0038336 3300037068 Bacteria 3543
1054 Ga0373925_0055603 3300037068 Bacteria 2963
1055 Ga0373925_0116839 3300037068 Bacteria 2067
1056 Ga0373925_0168515 3300037068 Bacteria 1728
1057 Ga0373925_0368755 3300037068 Bacteria 1168
1058 Ga0373925_1036199 3300037068 Bacteria 675
1059 Ga0395899_0608382 3300037312 Bacteria 695
1060 Ga0395899_0852044 3300037312 Bacteria 559
1061 Ga0395900_0873786 3300037418 Bacteria 824
1062 Ga0395898_0472857 3300037466 Bacteria 1193
1063 Ga0395898_1464913 3300037466 Bacteria 609
1064 Ga0395905_0031994 3300037471 Bacteria 4949
1065 Ga0395905_1080322 3300037471 Bacteria 706
1066 Ga0436364_0231314 3300037853 Bacteria 2982
1067 Ga0436364_0232752 3300037853 Bacteria 5954
1068 Ga0436364_1182233 3300037853 Bacteria 933
1069 Ga0395901_0137905 3300038443 Bacteria 2564
1070 Ga0395901_0715196 3300038443 Bacteria 998
1071 Ga0395901_1444189 3300038443 Bacteria 645
1072 Ga0436365_0350393 3300039437 Bacteria 627
1073 Ga0436365_0352567 3300039437 Bacteria 607
1074 Ga0436365_1425854 3300039437 Bacteria 2723
1075 Ga0451789_0117805 3300041443 Bacteria 882
1076 Ga0451791_1368894 3300041451 Bacteria 911
1077 Ga0451793_1166215 3300041452 Bacteria 569
1078 Ga0451793_1638534 3300041452 Bacteria 562
1079 Ga0451795_0309308 3300041456 Bacteria 681
1080 Ga0451798_0209264 3300041458 Bacteria 660
1081 Ga0451804_0332640 3300041463 Bacteria 779
1082 Ga0451804_1010519 3300041463 Bacteria 605
1083 Ga0451807_1931817 3300041486 Bacteria 722
1084 Ga0451833_1482099 3300041491 Bacteria 621
1085 Ga0451835_0589013 3300041492 Bacteria 669
1086 Ga0451839_0621132 3300041496 Bacteria 659
1087 Ga0451845_0055885 3300041501 Bacteria 854
1088 Ga0451847_1015364 3300041503 Bacteria 570
1089 Ga0451849_0651261 3300041505 Bacteria 1012
1090 Ga0451843_1021076 3300041509 Bacteria 700
1091 Ga0451853_2433109 3300041512 Bacteria 1741
1092 Ga0451853_3986792 3300041512 Bacteria 1951
1093 Ga0439448_0236222 3300042005 Bacteria 644
1094 Ga0439452_054376 3300042010 Bacteria 909
1095 Ga0439455_0055061 3300042012 Bacteria 1046
1096 Ga0439458_0091426 3300042157 Bacteria 784
1097 Ga0439459_0020837 3300042438 Bacteria 1254
1098 Ga0439459_0078009 3300042438 Bacteria 777
1099 Ga0439440_0273581 3300042993 Bacteria 520
1100 Ga0466972_0000079 3300044658 Bacteria 90348
1101 Ga0466972_0001061 3300044658 Bacteria 13191
1102 Ga0466972_0192948 3300044658 Bacteria 955
1103 Ga0466965_0334691 3300044683 Bacteria 827
1104 Ga0466965_0359893 3300044683 Bacteria 798
1105 Ga0466966_0058132 3300044684 Bacteria 2445
1106 Ga0466966_0375764 3300044684 Bacteria 854
1107 Ga0466961_0541072 3300044693 Bacteria 702
1108 Ga0466961_0969972 3300044693 Bacteria 505
1109 Ga0466963_0007491 3300044694 Bacteria 6512
1110 Ga0466963_0545221 3300044694 Bacteria 819
1111 Ga0466968_0010560 3300044735 Bacteria 3583
1112 Ga0466968_0078786 3300044735 Bacteria 1445
1113 Ga0466968_0193789 3300044735 Bacteria 949
1114 Ga0466970_0243334 3300044765 Bacteria 1007
1115 Ga0466957_0093861 3300044842 Bacteria 1884
1116 Ga0466957_0284174 3300044842 Bacteria 1108
1117 Ga0466957_0402361 3300044842 Bacteria 937
1118 Ga0466960_0171066 3300044901 Bacteria 1172
1119 Ga0466960_0736780 3300044901 Bacteria 593
1120 Ga0466960_0741794 3300044901 Bacteria 591
1121 Ga0466960_0921821 3300044901 Bacteria 534
1122 Ga0466959_0040060 3300045049 Bacteria 3462
1123 Ga0466959_0238621 3300045049 Bacteria 1256
1124 Ga0466967_0202886 3300045976 Bacteria 1878
1125 Ga0466967_1065175 3300045976 Bacteria 805
1126 Ga0466967_1542599 3300045976 Bacteria 662
1127 Ga0495592_0105015 3300046454 Bacteria 2007
1128 Ga0495592_0200664 3300046454 Bacteria 1346
1129 Ga0495592_0207253 3300046454 Bacteria 1319
1130 Ga0495592_0619197 3300046454 Bacteria 658
1131 Ga0495603_0002778 3300046455 Bacteria 10319
1132 Ga0495603_0341161 3300046455 Bacteria 859
1133 Ga0495603_0372723 3300046455 Bacteria 819
1134 Ga0495603_0435018 3300046455 Bacteria 751
1135 Ga0495603_0551532 3300046455 Bacteria 660
1136 Ga0495590_0147306 3300046457 Bacteria 852
1137 Ga0495591_098328 3300046458 Bacteria 728
1138 Ga0495629_0065563 3300046459 Bacteria 2535
1139 Ga0495629_0070734 3300046459 Bacteria 2434
1140 Ga0495629_0177624 3300046459 Bacteria 1476
1141 Ga0495629_0274632 3300046459 Bacteria 1157
1142 Ga0495629_0314481 3300046459 Bacteria 1071
1143 Ga0495638_0020090 3300046460 Bacteria 4414
1144 Ga0495638_0125537 3300046460 Bacteria 1512
1145 Ga0495638_0550727 3300046460 Bacteria 573
1146 Ga0495638_0589720 3300046460 Bacteria 547
1147 Ga0495641_0095897 3300046461 Bacteria 1324
1148 Ga0495641_0553912 3300046461 Bacteria 525
1149 Ga0495651_0029360 3300046462 Bacteria 4287
1150 Ga0495651_0191782 3300046462 Bacteria 1437
1151 Ga0495653_0082616 3300046463 Bacteria 2371
1152 Ga0495653_0400555 3300046463 Bacteria 872
1153 Ga0495653_0450921 3300046463 Bacteria 809
1154 Ga0495653_0505577 3300046463 Bacteria 753
1155 Ga0495650_0099119 3300046471 Bacteria 1097
1156 Ga0495580_0043983 3300046472 Bacteria 3177
1157 Ga0495580_0152884 3300046472 Bacteria 1599
1158 Ga0495582_0082297 3300046473 Bacteria 1788
1159 Ga0495582_0758712 3300046473 Bacteria 561
1160 Ga0495605_0079481 3300046474 Bacteria 1536
1161 Ga0495605_0265789 3300046474 Bacteria 731
1162 Ga0495639_0142339 3300046475 Bacteria 1153
1163 Ga0495639_0336377 3300046475 Bacteria 757
1164 Ga0495664_0056145 3300046477 Bacteria 2342
1165 Ga0495664_0122727 3300046477 Bacteria 1571
1166 Ga0495664_0325560 3300046477 Bacteria 927
1167 Ga0495664_0399360 3300046477 Bacteria 825
1168 Ga0495584_0072778 3300046491 Bacteria 1727
1169 Ga0495584_0073045 3300046491 Bacteria 1724
1170 Ga0495584_0276173 3300046491 Bacteria 854
1171 Ga0495585_0070948 3300046492 Bacteria 1899
1172 Ga0495585_0207470 3300046492 Bacteria 995
1173 Ga0495585_0295659 3300046492 Bacteria 797
1174 Ga0495585_0300591 3300046492 Bacteria 789
1175 Ga0495596_0068931 3300046500 Bacteria 1374
1176 Ga0495607_0224908 3300046501 Bacteria 916
1177 Ga0495607_0371971 3300046501 Bacteria 655
1178 Ga0495607_0373477 3300046501 Bacteria 654
1179 Ga0495583_0093717 3300046506 Bacteria 1290
1180 Ga0495583_0242545 3300046506 Bacteria 724
1181 Ga0495606_0006998 3300046507 Bacteria 10238
1182 Ga0495606_0066480 3300046507 Bacteria 2286
1183 Ga0495606_0263566 3300046507 Bacteria 950
1184 Ga0495606_0315868 3300046507 Bacteria 841
1185 Ga0495606_0450205 3300046507 Bacteria 660
1186 Ga0495608_0023395 3300046511 Bacteria 4234
1187 Ga0495608_0058489 3300046511 Bacteria 2541
1188 Ga0495610_0127467 3300046512 Bacteria 1109
1189 Ga0495610_0270903 3300046512 Bacteria 665
1190 Ga0495610_0292850 3300046512 Bacteria 630
1191 Ga0495616_0081220 3300046513 Bacteria 1551
1192 Ga0495618_0064992 3300046514 Bacteria 2318
1193 Ga0495618_0178450 3300046514 Bacteria 1350
1194 Ga0495618_0228836 3300046514 Bacteria 1171
1195 Ga0495620_0121887 3300046515 Bacteria 1027
1196 Ga0495620_0128405 3300046515 Bacteria 996
1197 Ga0495628_0012530 3300046516 Bacteria 7144
1198 Ga0495628_0121239 3300046516 Bacteria 2005
1199 Ga0495628_0422680 3300046516 Bacteria 971
1200 Ga0495628_0865242 3300046516 Bacteria 629
1201 Ga0495630_0019164 3300046517 Bacteria 5028
1202 Ga0495630_0077623 3300046517 Bacteria 2504
1203 Ga0495630_0494465 3300046517 Bacteria 938
1204 Ga0495630_0803725 3300046517 Bacteria 718
1205 Ga0495631_0036622 3300046518 Bacteria 2190
1206 Ga0495631_0223374 3300046518 Bacteria 804
1207 Ga0495631_0277840 3300046518 Bacteria 713
1208 Ga0495631_0320372 3300046518 Bacteria 660
1209 Ga0495632_0056495 3300046519 Bacteria 1918
1210 Ga0495632_0085482 3300046519 Bacteria 1501
1211 Ga0495632_0131267 3300046519 Bacteria 1166
1212 Ga0495632_0142348 3300046519 Bacteria 1112
1213 Ga0495632_0190293 3300046519 Bacteria 937
1214 Ga0495637_0090080 3300046520 Bacteria 1211
1215 Ga0495637_0228197 3300046520 Bacteria 676
1216 Ga0495637_0333795 3300046520 Bacteria 534
1217 Ga0495643_0138335 3300046522 Bacteria 1216
1218 Ga0495643_0202872 3300046522 Bacteria 951
1219 Ga0495644_0037867 3300046523 Bacteria 1820
1220 Ga0495644_0079264 3300046523 Bacteria 1237
1221 Ga0495648_0014927 3300046524 Bacteria 5658
1222 Ga0495648_0037099 3300046524 Bacteria 3136
1223 Ga0495648_0041864 3300046524 Bacteria 2888
1224 Ga0495648_0063034 3300046524 Bacteria 2192
1225 Ga0495648_0082027 3300046524 Bacteria 1832
1226 Ga0495648_0156846 3300046524 Bacteria 1181
1227 Ga0495648_0181804 3300046524 Bacteria 1068
1228 Ga0495648_0211952 3300046524 Bacteria 962
1229 Ga0495648_0322648 3300046524 Bacteria 715
1230 Ga0495663_0378107 3300046525 Bacteria 519
1231 Ga0495666_0145016 3300046526 Bacteria 1105
1232 Ga0495666_0467770 3300046526 Bacteria 564
1233 Ga0495642_0148056 3300046528 Bacteria 1015
1234 Ga0495652_0155483 3300046529 Bacteria 1781
1235 Ga0495652_0220458 3300046529 Bacteria 1426
1236 Ga0495652_0311042 3300046529 Bacteria 1141
1237 Ga0495652_0313453 3300046529 Bacteria 1136
1238 Ga0495652_0348609 3300046529 Bacteria 1061
1239 Ga0495665_0049613 3300046531 Bacteria 2225
1240 Ga0495665_0508617 3300046531 Bacteria 606
1241 Ga0495640_0007124 3300046533 Bacteria 8801
1242 Ga0495640_0023983 3300046533 Bacteria 4438
1243 Ga0495640_0028223 3300046533 Bacteria 4042
1244 Ga0495640_0085615 3300046533 Bacteria 2088
1245 Ga0495640_0659504 3300046533 Bacteria 629
1246 Ga0495586_0078473 3300046535 Bacteria 1812
1247 Ga0495587_0014340 3300046536 Bacteria 4974
1248 Ga0495587_0066633 3300046536 Bacteria 2100
1249 Ga0495587_0260700 3300046536 Bacteria 974
1250 Ga0495587_0284763 3300046536 Bacteria 926
1251 Ga0495587_0552330 3300046536 Bacteria 635
1252 Ga0495598_0024640 3300046537 Bacteria 1633
1253 Ga0495598_0226897 3300046537 Bacteria 684
1254 Ga0495609_0074168 3300046538 Bacteria 1493
1255 Ga0495609_0144594 3300046538 Bacteria 1013
1256 Ga0495609_0147695 3300046538 Bacteria 1001
1257 Ga0495609_0188209 3300046538 Bacteria 867
1258 Ga0495621_0204640 3300046539 Bacteria 795
1259 Ga0495597_0086798 3300046542 Bacteria 1332
1260 Ga0495597_0167782 3300046542 Bacteria 893
1261 Ga0495645_0007155 3300046543 Bacteria 7768
1262 Ga0495645_0058108 3300046543 Bacteria 2806
1263 Ga0495645_0065908 3300046543 Bacteria 2620
1264 Ga0495645_0202750 3300046543 Bacteria 1344
1265 Ga0495645_0368965 3300046543 Bacteria 921
1266 Ga0495622_0039374 3300046557 Bacteria 2201
1267 Ga0495622_0114915 3300046557 Bacteria 1231
1268 Ga0495622_0171185 3300046557 Bacteria 976
1269 Ga0495667_0006892 3300046559 Bacteria 7715
1270 Ga0495667_0163154 3300046559 Bacteria 1433
1271 Ga0495667_0469818 3300046559 Bacteria 789
1272 Ga0495656_0002642 3300046615 Bacteria 5973
1273 Ga0495656_0126518 3300046615 Bacteria 1212
1274 Ga0495656_0673322 3300046615 Bacteria 556
1275 Ga0495668_0055701 3300046616 Bacteria 2183
1276 Ga0495668_0194695 3300046616 Bacteria 1110
1277 Ga0495668_0221511 3300046616 Bacteria 1036
1278 Ga0495668_0236868 3300046616 Bacteria 999
1279 Ga0495668_0840332 3300046616 Bacteria 509
1280 Ga0495634_0123320 3300046642 Bacteria 1658
1281 Ga0495634_0135559 3300046642 Bacteria 1566
1282 Ga0495634_0198728 3300046642 Bacteria 1246
1283 Ga0495634_0289460 3300046642 Bacteria 993
1284 Ga0495611_0037207 3300046648 Bacteria 2162
1285 Ga0495611_0315708 3300046648 Bacteria 719
1286 Ga0495625_0056019 3300046660 Bacteria 2808
1287 Ga0495625_0168223 3300046660 Bacteria 1465
1288 Ga0495625_0334717 3300046660 Bacteria 961
1289 Ga0495625_0377032 3300046660 Bacteria 891
1290 Ga0495625_0787072 3300046660 Bacteria 554
1291 Ga0495635_0282246 3300046663 Bacteria 1115
1292 Ga0495635_0317270 3300046663 Bacteria 1043
1293 Ga0495635_0449963 3300046663 Bacteria 851
1294 Ga0495659_0009434 3300046664 Bacteria 3114
1295 Ga0495659_0055584 3300046664 Bacteria 1451
1296 Ga0495661_0214557 3300046665 Bacteria 1000
1297 Ga0495661_0451466 3300046665 Bacteria 619
1298 Ga0495588_0011004 3300046674 Bacteria 4233
1299 Ga0495588_0151606 3300046674 Bacteria 1225
1300 Ga0495588_0226189 3300046674 Bacteria 987
1301 Ga0495588_0560445 3300046674 Bacteria 599
1302 Ga0495657_0019556 3300046675 Bacteria 4884
1303 Ga0495657_0054792 3300046675 Bacteria 2662
1304 Ga0495657_0462943 3300046675 Bacteria 742
1305 Ga0495657_0864010 3300046675 Bacteria 515
1306 Ga0495599_0086294 3300046678 Bacteria 1960
1307 Ga0495599_0143862 3300046678 Bacteria 1478
1308 Ga0495599_0148341 3300046678 Bacteria 1454
1309 Ga0495599_0439046 3300046678 Bacteria 774
1310 Ga0495623_0032327 3300046679 Bacteria 3363
1311 Ga0495623_0091416 3300046679 Bacteria 1867
1312 Ga0495646_0010341 3300046680 Bacteria 5934
1313 Ga0495646_0222676 3300046680 Bacteria 1019
1314 Ga0495647_0047804 3300046681 Bacteria 1652
1315 Ga0495647_0450174 3300046681 Bacteria 596
1316 Ga0495647_0464744 3300046681 Bacteria 587
1317 Ga0495658_0074262 3300046683 Bacteria 1981
1318 Ga0495658_0145919 3300046683 Bacteria 1450
1319 Ga0495669_0001990 3300046684 Bacteria 8393
1320 Ga0495613_0162469 3300046689 Bacteria 1588
1321 Ga0495613_0594472 3300046689 Bacteria 737
1322 Ga0495624_0082595 3300046690 Bacteria 1988
1323 Ga0495624_0386205 3300046690 Bacteria 841
1324 Ga0495670_0161747 3300046691 Bacteria 1176
1325 Ga0495671_0110181 3300046692 Bacteria 1345
1326 Ga0495671_0239628 3300046692 Bacteria 876
1327 Ga0495671_0252571 3300046692 Bacteria 851
1328 Ga0495649_0015884 3300046694 Bacteria 4277
1329 Ga0495649_0093239 3300046694 Bacteria 1603
1330 Ga0495649_0497034 3300046694 Bacteria 607
1331 Ga0495589_0112277 3300046794 Bacteria 1315
1332 Ga0495589_0398734 3300046794 Bacteria 632
1333 Ga0495589_0472584 3300046794 Bacteria 573
1334 Ga0495589_0582000 3300046794 Bacteria 510
1335 Ga0495600_0091391 3300046809 Bacteria 1985
1336 Ga0495600_0189485 3300046809 Bacteria 1323
1337 Ga0495600_0247155 3300046809 Bacteria 1135
1338 Ga0495600_0311403 3300046809 Bacteria 991
1339 Ga0495600_0559156 3300046809 Bacteria 698
1340 Ga0495660_0296253 3300046810 Bacteria 735
1341 Ga0495581_0104891 3300047315 Bacteria 1643
1342 Ga0495581_0299586 3300047315 Bacteria 940
1343 Ga0495581_0329483 3300047315 Bacteria 892
1344 Ga0495581_0499657 3300047315 Bacteria 707
1345 Ga0495604_0185719 3300047317 Bacteria 1452
1346 Ga0495604_0208007 3300047317 Bacteria 1353
1347 Ga0495604_0416077 3300047317 Bacteria 883
1348 Ga0495604_1045821 3300047317 Bacteria 503
1349 Ga0495636_0043671 3300047318 Bacteria 1866
1350 Ga0495674_0042923 3300047319 Bacteria 4029
1351 Ga0495674_0049361 3300047319 Bacteria 3719
1352 Ga0495674_0203809 3300047319 Bacteria 1640
1353 Ga0495674_0785839 3300047319 Bacteria 741
1354 Ga0495674_0966729 3300047319 Bacteria 654
1355 Ga0495674_1372104 3300047319 Bacteria 528
1356 Ga0495672_0404283 3300047320 Bacteria 624
1357 Ga0495672_0474768 3300047320 Bacteria 560
1358 Ga0495676_0076470 3300047321 Bacteria 2556
1359 Ga0495676_0201835 3300047321 Bacteria 1381
1360 Ga0495680_0025139 3300047322 Bacteria 4933
1361 Ga0495680_0193852 3300047322 Bacteria 1461
1362 Ga0495680_0362866 3300047322 Bacteria 1006
1363 Ga0495683_0083558 3300047323 Bacteria 1555
1364 Ga0495683_0126305 3300047323 Bacteria 1210
1365 Ga0495687_006694 3300047443 Bacteria 6990
1366 Ga0495675_0027294 3300047444 Bacteria 3638
1367 Ga0495675_0132509 3300047444 Bacteria 1548
1368 Ga0495675_0187240 3300047444 Bacteria 1265
1369 Ga0495675_0687673 3300047444 Bacteria 574
1370 Ga0495677_0015930 3300047445 Bacteria 2729
1371 Ga0495677_0046237 3300047445 Bacteria 1598
1372 Ga0495677_0198532 3300047445 Bacteria 780
1373 Ga0495679_022313 3300047446 Bacteria 2169
1374 Ga0495685_076321 3300047447 Bacteria 1119
1375 Ga0495673_0099999 3300047469 Bacteria 1174
1376 Ga0495673_0117364 3300047469 Bacteria 1057
1377 Ga0495673_0148550 3300047469 Bacteria 908
1378 Ga0495673_0168813 3300047469 Bacteria 835
1379 Ga0495673_0199830 3300047469 Bacteria 748
1380 Ga0495673_0243792 3300047469 Bacteria 658
1381 Ga0495681_0233571 3300047470 Bacteria 733
1382 Ga0495684_0005641 3300047471 Bacteria 9751
1383 Ga0495684_0203441 3300047471 Bacteria 1459
1384 Ga0495684_0273449 3300047471 Bacteria 1221
1385 Ga0495684_1050708 3300047471 Bacteria 514
1386 Ga0495686_0225445 3300047472 Bacteria 1064
1387 Ga0495686_0385122 3300047472 Bacteria 756
1388 Ga0495686_0613245 3300047472 Bacteria 562
1389 Ga0495593_0044012 3300047673 Bacteria 2390
1390 Ga0495593_0058612 3300047673 Bacteria 2019
1391 Ga0495593_0197819 3300047673 Bacteria 1010
1392 Ga0495593_0320652 3300047673 Bacteria 775
1393 Ga0495602_0177171 3300048088 Bacteria 1648
1394 Ga0495602_0565194 3300048088 Bacteria 786
1395 Ga0495602_0651834 3300048088 Bacteria 719
1396 Ga0495615_0018473 3300048090 Bacteria 1535
1397 Ga0495615_0034571 3300048090 Bacteria 1231
1398 Ga0495626_0096064 3300048091 Bacteria 1297
1399 Ga0495626_0111865 3300048091 Bacteria 1182
1400 Ga0496100_0038138 3300048903 Bacteria 3043
1401 Ga0496100_0081519 3300048903 Bacteria 2186
1402 Ga0496100_0139144 3300048903 Bacteria 1718
1403 Ga0496100_0213578 3300048903 Bacteria 1412
1404 Ga0496100_0591946 3300048903 Bacteria 861
1405 Ga0496100_0855031 3300048903 Bacteria 714
1406 Ga0496100_1038009 3300048903 Bacteria 645
1407 Ga0496101_0006365 3300048904 Bacteria 7599
1408 Ga0496101_0033698 3300048904 Bacteria 3614
1409 Ga0496101_0183070 3300048904 Bacteria 1614
1410 Ga0496101_0235397 3300048904 Bacteria 1424
1411 Ga0496101_0359095 3300048904 Bacteria 1145
1412 Ga0496101_0442599 3300048904 Bacteria 1025
1413 Ga0496101_0492185 3300048904 Bacteria 969
1414 Ga0496101_0723245 3300048904 Bacteria 786
1415 Ga0496101_0758326 3300048904 Bacteria 766
1416 Ga0496101_0992587 3300048904 Bacteria 660
1417 Ga0496101_1014996 3300048904 Bacteria 652
1418 Ga0496102_0003595 3300048905 Bacteria 13132
1419 Ga0496102_0067964 3300048905 Bacteria 3269
1420 Ga0496102_0072804 3300048905 Bacteria 3158
1421 Ga0496102_0100826 3300048905 Bacteria 2682
1422 Ga0496102_0326233 3300048905 Bacteria 1446
1423 Ga0496102_0326950 3300048905 Bacteria 1444
1424 Ga0496102_0454169 3300048905 Bacteria 1202
1425 Ga0496102_0613241 3300048905 Bacteria 1011
1426 Ga0496102_0661843 3300048905 Bacteria 967
1427 Ga0496102_1800617 3300048905 Bacteria 529
1428 Ga0496103_0004751 3300048906 Bacteria 8214
1429 Ga0496103_0013766 3300048906 Bacteria 4802
1430 Ga0496103_0086099 3300048906 Bacteria 1981
1431 Ga0496103_0183494 3300048906 Bacteria 1345
1432 Ga0496103_0375918 3300048906 Bacteria 913
1433 Ga0496103_0651728 3300048906 Bacteria 669
1434 Ga0496103_0778347 3300048906 Bacteria 604
1435 Ga0496103_0903243 3300048906 Bacteria 553
1436 Ga0496104_0001647 3300048907 Bacteria 19277
1437 Ga0496104_0004065 3300048907 Bacteria 12684
1438 Ga0496104_0010574 3300048907 Bacteria 8242
1439 Ga0496104_0080908 3300048907 Bacteria 3097
1440 Ga0496104_0341279 3300048907 Bacteria 1411
1441 Ga0496104_0424988 3300048907 Bacteria 1240
1442 Ga0496104_0451284 3300048907 Bacteria 1197
1443 Ga0496105_0022918 3300048908 Bacteria 5062
1444 Ga0496105_0051555 3300048908 Bacteria 3399
1445 Ga0496105_0116561 3300048908 Bacteria 2203
1446 Ga0496105_0183729 3300048908 Bacteria 1711
1447 Ga0496105_0318225 3300048908 Bacteria 1248
1448 Ga0496105_0330782 3300048908 Bacteria 1219
1449 Ga0496105_0368735 3300048908 Bacteria 1144
1450 Ga0496105_0761244 3300048908 Bacteria 739
1451 Ga0496105_0978077 3300048908 Bacteria 634
1452 Ga0496106_0029456 3300048909 Bacteria 4091
1453 Ga0496106_0047557 3300048909 Bacteria 3229
1454 Ga0496106_0098072 3300048909 Bacteria 2270
1455 Ga0496106_0102248 3300048909 Bacteria 2223
1456 Ga0496106_0146926 3300048909 Bacteria 1858
1457 Ga0496106_0328246 3300048909 Bacteria 1228
1458 Ga0496106_0414878 3300048909 Bacteria 1082
1459 Ga0496106_0564853 3300048909 Bacteria 913
1460 Ga0496106_0845233 3300048909 Bacteria 725
1461 Ga0496106_1076517 3300048909 Bacteria 630
1462 Ga0496107_0000947 3300048910 Bacteria 17177
1463 Ga0496107_0104673 3300048910 Bacteria 2077
1464 Ga0496107_0106384 3300048910 Bacteria 2060
1465 Ga0496107_0173695 3300048910 Bacteria 1599
1466 Ga0496107_0757584 3300048910 Bacteria 712
1467 Ga0496107_1161802 3300048910 Bacteria 556
1468 Ga0496108_0013705 3300048911 Bacteria 6616
1469 Ga0496108_0028679 3300048911 Bacteria 4606
1470 Ga0496108_0053689 3300048911 Bacteria 3380
1471 Ga0496108_0198252 3300048911 Bacteria 1742
1472 Ga0496108_0210750 3300048911 Bacteria 1687
1473 Ga0496108_0229456 3300048911 Bacteria 1614
1474 Ga0496108_0250088 3300048911 Bacteria 1542
1475 Ga0496108_0356915 3300048911 Bacteria 1275
1476 Ga0496108_0427899 3300048911 Bacteria 1156
1477 Ga0496108_0676832 3300048911 Bacteria 896
1478 Ga0496108_0798170 3300048911 Bacteria 815
1479 Ga0496109_0008951 3300048912 Bacteria 8527
1480 Ga0496109_0048452 3300048912 Bacteria 3866
1481 Ga0496109_0110861 3300048912 Bacteria 2551
1482 Ga0496109_0196509 3300048912 Bacteria 1896
1483 Ga0496109_0220090 3300048912 Bacteria 1785
1484 Ga0496110_0045263 3300048913 Bacteria 3846
1485 Ga0496110_0047060 3300048913 Bacteria 3775
1486 Ga0496110_0062445 3300048913 Bacteria 3290
1487 Ga0496110_0161087 3300048913 Bacteria 2034
1488 Ga0496110_0164218 3300048913 Bacteria 2013
1489 Ga0496110_0484369 3300048913 Bacteria 1127
1490 Ga0496110_0725000 3300048913 Bacteria 896
1491 Ga0496110_1176713 3300048913 Bacteria 675
1492 Ga0496111_0015443 3300048914 Bacteria 5242
1493 Ga0496111_0028576 3300048914 Bacteria 3953
1494 Ga0496111_0423490 3300048914 Bacteria 983
1495 Ga0496111_0462441 3300048914 Bacteria 936
1496 Ga0496111_1064214 3300048914 Bacteria 578
1497 Ga0496111_1191220 3300048914 Bacteria 540
1498 Ga0496112_0012760 3300048915 Bacteria 7731
1499 Ga0496112_0110694 3300048915 Bacteria 2716
1500 Ga0496112_0336783 3300048915 Bacteria 1452
1501 Ga0496112_0338342 3300048915 Bacteria 1448
1502 Ga0496112_0460291 3300048915 Bacteria 1209
1503 Ga0496112_0730127 3300048915 Bacteria 917
1504 Ga0496112_0892020 3300048915 Bacteria 811
1505 Ga0496112_1301341 3300048915 Bacteria 642
1506 Ga0496112_1488728 3300048915 Bacteria 591
1507 Ga0496113_0001327 3300048916 Bacteria 13676
1508 Ga0496113_0038477 3300048916 Bacteria 3517
1509 Ga0496113_0039228 3300048916 Bacteria 3485
1510 Ga0496113_0060669 3300048916 Bacteria 2852
1511 Ga0496113_0153794 3300048916 Bacteria 1816
1512 Ga0496113_0264612 3300048916 Bacteria 1374
1513 Ga0496113_0449521 3300048916 Bacteria 1035
1514 Ga0496114_0021716 3300048917 Bacteria 5225
1515 Ga0496114_0024353 3300048917 Bacteria 4940
1516 Ga0496114_0066002 3300048917 Bacteria 3033
1517 Ga0496114_0082601 3300048917 Bacteria 2716
1518 Ga0496114_0440805 3300048917 Bacteria 1153
1519 Ga0496114_1335716 3300048917 Bacteria 604
1520 Ga0496114_1549244 3300048917 Bacteria 551
1521 Ga0496115_0000604 3300048918 Bacteria 27391
1522 Ga0496115_0022771 3300048918 Bacteria 4857
1523 Ga0496115_0058271 3300048918 Bacteria 3108
1524 Ga0496115_0065715 3300048918 Bacteria 2930
1525 Ga0496115_0144469 3300048918 Bacteria 1963
1526 Ga0496115_0213542 3300048918 Bacteria 1593
1527 Ga0496115_0321795 3300048918 Bacteria 1265
1528 Ga0496115_0365576 3300048918 Bacteria 1175
1529 Ga0496115_0436011 3300048918 Bacteria 1060
1530 Ga0496115_0726893 3300048918 Bacteria 778
1531 Ga0496115_0766156 3300048918 Bacteria 753
1532 Ga0496116_0088080 3300048919 Bacteria 1898
1533 Ga0496116_0141072 3300048919 Bacteria 1356
1534 Ga0496117_0174193 3300048920 Bacteria 1245
1535 Ga0496117_0241697 3300048920 Bacteria 991
1536 Ga0496117_0325164 3300048920 Bacteria 804
1537 Ga0496117_0376013 3300048920 Bacteria 725
1538 Ga0496118_0009891 3300048921 Bacteria 9537
1539 Ga0496118_0095578 3300048921 Bacteria 2028
1540 Ga0496118_0158508 3300048921 Bacteria 1404
1541 Ga0496118_0161367 3300048921 Bacteria 1386
1542 Ga0496118_0193568 3300048921 Bacteria 1213
1543 Ga0496118_0330219 3300048921 Bacteria 823
1544 Ga0496119_0006875 3300048922 Bacteria 10389
1545 Ga0496119_0079366 3300048922 Bacteria 1896
1546 Ga0496119_0093315 3300048922 Bacteria 1705
1547 Ga0496119_0598428 3300048922 Bacteria 502
1548 Ga0496120_0014529 3300048923 Bacteria 5244
1549 Ga0496120_0070618 3300048923 Bacteria 1920
1550 Ga0496120_0141164 3300048923 Bacteria 1223
1551 Ga0496120_0240146 3300048923 Bacteria 855
1552 Ga0496121_0014245 3300048924 Bacteria 8457
1553 Ga0496121_0017920 3300048924 Bacteria 7184
1554 Ga0496121_0020183 3300048924 Bacteria 6613
1555 Ga0496121_0037977 3300048924 Bacteria 4271
1556 Ga0496121_0048593 3300048924 Bacteria 3608
1557 Ga0496121_0062307 3300048924 Bacteria 3056
1558 Ga0496121_0079016 3300048924 Bacteria 2613
1559 Ga0496121_0101752 3300048924 Bacteria 2215
1560 Ga0496121_0115405 3300048924 Bacteria 2039
1561 Ga0496121_0126057 3300048924 Bacteria 1924
1562 Ga0496121_0195694 3300048924 Bacteria 1445
1563 Ga0496121_0348525 3300048924 Bacteria 987
1564 Ga0496122_0240587 3300048925 Bacteria 1021
1565 Ga0496122_0610633 3300048925 Bacteria 508
1566 Ga0496124_0314714 3300048927 Bacteria 1124
1567 Ga0496124_0346105 3300048927 Bacteria 1053
1568 Ga0496124_0504462 3300048927 Bacteria 810
1569 Ga0496124_0649957 3300048927 Bacteria 677
1570 Ga0496124_0844168 3300048927 Bacteria 562
1571 Ga0496125_0065618 3300048928 Bacteria 2874
1572 Ga0496125_0067022 3300048928 Bacteria 2832
1573 Ga0496125_0076359 3300048928 Bacteria 2587
1574 Ga0496125_0219108 3300048928 Bacteria 1228
1575 Ga0496125_0488082 3300048928 Bacteria 696
1576 Ga0496126_0008677 3300048929 Bacteria 10918
1577 Ga0496126_0009242 3300048929 Bacteria 10508
1578 Ga0496126_0066191 3300048929 Bacteria 3231
1579 Ga0496126_0085099 3300048929 Bacteria 2788
1580 Ga0496126_0117860 3300048929 Bacteria 2306
1581 Ga0496126_0173025 3300048929 Bacteria 1838
1582 Ga0496126_0235255 3300048929 Bacteria 1533
1583 Ga0496126_0244448 3300048929 Bacteria 1498
1584 Ga0496126_0250513 3300048929 Bacteria 1476
1585 Ga0496126_0253399 3300048929 Bacteria 1466
1586 Ga0496126_0253675 3300048929 Bacteria 1465
1587 Ga0496126_0300360 3300048929 Bacteria 1325
1588 Ga0496126_0509312 3300048929 Bacteria 961
1589 Ga0496126_0609042 3300048929 Bacteria 859
1590 Ga0496126_0670837 3300048929 Bacteria 809
1591 Ga0496126_0802403 3300048929 Bacteria 722
1592 Ga0496126_0905716 3300048929 Bacteria 668
1593 Ga0496126_1105214 3300048929 Bacteria 588
1594 Ga0495682_0018342 3300049460 Bacteria 2636
1595 Ga0501031_0371449 3300049568 Bacteria 925
1596 Ga0501038_0242687 3300049574 Bacteria 1430
1597 Ga0501038_0717583 3300049574 Bacteria 748
1598 Ga0501039_0209819 3300049575 Bacteria 1532
1599 Ga0501040_0283720 3300049576 Bacteria 1183
1600 Ga0501041_0182756 3300049577 Bacteria 1313
1601 Ga0501041_0646236 3300049577 Bacteria 676
1602 Ga0501042_0453703 3300049578 Bacteria 930
1603 Ga0501046_0715063 3300049580 Bacteria 705
1604 Ga0501067_0082667 3300049583 Bacteria 1781
1605 Ga0501067_0099416 3300049583 Bacteria 1616
1606 Ga0501067_0174653 3300049583 Bacteria 1197
1607 Ga0501067_0282238 3300049583 Bacteria 925
1608 Ga0501068_0799284 3300049584 Bacteria 619
1609 Ga0501068_0848868 3300049584 Bacteria 600
1610 Ga0501069_0104218 3300049585 Bacteria 1612
1611 Ga0501071_1180300 3300049587 Bacteria 591
1612 Ga0501072_0504589 3300049588 Bacteria 957
1613 Ga0501074_0876767 3300049590 Bacteria 632
1614 Ga0501075_0255777 3300049591 Bacteria 1335
1615 Ga0501076_0589866 3300049592 Bacteria 917
1616 Ga0501077_0371005 3300049593 Bacteria 914
1617 Ga0501201_053263 3300049651 Bacteria 510
1618 nmdc:mga03683_175614_c1 3300050489 Bacteria 975
1619 nmdc:mga03683_256197_c1 3300050489 Bacteria 813
1620 nmdc:mga03683_55344_c1 3300050489 Bacteria 1666
1621 nmdc:mga03n38_1351_c1 3300050490 Bacteria 6942
1622 nmdc:mga03n38_364714_c1 3300050490 Bacteria 789
1623 nmdc:mga03n38_405657_c1 3300050490 Bacteria 751
1624 nmdc:mga03n38_44340_c1 3300050490 Bacteria 1953
1625 nmdc:mga00v17_1048259_c1 3300050491 Bacteria 512
1626 nmdc:mga00v17_109098_c1 3300050491 Bacteria 1754
1627 nmdc:mga00v17_4146_c1 3300050491 Bacteria 7505
1628 nmdc:mga0yw44_139702_c1 3300050492 Bacteria 1573
1629 nmdc:mga0yw44_47972_c1 3300050492 Bacteria 2574
1630 nmdc:mga0yw44_5233_c1 3300050492 Bacteria 6085
1631 nmdc:mga0yw44_539934_c1 3300050492 Bacteria 792
1632 nmdc:mga0yw44_695954_c1 3300050492 Bacteria 690
1633 nmdc:mga0yw44_721821_c1 3300050492 Bacteria 677
1634 nmdc:mga0yw44_743877_c1 3300050492 Bacteria 666
1635 nmdc:mga0yw44_99641_c1 3300050492 Bacteria 1849
1636 nmdc:mga0k408_324890_c1 3300050493 Bacteria 918
1637 nmdc:mga0k408_346439_c1 3300050493 Bacteria 886
1638 nmdc:mga0k408_53785_c2 3300050493 Bacteria 2000
1639 nmdc:mga06z11_207020_c1 3300050494 Bacteria 1142
1640 nmdc:mga06z11_220266_c1 3300050494 Bacteria 1109
1641 nmdc:mga06z11_608380_c1 3300050494 Bacteria 665
1642 nmdc:mga06z11_61386_c1 3300050494 Bacteria 1960
1643 nmdc:mga06z11_915607_c1 3300050494 Bacteria 534
1644 nmdc:mga06z11_93936_c1 3300050494 Bacteria 1634
1645 nmdc:mga04h51_100828_c1 3300050495 Bacteria 1052
1646 nmdc:mga04h51_143096_c1 3300050495 Bacteria 908
1647 nmdc:mga04h51_297348_c1 3300050495 Bacteria 657
1648 nmdc:mga04h51_35189_c1 3300050495 Bacteria 1604
1649 nmdc:mga04h51_36493_c1 3300050495 Bacteria 1582
1650 nmdc:mga07m45_171809_c1 3300050496 Bacteria 1260
1651 nmdc:mga07m45_42075_c1 3300050496 Bacteria 2560
1652 nmdc:mga07m45_44129_c1 3300050496 Bacteria 2501
1653 nmdc:mga07m45_82651_c1 3300050496 Bacteria 1834
1654 nmdc:mga05p37_40049_c1 3300050507 Bacteria 5754
1655 nmdc:mga09592_496886_c1 3300050508 Bacteria 1050
1656 nmdc:mga0qj67_778806_c1 3300050509 Bacteria 758
1657 nmdc:mga08y16_1199988_c1 3300050511 Bacteria 729
1658 nmdc:mga08y16_261869_c1 3300050511 Bacteria 1786
1659 nmdc:mga0n895_1512238_c1 3300050512 Bacteria 637
1660 nmdc:mga0n895_33764_c1 3300050512 Bacteria 4918
1661 nmdc:mga0n895_454902_c1 3300050512 Bacteria 1292
1662 nmdc:mga0n895_476854_c1 3300050512 Bacteria 1258
1663 nmdc:mga0rr50_102280_c1 3300050513 Bacteria 2253
1664 nmdc:mga0rr50_26952_c1 3300050513 Bacteria 4018
1665 nmdc:mga08x19_1011500_c1 3300050514 Bacteria 590
1666 nmdc:mga08x19_261026_c1 3300050514 Bacteria 1197
1667 nmdc:mga08x19_463185_c1 3300050514 Bacteria 893
1668 nmdc:mga0a205_1345428_c1 3300050515 Unclassified 562
1669 nmdc:mga0sz30_110075_c1 3300050516 Bacteria 1207
1670 nmdc:mga0sz30_182077_c1 3300050516 Bacteria 932
1671 nmdc:mga0sz30_237048_c1 3300050516 Bacteria 812
1672 nmdc:mga0sz30_302959_c1 3300050516 Bacteria 713
1673 nmdc:mga0sz30_31337_c1 3300050516 Bacteria 1830
1674 nmdc:mga0sz30_417251_c1 3300050516 Bacteria 602
1675 Ga0495601_0035469 3300053077 Bacteria 3114
1676 Ga0495601_0119683 3300053077 Bacteria 1709
1677 Ga0495601_0167446 3300053077 Bacteria 1436
1678 Ga0495601_0290673 3300053077 Bacteria 1065
1679 Ga0495601_0303104 3300053077 Bacteria 1040
1680 Ga0495601_0481337 3300053077 Bacteria 802
1681 Ga0495612_0021447 3300053078 Bacteria 2592
1682 Ga0495612_0026650 3300053078 Bacteria 2323
1683 Ga0495612_0271320 3300053078 Bacteria 757
1684 Ga0495612_0285759 3300053078 Bacteria 738
1685 Ga0495612_0311032 3300053078 Bacteria 707
1686 Ga0500610_0246899 3300053079 Bacteria 826
1687 Ga0500610_0383668 3300053079 Bacteria 579
1688 Ga0500635_0017787 3300053080 Bacteria 2135
1689 Ga0500635_0305917 3300053080 Bacteria 628
1690 Ga0495655_0018190 3300053083 Bacteria 1541
1691 Ga0495655_0144557 3300053083 Bacteria 743
1692 Ga0495595_0009899 3300053084 Bacteria 3952
1693 Ga0495595_0031623 3300053084 Bacteria 2380
1694 Ga0495595_0477595 3300053084 Bacteria 634
1695 Ga0495619_0022726 3300053085 Bacteria 4016
1696 Ga0495619_0232266 3300053085 Bacteria 1278
1697 Ga0495619_0424691 3300053085 Bacteria 917
1698 Ga0495619_0748151 3300053085 Bacteria 663
1699 Ga0500578_0140992 3300053086 Bacteria 1507
1700 Ga0500578_0745454 3300053086 Bacteria 523
1701 Ga0500643_000150 3300053087 Bacteria 71016
1702 Ga0500644_0067878 3300053088 Bacteria 1277
1703 Ga0500644_0309256 3300053088 Bacteria 678
1704 Ga0500647_0127758 3300053091 Bacteria 1199
1705 Ga0500583_0279806 3300053092 Bacteria 819
1706 Ga0500651_0035391 3300053093 Bacteria 3146
1707 Ga0500651_0592872 3300053093 Bacteria 602
1708 Ga0500566_0000293 3300053094 Bacteria 26861
1709 Ga0500566_0000412 3300053094 Bacteria 23818
1710 Ga0500566_0338387 3300053094 Bacteria 694
1711 Ga0500640_077058 3300053095 Bacteria 1421
1712 Ga0500641_0007243 3300053096 Bacteria 3954
1713 Ga0500641_0009681 3300053096 Bacteria 3467
1714 Ga0500641_0034843 3300053096 Bacteria 2006
1715 Ga0500641_0104391 3300053096 Bacteria 1217
1716 Ga0500650_0064410 3300053098 Bacteria 1713
1717 Ga0500650_0245775 3300053098 Bacteria 804
1718 Ga0500650_0310615 3300053098 Bacteria 696
1719 Ga0500553_196389 3300053101 Bacteria 698
1720 Ga0500554_004219 3300053102 Bacteria 3025
1721 Ga0500554_032547 3300053102 Bacteria 1548
1722 Ga0500555_001186 3300053103 Bacteria 8535
1723 Ga0500555_079476 3300053103 Bacteria 855
1724 Ga0500556_0011102 3300053104 Bacteria 2660
1725 Ga0500556_0288254 3300053104 Bacteria 643
1726 Ga0500557_000062 3300053105 Bacteria 43893
1727 Ga0500558_185678 3300053106 Bacteria 738
1728 Ga0500562_103782 3300053108 Bacteria 774
1729 Ga0500569_142289 3300053109 Bacteria 807
1730 Ga0500569_176213 3300053109 Bacteria 726
1731 Ga0500572_001006 3300053111 Bacteria 8512
1732 Ga0500572_041328 3300053111 Bacteria 1338
1733 Ga0500594_0119191 3300053118 Bacteria 827
1734 Ga0500594_0175492 3300053118 Bacteria 698
1735 Ga0500594_0207880 3300053118 Bacteria 644
1736 Ga0500595_000395 3300053119 Bacteria 28044
1737 Ga0500595_000496 3300053119 Bacteria 24015
1738 Ga0500595_016839 3300053119 Bacteria 2714
1739 Ga0500595_029608 3300053119 Bacteria 1856
1740 Ga0500595_030732 3300053119 Bacteria 1807
1741 Ga0500595_117287 3300053119 Bacteria 754
1742 Ga0500597_247483 3300053120 Bacteria 731
1743 Ga0500607_022647 3300053121 Bacteria 3529
1744 Ga0500607_260016 3300053121 Bacteria 681
1745 Ga0500608_031229 3300053122 Bacteria 2527
1746 Ga0500608_129309 3300053122 Bacteria 1134
1747 Ga0500614_018221 3300053123 Bacteria 1595
1748 Ga0500621_258808 3300053126 Bacteria 580
1749 Ga0500626_033792 3300053128 Bacteria 2311
1750 Ga0500642_0000127 3300053130 Bacteria 34341
1751 Ga0500642_0042964 3300053130 Bacteria 1962
1752 Ga0500642_0415122 3300053130 Bacteria 584
1753 Ga0500652_040054 3300053131 Bacteria 1881
1754 Ga0500652_194514 3300053131 Bacteria 825
1755 Ga0500655_011686 3300053133 Bacteria 1593
1756 Ga0500658_0267966 3300053134 Bacteria 785
1757 Ga0500658_0393663 3300053134 Bacteria 634
1758 Ga0500559_0001342 3300053136 Bacteria 14123
1759 Ga0500559_0039859 3300053136 Bacteria 2044
1760 Ga0500559_0135222 3300053136 Bacteria 1152
1761 Ga0500559_0342745 3300053136 Bacteria 699
1762 Ga0500561_0025887 3300053137 Bacteria 1432
1763 Ga0500564_130498 3300053138 Bacteria 1087
1764 Ga0500568_0288196 3300053139 Bacteria 596
1765 Ga0500568_0292854 3300053139 Bacteria 591
1766 Ga0500568_0345049 3300053139 Bacteria 540
1767 Ga0500588_0065495 3300053146 Bacteria 1177
1768 Ga0500588_0292940 3300053146 Bacteria 615
1769 Ga0500588_0393314 3300053146 Bacteria 528
1770 Ga0500589_080197 3300053147 Bacteria 1459
1771 Ga0500590_133266 3300053148 Bacteria 1146
1772 Ga0500590_186072 3300053148 Bacteria 896
1773 Ga0500603_006349 3300053150 Bacteria 2567
1774 Ga0500604_0018478 3300053151 Bacteria 1943
1775 Ga0500616_0042038 3300053153 Bacteria 2449
1776 Ga0500616_0087462 3300053153 Bacteria 1551
1777 Ga0500616_0145973 3300053153 Bacteria 1100
1778 Ga0500619_111911 3300053154 Bacteria 929
1779 Ga0500620_262571 3300053155 Bacteria 571
1780 Ga0500622_0062318 3300053156 Bacteria 1899
1781 Ga0500622_0063763 3300053156 Bacteria 1875
1782 Ga0500622_0074084 3300053156 Bacteria 1716
1783 Ga0500624_007439 3300053157 Bacteria 1507
1784 Ga0500627_0018363 3300053158 Bacteria 2767
1785 Ga0500627_0026749 3300053158 Bacteria 2385
1786 Ga0500627_0039239 3300053158 Bacteria 2027
1787 Ga0500634_0209048 3300053161 Bacteria 849
1788 Ga0500638_000370 3300053162 Bacteria 10477
1789 Ga0500638_022359 3300053162 Bacteria 2996
1790 Ga0500638_216215 3300053162 Bacteria 799
1791 Ga0500638_260636 3300053162 Bacteria 692
1792 Ga0500639_004522 3300053163 Bacteria 7069
1793 Ga0500636_0000041 3300053177 Bacteria 69687
1794 Ga0500636_0053870 3300053177 Bacteria 2360
1795 Ga0500636_0088163 3300053177 Bacteria 1780
1796 Ga0500636_0163495 3300053177 Bacteria 1211
1797 Ga0500636_0207473 3300053177 Bacteria 1031
1798 Ga0500636_0325885 3300053177 Bacteria 744
1799 Ga0500637_0000026 3300053178 Bacteria 59050
1800 Ga0500637_0079586 3300053178 Bacteria 1892
1801 Ga0500637_0103093 3300053178 Bacteria 1654
1802 Ga0500637_0619463 3300053178 Bacteria 509
1803 Ga0500576_001460 3300053725 Bacteria 7974
1804 Ga0500611_090875 3300053727 Bacteria 777
1805 Ga0500625_015049 3300053729 Bacteria 3585
1806 Ga0500645_010714 3300053730 Bacteria 3018
1807 Ga0500645_066730 3300053730 Bacteria 1036
1808 Ga0500609_026905 3300053731 Bacteria 788
1809 Ga0500596_011400 3300053735 Bacteria 1360
1810 Ga0500599_018322 3300053736 Bacteria 978
1811 Ga0500601_000306 3300053737 Bacteria 9164
1812 Ga0500661_001127 3300055283 Bacteria 5003
1813 Ga0500661_011645 3300055283 Bacteria 1589
1814 Ga0500661_043445 3300055283 Bacteria 797
1815 Ga0501082_0404079 3300060353 Bacteria 1192
1816 Ga0466962_0026115 3300061719 Bacteria 2805
1817 Ga0530510_0350435 3300061734 Bacteria 1109

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025910 Ga0207684_10832422 Ga0207684_108324222 89
2 iso_pu_bacteria 2507262055 2507507460 101
3 iso_pu_bacteria 2508501009 2508541574 101
4 iso_pu_bacteria 2508501042 2508692883 101
5 iso_pu_bacteria 2511231028 2511398976 101
6 iso_pu_bacteria 2513237092 2513621666 101
7 iso_pu_bacteria 2513237095 2513651150 101
8 iso_pu_bacteria 2513237139 2513878361 101
9 iso_pu_bacteria 2513237161 2514011712 101
10 iso_pu_bacteria 2515154112 2515626273 101
11 iso_pu_bacteria 2517093001 2517107853 101
12 iso_pu_bacteria 2528768022 2528852876 101
13 iso_pu_bacteria 2617270735 2617352715 101
14 iso_pu_bacteria 2617270741 2617372942 101
15 iso_pu_bacteria 2802429603 2805920584 101
16 iso_pu_bacteria 2816332527 2818236770 101
17 iso_pu_bacteria 2824600985 2824605663 101
18 iso_pu_bacteria 2824609381 2824611775 101
19 iso_pu_bacteria 2824661429 2824664034 101
20 iso_pu_bacteria 2824671348 2824675202 101
21 iso_pu_bacteria 2824679649 2824681572 101
22 iso_pu_bacteria 2824687955 2824690050 101
23 iso_pu_bacteria 2824704595 2824711114 101
24 iso_pu_bacteria 2824732956 2824735654 101
25 iso_pu_bacteria 2824746037 2824752148 101
26 iso_pu_bacteria 2824753945 2824760451 101
27 iso_pu_bacteria 2824763712 2824766560 101
28 iso_pu_bacteria 2824773399 2824776680 101
29 iso_pu_bacteria 2841941048 2841946389 101
30 iso_pu_bacteria 2841957949 2841965630 101
31 iso_pu_bacteria 2841974524 2841978429 101
32 iso_pu_bacteria 2842038055 2842040858 101
33 iso_pu_bacteria 2842045827 2842046197 101
34 iso_pu_bacteria 2847930680 2847937537 101
35 iso_pu_bacteria 2849076700 2849078187 101
36 iso_pu_bacteria 2857509624 2857511348 101
37 iso_pu_bacteria 2874590934 2874598576 101
38 iso_pu_bacteria 2874612657 2874616761 101
39 iso_pu_bacteria 2874620515 2874628289 101
40 iso_pu_bacteria 2874628541 2874630114 101
41 iso_pu_bacteria 2874645413 2874652029 101
42 iso_pu_bacteria 2876771140 2876778614 101
43 iso_pu_bacteria 2876818435 2876823419 101
44 iso_pu_bacteria 2879074833 2879082407 101
45 iso_pu_bacteria 2879083081 2879084950 101
46 iso_pu_bacteria 2879099564 2879107933 101
47 iso_pu_bacteria 2879127579 2879131812 101
48 iso_pu_bacteria 2879142872 2879150148 101
49 iso_pu_bacteria 2881364244 2881370117 101
50 iso_pu_bacteria 2881665667 2881670117 101
51 iso_pu_bacteria 2885366525 2885370182 101
52 iso_pu_bacteria 2885409591 2885414373 101
53 iso_pu_bacteria 2888378607 2888385693 101
54 iso_pu_bacteria 2904666416 2904674092 101
55 iso_pu_bacteria 2904711408 2904711742 101
56 iso_pu_bacteria 2906643746 2906651214 101
57 iso_pu_bacteria 2908775508 2908781391 101
58 iso_pu_bacteria 2922368715 2922375940 101
59 iso_pu_bacteria 2922393267 2922396857 101
60 iso_pu_bacteria 2929615660 2929621253 101
61 iso_pu_bacteria 2929624759 2929625916 101
62 iso_pu_bacteria 2932784394 2932785199 101
63 iso_pu_bacteria 2932794094 2932799650 101
64 iso_pu_bacteria 2932801729 2932808762 101
65 iso_pu_bacteria 2932809354 2932810233 101
66 iso_pu_bacteria 2932818245 2932821805 101
67 iso_pu_bacteria 2932828146 2932829035 101
68 iso_pu_bacteria 2933577622 2933582878 101
69 iso_pu_bacteria 2935608549 2935610036 101
70 iso_pu_bacteria 2935616580 2935619545 101
71 iso_pu_bacteria 2935638405 2935638525 101
72 iso_pu_bacteria 2935648319 2935656354 101
73 iso_pu_bacteria 2935656913 2935660090 101
74 iso_pu_bacteria 2935665750 2935666623 101
75 iso_pu_bacteria 2935675223 2935682187 101
76 iso_pu_bacteria 2935684952 2935691157 101
77 iso_pu_bacteria 2935694250 2935694418 101
78 iso_pu_bacteria 2935703347 2935703531 101
79 iso_pu_bacteria 2935713505 2935718538 101
80 iso_pu_bacteria 2935722832 2935727482 101
81 iso_pu_bacteria 2935732158 2935736185 101
82 iso_pu_bacteria 2935741537 2935745565 101
83 iso_pu_bacteria 2935750917 2935755946 101
84 iso_pu_bacteria 2935760218 2935760792 101
85 iso_pu_bacteria 2935769743 2935776447 101
86 iso_pu_bacteria 2935777560 2935780840 101
87 iso_pu_bacteria 2935785616 2935792328 101
88 iso_pu_bacteria 2935793552 2935800497 101
89 iso_pu_bacteria 2935801545 2935801668 101
90 iso_pu_bacteria 2935810662 2935814922 101
91 iso_pu_bacteria 2935819856 2935823196 101
92 iso_pu_bacteria 2935827899 2935828019 101
93 iso_pu_bacteria 2935837841 2935842225 101
94 iso_pu_bacteria 2935847175 2935848778 101
95 iso_pu_bacteria 2935855204 2935858139 101
96 iso_pu_bacteria 2935864058 2935868044 101
97 iso_pu_bacteria 2935873716 2935873933 101
98 iso_pu_bacteria 2935883170 2935885692 101
99 iso_pu_bacteria 2935908558 2935909420 101
100 iso_pu_bacteria 2935916978 2935917142 101
101 iso_pu_bacteria 2935926038 2935926901 101
102 iso_pu_bacteria 2935934488 2935937255 101
103 iso_pu_bacteria 2935942939 2935944442 101
104 iso_pu_bacteria 2935951376 2935952879 101
105 iso_pu_bacteria 2935967501 2935969719 101
106 iso_pu_bacteria 2935975950 2935976330 101
107 iso_pu_bacteria 2935984226 2935991829 101
108 iso_pu_bacteria 2935992306 2935993143 101
109 iso_pu_bacteria 2936002035 2936003080 101
110 iso_pu_bacteria 2936011229 2936014506 101
111 iso_pu_bacteria 2936019824 2936027827 101
112 iso_pu_bacteria 2936028420 2936031297 101
113 iso_pu_bacteria 2936037263 2936040435 101
114 iso_pu_bacteria 2936046547 2936049612 101
115 iso_pu_bacteria 2936055302 2936061172 101
116 iso_pu_bacteria 2940556831 2940562079 101
117 iso_pu_bacteria 2941538514 2941542273 101
118 iso_pu_bacteria 3005587118 3005588270 101
119 iso_pu_bacteria 8016522445 8016528498 101
120 iso_pu_bacteria 8016530956 8016533657 101
121 iso_pu_bacteria 8016539877 8016546879 101
122 iso_pu_bacteria 8016557553 8016563602 101
123 iso_pu_bacteria 8016566248 8016571987 101
124 iso_pu_bacteria 8016575299 8016576192 101
125 iso_pu_bacteria 8016595262 8016601337 101
126 iso_pu_bacteria 8016603502 8016609093 101
127 iso_pu_bacteria 8016613128 8016615811 101
128 iso_pu_bacteria 8016622563 8016625422 101
129 iso_pu_bacteria 8016630954 8016638947 101
130 iso_pu_bacteria 8017057580 8017065149 101
131 iso_pu_bacteria 8019530166 8019533437 101
132 iso_pu_bacteria 8019576017 8019584539 101
133 iso_pu_bacteria 8019586578 8019592312 101
134 iso_pu_bacteria 8019597564 8019598975 101
135 iso_pu_bacteria 8019608314 8019609402 101
136 iso_pu_bacteria 8019619141 8019620025 101
137 iso_pu_bacteria 8019638758 8019646822 101
138 iso_pu_bacteria 8019659431 8019660961 101
139 iso_pu_bacteria 8019668869 8019670521 101
140 iso_pu_bacteria 8019678201 8019685711 101
141 iso_pu_bacteria 8019687851 8019691288 101
142 iso_pu_bacteria 8055742211 8055744886 101
143 iso_pu_bacteria 2513237101 2513693727 102
144 iso_pu_bacteria 2513237104 2513721520 102
145 iso_pu_bacteria 2524023205 2524436077 102
146 iso_pu_bacteria 2524023228 2524533660 102
147 iso_pu_bacteria 2667528175 2671123242 102
148 iso_pu_bacteria 2721755755 2723843499 102
149 iso_pu_bacteria 2791355197 2793066499 102
150 iso_pu_bacteria 2791355199 2793083973 102
151 iso_pu_bacteria 2874604998 2874611591 102
152 iso_pu_bacteria 2876808645 2876813623 102
153 iso_pu_bacteria 2879110137 2879117448 102
154 iso_pu_bacteria 2889033259 2889037808 102
155 iso_pu_bacteria 2903748898 2903752225 102
156 iso_pu_bacteria 2904699407 2904701035 102
157 iso_pu_bacteria 2906610324 2906616336 102
158 iso_pu_bacteria 2908739725 2908741474 102
159 iso_pu_bacteria 2922361189 2922361755 102
160 iso_pu_bacteria 2922386360 2922387000 102
161 iso_pu_bacteria 2922425934 2922431666 102
162 iso_pu_bacteria 2935630451 2935635784 102
163 iso_pu_bacteria 2935959822 2935962908 102
164 iso_pu_bacteria 2941507105 2941512379 102
165 iso_pu_bacteria 2941515067 2941520116 102
166 iso_pu_bacteria 2941523033 2941528265 102
167 iso_pu_bacteria 3005474847 3005481465 102
168 iso_pu_bacteria 8006933436 8006939252 102
169 iso_pu_bacteria 8006964411 8006966869 102
170 iso_pu_bacteria 8006973647 8006978910 102
171 iso_pu_bacteria 8006984368 8006984623 102
172 iso_pu_bacteria 8006994254 8006994623 102
173 iso_pu_bacteria 8019555841 8019565113 102
174 iso_pu_bacteria 8019565922 8019575215 102
175 iso_pu_bacteria 8056673599 8056680910 102
176 iso_pu_bacteria 8056689827 8056690616 102
177 3300014969 Ga0157376_11490889 Ga0157376_114908892 103
178 3300041491 Ga0451833_1482099 Ga0451833_1482099_281_598 104
179 3300001989 JGI24739J22299_10116862 JGI24739J22299_101168622 105
180 3300002239 JGI24034J26672_10029778 JGI24034J26672_100297782 105
181 3300003203 JGI25406J46586_10014944 JGI25406J46586_100149444 105
182 3300003203 JGI25406J46586_10095467 JGI25406J46586_100954672 105
183 3300003215 JGI25153J46596_10000317 JGI25153J46596_100003179 105
184 3300003215 JGI25153J46596_10004814 JGI25153J46596_100048146 105
185 3300003215 JGI25153J46596_10005866 JGI25153J46596_100058665 105
186 3300003215 JGI25153J46596_10007843 JGI25153J46596_100078436 105
187 3300003215 JGI25153J46596_10012385 JGI25153J46596_100123854 105
188 3300003320 rootH2_10065932 rootH2_100659323 105
189 3300003320 rootH2_10191834 rootH2_101918342 105
190 3300003323 rootH1_10061598 rootH1_100615982 105
191 3300003354 JGI25160J50197_1002533 JGI25160J50197_10025337 105
192 3300003354 JGI25160J50197_1007102 JGI25160J50197_10071024 105
193 3300003659 JGI25404J52841_10000871 JGI25404J52841_100008712 105
194 3300003659 JGI25404J52841_10007910 JGI25404J52841_100079104 105
195 3300003659 JGI25404J52841_10008582 JGI25404J52841_100085823 105
196 3300003659 JGI25404J52841_10025548 JGI25404J52841_100255482 105
197 3300003659 JGI25404J52841_10029100 JGI25404J52841_100291003 105
198 3300003659 JGI25404J52841_10037822 JGI25404J52841_100378222 105
199 3300003659 JGI25404J52841_10042107 JGI25404J52841_100421072 105
200 3300003659 JGI25404J52841_10052353 JGI25404J52841_100523532 105
201 3300003659 JGI25404J52841_10083583 JGI25404J52841_100835832 105
202 3300003752 Ga0055539_1012434 Ga0055539_10124342 105
203 3300003762 Ga0055542_1006210 Ga0055542_10062103 105
204 3300003911 JGI25405J52794_10076813 JGI25405J52794_100768131 105
205 3300004625 Ga0055543_1014610 Ga0055543_10146102 105
206 3300004625 Ga0055543_1024903 Ga0055543_10249031 105
207 3300005262 Ga0065165_1000747 Ga0065165_100074717 105
208 3300005262 Ga0065165_1028625 Ga0065165_10286253 105
209 3300005290 Ga0065712_10415587 Ga0065712_104155871 105
210 3300005293 Ga0065715_10644930 Ga0065715_106449302 105
211 3300005293 Ga0065715_11024783 Ga0065715_110247832 105
212 3300005295 Ga0065707_10276170 Ga0065707_102761702 105
213 3300005327 Ga0070658_10136673 Ga0070658_101366734 105
214 3300005328 Ga0070676_10133797 Ga0070676_101337972 105
215 3300005328 Ga0070676_11115087 Ga0070676_111150872 105
216 3300005329 Ga0070683_100076181 Ga0070683_1000761814 105
217 3300005329 Ga0070683_100315205 Ga0070683_1003152052 105
218 3300005329 Ga0070683_100649752 Ga0070683_1006497521 105
219 3300005329 Ga0070683_100856652 Ga0070683_1008566522 105
220 3300005331 Ga0070670_100380916 Ga0070670_1003809162 105
221 3300005331 Ga0070670_100772361 Ga0070670_1007723612 105
222 3300005334 Ga0068869_100029055 Ga0068869_1000290552 105
223 3300005334 Ga0068869_100074710 Ga0068869_1000747102 105
224 3300005334 Ga0068869_100217523 Ga0068869_1002175232 105
225 3300005334 Ga0068869_100645898 Ga0068869_1006458982 105
226 3300005334 Ga0068869_101079417 Ga0068869_1010794171 105
227 3300005334 Ga0068869_101242578 Ga0068869_1012425782 105
228 3300005335 Ga0070666_11078737 Ga0070666_110787371 105
229 3300005335 Ga0070666_11515301 Ga0070666_115153011 105
230 3300005336 Ga0070680_100023775 Ga0070680_1000237754 105
231 3300005336 Ga0070680_100064981 Ga0070680_1000649813 105
232 3300005336 Ga0070680_100119741 Ga0070680_1001197412 105
233 3300005336 Ga0070680_100142232 Ga0070680_1001422322 105
234 3300005337 Ga0070682_100064502 Ga0070682_1000645022 105
235 3300005337 Ga0070682_101571997 Ga0070682_1015719971 105
236 3300005338 Ga0068868_100048941 Ga0068868_1000489412 105
237 3300005338 Ga0068868_100232925 Ga0068868_1002329252 105
238 3300005338 Ga0068868_100491401 Ga0068868_1004914012 105
239 3300005338 Ga0068868_100860479 Ga0068868_1008604792 105
240 3300005339 Ga0070660_100037797 Ga0070660_1000377973 105
241 3300005339 Ga0070660_100360751 Ga0070660_1003607512 105
242 3300005339 Ga0070660_100421791 Ga0070660_1004217913 105
243 3300005339 Ga0070660_101269811 Ga0070660_1012698112 105
244 3300005340 Ga0070689_100282595 Ga0070689_1002825952 105
245 3300005341 Ga0070691_10108586 Ga0070691_101085862 105
246 3300005341 Ga0070691_10920039 Ga0070691_109200391 105
247 3300005341 Ga0070691_11016258 Ga0070691_110162581 105
248 3300005343 Ga0070687_100176927 Ga0070687_1001769271 105
249 3300005343 Ga0070687_101111280 Ga0070687_1011112801 105
250 3300005344 Ga0070661_100104163 Ga0070661_1001041634 105
251 3300005344 Ga0070661_100191217 Ga0070661_1001912172 105
252 3300005347 Ga0070668_100027260 Ga0070668_1000272605 105
253 3300005347 Ga0070668_100101314 Ga0070668_1001013143 105
254 3300005347 Ga0070668_100113621 Ga0070668_1001136214 105
255 3300005347 Ga0070668_100125736 Ga0070668_1001257363 105
256 3300005347 Ga0070668_100645654 Ga0070668_1006456541 105
257 3300005347 Ga0070668_100990526 Ga0070668_1009905262 105
258 3300005347 Ga0070668_101164617 Ga0070668_1011646172 105
259 3300005347 Ga0070668_101569422 Ga0070668_1015694222 105
260 3300005347 Ga0070668_101569955 Ga0070668_1015699552 105
261 3300005347 Ga0070668_102132827 Ga0070668_1021328272 105
262 3300005353 Ga0070669_100156285 Ga0070669_1001562852 105
263 3300005354 Ga0070675_100734767 Ga0070675_1007347672 105
264 3300005354 Ga0070675_101601728 Ga0070675_1016017282 105
265 3300005355 Ga0070671_100044655 Ga0070671_1000446553 105
266 3300005355 Ga0070671_100104083 Ga0070671_1001040833 105
267 3300005355 Ga0070671_100250472 Ga0070671_1002504722 105
268 3300005355 Ga0070671_100460904 Ga0070671_1004609042 105
269 3300005356 Ga0070674_100046227 Ga0070674_1000462275 105
270 3300005356 Ga0070674_100297571 Ga0070674_1002975713 105
271 3300005356 Ga0070674_101485558 Ga0070674_1014855582 105
272 3300005364 Ga0070673_100350114 Ga0070673_1003501142 105
273 3300005364 Ga0070673_100660418 Ga0070673_1006604182 105
274 3300005364 Ga0070673_100748112 Ga0070673_1007481122 105
275 3300005365 Ga0070688_100738557 Ga0070688_1007385572 105
276 3300005366 Ga0070659_100201438 Ga0070659_1002014382 105
277 3300005366 Ga0070659_100263299 Ga0070659_1002632992 105
278 3300005366 Ga0070659_100908230 Ga0070659_1009082301 105
279 3300005366 Ga0070659_101897469 Ga0070659_1018974692 105
280 3300005367 Ga0070667_100146893 Ga0070667_1001468933 105
281 3300005367 Ga0070667_100437851 Ga0070667_1004378512 105
282 3300005367 Ga0070667_100566634 Ga0070667_1005666342 105
283 3300005367 Ga0070667_100606564 Ga0070667_1006065642 105
284 3300005367 Ga0070667_100955227 Ga0070667_1009552272 105
285 3300005367 Ga0070667_100960770 Ga0070667_1009607702 105
286 3300005406 Ga0070703_10120652 Ga0070703_101206521 105
287 3300005434 Ga0070709_10002197 Ga0070709_100021974 105
288 3300005434 Ga0070709_10036355 Ga0070709_100363554 105
289 3300005434 Ga0070709_10250031 Ga0070709_102500313 105
290 3300005434 Ga0070709_10571818 Ga0070709_105718181 105
291 3300005434 Ga0070709_11437574 Ga0070709_114375741 105
292 3300005435 Ga0070714_100002801 Ga0070714_1000028014 105
293 3300005435 Ga0070714_100107849 Ga0070714_1001078494 105
294 3300005435 Ga0070714_100468732 Ga0070714_1004687322 105
295 3300005436 Ga0070713_100101308 Ga0070713_1001013083 105
296 3300005436 Ga0070713_100257137 Ga0070713_1002571374 105
297 3300005436 Ga0070713_100532737 Ga0070713_1005327372 105
298 3300005437 Ga0070710_10000678 Ga0070710_100006781 105
299 3300005437 Ga0070710_10040951 Ga0070710_100409514 105
300 3300005437 Ga0070710_10676579 Ga0070710_106765791 105
301 3300005438 Ga0070701_10245988 Ga0070701_102459882 105
302 3300005439 Ga0070711_100012735 Ga0070711_1000127356 105
303 3300005439 Ga0070711_100030578 Ga0070711_1000305784 105
304 3300005439 Ga0070711_100287231 Ga0070711_1002872312 105
305 3300005439 Ga0070711_100518087 Ga0070711_1005180872 105
306 3300005439 Ga0070711_101333064 Ga0070711_1013330642 105
307 3300005441 Ga0070700_100107452 Ga0070700_1001074522 105
308 3300005441 Ga0070700_100141268 Ga0070700_1001412684 105
309 3300005445 Ga0070708_100962523 Ga0070708_1009625232 105
310 3300005445 Ga0070708_101800275 Ga0070708_1018002752 105
311 3300005455 Ga0070663_100008949 Ga0070663_1000089496 105
312 3300005455 Ga0070663_100034033 Ga0070663_1000340335 105
313 3300005455 Ga0070663_100047641 Ga0070663_1000476413 105
314 3300005455 Ga0070663_100053262 Ga0070663_1000532622 105
315 3300005455 Ga0070663_100186548 Ga0070663_1001865483 105
316 3300005455 Ga0070663_100451553 Ga0070663_1004515532 105
317 3300005455 Ga0070663_100616170 Ga0070663_1006161702 105
318 3300005455 Ga0070663_100877351 Ga0070663_1008773512 105
319 3300005455 Ga0070663_101697054 Ga0070663_1016970542 105
320 3300005456 Ga0070678_100094705 Ga0070678_1000947053 105
321 3300005456 Ga0070678_100095574 Ga0070678_1000955742 105
322 3300005456 Ga0070678_100235114 Ga0070678_1002351143 105
323 3300005456 Ga0070678_100563910 Ga0070678_1005639102 105
324 3300005456 Ga0070678_101067052 Ga0070678_1010670522 105
325 3300005456 Ga0070678_101327549 Ga0070678_1013275492 105
326 3300005456 Ga0070678_101742792 Ga0070678_1017427922 105
327 3300005456 Ga0070678_102016410 Ga0070678_1020164102 105
328 3300005457 Ga0070662_100044307 Ga0070662_1000443072 105
329 3300005457 Ga0070662_100049683 Ga0070662_1000496832 105
330 3300005457 Ga0070662_100237999 Ga0070662_1002379992 105
331 3300005457 Ga0070662_100262055 Ga0070662_1002620552 105
332 3300005457 Ga0070662_100808928 Ga0070662_1008089281 105
333 3300005457 Ga0070662_101115648 Ga0070662_1011156482 105
334 3300005458 Ga0070681_10022753 Ga0070681_100227535 105
335 3300005458 Ga0070681_10090364 Ga0070681_100903643 105
336 3300005458 Ga0070681_10304038 Ga0070681_103040382 105
337 3300005458 Ga0070681_10390344 Ga0070681_103903442 105
338 3300005459 Ga0068867_100280406 Ga0068867_1002804062 105
339 3300005459 Ga0068867_101700612 Ga0068867_1017006122 105
340 3300005466 Ga0070685_10428649 Ga0070685_104286492 105
341 3300005466 Ga0070685_10594279 Ga0070685_105942791 105
342 3300005467 Ga0070706_100141178 Ga0070706_1001411784 105
343 3300005468 Ga0070707_100602760 Ga0070707_1006027602 105
344 3300005471 Ga0070698_100291619 Ga0070698_1002916193 105
345 3300005518 Ga0070699_100326955 Ga0070699_1003269552 105
346 3300005518 Ga0070699_100963944 Ga0070699_1009639442 105
347 3300005530 Ga0070679_100106692 Ga0070679_1001066922 105
348 3300005530 Ga0070679_100645170 Ga0070679_1006451702 105
349 3300005530 Ga0070679_100750704 Ga0070679_1007507042 105
350 3300005530 Ga0070679_101075727 Ga0070679_1010757272 105
351 3300005530 Ga0070679_101397953 Ga0070679_1013979531 105
352 3300005535 Ga0070684_100009391 Ga0070684_1000093914 105
353 3300005535 Ga0070684_100065826 Ga0070684_1000658263 105
354 3300005535 Ga0070684_100156524 Ga0070684_1001565243 105
355 3300005535 Ga0070684_100559927 Ga0070684_1005599271 105
356 3300005539 Ga0068853_100207247 Ga0068853_1002072473 105
357 3300005539 Ga0068853_100211567 Ga0068853_1002115673 105
358 3300005539 Ga0068853_100252508 Ga0068853_1002525082 105
359 3300005539 Ga0068853_100483256 Ga0068853_1004832562 105
360 3300005539 Ga0068853_100810353 Ga0068853_1008103532 105
361 3300005539 Ga0068853_101776561 Ga0068853_1017765612 105
362 3300005543 Ga0070672_100065744 Ga0070672_1000657444 105
363 3300005543 Ga0070672_100143728 Ga0070672_1001437282 105
364 3300005543 Ga0070672_100831430 Ga0070672_1008314302 105
365 3300005543 Ga0070672_101204135 Ga0070672_1012041352 105
366 3300005544 Ga0070686_101043113 Ga0070686_1010431132 105
367 3300005545 Ga0070695_100189432 Ga0070695_1001894321 105
368 3300005545 Ga0070695_100290061 Ga0070695_1002900611 105
369 3300005546 Ga0070696_100525428 Ga0070696_1005254282 105
370 3300005546 Ga0070696_100691291 Ga0070696_1006912912 105
371 3300005546 Ga0070696_100998809 Ga0070696_1009988091 105
372 3300005547 Ga0070693_100448625 Ga0070693_1004486252 105
373 3300005547 Ga0070693_100468175 Ga0070693_1004681751 105
374 3300005547 Ga0070693_100894844 Ga0070693_1008948442 105
375 3300005548 Ga0070665_100023384 Ga0070665_1000233845 105
376 3300005548 Ga0070665_100051490 Ga0070665_1000514905 105
377 3300005548 Ga0070665_100078654 Ga0070665_1000786544 105
378 3300005548 Ga0070665_100099122 Ga0070665_1000991222 105
379 3300005548 Ga0070665_100123917 Ga0070665_1001239174 105
380 3300005548 Ga0070665_100134445 Ga0070665_1001344452 105
381 3300005548 Ga0070665_100349116 Ga0070665_1003491162 105
382 3300005548 Ga0070665_100401676 Ga0070665_1004016762 105
383 3300005548 Ga0070665_100572960 Ga0070665_1005729603 105
384 3300005548 Ga0070665_100790620 Ga0070665_1007906202 105
385 3300005548 Ga0070665_100819186 Ga0070665_1008191862 105
386 3300005548 Ga0070665_101546117 Ga0070665_1015461172 105
387 3300005548 Ga0070665_101985406 Ga0070665_1019854062 105
388 3300005549 Ga0070704_100319412 Ga0070704_1003194123 105
389 3300005563 Ga0068855_100176362 Ga0068855_1001763622 105
390 3300005563 Ga0068855_100181159 Ga0068855_1001811593 105
391 3300005563 Ga0068855_100392661 Ga0068855_1003926613 105
392 3300005563 Ga0068855_100925958 Ga0068855_1009259582 105
393 3300005564 Ga0070664_100084031 Ga0070664_1000840312 105
394 3300005564 Ga0070664_100107954 Ga0070664_1001079544 105
395 3300005564 Ga0070664_101567630 Ga0070664_1015676302 105
396 3300005564 Ga0070664_102022727 Ga0070664_1020227271 105
397 3300005577 Ga0068857_100037748 Ga0068857_1000377482 105
398 3300005577 Ga0068857_100059974 Ga0068857_1000599745 105
399 3300005577 Ga0068857_100276573 Ga0068857_1002765733 105
400 3300005577 Ga0068857_100404371 Ga0068857_1004043711 105
401 3300005577 Ga0068857_101130912 Ga0068857_1011309122 105
402 3300005578 Ga0068854_100097953 Ga0068854_1000979531 105
403 3300005578 Ga0068854_100475090 Ga0068854_1004750902 105
404 3300005578 Ga0068854_100838820 Ga0068854_1008388202 105
405 3300005578 Ga0068854_100878265 Ga0068854_1008782652 105
406 3300005578 Ga0068854_101242383 Ga0068854_1012423831 105
407 3300005578 Ga0068854_102089291 Ga0068854_1020892911 105
408 3300005614 Ga0068856_100079699 Ga0068856_1000796991 105
409 3300005614 Ga0068856_100335083 Ga0068856_1003350832 105
410 3300005614 Ga0068856_101378005 Ga0068856_1013780052 105
411 3300005614 Ga0068856_101595278 Ga0068856_1015952782 105
412 3300005614 Ga0068856_101728746 Ga0068856_1017287462 105
413 3300005616 Ga0068852_100006452 Ga0068852_1000064528 105
414 3300005616 Ga0068852_100038198 Ga0068852_1000381983 105
415 3300005616 Ga0068852_100133040 Ga0068852_1001330402 105
416 3300005616 Ga0068852_100406063 Ga0068852_1004060632 105
417 3300005616 Ga0068852_100426524 Ga0068852_1004265242 105
418 3300005616 Ga0068852_100455793 Ga0068852_1004557933 105
419 3300005616 Ga0068852_100470076 Ga0068852_1004700762 105
420 3300005616 Ga0068852_100873214 Ga0068852_1008732142 105
421 3300005616 Ga0068852_101718998 Ga0068852_1017189982 105
422 3300005616 Ga0068852_101734815 Ga0068852_1017348152 105
423 3300005616 Ga0068852_102086375 Ga0068852_1020863752 105
424 3300005617 Ga0068859_100103545 Ga0068859_1001035452 105
425 3300005617 Ga0068859_100181183 Ga0068859_1001811833 105
426 3300005617 Ga0068859_100357364 Ga0068859_1003573642 105
427 3300005617 Ga0068859_102157565 Ga0068859_1021575652 105
428 3300005618 Ga0068864_100058929 Ga0068864_1000589293 105
429 3300005618 Ga0068864_100278065 Ga0068864_1002780652 105
430 3300005618 Ga0068864_100300154 Ga0068864_1003001542 105
431 3300005718 Ga0068866_10020120 Ga0068866_100201204 105
432 3300005718 Ga0068866_10121670 Ga0068866_101216703 105
433 3300005719 Ga0068861_100045277 Ga0068861_1000452774 105
434 3300005719 Ga0068861_100248218 Ga0068861_1002482183 105
435 3300005719 Ga0068861_100577234 Ga0068861_1005772342 105
436 3300005719 Ga0068861_100652866 Ga0068861_1006528662 105
437 3300005719 Ga0068861_100920044 Ga0068861_1009200441 105
438 3300005719 Ga0068861_101560093 Ga0068861_1015600932 105
439 3300005719 Ga0068861_102049992 Ga0068861_1020499922 105
440 3300005719 Ga0068861_102242785 Ga0068861_1022427852 105
441 3300005834 Ga0068851_10082500 Ga0068851_100825002 105
442 3300005834 Ga0068851_10118916 Ga0068851_101189162 105
443 3300005834 Ga0068851_10311032 Ga0068851_103110322 105
444 3300005840 Ga0068870_10277692 Ga0068870_102776923 105
445 3300005840 Ga0068870_10779871 Ga0068870_107798712 105
446 3300005840 Ga0068870_11421920 Ga0068870_114219202 105
447 3300005841 Ga0068863_100234737 Ga0068863_1002347372 105
448 3300005841 Ga0068863_101347047 Ga0068863_1013470472 105
449 3300005841 Ga0068863_101352050 Ga0068863_1013520501 105
450 3300005842 Ga0068858_100119984 Ga0068858_1001199843 105
451 3300005842 Ga0068858_100578938 Ga0068858_1005789382 105
452 3300005842 Ga0068858_100727093 Ga0068858_1007270932 105
453 3300005842 Ga0068858_101185028 Ga0068858_1011850282 105
454 3300005843 Ga0068860_100153207 Ga0068860_1001532073 105
455 3300005843 Ga0068860_100190322 Ga0068860_1001903224 105
456 3300005843 Ga0068860_100388574 Ga0068860_1003885742 105
457 3300005843 Ga0068860_101836220 Ga0068860_1018362202 105
458 3300005844 Ga0068862_100034594 Ga0068862_1000345945 105
459 3300005844 Ga0068862_100215475 Ga0068862_1002154752 105
460 3300005844 Ga0068862_100345350 Ga0068862_1003453502 105
461 3300005844 Ga0068862_100809320 Ga0068862_1008093202 105
462 3300005844 Ga0068862_100959577 Ga0068862_1009595772 105
463 3300005844 Ga0068862_101260260 Ga0068862_1012602602 105
464 3300005844 Ga0068862_101709618 Ga0068862_1017096182 105
465 3300005937 Ga0081455_10030485 Ga0081455_100304852 105
466 3300005937 Ga0081455_10045444 Ga0081455_100454443 105
467 3300005937 Ga0081455_10056270 Ga0081455_100562703 105
468 3300005937 Ga0081455_10066759 Ga0081455_100667592 105
469 3300005937 Ga0081455_10248694 Ga0081455_102486943 105
470 3300005937 Ga0081455_10544844 Ga0081455_105448442 105
471 3300005937 Ga0081455_10709519 Ga0081455_107095191 105
472 3300005937 Ga0081455_10729471 Ga0081455_107294712 105
473 3300005981 Ga0081538_10101414 Ga0081538_101014142 105
474 3300005981 Ga0081538_10172578 Ga0081538_101725782 105
475 3300005983 Ga0081540_1003418 Ga0081540_10034183 105
476 3300005983 Ga0081540_1012000 Ga0081540_10120006 105
477 3300005983 Ga0081540_1014330 Ga0081540_10143303 105
478 3300005983 Ga0081540_1021006 Ga0081540_10210063 105
479 3300005983 Ga0081540_1021049 Ga0081540_10210495 105
480 3300005983 Ga0081540_1043950 Ga0081540_10439503 105
481 3300005983 Ga0081540_1064372 Ga0081540_10643722 105
482 3300005983 Ga0081540_1076996 Ga0081540_10769962 105
483 3300005983 Ga0081540_1083694 Ga0081540_10836942 105
484 3300005983 Ga0081540_1088582 Ga0081540_10885823 105
485 3300005983 Ga0081540_1088921 Ga0081540_10889213 105
486 3300005985 Ga0081539_10000220 Ga0081539_1000022057 105
487 3300005985 Ga0081539_10010808 Ga0081539_100108082 105
488 3300005985 Ga0081539_10198019 Ga0081539_101980192 105
489 3300006028 Ga0070717_10001656 Ga0070717_1000165612 105
490 3300006028 Ga0070717_10344845 Ga0070717_103448452 105
491 3300006028 Ga0070717_10382104 Ga0070717_103821042 105
492 3300006038 Ga0075365_10024652 Ga0075365_100246522 105
493 3300006038 Ga0075365_10055451 Ga0075365_100554513 105
494 3300006038 Ga0075365_10093391 Ga0075365_100933914 105
495 3300006038 Ga0075365_10229899 Ga0075365_102298993 105
496 3300006038 Ga0075365_10490264 Ga0075365_104902642 105
497 3300006038 Ga0075365_10950937 Ga0075365_109509372 105
498 3300006042 Ga0075368_10011424 Ga0075368_100114243 105
499 3300006042 Ga0075368_10107462 Ga0075368_101074622 105
500 3300006042 Ga0075368_10164131 Ga0075368_101641312 105
501 3300006042 Ga0075368_10395373 Ga0075368_103953731 105
502 3300006048 Ga0075363_100002488 Ga0075363_1000024883 105
503 3300006048 Ga0075363_100026304 Ga0075363_1000263043 105
504 3300006048 Ga0075363_100181370 Ga0075363_1001813703 105
505 3300006048 Ga0075363_100218521 Ga0075363_1002185212 105
506 3300006051 Ga0075364_10024940 Ga0075364_100249404 105
507 3300006051 Ga0075364_10080988 Ga0075364_100809883 105
508 3300006051 Ga0075364_10109723 Ga0075364_101097232 105
509 3300006051 Ga0075364_10181953 Ga0075364_101819532 105
510 3300006163 Ga0070715_10398856 Ga0070715_103988562 105
511 3300006173 Ga0070716_100047412 Ga0070716_1000474122 105
512 3300006173 Ga0070716_100334574 Ga0070716_1003345742 105
513 3300006173 Ga0070716_100405951 Ga0070716_1004059512 105
514 3300006173 Ga0070716_100736766 Ga0070716_1007367662 105
515 3300006173 Ga0070716_100743603 Ga0070716_1007436032 105
516 3300006173 Ga0070716_100807535 Ga0070716_1008075352 105
517 3300006173 Ga0070716_101681669 Ga0070716_1016816692 105
518 3300006173 Ga0070716_101726546 Ga0070716_1017265462 105
519 3300006175 Ga0070712_100022680 Ga0070712_1000226803 105
520 3300006175 Ga0070712_100207598 Ga0070712_1002075982 105
521 3300006175 Ga0070712_100228436 Ga0070712_1002284361 105
522 3300006175 Ga0070712_100581041 Ga0070712_1005810412 105
523 3300006175 Ga0070712_100946375 Ga0070712_1009463752 105
524 3300006175 Ga0070712_101179742 Ga0070712_1011797422 105
525 3300006177 Ga0075362_10052802 Ga0075362_100528023 105
526 3300006177 Ga0075362_10155294 Ga0075362_101552942 105
527 3300006178 Ga0075367_10121791 Ga0075367_101217912 105
528 3300006178 Ga0075367_10453376 Ga0075367_104533761 105
529 3300006178 Ga0075367_10508126 Ga0075367_105081262 105
530 3300006178 Ga0075367_10537583 Ga0075367_105375832 105
531 3300006178 Ga0075367_10765861 Ga0075367_107658612 105
532 3300006178 Ga0075367_11026376 Ga0075367_110263762 105
533 3300006186 Ga0075369_10032260 Ga0075369_100322603 105
534 3300006186 Ga0075369_10086614 Ga0075369_100866142 105
535 3300006186 Ga0075369_10240110 Ga0075369_102401102 105
536 3300006186 Ga0075369_10508923 Ga0075369_105089232 105
537 3300006195 Ga0075366_10033470 Ga0075366_100334703 105
538 3300006195 Ga0075366_10066567 Ga0075366_100665671 105
539 3300006195 Ga0075366_10129971 Ga0075366_101299712 105
540 3300006195 Ga0075366_10211076 Ga0075366_102110762 105
541 3300006195 Ga0075366_10332512 Ga0075366_103325122 105
542 3300006195 Ga0075366_10482800 Ga0075366_104828002 105
543 3300006237 Ga0097621_100099480 Ga0097621_1000994803 105
544 3300006237 Ga0097621_100143816 Ga0097621_1001438163 105
545 3300006353 Ga0075370_10031839 Ga0075370_100318394 105
546 3300006353 Ga0075370_10082329 Ga0075370_100823294 105
547 3300006353 Ga0075370_10149538 Ga0075370_101495383 105
548 3300006353 Ga0075370_10461448 Ga0075370_104614482 105
549 3300006353 Ga0075370_10912744 Ga0075370_109127442 105
550 3300006358 Ga0068871_100069423 Ga0068871_1000694234 105
551 3300006358 Ga0068871_100072638 Ga0068871_1000726384 105
552 3300006358 Ga0068871_100525777 Ga0068871_1005257772 105
553 3300006358 Ga0068871_100686759 Ga0068871_1006867592 105
554 3300006358 Ga0068871_101530444 Ga0068871_1015304442 105
555 3300006844 Ga0075428_100208936 Ga0075428_1002089364 105
556 3300006844 Ga0075428_100341471 Ga0075428_1003414712 105
557 3300006847 Ga0075431_100682133 Ga0075431_1006821333 105
558 3300006852 Ga0075433_11206381 Ga0075433_112063812 105
559 3300006871 Ga0075434_100006763 Ga0075434_10000676313 105
560 3300006871 Ga0075434_100559189 Ga0075434_1005591892 105
561 3300006871 Ga0075434_101393912 Ga0075434_1013939122 105
562 3300006880 Ga0075429_100227680 Ga0075429_1002276802 105
563 3300006881 Ga0068865_100124324 Ga0068865_1001243243 105
564 3300006881 Ga0068865_100190154 Ga0068865_1001901544 105
565 3300006881 Ga0068865_100541348 Ga0068865_1005413481 105
566 3300006881 Ga0068865_100603271 Ga0068865_1006032712 105
567 3300006914 Ga0075436_100247577 Ga0075436_1002475773 105
568 3300006914 Ga0075436_100614745 Ga0075436_1006147452 105
569 3300006931 Ga0097620_100103547 Ga0097620_1001035475 105
570 3300006931 Ga0097620_100181187 Ga0097620_1001811873 105
571 3300006931 Ga0097620_100357379 Ga0097620_1003573792 105
572 3300006931 Ga0097620_102157218 Ga0097620_1021572182 105
573 3300006942 Ga0099824_1011502 Ga0099824_10115028 105
574 3300006944 Ga0099823_1053057 Ga0099823_10530572 105
575 3300006944 Ga0099823_1142403 Ga0099823_11424032 105
576 3300007076 Ga0075435_100034806 Ga0075435_1000348064 105
577 3300007076 Ga0075435_100129312 Ga0075435_1001293122 105
578 3300007265 Ga0099794_10106117 Ga0099794_101061173 105
579 3300007788 Ga0099795_10096020 Ga0099795_100960202 105
580 3300007788 Ga0099795_10177988 Ga0099795_101779882 105
581 3300007788 Ga0099795_10490110 Ga0099795_104901102 105
582 3300009011 Ga0105251_10067654 Ga0105251_100676542 105
583 3300009092 Ga0105250_10156739 Ga0105250_101567392 105
584 3300009092 Ga0105250_10339527 Ga0105250_103395272 105
585 3300009093 Ga0105240_10024721 Ga0105240_100247213 105
586 3300009093 Ga0105240_10084695 Ga0105240_100846954 105
587 3300009093 Ga0105240_10171825 Ga0105240_101718252 105
588 3300009093 Ga0105240_10379621 Ga0105240_103796212 105
589 3300009093 Ga0105240_11049920 Ga0105240_110499202 105
590 3300009094 Ga0111539_10010769 Ga0111539_100107697 105
591 3300009094 Ga0111539_11209150 Ga0111539_112091502 105
592 3300009098 Ga0105245_10137591 Ga0105245_101375913 105
593 3300009098 Ga0105245_10154818 Ga0105245_101548182 105
594 3300009098 Ga0105245_10260588 Ga0105245_102605882 105
595 3300009098 Ga0105245_10461621 Ga0105245_104616212 105
596 3300009098 Ga0105245_10665505 Ga0105245_106655052 105
597 3300009098 Ga0105245_10669428 Ga0105245_106694282 105
598 3300009098 Ga0105245_11828939 Ga0105245_118289392 105
599 3300009101 Ga0105247_10034754 Ga0105247_100347543 105
600 3300009101 Ga0105247_10045941 Ga0105247_100459412 105
601 3300009101 Ga0105247_10100789 Ga0105247_101007893 105
602 3300009101 Ga0105247_10136111 Ga0105247_101361112 105
603 3300009101 Ga0105247_10225649 Ga0105247_102256492 105
604 3300009101 Ga0105247_10259138 Ga0105247_102591382 105
605 3300009101 Ga0105247_10810728 Ga0105247_108107281 105
606 3300009147 Ga0114129_10368158 Ga0114129_103681583 105
607 3300009148 Ga0105243_10205446 Ga0105243_102054462 105
608 3300009148 Ga0105243_10387430 Ga0105243_103874302 105
609 3300009148 Ga0105243_10587780 Ga0105243_105877802 105
610 3300009148 Ga0105243_11106187 Ga0105243_111061871 105
611 3300009148 Ga0105243_11544772 Ga0105243_115447722 105
612 3300009174 Ga0105241_10029756 Ga0105241_100297562 105
613 3300009174 Ga0105241_10050318 Ga0105241_100503183 105
614 3300009174 Ga0105241_10073114 Ga0105241_100731142 105
615 3300009174 Ga0105241_10100450 Ga0105241_101004502 105
616 3300009174 Ga0105241_10232984 Ga0105241_102329842 105
617 3300009174 Ga0105241_10435013 Ga0105241_104350132 105
618 3300009174 Ga0105241_11213549 Ga0105241_112135492 105
619 3300009174 Ga0105241_11479025 Ga0105241_114790252 105
620 3300009174 Ga0105241_11859194 Ga0105241_118591942 105
621 3300009176 Ga0105242_10165539 Ga0105242_101655392 105
622 3300009176 Ga0105242_10457511 Ga0105242_104575112 105
623 3300009176 Ga0105242_10467047 Ga0105242_104670473 105
624 3300009177 Ga0105248_10167112 Ga0105248_101671122 105
625 3300009177 Ga0105248_10194824 Ga0105248_101948242 105
626 3300009177 Ga0105248_10260394 Ga0105248_102603943 105
627 3300009177 Ga0105248_10265805 Ga0105248_102658052 105
628 3300009177 Ga0105248_10633494 Ga0105248_106334942 105
629 3300009177 Ga0105248_11249221 Ga0105248_112492212 105
630 3300009177 Ga0105248_12510190 Ga0105248_125101902 105
631 3300009545 Ga0105237_10009950 Ga0105237_100099509 105
632 3300009545 Ga0105237_10047158 Ga0105237_100471585 105
633 3300009545 Ga0105237_10113776 Ga0105237_101137763 105
634 3300009545 Ga0105237_10159241 Ga0105237_101592412 105
635 3300009545 Ga0105237_10503464 Ga0105237_105034642 105
636 3300009545 Ga0105237_10536312 Ga0105237_105363122 105
637 3300009545 Ga0105237_10578153 Ga0105237_105781532 105
638 3300009545 Ga0105237_10679083 Ga0105237_106790832 105
639 3300009545 Ga0105237_10750872 Ga0105237_107508722 105
640 3300009545 Ga0105237_10822256 Ga0105237_108222562 105
641 3300009551 Ga0105238_10135316 Ga0105238_101353164 105
642 3300009551 Ga0105238_10151847 Ga0105238_101518473 105
643 3300009551 Ga0105238_10331334 Ga0105238_103313342 105
644 3300009551 Ga0105238_10473029 Ga0105238_104730292 105
645 3300009551 Ga0105238_11083676 Ga0105238_110836762 105
646 3300009551 Ga0105238_11716973 Ga0105238_117169732 105
647 3300009551 Ga0105238_11778765 Ga0105238_117787651 105
648 3300009551 Ga0105238_12219693 Ga0105238_122196932 105
649 3300009553 Ga0105249_10263615 Ga0105249_102636152 105
650 3300009553 Ga0105249_10551819 Ga0105249_105518192 105
651 3300009553 Ga0105249_10575784 Ga0105249_105757842 105
652 3300009553 Ga0105249_11036827 Ga0105249_110368272 105
653 3300009553 Ga0105249_11198226 Ga0105249_111982262 105
654 3300009553 Ga0105249_11767243 Ga0105249_117672432 105
655 3300009553 Ga0105249_12489584 Ga0105249_124895842 105
656 3300010159 Ga0099796_10100427 Ga0099796_101004272 105
657 3300010375 Ga0105239_10066752 Ga0105239_100667525 105
658 3300010375 Ga0105239_10084742 Ga0105239_100847425 105
659 3300010375 Ga0105239_10127564 Ga0105239_101275642 105
660 3300010375 Ga0105239_10139452 Ga0105239_101394524 105
661 3300010375 Ga0105239_10159171 Ga0105239_101591715 105
662 3300010375 Ga0105239_10218055 Ga0105239_102180551 105
663 3300010375 Ga0105239_10235661 Ga0105239_102356612 105
664 3300010375 Ga0105239_10292556 Ga0105239_102925564 105
665 3300010375 Ga0105239_10387551 Ga0105239_103875511 105
666 3300010375 Ga0105239_10578048 Ga0105239_105780482 105
667 3300010375 Ga0105239_10685943 Ga0105239_106859432 105
668 3300010375 Ga0105239_10693422 Ga0105239_106934222 105
669 3300010375 Ga0105239_10920011 Ga0105239_109200112 105
670 3300010375 Ga0105239_10964339 Ga0105239_109643392 105
671 3300010375 Ga0105239_11988113 Ga0105239_119881132 105
672 3300010375 Ga0105239_12374053 Ga0105239_123740531 105
673 3300011119 Ga0105246_10013775 Ga0105246_100137755 105
674 3300011119 Ga0105246_10045998 Ga0105246_100459984 105
675 3300011119 Ga0105246_10104444 Ga0105246_101044443 105
676 3300011119 Ga0105246_10266822 Ga0105246_102668223 105
677 3300011119 Ga0105246_10268572 Ga0105246_102685723 105
678 3300011119 Ga0105246_11041962 Ga0105246_110419621 105
679 3300012513 Ga0157326_1040953 Ga0157326_10409531 105
680 3300013104 Ga0157370_10057618 Ga0157370_100576184 105
681 3300013104 Ga0157370_10178217 Ga0157370_101782173 105
682 3300013104 Ga0157370_10917221 Ga0157370_109172212 105
683 3300013105 Ga0157369_10012423 Ga0157369_100124234 105
684 3300013105 Ga0157369_11869759 Ga0157369_118697591 105
685 3300013105 Ga0157369_11939108 Ga0157369_119391081 105
686 3300013296 Ga0157374_10024785 Ga0157374_100247855 105
687 3300013296 Ga0157374_10040321 Ga0157374_100403214 105
688 3300013296 Ga0157374_12210038 Ga0157374_122100382 105
689 3300013296 Ga0157374_12505836 Ga0157374_125058362 105
690 3300013297 Ga0157378_10004961 Ga0157378_100049614 105
691 3300013297 Ga0157378_10133315 Ga0157378_101333154 105
692 3300013297 Ga0157378_10278553 Ga0157378_102785532 105
693 3300013297 Ga0157378_10662215 Ga0157378_106622152 105
694 3300013306 Ga0163162_10060239 Ga0163162_100602392 105
695 3300013306 Ga0163162_10062895 Ga0163162_100628954 105
696 3300013306 Ga0163162_10163138 Ga0163162_101631382 105
697 3300013306 Ga0163162_10184729 Ga0163162_101847294 105
698 3300013306 Ga0163162_10847605 Ga0163162_108476052 105
699 3300013306 Ga0163162_11199143 Ga0163162_111991432 105
700 3300013306 Ga0163162_12465624 Ga0163162_124656242 105
701 3300013306 Ga0163162_12912457 Ga0163162_129124571 105
702 3300013307 Ga0157372_10577521 Ga0157372_105775212 105
703 3300013308 Ga0157375_10063269 Ga0157375_100632694 105
704 3300013308 Ga0157375_10105710 Ga0157375_101057103 105
705 3300013308 Ga0157375_10644025 Ga0157375_106440252 105
706 3300014325 Ga0163163_10060452 Ga0163163_100604523 105
707 3300014325 Ga0163163_10060614 Ga0163163_100606144 105
708 3300014325 Ga0163163_10124811 Ga0163163_101248113 105
709 3300014325 Ga0163163_10177238 Ga0163163_101772382 105
710 3300014325 Ga0163163_10352566 Ga0163163_103525663 105
711 3300014325 Ga0163163_10512413 Ga0163163_105124132 105
712 3300014325 Ga0163163_11668809 Ga0163163_116688092 105
713 3300014325 Ga0163163_12797247 Ga0163163_127972472 105
714 3300014326 Ga0157380_10052368 Ga0157380_100523684 105
715 3300014326 Ga0157380_10245136 Ga0157380_102451363 105
716 3300014326 Ga0157380_10271597 Ga0157380_102715972 105
717 3300014326 Ga0157380_10592277 Ga0157380_105922772 105
718 3300014326 Ga0157380_11825509 Ga0157380_118255092 105
719 3300014326 Ga0157380_13065113 Ga0157380_130651132 105
720 3300014497 Ga0182008_10281973 Ga0182008_102819732 105
721 3300014968 Ga0157379_10092888 Ga0157379_100928882 105
722 3300014968 Ga0157379_10286016 Ga0157379_102860162 105
723 3300014968 Ga0157379_10860877 Ga0157379_108608772 105
724 3300014968 Ga0157379_11332319 Ga0157379_113323192 105
725 3300014968 Ga0157379_11430515 Ga0157379_114305152 105
726 3300014969 Ga0157376_10053421 Ga0157376_100534213 105
727 3300014969 Ga0157376_10160876 Ga0157376_101608763 105
728 3300015261 Ga0182006_1166909 Ga0182006_11669092 105
729 3300015262 Ga0182007_10339427 Ga0182007_103394272 105
730 3300017792 Ga0163161_10049743 Ga0163161_100497434 105
731 3300017792 Ga0163161_10217819 Ga0163161_102178192 105
732 3300017792 Ga0163161_10546613 Ga0163161_105466131 105
733 3300017792 Ga0163161_10651123 Ga0163161_106511232 105
734 3300017792 Ga0163161_10986892 Ga0163161_109868922 105
735 3300017792 Ga0163161_11152346 Ga0163161_111523462 105
736 3300021320 Ga0214544_1000001 Ga0214544_1000001545 105
737 3300021320 Ga0214544_1048277 Ga0214544_10482772 105
738 3300021321 Ga0214542_1001925 Ga0214542_100192532 105
739 3300021321 Ga0214542_1052937 Ga0214542_10529372 105
740 3300021324 Ga0214545_1000003 Ga0214545_1000003217 105
741 3300021324 Ga0214545_1028006 Ga0214545_10280062 105
742 3300021327 Ga0214543_1000002 Ga0214543_1000002549 105
743 3300021327 Ga0214543_1053896 Ga0214543_10538962 105
744 3300021388 Ga0213875_10000033 Ga0213875_1000003342 105
745 3300025230 Ga0209563_100325 Ga0209563_1003255 105
746 3300025250 Ga0209026_1057755 Ga0209026_10577552 105
747 3300025250 Ga0209026_1062214 Ga0209026_10622141 105
748 3300025253 Ga0209677_102346 Ga0209677_1023465 105
749 3300025254 Ga0209148_1000812 Ga0209148_100081216 105
750 3300025261 Ga0209233_1002884 Ga0209233_10028846 105
751 3300025261 Ga0209233_1003610 Ga0209233_10036102 105
752 3300025261 Ga0209233_1017593 Ga0209233_10175932 105
753 3300025261 Ga0209233_1057131 Ga0209233_10571312 105
754 3300025272 Ga0209455_1010982 Ga0209455_10109822 105
755 3300025295 Ga0209564_1005325 Ga0209564_10053257 105
756 3300025295 Ga0209564_1016531 Ga0209564_10165312 105
757 3300025297 Ga0209758_1000011 Ga0209758_1000011538 105
758 3300025297 Ga0209758_1000120 Ga0209758_100012037 105
759 3300025297 Ga0209758_1000435 Ga0209758_100043558 105
760 3300025297 Ga0209758_1001848 Ga0209758_100184815 105
761 3300025297 Ga0209758_1002526 Ga0209758_100252613 105
762 3300025297 Ga0209758_1002848 Ga0209758_100284811 105
763 3300025297 Ga0209758_1008838 Ga0209758_10088384 105
764 3300025297 Ga0209758_1018387 Ga0209758_10183875 105
765 3300025297 Ga0209758_1060706 Ga0209758_10607062 105
766 3300025297 Ga0209758_1068657 Ga0209758_10686572 105
767 3300025297 Ga0209758_1069994 Ga0209758_10699942 105
768 3300025297 Ga0209758_1075221 Ga0209758_10752213 105
769 3300025297 Ga0209758_1091302 Ga0209758_10913021 105
770 3300025297 Ga0209758_1119965 Ga0209758_11199652 105
771 3300025299 Ga0209256_1010441 Ga0209256_10104414 105
772 3300025299 Ga0209256_1040226 Ga0209256_10402262 105
773 3300025299 Ga0209256_1083055 Ga0209256_10830552 105
774 3300025302 Ga0207426_1000458 Ga0207426_100045814 105
775 3300025302 Ga0207426_1006703 Ga0207426_10067034 105
776 3300025302 Ga0207426_1014805 Ga0207426_10148052 105
777 3300025302 Ga0207426_1066486 Ga0207426_10664863 105
778 3300025302 Ga0207426_1093383 Ga0207426_10933832 105
779 3300025304 Ga0209257_1001101 Ga0209257_10011018 105
780 3300025304 Ga0209257_1030664 Ga0209257_10306644 105
781 3300025304 Ga0209257_1063837 Ga0209257_10638372 105
782 3300025315 Ga0207697_10144965 Ga0207697_101449653 105
783 3300025321 Ga0207656_10107837 Ga0207656_101078372 105
784 3300025321 Ga0207656_10277907 Ga0207656_102779072 105
785 3300025711 Ga0207696_1082712 Ga0207696_10827122 105
786 3300025735 Ga0207713_1090303 Ga0207713_10903032 105
787 3300025893 Ga0207682_10121272 Ga0207682_101212721 105
788 3300025898 Ga0207692_10000797 Ga0207692_100007973 105
789 3300025898 Ga0207692_10040116 Ga0207692_100401164 105
790 3300025899 Ga0207642_10636227 Ga0207642_106362272 105
791 3300025900 Ga0207710_10115478 Ga0207710_101154781 105
792 3300025900 Ga0207710_10150701 Ga0207710_101507012 105
793 3300025900 Ga0207710_10161530 Ga0207710_101615302 105
794 3300025901 Ga0207688_10059834 Ga0207688_100598344 105
795 3300025901 Ga0207688_10062400 Ga0207688_100624002 105
796 3300025901 Ga0207688_10266632 Ga0207688_102666322 105
797 3300025901 Ga0207688_10465579 Ga0207688_104655792 105
798 3300025903 Ga0207680_10737398 Ga0207680_107373982 105
799 3300025904 Ga0207647_10008820 Ga0207647_100088205 105
800 3300025904 Ga0207647_10077783 Ga0207647_100777834 105
801 3300025905 Ga0207685_10690692 Ga0207685_106906922 105
802 3300025906 Ga0207699_10001610 Ga0207699_100016104 105
803 3300025906 Ga0207699_10085855 Ga0207699_100858552 105
804 3300025906 Ga0207699_10530763 Ga0207699_105307632 105
805 3300025906 Ga0207699_11168749 Ga0207699_111687491 105
806 3300025907 Ga0207645_10132858 Ga0207645_101328583 105
807 3300025907 Ga0207645_10770504 Ga0207645_107705042 105
808 3300025908 Ga0207643_10104196 Ga0207643_101041961 105
809 3300025908 Ga0207643_10471403 Ga0207643_104714032 105
810 3300025908 Ga0207643_10487165 Ga0207643_104871651 105
811 3300025909 Ga0207705_10195132 Ga0207705_101951322 105
812 3300025909 Ga0207705_11014313 Ga0207705_110143132 105
813 3300025909 Ga0207705_11068360 Ga0207705_110683602 105
814 3300025909 Ga0207705_11120616 Ga0207705_111206162 105
815 3300025910 Ga0207684_10372915 Ga0207684_103729152 105
816 3300025911 Ga0207654_10020891 Ga0207654_100208912 105
817 3300025911 Ga0207654_10029833 Ga0207654_100298334 105
818 3300025911 Ga0207654_10119575 Ga0207654_101195754 105
819 3300025911 Ga0207654_10397877 Ga0207654_103978773 105
820 3300025911 Ga0207654_10444023 Ga0207654_104440232 105
821 3300025911 Ga0207654_10499062 Ga0207654_104990622 105
822 3300025912 Ga0207707_10000886 Ga0207707_1000088622 105
823 3300025912 Ga0207707_10031075 Ga0207707_100310753 105
824 3300025912 Ga0207707_10518469 Ga0207707_105184692 105
825 3300025912 Ga0207707_10563285 Ga0207707_105632852 105
826 3300025912 Ga0207707_10783900 Ga0207707_107839002 105
827 3300025912 Ga0207707_11528242 Ga0207707_115282422 105
828 3300025913 Ga0207695_10000163 Ga0207695_100001639 105
829 3300025913 Ga0207695_10306738 Ga0207695_103067382 105
830 3300025913 Ga0207695_10415311 Ga0207695_104153112 105
831 3300025913 Ga0207695_10458658 Ga0207695_104586582 105
832 3300025914 Ga0207671_10056823 Ga0207671_100568234 105
833 3300025914 Ga0207671_10058973 Ga0207671_100589734 105
834 3300025914 Ga0207671_10110956 Ga0207671_101109564 105
835 3300025914 Ga0207671_10347827 Ga0207671_103478272 105
836 3300025914 Ga0207671_10378502 Ga0207671_103785023 105
837 3300025914 Ga0207671_10694687 Ga0207671_106946872 105
838 3300025914 Ga0207671_10799111 Ga0207671_107991112 105
839 3300025914 Ga0207671_10860590 Ga0207671_108605902 105
840 3300025914 Ga0207671_11074707 Ga0207671_110747072 105
841 3300025914 Ga0207671_11269545 Ga0207671_112695452 105
842 3300025915 Ga0207693_10034047 Ga0207693_100340473 105
843 3300025915 Ga0207693_10203094 Ga0207693_102030942 105
844 3300025915 Ga0207693_10370390 Ga0207693_103703902 105
845 3300025915 Ga0207693_10501300 Ga0207693_105013002 105
846 3300025915 Ga0207693_10810939 Ga0207693_108109392 105
847 3300025916 Ga0207663_10121345 Ga0207663_101213452 105
848 3300025916 Ga0207663_10627550 Ga0207663_106275502 105
849 3300025916 Ga0207663_11276049 Ga0207663_112760492 105
850 3300025917 Ga0207660_10010388 Ga0207660_100103887 105
851 3300025917 Ga0207660_10022287 Ga0207660_100222875 105
852 3300025917 Ga0207660_10027535 Ga0207660_100275355 105
853 3300025917 Ga0207660_10256833 Ga0207660_102568334 105
854 3300025917 Ga0207660_10510935 Ga0207660_105109352 105
855 3300025917 Ga0207660_10516702 Ga0207660_105167022 105
856 3300025918 Ga0207662_10177795 Ga0207662_101777953 105
857 3300025919 Ga0207657_10008437 Ga0207657_1000843712 105
858 3300025919 Ga0207657_10319838 Ga0207657_103198381 105
859 3300025919 Ga0207657_11262655 Ga0207657_112626552 105
860 3300025920 Ga0207649_10163987 Ga0207649_101639871 105
861 3300025920 Ga0207649_11209315 Ga0207649_112093152 105
862 3300025920 Ga0207649_11283566 Ga0207649_112835662 105
863 3300025920 Ga0207649_11663260 Ga0207649_116632602 105
864 3300025921 Ga0207652_10105158 Ga0207652_101051584 105
865 3300025921 Ga0207652_10118636 Ga0207652_101186361 105
866 3300025921 Ga0207652_10446869 Ga0207652_104468692 105
867 3300025921 Ga0207652_10948233 Ga0207652_109482331 105
868 3300025922 Ga0207646_10656333 Ga0207646_106563332 105
869 3300025922 Ga0207646_11585676 Ga0207646_115856762 105
870 3300025923 Ga0207681_10036681 Ga0207681_100366813 105
871 3300025923 Ga0207681_10208829 Ga0207681_102088293 105
872 3300025923 Ga0207681_10293023 Ga0207681_102930233 105
873 3300025923 Ga0207681_10818262 Ga0207681_108182622 105
874 3300025924 Ga0207694_10143224 Ga0207694_101432241 105
875 3300025924 Ga0207694_10203424 Ga0207694_102034242 105
876 3300025924 Ga0207694_10208299 Ga0207694_102082992 105
877 3300025924 Ga0207694_10230767 Ga0207694_102307672 105
878 3300025924 Ga0207694_10282251 Ga0207694_102822513 105
879 3300025924 Ga0207694_10471864 Ga0207694_104718642 105
880 3300025924 Ga0207694_10825971 Ga0207694_108259712 105
881 3300025924 Ga0207694_10859654 Ga0207694_108596541 105
882 3300025924 Ga0207694_11089264 Ga0207694_110892641 105
883 3300025924 Ga0207694_11132784 Ga0207694_111327842 105
884 3300025924 Ga0207694_11483488 Ga0207694_114834882 105
885 3300025924 Ga0207694_11520128 Ga0207694_115201281 105
886 3300025924 Ga0207694_11741407 Ga0207694_117414071 105
887 3300025925 Ga0207650_10527525 Ga0207650_105275252 105
888 3300025925 Ga0207650_10840672 Ga0207650_108406722 105
889 3300025926 Ga0207659_11071392 Ga0207659_110713922 105
890 3300025927 Ga0207687_10218131 Ga0207687_102181311 105
891 3300025927 Ga0207687_10280699 Ga0207687_102806992 105
892 3300025927 Ga0207687_10327438 Ga0207687_103274383 105
893 3300025927 Ga0207687_10842430 Ga0207687_108424302 105
894 3300025928 Ga0207700_10007466 Ga0207700_100074662 105
895 3300025928 Ga0207700_10052174 Ga0207700_100521744 105
896 3300025928 Ga0207700_10612413 Ga0207700_106124132 105
897 3300025928 Ga0207700_10756811 Ga0207700_107568111 105
898 3300025928 Ga0207700_10761249 Ga0207700_107612492 105
899 3300025929 Ga0207664_10007788 Ga0207664_100077884 105
900 3300025929 Ga0207664_10267241 Ga0207664_102672413 105
901 3300025929 Ga0207664_10628867 Ga0207664_106288672 105
902 3300025929 Ga0207664_12004164 Ga0207664_120041641 105
903 3300025931 Ga0207644_10188346 Ga0207644_101883464 105
904 3300025931 Ga0207644_10396610 Ga0207644_103966102 105
905 3300025931 Ga0207644_10573103 Ga0207644_105731032 105
906 3300025931 Ga0207644_11573672 Ga0207644_115736722 105
907 3300025932 Ga0207690_10014466 Ga0207690_100144666 105
908 3300025932 Ga0207690_10100093 Ga0207690_101000932 105
909 3300025932 Ga0207690_11290918 Ga0207690_112909182 105
910 3300025933 Ga0207706_10059649 Ga0207706_100596494 105
911 3300025933 Ga0207706_10321227 Ga0207706_103212272 105
912 3300025933 Ga0207706_11078484 Ga0207706_110784841 105
913 3300025933 Ga0207706_11296498 Ga0207706_112964982 105
914 3300025934 Ga0207686_10089706 Ga0207686_100897063 105
915 3300025934 Ga0207686_10103845 Ga0207686_101038454 105
916 3300025934 Ga0207686_10340382 Ga0207686_103403822 105
917 3300025934 Ga0207686_10390090 Ga0207686_103900903 105
918 3300025935 Ga0207709_10040013 Ga0207709_100400134 105
919 3300025935 Ga0207709_10446371 Ga0207709_104463712 105
920 3300025935 Ga0207709_11200635 Ga0207709_112006352 105
921 3300025935 Ga0207709_11255427 Ga0207709_112554272 105
922 3300025936 Ga0207670_10372014 Ga0207670_103720142 105
923 3300025936 Ga0207670_10470731 Ga0207670_104707312 105
924 3300025937 Ga0207669_10005298 Ga0207669_100052984 105
925 3300025937 Ga0207669_10157627 Ga0207669_101576271 105
926 3300025938 Ga0207704_10175381 Ga0207704_101753812 105
927 3300025938 Ga0207704_10222242 Ga0207704_102222422 105
928 3300025938 Ga0207704_10267067 Ga0207704_102670672 105
929 3300025938 Ga0207704_10343707 Ga0207704_103437072 105
930 3300025938 Ga0207704_10543832 Ga0207704_105438322 105
931 3300025938 Ga0207704_11010744 Ga0207704_110107442 105
932 3300025938 Ga0207704_11704287 Ga0207704_117042872 105
933 3300025939 Ga0207665_10065508 Ga0207665_100655083 105
934 3300025939 Ga0207665_10116671 Ga0207665_101166712 105
935 3300025939 Ga0207665_10210186 Ga0207665_102101863 105
936 3300025939 Ga0207665_10335289 Ga0207665_103352892 105
937 3300025939 Ga0207665_10733330 Ga0207665_107333302 105
938 3300025939 Ga0207665_10767086 Ga0207665_107670862 105
939 3300025940 Ga0207691_10025303 Ga0207691_100253035 105
940 3300025940 Ga0207691_10148496 Ga0207691_101484962 105
941 3300025940 Ga0207691_10546478 Ga0207691_105464782 105
942 3300025940 Ga0207691_10585505 Ga0207691_105855052 105
943 3300025941 Ga0207711_10420248 Ga0207711_104202482 105
944 3300025941 Ga0207711_10496565 Ga0207711_104965652 105
945 3300025941 Ga0207711_10864244 Ga0207711_108642441 105
946 3300025941 Ga0207711_11043965 Ga0207711_110439652 105
947 3300025942 Ga0207689_10019353 Ga0207689_100193536 105
948 3300025942 Ga0207689_10036827 Ga0207689_100368273 105
949 3300025942 Ga0207689_10117631 Ga0207689_101176314 105
950 3300025942 Ga0207689_10861500 Ga0207689_108615002 105
951 3300025942 Ga0207689_10896718 Ga0207689_108967182 105
952 3300025944 Ga0207661_10018951 Ga0207661_100189512 105
953 3300025944 Ga0207661_10040025 Ga0207661_100400255 105
954 3300025944 Ga0207661_10254792 Ga0207661_102547922 105
955 3300025944 Ga0207661_10779078 Ga0207661_107790782 105
956 3300025945 Ga0207679_10336118 Ga0207679_103361182 105
957 3300025945 Ga0207679_11479639 Ga0207679_114796391 105
958 3300025949 Ga0207667_10019974 Ga0207667_100199747 105
959 3300025949 Ga0207667_10113813 Ga0207667_101138134 105
960 3300025949 Ga0207667_10172122 Ga0207667_101721222 105
961 3300025949 Ga0207667_10189492 Ga0207667_101894924 105
962 3300025949 Ga0207667_10356397 Ga0207667_103563973 105
963 3300025949 Ga0207667_10474438 Ga0207667_104744381 105
964 3300025960 Ga0207651_10810511 Ga0207651_108105111 105
965 3300025960 Ga0207651_11457764 Ga0207651_114577641 105
966 3300025960 Ga0207651_11547555 Ga0207651_115475552 105
967 3300025961 Ga0207712_10082756 Ga0207712_100827564 105
968 3300025961 Ga0207712_10337782 Ga0207712_103377822 105
969 3300025961 Ga0207712_10675449 Ga0207712_106754492 105
970 3300025961 Ga0207712_10829072 Ga0207712_108290721 105
971 3300025961 Ga0207712_11063109 Ga0207712_110631092 105
972 3300025972 Ga0207668_10030855 Ga0207668_100308553 105
973 3300025972 Ga0207668_10064631 Ga0207668_100646313 105
974 3300025972 Ga0207668_10069258 Ga0207668_100692582 105
975 3300025972 Ga0207668_10108642 Ga0207668_101086424 105
976 3300025972 Ga0207668_10119579 Ga0207668_101195794 105
977 3300025972 Ga0207668_10151383 Ga0207668_101513832 105
978 3300025972 Ga0207668_10318838 Ga0207668_103188382 105
979 3300025972 Ga0207668_10826765 Ga0207668_108267652 105
980 3300025981 Ga0207640_10103726 Ga0207640_101037263 105
981 3300025981 Ga0207640_10187043 Ga0207640_101870432 105
982 3300025981 Ga0207640_10371814 Ga0207640_103718142 105
983 3300025981 Ga0207640_10569523 Ga0207640_105695231 105
984 3300025981 Ga0207640_10769184 Ga0207640_107691842 105
985 3300025981 Ga0207640_11678143 Ga0207640_116781432 105
986 3300025986 Ga0207658_10059201 Ga0207658_100592014 105
987 3300025986 Ga0207658_10109147 Ga0207658_101091473 105
988 3300025986 Ga0207658_10609077 Ga0207658_106090772 105
989 3300025986 Ga0207658_10935166 Ga0207658_109351662 105
990 3300025986 Ga0207658_11089706 Ga0207658_110897062 105
991 3300026023 Ga0207677_10073769 Ga0207677_100737693 105
992 3300026023 Ga0207677_10348208 Ga0207677_103482082 105
993 3300026023 Ga0207677_11013682 Ga0207677_110136822 105
994 3300026023 Ga0207677_11763024 Ga0207677_117630241 105
995 3300026035 Ga0207703_10127440 Ga0207703_101274403 105
996 3300026035 Ga0207703_10129128 Ga0207703_101291283 105
997 3300026035 Ga0207703_10406199 Ga0207703_104061992 105
998 3300026035 Ga0207703_10725421 Ga0207703_107254211 105
999 3300026041 Ga0207639_10034032 Ga0207639_100340322 105
1000 3300026041 Ga0207639_10151261 Ga0207639_101512612 105
1001 3300026041 Ga0207639_10519278 Ga0207639_105192782 105
1002 3300026041 Ga0207639_10768729 Ga0207639_107687292 105
1003 3300026041 Ga0207639_10782080 Ga0207639_107820801 105
1004 3300026041 Ga0207639_10786226 Ga0207639_107862262 105
1005 3300026041 Ga0207639_10929280 Ga0207639_109292801 105
1006 3300026041 Ga0207639_11324289 Ga0207639_113242891 105
1007 3300026041 Ga0207639_11389984 Ga0207639_113899841 105
1008 3300026067 Ga0207678_10017857 Ga0207678_100178575 105
1009 3300026067 Ga0207678_10022393 Ga0207678_100223935 105
1010 3300026067 Ga0207678_10026311 Ga0207678_100263114 105
1011 3300026067 Ga0207678_10033211 Ga0207678_100332114 105
1012 3300026067 Ga0207678_10034200 Ga0207678_100342005 105
1013 3300026067 Ga0207678_10035164 Ga0207678_100351642 105
1014 3300026067 Ga0207678_10050960 Ga0207678_100509604 105
1015 3300026067 Ga0207678_10647530 Ga0207678_106475302 105
1016 3300026067 Ga0207678_11035574 Ga0207678_110355741 105
1017 3300026075 Ga0207708_10062133 Ga0207708_100621334 105
1018 3300026078 Ga0207702_10087083 Ga0207702_100870833 105
1019 3300026078 Ga0207702_11011113 Ga0207702_110111132 105
1020 3300026078 Ga0207702_11183444 Ga0207702_111834442 105
1021 3300026078 Ga0207702_11638785 Ga0207702_116387852 105
1022 3300026088 Ga0207641_10203963 Ga0207641_102039631 105
1023 3300026088 Ga0207641_10575879 Ga0207641_105758792 105
1024 3300026088 Ga0207641_10622795 Ga0207641_106227952 105
1025 3300026088 Ga0207641_10646257 Ga0207641_106462572 105
1026 3300026088 Ga0207641_11294181 Ga0207641_112941812 105
1027 3300026089 Ga0207648_10032340 Ga0207648_100323403 105
1028 3300026089 Ga0207648_10372821 Ga0207648_103728211 105
1029 3300026089 Ga0207648_11121351 Ga0207648_111213512 105
1030 3300026095 Ga0207676_10068020 Ga0207676_100680203 105
1031 3300026095 Ga0207676_10125942 Ga0207676_101259424 105
1032 3300026095 Ga0207676_10177406 Ga0207676_101774063 105
1033 3300026095 Ga0207676_10209105 Ga0207676_102091054 105
1034 3300026095 Ga0207676_10440842 Ga0207676_104408422 105
1035 3300026095 Ga0207676_12061563 Ga0207676_120615632 105
1036 3300026095 Ga0207676_12587968 Ga0207676_125879682 105
1037 3300026116 Ga0207674_10007720 Ga0207674_100077205 105
1038 3300026116 Ga0207674_10078663 Ga0207674_100786632 105
1039 3300026116 Ga0207674_10167564 Ga0207674_101675643 105
1040 3300026116 Ga0207674_10200587 Ga0207674_102005873 105
1041 3300026118 Ga0207675_100048212 Ga0207675_1000482126 105
1042 3300026118 Ga0207675_100058719 Ga0207675_1000587194 105
1043 3300026118 Ga0207675_100293273 Ga0207675_1002932732 105
1044 3300026118 Ga0207675_100763214 Ga0207675_1007632142 105
1045 3300026118 Ga0207675_101916778 Ga0207675_1019167781 105
1046 3300026118 Ga0207675_102016267 Ga0207675_1020162671 105
1047 3300026118 Ga0207675_102215922 Ga0207675_1022159222 105
1048 3300026118 Ga0207675_102742402 Ga0207675_1027424022 105
1049 3300026121 Ga0207683_10003797 Ga0207683_100037976 105
1050 3300026121 Ga0207683_10068301 Ga0207683_100683017 105
1051 3300026121 Ga0207683_10091282 Ga0207683_100912825 105
1052 3300026121 Ga0207683_10469443 Ga0207683_104694433 105
1053 3300026121 Ga0207683_10508077 Ga0207683_105080772 105
1054 3300026121 Ga0207683_10594051 Ga0207683_105940512 105
1055 3300026121 Ga0207683_11198547 Ga0207683_111985472 105
1056 3300026121 Ga0207683_11373039 Ga0207683_113730392 105
1057 3300026142 Ga0207698_10025911 Ga0207698_100259111 105
1058 3300026142 Ga0207698_10132646 Ga0207698_101326463 105
1059 3300026142 Ga0207698_10138196 Ga0207698_101381963 105
1060 3300026142 Ga0207698_10365103 Ga0207698_103651032 105
1061 3300026142 Ga0207698_10390739 Ga0207698_103907393 105
1062 3300026142 Ga0207698_10432956 Ga0207698_104329563 105
1063 3300026142 Ga0207698_10726837 Ga0207698_107268371 105
1064 3300026142 Ga0207698_11388057 Ga0207698_113880572 105
1065 3300027296 Ga0209389_1000043 Ga0209389_100004319 105
1066 3300027296 Ga0209389_1000077 Ga0209389_100007785 105
1067 3300027357 Ga0209589_1000047 Ga0209589_100004792 105
1068 3300027361 Ga0209489_100075 Ga0209489_100075124 105
1069 3300027361 Ga0209489_100251 Ga0209489_10025185 105
1070 3300027363 Ga0209700_100271 Ga0209700_10027185 105
1071 3300027866 Ga0209813_10013523 Ga0209813_100135232 105
1072 3300027866 Ga0209813_10046981 Ga0209813_100469812 105
1073 3300027866 Ga0209813_10270504 Ga0209813_102705042 105
1074 3300027866 Ga0209813_10357414 Ga0209813_103574142 105
1075 3300027907 Ga0207428_10255880 Ga0207428_102558802 105
1076 3300028379 Ga0268266_10007625 Ga0268266_100076254 105
1077 3300028379 Ga0268266_10020198 Ga0268266_100201985 105
1078 3300028379 Ga0268266_10022295 Ga0268266_100222953 105
1079 3300028379 Ga0268266_10043720 Ga0268266_100437202 105
1080 3300028379 Ga0268266_10056470 Ga0268266_100564704 105
1081 3300028379 Ga0268266_10128490 Ga0268266_101284904 105
1082 3300028379 Ga0268266_10492373 Ga0268266_104923732 105
1083 3300028379 Ga0268266_10759427 Ga0268266_107594272 105
1084 3300028379 Ga0268266_10796398 Ga0268266_107963982 105
1085 3300028379 Ga0268266_11098647 Ga0268266_110986472 105
1086 3300028379 Ga0268266_11853262 Ga0268266_118532622 105
1087 3300028379 Ga0268266_12271841 Ga0268266_122718412 105
1088 3300028380 Ga0268265_10054843 Ga0268265_100548435 105
1089 3300028380 Ga0268265_10170480 Ga0268265_101704804 105
1090 3300028380 Ga0268265_10192843 Ga0268265_101928431 105
1091 3300028380 Ga0268265_10487539 Ga0268265_104875392 105
1092 3300028380 Ga0268265_10603329 Ga0268265_106033292 105
1093 3300028380 Ga0268265_10791405 Ga0268265_107914051 105
1094 3300028380 Ga0268265_11019108 Ga0268265_110191082 105
1095 3300028381 Ga0268264_10140299 Ga0268264_101402993 105
1096 3300028381 Ga0268264_10334994 Ga0268264_103349942 105
1097 3300028381 Ga0268264_11563372 Ga0268264_115633722 105
1098 3300028381 Ga0268264_12471887 Ga0268264_124718872 105
1099 3300028556 Ga0265337_1006171 Ga0265337_10061715 105
1100 3300028558 Ga0265326_10028694 Ga0265326_100286942 105
1101 3300028563 Ga0265319_1011253 Ga0265319_10112535 105
1102 3300028573 Ga0265334_10010046 Ga0265334_100100463 105
1103 3300028577 Ga0265318_10108290 Ga0265318_101082902 105
1104 3300028577 Ga0265318_10389161 Ga0265318_103891611 105
1105 3300028653 Ga0265323_10000434 Ga0265323_1000043422 105
1106 3300028654 Ga0265322_10017119 Ga0265322_100171193 105
1107 3300028666 Ga0265336_10000649 Ga0265336_1000064915 105
1108 3300028786 Ga0307517_10623476 Ga0307517_106234761 105
1109 3300028794 Ga0307515_10651065 Ga0307515_106510652 105
1110 3300028800 Ga0265338_10000280 Ga0265338_1000028048 105
1111 3300029957 Ga0265324_10108602 Ga0265324_101086022 105
1112 3300031235 Ga0265330_10006697 Ga0265330_100066975 105
1113 3300031235 Ga0265330_10016700 Ga0265330_100167003 105
1114 3300031238 Ga0265332_10013075 Ga0265332_100130754 105
1115 3300031239 Ga0265328_10170447 Ga0265328_101704472 105
1116 3300031241 Ga0265325_10434418 Ga0265325_104344181 105
1117 3300031242 Ga0265329_10054722 Ga0265329_100547223 105
1118 3300031247 Ga0265340_10017751 Ga0265340_100177514 105
1119 3300031247 Ga0265340_10140965 Ga0265340_101409652 105
1120 3300031247 Ga0265340_10412045 Ga0265340_104120451 105
1121 3300031249 Ga0265339_10023730 Ga0265339_100237304 105
1122 3300031249 Ga0265339_10179779 Ga0265339_101797793 105
1123 3300031249 Ga0265339_10228397 Ga0265339_102283972 105
1124 3300031249 Ga0265339_10233447 Ga0265339_102334472 105
1125 3300031344 Ga0265316_10136483 Ga0265316_101364832 105
1126 3300031456 Ga0307513_10220308 Ga0307513_102203082 105
1127 3300031456 Ga0307513_10419191 Ga0307513_104191912 105
1128 3300031456 Ga0307513_10668572 Ga0307513_106685722 105
1129 3300031507 Ga0307509_10098111 Ga0307509_100981114 105
1130 3300031507 Ga0307509_10674880 Ga0307509_106748802 105
1131 3300031548 Ga0307408_101409927 Ga0307408_1014099272 105
1132 3300031595 Ga0265313_10240158 Ga0265313_102401582 105
1133 3300031616 Ga0307508_10003532 Ga0307508_100035326 105
1134 3300031616 Ga0307508_10111858 Ga0307508_101118583 105
1135 3300031616 Ga0307508_10340520 Ga0307508_103405202 105
1136 3300031649 Ga0307514_10317603 Ga0307514_103176032 105
1137 3300031711 Ga0265314_10031072 Ga0265314_100310723 105
1138 3300031711 Ga0265314_10169805 Ga0265314_101698053 105
1139 3300031712 Ga0265342_10062949 Ga0265342_100629493 105
1140 3300031712 Ga0265342_10439243 Ga0265342_104392432 105
1141 3300031730 Ga0307516_10126545 Ga0307516_101265452 105
1142 3300031730 Ga0307516_10964627 Ga0307516_109646272 105
1143 3300031731 Ga0307405_10756220 Ga0307405_107562202 105
1144 3300031824 Ga0307413_10784291 Ga0307413_107842912 105
1145 3300031852 Ga0307410_10623428 Ga0307410_106234281 105
1146 3300031903 Ga0307407_10520668 Ga0307407_105206682 105
1147 3300031911 Ga0307412_10379263 Ga0307412_103792632 105
1148 3300031911 Ga0307412_11475254 Ga0307412_114752542 105
1149 3300031995 Ga0307409_100267344 Ga0307409_1002673441 105
1150 3300031995 Ga0307409_100320888 Ga0307409_1003208883 105
1151 3300031995 Ga0307409_100649072 Ga0307409_1006490722 105
1152 3300031995 Ga0307409_101827303 Ga0307409_1018273032 105
1153 3300032002 Ga0307416_100179356 Ga0307416_1001793563 105
1154 3300032002 Ga0307416_101155366 Ga0307416_1011553662 105
1155 3300032002 Ga0307416_101484597 Ga0307416_1014845972 105
1156 3300032002 Ga0307416_101899462 Ga0307416_1018994622 105
1157 3300032004 Ga0307414_10797793 Ga0307414_107977932 105
1158 3300032004 Ga0307414_10924211 Ga0307414_109242112 105
1159 3300032005 Ga0307411_10727436 Ga0307411_107274362 105
1160 3300032126 Ga0307415_100233281 Ga0307415_1002332813 105
1161 3300032126 Ga0307415_101320124 Ga0307415_1013201242 105
1162 3300033179 Ga0307507_10329935 Ga0307507_103299352 105
1163 3300033180 Ga0307510_10006305 Ga0307510_1000630511 105
1164 3300033180 Ga0307510_10032835 Ga0307510_100328356 105
1165 3300033180 Ga0307510_10041581 Ga0307510_100415814 105
1166 3300033180 Ga0307510_10264795 Ga0307510_102647952 105
1167 3300033180 Ga0307510_10331321 Ga0307510_103313212 105
1168 3300035083 Ga0373926_0044210 Ga0373926_0044210_68_388 105
1169 3300035086 Ga0373934_0035852 Ga0373934_0035852_782_1102 105
1170 3300035090 Ga0373949_0208963 Ga0373949_0208963_220_540 105
1171 3300035111 Ga0373923_0051442 Ga0373923_0051442_37_357 105
1172 3300035111 Ga0373923_0266431 Ga0373923_0266431_10_330 105
1173 3300035113 Ga0373936_0348066 Ga0373936_0348066_168_488 105
1174 3300035114 Ga0373939_0175170 Ga0373939_0175170_446_766 105
1175 3300035115 Ga0373941_0028234 Ga0373941_0028234_138_458 105
1176 3300035116 Ga0373945_0101883 Ga0373945_0101883_379_699 105
1177 3300035116 Ga0373945_0497283 Ga0373945_0497283_25_345 105
1178 3300035117 Ga0373953_0003406 Ga0373953_0003406_2823_3143 105
1179 3300035117 Ga0373953_0163712 Ga0373953_0163712_515_835 105
1180 3300035117 Ga0373953_0286993 Ga0373953_0286993_355_675 105
1181 3300035118 Ga0373954_0005974 Ga0373954_0005974_3496_3816 105
1182 3300035119 Ga0373956_0056434 Ga0373956_0056434_763_1083 105
1183 3300035119 Ga0373956_0160729 Ga0373956_0160729_408_728 105
1184 3300035120 Ga0373957_0022105 Ga0373957_0022105_877_1197 105
1185 3300035121 Ga0373960_0170797 Ga0373960_0170797_110_430 105
1186 3300035170 Ga0373943_0153691 Ga0373943_0153691_556_876 105
1187 3300035170 Ga0373943_0324958 Ga0373943_0324958_492_812 105
1188 3300035171 Ga0373946_0210640 Ga0373946_0210640_550_870 105
1189 3300035172 Ga0373955_0159501 Ga0373955_0159501_426_746 105
1190 3300035172 Ga0373955_0198644 Ga0373955_0198644_653_973 105
1191 3300035207 Ga0373942_0032763 Ga0373942_0032763_909_1229 105
1192 3300035207 Ga0373942_0348462 Ga0373942_0348462_78_398 105
1193 3300035241 Ga0373961_0368075 Ga0373961_0368075_24_344 105
1194 3300035241 Ga0373961_0398268 Ga0373961_0398268_48_368 105
1195 3300035242 Ga0373962_0251592 Ga0373962_0251592_105_425 105
1196 3300035410 Ga0373924_0017906 Ga0373924_0017906_1107_1427 105
1197 3300035410 Ga0373924_0232802 Ga0373924_0232802_189_509 105
1198 3300035691 Ga0373931_0023469 Ga0373931_0023469_1066_1386 105
1199 3300035691 Ga0373931_0561197 Ga0373931_0561197_104_424 105
1200 3300035692 Ga0373935_0394890 Ga0373935_0394890_454_774 105
1201 3300035692 Ga0373935_1514796 Ga0373935_1514796_173_490 105
1202 3300035695 Ga0373927_0039104 Ga0373927_0039104_817_1137 105
1203 3300035695 Ga0373927_0110471 Ga0373927_0110471_741_1061 105
1204 3300035695 Ga0373927_0162932 Ga0373927_0162932_367_687 105
1205 3300035695 Ga0373927_0173896 Ga0373927_0173896_904_1224 105
1206 3300035695 Ga0373927_0180032 Ga0373927_0180032_287_607 105
1207 3300035695 Ga0373927_0652777 Ga0373927_0652777_49_366 105
1208 3300035724 Ga0373933_0001821 Ga0373933_0001821_7525_7845 105
1209 3300035724 Ga0373933_0053328 Ga0373933_0053328_1841_2161 105
1210 3300035725 Ga0373947_0032481 Ga0373947_0032481_868_1188 105
1211 3300035725 Ga0373947_0171304 Ga0373947_0171304_1038_1358 105
1212 3300036401 Ga0373937_0142169 Ga0373937_0142169_1182_1502 105
1213 3300036401 Ga0373937_0177094 Ga0373937_0177094_1090_1410 105
1214 3300036401 Ga0373937_0297000 Ga0373937_0297000_152_472 105
1215 3300037068 Ga0373925_0038336 Ga0373925_0038336_1645_1965 105
1216 3300037068 Ga0373925_0055603 Ga0373925_0055603_2545_2865 105
1217 3300037068 Ga0373925_0116839 Ga0373925_0116839_137_457 105
1218 3300037068 Ga0373925_0168515 Ga0373925_0168515_499_819 105
1219 3300037068 Ga0373925_0368755 Ga0373925_0368755_331_651 105
1220 3300037068 Ga0373925_1036199 Ga0373925_1036199_81_401 105
1221 3300037312 Ga0395899_0608382 Ga0395899_0608382_150_470 105
1222 3300037312 Ga0395899_0852044 Ga0395899_0852044_191_508 105
1223 3300037418 Ga0395900_0873786 Ga0395900_0873786_187_504 105
1224 3300037466 Ga0395898_0472857 Ga0395898_0472857_281_601 105
1225 3300037466 Ga0395898_1464913 Ga0395898_1464913_99_416 105
1226 3300037471 Ga0395905_0031994 Ga0395905_0031994_2379_2696 105
1227 3300037471 Ga0395905_1080322 Ga0395905_1080322_234_554 105
1228 3300037853 Ga0436364_0232752 Ga0436364_0232752_2227_2547 105
1229 3300037853 Ga0436364_1182233 Ga0436364_1182233_144_464 105
1230 3300038443 Ga0395901_0137905 Ga0395901_0137905_673_993 105
1231 3300038443 Ga0395901_0715196 Ga0395901_0715196_292_609 105
1232 3300038443 Ga0395901_1444189 Ga0395901_1444189_89_406 105
1233 3300039437 Ga0436365_0352567 Ga0436365_0352567_243_578 105
1234 3300041443 Ga0451789_0117805 Ga0451789_0117805_149_466 105
1235 3300041451 Ga0451791_1368894 Ga0451791_1368894_320_640 105
1236 3300041452 Ga0451793_1166215 Ga0451793_1166215_108_428 105
1237 3300041452 Ga0451793_1638534 Ga0451793_1638534_58_378 105
1238 3300041456 Ga0451795_0309308 Ga0451795_0309308_191_511 105
1239 3300041458 Ga0451798_0209264 Ga0451798_0209264_214_534 105
1240 3300041463 Ga0451804_0332640 Ga0451804_0332640_430_750 105
1241 3300041463 Ga0451804_1010519 Ga0451804_1010519_49_369 105
1242 3300041486 Ga0451807_1931817 Ga0451807_1931817_121_441 105
1243 3300041496 Ga0451839_0621132 Ga0451839_0621132_114_434 105
1244 3300041501 Ga0451845_0055885 Ga0451845_0055885_477_797 105
1245 3300041503 Ga0451847_1015364 Ga0451847_1015364_147_467 105
1246 3300041505 Ga0451849_0651261 Ga0451849_0651261_626_943 105
1247 3300041509 Ga0451843_1021076 Ga0451843_1021076_265_585 105
1248 3300041512 Ga0451853_2433109 Ga0451853_2433109_1201_1521 105
1249 3300041512 Ga0451853_3986792 Ga0451853_3986792_1576_1896 105
1250 3300042005 Ga0439448_0236222 Ga0439448_0236222_313_630 105
1251 3300042010 Ga0439452_054376 Ga0439452_054376_155_478 105
1252 3300042012 Ga0439455_0055061 Ga0439455_0055061_102_419 105
1253 3300042157 Ga0439458_0091426 Ga0439458_0091426_441_761 105
1254 3300042438 Ga0439459_0020837 Ga0439459_0020837_720_1040 105
1255 3300042438 Ga0439459_0078009 Ga0439459_0078009_336_656 105
1256 3300042993 Ga0439440_0273581 Ga0439440_0273581_152_472 105
1257 3300044658 Ga0466972_0000079 Ga0466972_0000079_67886_68203 105
1258 3300044658 Ga0466972_0001061 Ga0466972_0001061_2298_2615 105
1259 3300044658 Ga0466972_0192948 Ga0466972_0192948_250_567 105
1260 3300044683 Ga0466965_0334691 Ga0466965_0334691_255_572 105
1261 3300044683 Ga0466965_0359893 Ga0466965_0359893_378_695 105
1262 3300044684 Ga0466966_0058132 Ga0466966_0058132_174_491 105
1263 3300044684 Ga0466966_0375764 Ga0466966_0375764_210_530 105
1264 3300044693 Ga0466961_0541072 Ga0466961_0541072_213_530 105
1265 3300044693 Ga0466961_0969972 Ga0466961_0969972_81_398 105
1266 3300044694 Ga0466963_0007491 Ga0466963_0007491_5942_6262 105
1267 3300044694 Ga0466963_0545221 Ga0466963_0545221_307_624 105
1268 3300044735 Ga0466968_0010560 Ga0466968_0010560_2559_2876 105
1269 3300044735 Ga0466968_0078786 Ga0466968_0078786_952_1269 105
1270 3300044735 Ga0466968_0193789 Ga0466968_0193789_592_909 105
1271 3300044765 Ga0466970_0243334 Ga0466970_0243334_355_672 105
1272 3300044842 Ga0466957_0093861 Ga0466957_0093861_454_771 105
1273 3300044842 Ga0466957_0284174 Ga0466957_0284174_83_400 105
1274 3300044901 Ga0466960_0171066 Ga0466960_0171066_650_967 105
1275 3300044901 Ga0466960_0736780 Ga0466960_0736780_266_583 105
1276 3300044901 Ga0466960_0741794 Ga0466960_0741794_200_517 105
1277 3300044901 Ga0466960_0921821 Ga0466960_0921821_140_457 105
1278 3300045049 Ga0466959_0040060 Ga0466959_0040060_824_1141 105
1279 3300045976 Ga0466967_0202886 Ga0466967_0202886_657_974 105
1280 3300045976 Ga0466967_1542599 Ga0466967_1542599_78_398 105
1281 3300046454 Ga0495592_0105015 Ga0495592_0105015_1262_1582 105
1282 3300046454 Ga0495592_0200664 Ga0495592_0200664_224_541 105
1283 3300046454 Ga0495592_0207253 Ga0495592_0207253_88_405 105
1284 3300046454 Ga0495592_0619197 Ga0495592_0619197_163_483 105
1285 3300046455 Ga0495603_0002778 Ga0495603_0002778_5456_5776 105
1286 3300046455 Ga0495603_0341161 Ga0495603_0341161_264_584 105
1287 3300046455 Ga0495603_0372723 Ga0495603_0372723_385_702 105
1288 3300046455 Ga0495603_0435018 Ga0495603_0435018_407_727 105
1289 3300046455 Ga0495603_0551532 Ga0495603_0551532_29_349 105
1290 3300046457 Ga0495590_0147306 Ga0495590_0147306_435_755 105
1291 3300046458 Ga0495591_098328 Ga0495591_098328_386_706 105
1292 3300046459 Ga0495629_0065563 Ga0495629_0065563_1007_1327 105
1293 3300046459 Ga0495629_0070734 Ga0495629_0070734_98_415 105
1294 3300046459 Ga0495629_0177624 Ga0495629_0177624_652_972 105
1295 3300046459 Ga0495629_0274632 Ga0495629_0274632_192_509 105
1296 3300046459 Ga0495629_0314481 Ga0495629_0314481_219_539 105
1297 3300046460 Ga0495638_0020090 Ga0495638_0020090_2543_2860 105
1298 3300046460 Ga0495638_0125537 Ga0495638_0125537_741_1061 105
1299 3300046460 Ga0495638_0550727 Ga0495638_0550727_35_355 105
1300 3300046460 Ga0495638_0589720 Ga0495638_0589720_22_342 105
1301 3300046461 Ga0495641_0095897 Ga0495641_0095897_562_882 105
1302 3300046461 Ga0495641_0553912 Ga0495641_0553912_166_486 105
1303 3300046462 Ga0495651_0029360 Ga0495651_0029360_3034_3351 105
1304 3300046462 Ga0495651_0191782 Ga0495651_0191782_34_351 105
1305 3300046463 Ga0495653_0082616 Ga0495653_0082616_1151_1471 105
1306 3300046463 Ga0495653_0400555 Ga0495653_0400555_115_435 105
1307 3300046463 Ga0495653_0450921 Ga0495653_0450921_220_540 105
1308 3300046463 Ga0495653_0505577 Ga0495653_0505577_210_527 105
1309 3300046471 Ga0495650_0099119 Ga0495650_0099119_116_436 105
1310 3300046472 Ga0495580_0043983 Ga0495580_0043983_2190_2510 105
1311 3300046472 Ga0495580_0152884 Ga0495580_0152884_625_945 105
1312 3300046473 Ga0495582_0082297 Ga0495582_0082297_701_1021 105
1313 3300046473 Ga0495582_0758712 Ga0495582_0758712_47_367 105
1314 3300046474 Ga0495605_0079481 Ga0495605_0079481_33_353 105
1315 3300046474 Ga0495605_0265789 Ga0495605_0265789_154_474 105
1316 3300046475 Ga0495639_0142339 Ga0495639_0142339_538_858 105
1317 3300046475 Ga0495639_0336377 Ga0495639_0336377_213_533 105
1318 3300046477 Ga0495664_0056145 Ga0495664_0056145_227_544 105
1319 3300046477 Ga0495664_0122727 Ga0495664_0122727_719_1039 105
1320 3300046477 Ga0495664_0325560 Ga0495664_0325560_19_339 105
1321 3300046477 Ga0495664_0399360 Ga0495664_0399360_384_704 105
1322 3300046491 Ga0495584_0072778 Ga0495584_0072778_178_498 105
1323 3300046491 Ga0495584_0073045 Ga0495584_0073045_727_1044 105
1324 3300046491 Ga0495584_0276173 Ga0495584_0276173_280_597 105
1325 3300046492 Ga0495585_0070948 Ga0495585_0070948_1434_1754 105
1326 3300046492 Ga0495585_0207470 Ga0495585_0207470_292_609 105
1327 3300046492 Ga0495585_0295659 Ga0495585_0295659_240_560 105
1328 3300046492 Ga0495585_0300591 Ga0495585_0300591_213_533 105
1329 3300046500 Ga0495596_0068931 Ga0495596_0068931_736_1056 105
1330 3300046501 Ga0495607_0224908 Ga0495607_0224908_288_605 105
1331 3300046501 Ga0495607_0371971 Ga0495607_0371971_258_575 105
1332 3300046501 Ga0495607_0373477 Ga0495607_0373477_153_473 105
1333 3300046506 Ga0495583_0093717 Ga0495583_0093717_697_1017 105
1334 3300046506 Ga0495583_0242545 Ga0495583_0242545_226_543 105
1335 3300046507 Ga0495606_0006998 Ga0495606_0006998_3442_3759 105
1336 3300046507 Ga0495606_0066480 Ga0495606_0066480_774_1091 105
1337 3300046507 Ga0495606_0263566 Ga0495606_0263566_435_752 105
1338 3300046507 Ga0495606_0315868 Ga0495606_0315868_64_381 105
1339 3300046507 Ga0495606_0450205 Ga0495606_0450205_174_491 105
1340 3300046511 Ga0495608_0023395 Ga0495608_0023395_3758_4078 105
1341 3300046511 Ga0495608_0058489 Ga0495608_0058489_2096_2413 105
1342 3300046512 Ga0495610_0127467 Ga0495610_0127467_545_862 105
1343 3300046512 Ga0495610_0270903 Ga0495610_0270903_22_342 105
1344 3300046512 Ga0495610_0292850 Ga0495610_0292850_121_441 105
1345 3300046513 Ga0495616_0081220 Ga0495616_0081220_1185_1502 105
1346 3300046514 Ga0495618_0064992 Ga0495618_0064992_979_1299 105
1347 3300046514 Ga0495618_0178450 Ga0495618_0178450_151_468 105
1348 3300046514 Ga0495618_0228836 Ga0495618_0228836_481_801 105
1349 3300046515 Ga0495620_0121887 Ga0495620_0121887_238_558 105
1350 3300046515 Ga0495620_0128405 Ga0495620_0128405_369_689 105
1351 3300046516 Ga0495628_0012530 Ga0495628_0012530_4391_4708 105
1352 3300046516 Ga0495628_0121239 Ga0495628_0121239_382_702 105
1353 3300046516 Ga0495628_0422680 Ga0495628_0422680_627_944 105
1354 3300046516 Ga0495628_0865242 Ga0495628_0865242_272_592 105
1355 3300046517 Ga0495630_0019164 Ga0495630_0019164_917_1237 105
1356 3300046517 Ga0495630_0077623 Ga0495630_0077623_950_1270 105
1357 3300046517 Ga0495630_0494465 Ga0495630_0494465_488_808 105
1358 3300046517 Ga0495630_0803725 Ga0495630_0803725_225_542 105
1359 3300046518 Ga0495631_0036622 Ga0495631_0036622_279_599 105
1360 3300046518 Ga0495631_0223374 Ga0495631_0223374_157_474 105
1361 3300046518 Ga0495631_0277840 Ga0495631_0277840_347_667 105
1362 3300046518 Ga0495631_0320372 Ga0495631_0320372_206_523 105
1363 3300046519 Ga0495632_0056495 Ga0495632_0056495_232_552 105
1364 3300046519 Ga0495632_0085482 Ga0495632_0085482_652_972 105
1365 3300046519 Ga0495632_0131267 Ga0495632_0131267_786_1103 105
1366 3300046519 Ga0495632_0142348 Ga0495632_0142348_345_665 105
1367 3300046519 Ga0495632_0190293 Ga0495632_0190293_190_510 105
1368 3300046520 Ga0495637_0090080 Ga0495637_0090080_309_629 105
1369 3300046520 Ga0495637_0228197 Ga0495637_0228197_24_344 105
1370 3300046520 Ga0495637_0333795 Ga0495637_0333795_85_402 105
1371 3300046522 Ga0495643_0138335 Ga0495643_0138335_171_488 105
1372 3300046522 Ga0495643_0202872 Ga0495643_0202872_286_603 105
1373 3300046523 Ga0495644_0037867 Ga0495644_0037867_31_351 105
1374 3300046523 Ga0495644_0079264 Ga0495644_0079264_726_1046 105
1375 3300046524 Ga0495648_0014927 Ga0495648_0014927_888_1208 105
1376 3300046524 Ga0495648_0037099 Ga0495648_0037099_779_1096 105
1377 3300046524 Ga0495648_0041864 Ga0495648_0041864_1504_1821 105
1378 3300046524 Ga0495648_0063034 Ga0495648_0063034_1725_2042 105
1379 3300046524 Ga0495648_0082027 Ga0495648_0082027_726_1046 105
1380 3300046524 Ga0495648_0156846 Ga0495648_0156846_287_604 105
1381 3300046524 Ga0495648_0181804 Ga0495648_0181804_661_981 105
1382 3300046524 Ga0495648_0211952 Ga0495648_0211952_456_776 105
1383 3300046524 Ga0495648_0322648 Ga0495648_0322648_357_674 105
1384 3300046525 Ga0495663_0378107 Ga0495663_0378107_103_423 105
1385 3300046526 Ga0495666_0145016 Ga0495666_0145016_424_744 105
1386 3300046526 Ga0495666_0467770 Ga0495666_0467770_186_506 105
1387 3300046528 Ga0495642_0148056 Ga0495642_0148056_573_893 105
1388 3300046529 Ga0495652_0155483 Ga0495652_0155483_595_912 105
1389 3300046529 Ga0495652_0220458 Ga0495652_0220458_829_1149 105
1390 3300046529 Ga0495652_0311042 Ga0495652_0311042_186_506 105
1391 3300046529 Ga0495652_0313453 Ga0495652_0313453_424_744 105
1392 3300046529 Ga0495652_0348609 Ga0495652_0348609_121_441 105
1393 3300046531 Ga0495665_0049613 Ga0495665_0049613_735_1055 105
1394 3300046531 Ga0495665_0508617 Ga0495665_0508617_158_475 105
1395 3300046533 Ga0495640_0023983 Ga0495640_0023983_500_820 105
1396 3300046533 Ga0495640_0028223 Ga0495640_0028223_3621_3938 105
1397 3300046533 Ga0495640_0085615 Ga0495640_0085615_826_1143 105
1398 3300046533 Ga0495640_0659504 Ga0495640_0659504_60_380 105
1399 3300046535 Ga0495586_0078473 Ga0495586_0078473_1408_1728 105
1400 3300046536 Ga0495587_0014340 Ga0495587_0014340_3060_3377 105
1401 3300046536 Ga0495587_0066633 Ga0495587_0066633_1717_2037 105
1402 3300046536 Ga0495587_0260700 Ga0495587_0260700_391_711 105
1403 3300046536 Ga0495587_0284763 Ga0495587_0284763_480_800 105
1404 3300046536 Ga0495587_0552330 Ga0495587_0552330_115_435 105
1405 3300046537 Ga0495598_0024640 Ga0495598_0024640_1173_1493 105
1406 3300046537 Ga0495598_0226897 Ga0495598_0226897_346_666 105
1407 3300046538 Ga0495609_0074168 Ga0495609_0074168_367_684 105
1408 3300046538 Ga0495609_0144594 Ga0495609_0144594_295_615 105
1409 3300046538 Ga0495609_0147695 Ga0495609_0147695_657_977 105
1410 3300046538 Ga0495609_0188209 Ga0495609_0188209_133_450 105
1411 3300046539 Ga0495621_0204640 Ga0495621_0204640_196_516 105
1412 3300046542 Ga0495597_0086798 Ga0495597_0086798_708_1025 105
1413 3300046542 Ga0495597_0167782 Ga0495597_0167782_466_783 105
1414 3300046543 Ga0495645_0007155 Ga0495645_0007155_2692_3009 105
1415 3300046543 Ga0495645_0058108 Ga0495645_0058108_2244_2564 105
1416 3300046543 Ga0495645_0065908 Ga0495645_0065908_2011_2331 105
1417 3300046543 Ga0495645_0202750 Ga0495645_0202750_937_1254 105
1418 3300046543 Ga0495645_0368965 Ga0495645_0368965_478_795 105
1419 3300046557 Ga0495622_0039374 Ga0495622_0039374_718_1035 105
1420 3300046557 Ga0495622_0114915 Ga0495622_0114915_270_590 105
1421 3300046557 Ga0495622_0171185 Ga0495622_0171185_559_879 105
1422 3300046559 Ga0495667_0006892 Ga0495667_0006892_3805_4122 105
1423 3300046559 Ga0495667_0163154 Ga0495667_0163154_735_1055 105
1424 3300046559 Ga0495667_0469818 Ga0495667_0469818_262_579 105
1425 3300046615 Ga0495656_0002642 Ga0495656_0002642_293_613 105
1426 3300046615 Ga0495656_0126518 Ga0495656_0126518_831_1151 105
1427 3300046615 Ga0495656_0673322 Ga0495656_0673322_64_384 105
1428 3300046616 Ga0495668_0055701 Ga0495668_0055701_1622_1942 105
1429 3300046616 Ga0495668_0194695 Ga0495668_0194695_17_337 105
1430 3300046616 Ga0495668_0221511 Ga0495668_0221511_584_904 105
1431 3300046616 Ga0495668_0236868 Ga0495668_0236868_651_971 105
1432 3300046616 Ga0495668_0840332 Ga0495668_0840332_99_416 105
1433 3300046642 Ga0495634_0123320 Ga0495634_0123320_901_1221 105
1434 3300046642 Ga0495634_0135559 Ga0495634_0135559_22_339 105
1435 3300046642 Ga0495634_0198728 Ga0495634_0198728_806_1126 105
1436 3300046642 Ga0495634_0289460 Ga0495634_0289460_96_413 105
1437 3300046648 Ga0495611_0037207 Ga0495611_0037207_1749_2066 105
1438 3300046648 Ga0495611_0315708 Ga0495611_0315708_249_566 105
1439 3300046660 Ga0495625_0056019 Ga0495625_0056019_2255_2572 105
1440 3300046660 Ga0495625_0168223 Ga0495625_0168223_1061_1378 105
1441 3300046660 Ga0495625_0334717 Ga0495625_0334717_171_488 105
1442 3300046660 Ga0495625_0377032 Ga0495625_0377032_97_417 105
1443 3300046660 Ga0495625_0787072 Ga0495625_0787072_81_401 105
1444 3300046663 Ga0495635_0282246 Ga0495635_0282246_196_516 105
1445 3300046663 Ga0495635_0317270 Ga0495635_0317270_337_654 105
1446 3300046663 Ga0495635_0449963 Ga0495635_0449963_115_435 105
1447 3300046664 Ga0495659_0009434 Ga0495659_0009434_971_1291 105
1448 3300046664 Ga0495659_0055584 Ga0495659_0055584_896_1216 105
1449 3300046665 Ga0495661_0214557 Ga0495661_0214557_546_863 105
1450 3300046665 Ga0495661_0451466 Ga0495661_0451466_41_361 105
1451 3300046674 Ga0495588_0011004 Ga0495588_0011004_1571_1888 105
1452 3300046674 Ga0495588_0151606 Ga0495588_0151606_614_931 105
1453 3300046674 Ga0495588_0226189 Ga0495588_0226189_312_632 105
1454 3300046674 Ga0495588_0560445 Ga0495588_0560445_81_401 105
1455 3300046675 Ga0495657_0019556 Ga0495657_0019556_3737_4054 105
1456 3300046675 Ga0495657_0054792 Ga0495657_0054792_2262_2582 105
1457 3300046675 Ga0495657_0462943 Ga0495657_0462943_212_529 105
1458 3300046675 Ga0495657_0864010 Ga0495657_0864010_46_366 105
1459 3300046678 Ga0495599_0086294 Ga0495599_0086294_355_675 105
1460 3300046678 Ga0495599_0143862 Ga0495599_0143862_319_636 105
1461 3300046678 Ga0495599_0148341 Ga0495599_0148341_947_1267 105
1462 3300046678 Ga0495599_0439046 Ga0495599_0439046_121_441 105
1463 3300046679 Ga0495623_0032327 Ga0495623_0032327_1827_2144 105
1464 3300046679 Ga0495623_0091416 Ga0495623_0091416_1107_1427 105
1465 3300046680 Ga0495646_0010341 Ga0495646_0010341_1240_1557 105
1466 3300046680 Ga0495646_0222676 Ga0495646_0222676_220_540 105
1467 3300046681 Ga0495647_0047804 Ga0495647_0047804_919_1239 105
1468 3300046681 Ga0495647_0450174 Ga0495647_0450174_231_551 105
1469 3300046681 Ga0495647_0464744 Ga0495647_0464744_79_399 105
1470 3300046683 Ga0495658_0074262 Ga0495658_0074262_102_422 105
1471 3300046683 Ga0495658_0145919 Ga0495658_0145919_748_1068 105
1472 3300046684 Ga0495669_0001990 Ga0495669_0001990_4321_4641 105
1473 3300046689 Ga0495613_0162469 Ga0495613_0162469_556_876 105
1474 3300046689 Ga0495613_0594472 Ga0495613_0594472_211_531 105
1475 3300046690 Ga0495624_0082595 Ga0495624_0082595_81_398 105
1476 3300046690 Ga0495624_0386205 Ga0495624_0386205_49_369 105
1477 3300046691 Ga0495670_0161747 Ga0495670_0161747_573_893 105
1478 3300046692 Ga0495671_0110181 Ga0495671_0110181_435_752 105
1479 3300046692 Ga0495671_0239628 Ga0495671_0239628_538_858 105
1480 3300046692 Ga0495671_0252571 Ga0495671_0252571_95_412 105
1481 3300046694 Ga0495649_0015884 Ga0495649_0015884_415_732 105
1482 3300046694 Ga0495649_0093239 Ga0495649_0093239_1112_1429 105
1483 3300046694 Ga0495649_0497034 Ga0495649_0497034_12_332 105
1484 3300046794 Ga0495589_0112277 Ga0495589_0112277_840_1160 105
1485 3300046794 Ga0495589_0398734 Ga0495589_0398734_222_542 105
1486 3300046794 Ga0495589_0472584 Ga0495589_0472584_154_474 105
1487 3300046794 Ga0495589_0582000 Ga0495589_0582000_110_427 105
1488 3300046809 Ga0495600_0091391 Ga0495600_0091391_1488_1805 105
1489 3300046809 Ga0495600_0189485 Ga0495600_0189485_844_1164 105
1490 3300046809 Ga0495600_0247155 Ga0495600_0247155_143_463 105
1491 3300046809 Ga0495600_0311403 Ga0495600_0311403_607_927 105
1492 3300046809 Ga0495600_0559156 Ga0495600_0559156_352_669 105
1493 3300046810 Ga0495660_0296253 Ga0495660_0296253_215_532 105
1494 3300047315 Ga0495581_0104891 Ga0495581_0104891_1200_1520 105
1495 3300047315 Ga0495581_0299586 Ga0495581_0299586_502_819 105
1496 3300047315 Ga0495581_0329483 Ga0495581_0329483_20_340 105
1497 3300047315 Ga0495581_0499657 Ga0495581_0499657_196_516 105
1498 3300047317 Ga0495604_0185719 Ga0495604_0185719_268_588 105
1499 3300047317 Ga0495604_0208007 Ga0495604_0208007_210_530 105
1500 3300047317 Ga0495604_0416077 Ga0495604_0416077_80_397 105
1501 3300047317 Ga0495604_1045821 Ga0495604_1045821_60_380 105
1502 3300047318 Ga0495636_0043671 Ga0495636_0043671_1217_1537 105
1503 3300047319 Ga0495674_0042923 Ga0495674_0042923_3486_3803 105
1504 3300047319 Ga0495674_0049361 Ga0495674_0049361_1409_1729 105
1505 3300047319 Ga0495674_0203809 Ga0495674_0203809_576_896 105
1506 3300047319 Ga0495674_0785839 Ga0495674_0785839_244_561 105
1507 3300047319 Ga0495674_0966729 Ga0495674_0966729_178_498 105
1508 3300047319 Ga0495674_1372104 Ga0495674_1372104_53_373 105
1509 3300047320 Ga0495672_0404283 Ga0495672_0404283_288_608 105
1510 3300047320 Ga0495672_0474768 Ga0495672_0474768_62_382 105
1511 3300047321 Ga0495676_0076470 Ga0495676_0076470_601_918 105
1512 3300047321 Ga0495676_0201835 Ga0495676_0201835_217_537 105
1513 3300047322 Ga0495680_0025139 Ga0495680_0025139_2760_3077 105
1514 3300047322 Ga0495680_0193852 Ga0495680_0193852_709_1029 105
1515 3300047322 Ga0495680_0362866 Ga0495680_0362866_495_815 105
1516 3300047323 Ga0495683_0083558 Ga0495683_0083558_62_379 105
1517 3300047323 Ga0495683_0126305 Ga0495683_0126305_708_1025 105
1518 3300047443 Ga0495687_006694 Ga0495687_006694_6660_6977 105
1519 3300047444 Ga0495675_0027294 Ga0495675_0027294_1344_1661 105
1520 3300047444 Ga0495675_0132509 Ga0495675_0132509_406_726 105
1521 3300047444 Ga0495675_0187240 Ga0495675_0187240_320_640 105
1522 3300047444 Ga0495675_0687673 Ga0495675_0687673_157_474 105
1523 3300047445 Ga0495677_0015930 Ga0495677_0015930_630_950 105
1524 3300047445 Ga0495677_0046237 Ga0495677_0046237_506_823 105
1525 3300047445 Ga0495677_0198532 Ga0495677_0198532_193_510 105
1526 3300047446 Ga0495679_022313 Ga0495679_022313_193_513 105
1527 3300047447 Ga0495685_076321 Ga0495685_076321_561_881 105
1528 3300047469 Ga0495673_0099999 Ga0495673_0099999_687_1007 105
1529 3300047469 Ga0495673_0117364 Ga0495673_0117364_522_839 105
1530 3300047469 Ga0495673_0148550 Ga0495673_0148550_46_363 105
1531 3300047469 Ga0495673_0168813 Ga0495673_0168813_15_335 105
1532 3300047469 Ga0495673_0199830 Ga0495673_0199830_98_415 105
1533 3300047469 Ga0495673_0243792 Ga0495673_0243792_302_622 105
1534 3300047470 Ga0495681_0233571 Ga0495681_0233571_270_590 105
1535 3300047471 Ga0495684_0005641 Ga0495684_0005641_4767_5087 105
1536 3300047471 Ga0495684_0203441 Ga0495684_0203441_539_856 105
1537 3300047471 Ga0495684_0273449 Ga0495684_0273449_585_905 105
1538 3300047471 Ga0495684_1050708 Ga0495684_1050708_144_464 105
1539 3300047472 Ga0495686_0225445 Ga0495686_0225445_544_864 105
1540 3300047472 Ga0495686_0385122 Ga0495686_0385122_92_412 105
1541 3300047472 Ga0495686_0613245 Ga0495686_0613245_77_394 105
1542 3300047673 Ga0495593_0044012 Ga0495593_0044012_227_547 105
1543 3300047673 Ga0495593_0058612 Ga0495593_0058612_1452_1769 105
1544 3300047673 Ga0495593_0197819 Ga0495593_0197819_355_675 105
1545 3300047673 Ga0495593_0320652 Ga0495593_0320652_343_663 105
1546 3300048088 Ga0495602_0177171 Ga0495602_0177171_1236_1556 105
1547 3300048088 Ga0495602_0565194 Ga0495602_0565194_277_594 105
1548 3300048088 Ga0495602_0651834 Ga0495602_0651834_251_571 105
1549 3300048090 Ga0495615_0018473 Ga0495615_0018473_22_342 105
1550 3300048090 Ga0495615_0034571 Ga0495615_0034571_88_408 105
1551 3300048091 Ga0495626_0096064 Ga0495626_0096064_228_548 105
1552 3300048091 Ga0495626_0111865 Ga0495626_0111865_580_897 105
1553 3300048903 Ga0496100_0038138 Ga0496100_0038138_2081_2401 105
1554 3300048903 Ga0496100_0081519 Ga0496100_0081519_514_831 105
1555 3300048903 Ga0496100_0139144 Ga0496100_0139144_1232_1552 105
1556 3300048903 Ga0496100_0213578 Ga0496100_0213578_701_1018 105
1557 3300048903 Ga0496100_0591946 Ga0496100_0591946_43_363 105
1558 3300048903 Ga0496100_0855031 Ga0496100_0855031_297_614 105
1559 3300048903 Ga0496100_1038009 Ga0496100_1038009_188_508 105
1560 3300048904 Ga0496101_0006365 Ga0496101_0006365_6558_6878 105
1561 3300048904 Ga0496101_0033698 Ga0496101_0033698_2070_2390 105
1562 3300048904 Ga0496101_0183070 Ga0496101_0183070_1015_1332 105
1563 3300048904 Ga0496101_0235397 Ga0496101_0235397_680_997 105
1564 3300048904 Ga0496101_0359095 Ga0496101_0359095_580_900 105
1565 3300048904 Ga0496101_0442599 Ga0496101_0442599_306_626 105
1566 3300048904 Ga0496101_0492185 Ga0496101_0492185_152_472 105
1567 3300048904 Ga0496101_0723245 Ga0496101_0723245_367_684 105
1568 3300048904 Ga0496101_0758326 Ga0496101_0758326_240_560 105
1569 3300048904 Ga0496101_0992587 Ga0496101_0992587_230_550 105
1570 3300048904 Ga0496101_1014996 Ga0496101_1014996_317_634 105
1571 3300048905 Ga0496102_0003595 Ga0496102_0003595_5167_5487 105
1572 3300048905 Ga0496102_0067964 Ga0496102_0067964_1991_2308 105
1573 3300048905 Ga0496102_0072804 Ga0496102_0072804_258_575 105
1574 3300048905 Ga0496102_0100826 Ga0496102_0100826_1211_1531 105
1575 3300048905 Ga0496102_0326233 Ga0496102_0326233_64_384 105
1576 3300048905 Ga0496102_0326950 Ga0496102_0326950_591_911 105
1577 3300048905 Ga0496102_0454169 Ga0496102_0454169_409_729 105
1578 3300048905 Ga0496102_0613241 Ga0496102_0613241_207_527 105
1579 3300048905 Ga0496102_0661843 Ga0496102_0661843_394_714 105
1580 3300048905 Ga0496102_1800617 Ga0496102_1800617_58_378 105
1581 3300048906 Ga0496103_0004751 Ga0496103_0004751_381_698 105
1582 3300048906 Ga0496103_0013766 Ga0496103_0013766_334_654 105
1583 3300048906 Ga0496103_0086099 Ga0496103_0086099_57_377 105
1584 3300048906 Ga0496103_0183494 Ga0496103_0183494_773_1093 105
1585 3300048906 Ga0496103_0375918 Ga0496103_0375918_81_401 105
1586 3300048906 Ga0496103_0651728 Ga0496103_0651728_172_492 105
1587 3300048906 Ga0496103_0778347 Ga0496103_0778347_178_498 105
1588 3300048906 Ga0496103_0903243 Ga0496103_0903243_49_369 105
1589 3300048907 Ga0496104_0001647 Ga0496104_0001647_646_966 105
1590 3300048907 Ga0496104_0004065 Ga0496104_0004065_5139_5459 105
1591 3300048907 Ga0496104_0010574 Ga0496104_0010574_2221_2538 105
1592 3300048907 Ga0496104_0080908 Ga0496104_0080908_631_948 105
1593 3300048907 Ga0496104_0341279 Ga0496104_0341279_154_474 105
1594 3300048907 Ga0496104_0424988 Ga0496104_0424988_144_464 105
1595 3300048907 Ga0496104_0451284 Ga0496104_0451284_612_932 105
1596 3300048908 Ga0496105_0022918 Ga0496105_0022918_3860_4180 105
1597 3300048908 Ga0496105_0051555 Ga0496105_0051555_31_348 105
1598 3300048908 Ga0496105_0116561 Ga0496105_0116561_1692_2012 105
1599 3300048908 Ga0496105_0183729 Ga0496105_0183729_336_653 105
1600 3300048908 Ga0496105_0318225 Ga0496105_0318225_343_663 105
1601 3300048908 Ga0496105_0330782 Ga0496105_0330782_347_667 105
1602 3300048908 Ga0496105_0368735 Ga0496105_0368735_183_500 105
1603 3300048908 Ga0496105_0761244 Ga0496105_0761244_399_719 105
1604 3300048908 Ga0496105_0978077 Ga0496105_0978077_21_341 105
1605 3300048909 Ga0496106_0029456 Ga0496106_0029456_2228_2548 105
1606 3300048909 Ga0496106_0047557 Ga0496106_0047557_2736_3053 105
1607 3300048909 Ga0496106_0098072 Ga0496106_0098072_1522_1842 105
1608 3300048909 Ga0496106_0102248 Ga0496106_0102248_789_1109 105
1609 3300048909 Ga0496106_0146926 Ga0496106_0146926_1279_1599 105
1610 3300048909 Ga0496106_0328246 Ga0496106_0328246_154_474 105
1611 3300048909 Ga0496106_0414878 Ga0496106_0414878_562_882 105
1612 3300048909 Ga0496106_0564853 Ga0496106_0564853_360_680 105
1613 3300048909 Ga0496106_0845233 Ga0496106_0845233_183_500 105
1614 3300048909 Ga0496106_1076517 Ga0496106_1076517_36_353 105
1615 3300048910 Ga0496107_0000947 Ga0496107_0000947_5660_5980 105
1616 3300048910 Ga0496107_0104673 Ga0496107_0104673_1428_1748 105
1617 3300048910 Ga0496107_0106384 Ga0496107_0106384_1585_1902 105
1618 3300048910 Ga0496107_0173695 Ga0496107_0173695_556_876 105
1619 3300048910 Ga0496107_0757584 Ga0496107_0757584_316_636 105
1620 3300048910 Ga0496107_1161802 Ga0496107_1161802_32_352 105
1621 3300048911 Ga0496108_0013705 Ga0496108_0013705_2683_3003 105
1622 3300048911 Ga0496108_0028679 Ga0496108_0028679_2463_2780 105
1623 3300048911 Ga0496108_0053689 Ga0496108_0053689_1284_1604 105
1624 3300048911 Ga0496108_0198252 Ga0496108_0198252_1338_1655 105
1625 3300048911 Ga0496108_0210750 Ga0496108_0210750_690_1010 105
1626 3300048911 Ga0496108_0229456 Ga0496108_0229456_466_786 105
1627 3300048911 Ga0496108_0250088 Ga0496108_0250088_768_1088 105
1628 3300048911 Ga0496108_0356915 Ga0496108_0356915_584_904 105
1629 3300048911 Ga0496108_0427899 Ga0496108_0427899_579_899 105
1630 3300048911 Ga0496108_0676832 Ga0496108_0676832_177_494 105
1631 3300048911 Ga0496108_0798170 Ga0496108_0798170_21_341 105
1632 3300048912 Ga0496109_0008951 Ga0496109_0008951_6437_6757 105
1633 3300048912 Ga0496109_0048452 Ga0496109_0048452_70_390 105
1634 3300048912 Ga0496109_0110861 Ga0496109_0110861_2078_2395 105
1635 3300048912 Ga0496109_0196509 Ga0496109_0196509_1337_1657 105
1636 3300048912 Ga0496109_0220090 Ga0496109_0220090_809_1129 105
1637 3300048913 Ga0496110_0045263 Ga0496110_0045263_949_1269 105
1638 3300048913 Ga0496110_0047060 Ga0496110_0047060_1659_1979 105
1639 3300048913 Ga0496110_0062445 Ga0496110_0062445_1607_1924 105
1640 3300048913 Ga0496110_0161087 Ga0496110_0161087_1250_1570 105
1641 3300048913 Ga0496110_0164218 Ga0496110_0164218_1121_1438 105
1642 3300048913 Ga0496110_0484369 Ga0496110_0484369_258_578 105
1643 3300048913 Ga0496110_0725000 Ga0496110_0725000_238_558 105
1644 3300048913 Ga0496110_1176713 Ga0496110_1176713_178_498 105
1645 3300048914 Ga0496111_0015443 Ga0496111_0015443_4790_5110 105
1646 3300048914 Ga0496111_0028576 Ga0496111_0028576_1716_2033 105
1647 3300048914 Ga0496111_0423490 Ga0496111_0423490_631_951 105
1648 3300048914 Ga0496111_0462441 Ga0496111_0462441_284_604 105
1649 3300048914 Ga0496111_1064214 Ga0496111_1064214_187_507 105
1650 3300048914 Ga0496111_1191220 Ga0496111_1191220_20_340 105
1651 3300048915 Ga0496112_0012760 Ga0496112_0012760_5743_6063 105
1652 3300048915 Ga0496112_0110694 Ga0496112_0110694_549_869 105
1653 3300048915 Ga0496112_0336783 Ga0496112_0336783_605_922 105
1654 3300048915 Ga0496112_0338342 Ga0496112_0338342_360_680 105
1655 3300048915 Ga0496112_0460291 Ga0496112_0460291_875_1192 105
1656 3300048915 Ga0496112_0730127 Ga0496112_0730127_463_783 105
1657 3300048915 Ga0496112_0892020 Ga0496112_0892020_254_574 105
1658 3300048915 Ga0496112_1301341 Ga0496112_1301341_279_596 105
1659 3300048915 Ga0496112_1488728 Ga0496112_1488728_205_525 105
1660 3300048916 Ga0496113_0001327 Ga0496113_0001327_7290_7610 105
1661 3300048916 Ga0496113_0038477 Ga0496113_0038477_2534_2854 105
1662 3300048916 Ga0496113_0039228 Ga0496113_0039228_1729_2046 105
1663 3300048916 Ga0496113_0060669 Ga0496113_0060669_1173_1490 105
1664 3300048916 Ga0496113_0153794 Ga0496113_0153794_259_579 105
1665 3300048916 Ga0496113_0264612 Ga0496113_0264612_403_720 105
1666 3300048916 Ga0496113_0449521 Ga0496113_0449521_91_408 105
1667 3300048917 Ga0496114_0021716 Ga0496114_0021716_4118_4438 105
1668 3300048917 Ga0496114_0024353 Ga0496114_0024353_3709_4029 105
1669 3300048917 Ga0496114_0066002 Ga0496114_0066002_2433_2750 105
1670 3300048917 Ga0496114_0082601 Ga0496114_0082601_575_895 105
1671 3300048917 Ga0496114_0440805 Ga0496114_0440805_698_1018 105
1672 3300048917 Ga0496114_1335716 Ga0496114_1335716_14_334 105
1673 3300048917 Ga0496114_1549244 Ga0496114_1549244_216_536 105
1674 3300048918 Ga0496115_0000604 Ga0496115_0000604_5700_6020 105
1675 3300048918 Ga0496115_0022771 Ga0496115_0022771_2111_2431 105
1676 3300048918 Ga0496115_0058271 Ga0496115_0058271_1791_2108 105
1677 3300048918 Ga0496115_0065715 Ga0496115_0065715_2011_2331 105
1678 3300048918 Ga0496115_0144469 Ga0496115_0144469_1167_1484 105
1679 3300048918 Ga0496115_0213542 Ga0496115_0213542_465_785 105
1680 3300048918 Ga0496115_0321795 Ga0496115_0321795_407_727 105
1681 3300048918 Ga0496115_0365576 Ga0496115_0365576_834_1154 105
1682 3300048918 Ga0496115_0436011 Ga0496115_0436011_261_578 105
1683 3300048918 Ga0496115_0726893 Ga0496115_0726893_194_514 105
1684 3300048918 Ga0496115_0766156 Ga0496115_0766156_275_595 105
1685 3300048919 Ga0496116_0088080 Ga0496116_0088080_1326_1643 105
1686 3300048919 Ga0496116_0141072 Ga0496116_0141072_323_640 105
1687 3300048920 Ga0496117_0241697 Ga0496117_0241697_69_389 105
1688 3300048920 Ga0496117_0325164 Ga0496117_0325164_22_339 105
1689 3300048920 Ga0496117_0376013 Ga0496117_0376013_305_622 105
1690 3300048921 Ga0496118_0095578 Ga0496118_0095578_1035_1352 105
1691 3300048921 Ga0496118_0158508 Ga0496118_0158508_980_1300 105
1692 3300048921 Ga0496118_0161367 Ga0496118_0161367_52_369 105
1693 3300048921 Ga0496118_0193568 Ga0496118_0193568_763_1080 105
1694 3300048921 Ga0496118_0330219 Ga0496118_0330219_457_774 105
1695 3300048922 Ga0496119_0006875 Ga0496119_0006875_4257_4574 105
1696 3300048922 Ga0496119_0079366 Ga0496119_0079366_1412_1732 105
1697 3300048922 Ga0496119_0093315 Ga0496119_0093315_604_921 105
1698 3300048922 Ga0496119_0598428 Ga0496119_0598428_132_452 105
1699 3300048923 Ga0496120_0014529 Ga0496120_0014529_1441_1758 105
1700 3300048923 Ga0496120_0070618 Ga0496120_0070618_511_828 105
1701 3300048923 Ga0496120_0141164 Ga0496120_0141164_192_512 105
1702 3300048923 Ga0496120_0240146 Ga0496120_0240146_144_464 105
1703 3300048924 Ga0496121_0017920 Ga0496121_0017920_1688_2008 105
1704 3300048924 Ga0496121_0020183 Ga0496121_0020183_5746_6066 105
1705 3300048924 Ga0496121_0037977 Ga0496121_0037977_1060_1377 105
1706 3300048924 Ga0496121_0062307 Ga0496121_0062307_1529_1849 105
1707 3300048924 Ga0496121_0079016 Ga0496121_0079016_36_356 105
1708 3300048924 Ga0496121_0101752 Ga0496121_0101752_1713_2033 105
1709 3300048924 Ga0496121_0115405 Ga0496121_0115405_1502_1822 105
1710 3300048924 Ga0496121_0126057 Ga0496121_0126057_560_877 105
1711 3300048924 Ga0496121_0348525 Ga0496121_0348525_139_459 105
1712 3300048925 Ga0496122_0240587 Ga0496122_0240587_243_560 105
1713 3300048925 Ga0496122_0610633 Ga0496122_0610633_24_341 105
1714 3300048927 Ga0496124_0314714 Ga0496124_0314714_428_748 105
1715 3300048927 Ga0496124_0346105 Ga0496124_0346105_666_983 105
1716 3300048927 Ga0496124_0504462 Ga0496124_0504462_315_632 105
1717 3300048927 Ga0496124_0649957 Ga0496124_0649957_241_561 105
1718 3300048927 Ga0496124_0844168 Ga0496124_0844168_189_509 105
1719 3300048928 Ga0496125_0065618 Ga0496125_0065618_2279_2596 105
1720 3300048928 Ga0496125_0067022 Ga0496125_0067022_2444_2764 105
1721 3300048928 Ga0496125_0076359 Ga0496125_0076359_2034_2354 105
1722 3300048928 Ga0496125_0219108 Ga0496125_0219108_339_656 105
1723 3300048929 Ga0496126_0008677 Ga0496126_0008677_4706_5026 105
1724 3300048929 Ga0496126_0009242 Ga0496126_0009242_4099_4419 105
1725 3300048929 Ga0496126_0066191 Ga0496126_0066191_877_1197 105
1726 3300048929 Ga0496126_0085099 Ga0496126_0085099_362_679 105
1727 3300048929 Ga0496126_0173025 Ga0496126_0173025_848_1168 105
1728 3300048929 Ga0496126_0235255 Ga0496126_0235255_813_1133 105
1729 3300048929 Ga0496126_0250513 Ga0496126_0250513_269_589 105
1730 3300048929 Ga0496126_0253399 Ga0496126_0253399_1028_1345 105
1731 3300048929 Ga0496126_0253675 Ga0496126_0253675_283_603 105
1732 3300048929 Ga0496126_0509312 Ga0496126_0509312_414_734 105
1733 3300048929 Ga0496126_0609042 Ga0496126_0609042_363_683 105
1734 3300048929 Ga0496126_0670837 Ga0496126_0670837_223_543 105
1735 3300048929 Ga0496126_0802403 Ga0496126_0802403_332_649 105
1736 3300048929 Ga0496126_0905716 Ga0496126_0905716_209_526 105
1737 3300048929 Ga0496126_1105214 Ga0496126_1105214_63_380 105
1738 3300049460 Ga0495682_0018342 Ga0495682_0018342_2226_2543 105
1739 3300049568 Ga0501031_0371449 Ga0501031_0371449_199_519 105
1740 3300049574 Ga0501038_0242687 Ga0501038_0242687_873_1193 105
1741 3300049574 Ga0501038_0717583 Ga0501038_0717583_204_524 105
1742 3300049575 Ga0501039_0209819 Ga0501039_0209819_156_476 105
1743 3300049576 Ga0501040_0283720 Ga0501040_0283720_148_468 105
1744 3300049577 Ga0501041_0182756 Ga0501041_0182756_907_1227 105
1745 3300049577 Ga0501041_0646236 Ga0501041_0646236_112_432 105
1746 3300049578 Ga0501042_0453703 Ga0501042_0453703_41_361 105
1747 3300049580 Ga0501046_0715063 Ga0501046_0715063_164_484 105
1748 3300049583 Ga0501067_0082667 Ga0501067_0082667_214_534 105
1749 3300049583 Ga0501067_0099416 Ga0501067_0099416_702_1022 105
1750 3300049583 Ga0501067_0174653 Ga0501067_0174653_73_390 105
1751 3300049583 Ga0501067_0282238 Ga0501067_0282238_592_912 105
1752 3300049584 Ga0501068_0799284 Ga0501068_0799284_259_579 105
1753 3300049584 Ga0501068_0848868 Ga0501068_0848868_182_499 105
1754 3300049585 Ga0501069_0104218 Ga0501069_0104218_948_1268 105
1755 3300049587 Ga0501071_1180300 Ga0501071_1180300_134_454 105
1756 3300049588 Ga0501072_0504589 Ga0501072_0504589_570_890 105
1757 3300049590 Ga0501074_0876767 Ga0501074_0876767_102_422 105
1758 3300049591 Ga0501075_0255777 Ga0501075_0255777_273_593 105
1759 3300049592 Ga0501076_0589866 Ga0501076_0589866_396_716 105
1760 3300049593 Ga0501077_0371005 Ga0501077_0371005_338_658 105
1761 3300049651 Ga0501201_053263 Ga0501201_053263_31_354 105
1762 3300050489 nmdc:mga03683_175614_c1 nmdc:mga03683_175614_c1_79_399 105
1763 3300050489 nmdc:mga03683_256197_c1 nmdc:mga03683_256197_c1_43_363 105
1764 3300050489 nmdc:mga03683_55344_c1 nmdc:mga03683_55344_c1_1072_1389 105
1765 3300050490 nmdc:mga03n38_1351_c1 nmdc:mga03n38_1351_c1_5028_5348 105
1766 3300050490 nmdc:mga03n38_364714_c1 nmdc:mga03n38_364714_c1_33_353 105
1767 3300050490 nmdc:mga03n38_405657_c1 nmdc:mga03n38_405657_c1_91_411 105
1768 3300050490 nmdc:mga03n38_44340_c1 nmdc:mga03n38_44340_c1_1544_1861 105
1769 3300050491 nmdc:mga00v17_1048259_c1 nmdc:mga00v17_1048259_c1_160_480 105
1770 3300050491 nmdc:mga00v17_109098_c1 nmdc:mga00v17_109098_c1_82_399 105
1771 3300050491 nmdc:mga00v17_4146_c1 nmdc:mga00v17_4146_c1_2755_3075 105
1772 3300050492 nmdc:mga0yw44_139702_c1 nmdc:mga0yw44_139702_c1_448_765 105
1773 3300050492 nmdc:mga0yw44_47972_c1 nmdc:mga0yw44_47972_c1_885_1202 105
1774 3300050492 nmdc:mga0yw44_5233_c1 nmdc:mga0yw44_5233_c1_3655_3975 105
1775 3300050492 nmdc:mga0yw44_539934_c1 nmdc:mga0yw44_539934_c1_108_428 105
1776 3300050492 nmdc:mga0yw44_695954_c1 nmdc:mga0yw44_695954_c1_154_471 105
1777 3300050492 nmdc:mga0yw44_721821_c1 nmdc:mga0yw44_721821_c1_247_564 105
1778 3300050492 nmdc:mga0yw44_743877_c1 nmdc:mga0yw44_743877_c1_94_414 105
1779 3300050492 nmdc:mga0yw44_99641_c1 nmdc:mga0yw44_99641_c1_1008_1325 105
1780 3300050493 nmdc:mga0k408_324890_c1 nmdc:mga0k408_324890_c1_324_644 105
1781 3300050493 nmdc:mga0k408_346439_c1 nmdc:mga0k408_346439_c1_462_782 105
1782 3300050493 nmdc:mga0k408_53785_c2 nmdc:mga0k408_53785_c2_871_1188 105
1783 3300050494 nmdc:mga06z11_207020_c1 nmdc:mga06z11_207020_c1_491_811 105
1784 3300050494 nmdc:mga06z11_220266_c1 nmdc:mga06z11_220266_c1_631_951 105
1785 3300050494 nmdc:mga06z11_608380_c1 nmdc:mga06z11_608380_c1_257_577 105
1786 3300050494 nmdc:mga06z11_61386_c1 nmdc:mga06z11_61386_c1_1121_1441 105
1787 3300050494 nmdc:mga06z11_915607_c1 nmdc:mga06z11_915607_c1_78_398 105
1788 3300050494 nmdc:mga06z11_93936_c1 nmdc:mga06z11_93936_c1_623_940 105
1789 3300050495 nmdc:mga04h51_100828_c1 nmdc:mga04h51_100828_c1_148_468 105
1790 3300050495 nmdc:mga04h51_143096_c1 nmdc:mga04h51_143096_c1_468_788 105
1791 3300050495 nmdc:mga04h51_297348_c1 nmdc:mga04h51_297348_c1_305_622 105
1792 3300050495 nmdc:mga04h51_35189_c1 nmdc:mga04h51_35189_c1_680_1000 105
1793 3300050495 nmdc:mga04h51_36493_c1 nmdc:mga04h51_36493_c1_907_1224 105
1794 3300050496 nmdc:mga07m45_171809_c1 nmdc:mga07m45_171809_c1_894_1211 105
1795 3300050496 nmdc:mga07m45_42075_c1 nmdc:mga07m45_42075_c1_2125_2445 105
1796 3300050496 nmdc:mga07m45_44129_c1 nmdc:mga07m45_44129_c1_1362_1679 105
1797 3300050496 nmdc:mga07m45_82651_c1 nmdc:mga07m45_82651_c1_1149_1469 105
1798 3300050507 nmdc:mga05p37_40049_c1 nmdc:mga05p37_40049_c1_2216_2536 105
1799 3300050508 nmdc:mga09592_496886_c1 nmdc:mga09592_496886_c1_356_676 105
1800 3300050509 nmdc:mga0qj67_778806_c1 nmdc:mga0qj67_778806_c1_420_743 105
1801 3300050511 nmdc:mga08y16_1199988_c1 nmdc:mga08y16_1199988_c1_205_534 105
1802 3300050511 nmdc:mga08y16_261869_c1 nmdc:mga08y16_261869_c1_694_1014 105
1803 3300050512 nmdc:mga0n895_1512238_c1 nmdc:mga0n895_1512238_c1_35_355 105
1804 3300050512 nmdc:mga0n895_33764_c1 nmdc:mga0n895_33764_c1_2283_2603 105
1805 3300050512 nmdc:mga0n895_454902_c1 nmdc:mga0n895_454902_c1_152_472 105
1806 3300050512 nmdc:mga0n895_476854_c1 nmdc:mga0n895_476854_c1_80_400 105
1807 3300050513 nmdc:mga0rr50_102280_c1 nmdc:mga0rr50_102280_c1_1777_2097 105
1808 3300050513 nmdc:mga0rr50_26952_c1 nmdc:mga0rr50_26952_c1_1251_1571 105
1809 3300050514 nmdc:mga08x19_1011500_c1 nmdc:mga08x19_1011500_c1_186_506 105
1810 3300050514 nmdc:mga08x19_261026_c1 nmdc:mga08x19_261026_c1_141_461 105
1811 3300050514 nmdc:mga08x19_463185_c1 nmdc:mga08x19_463185_c1_426_746 105
1812 3300050515 nmdc:mga0a205_1345428_c1 nmdc:mga0a205_1345428_c1_204_524 105
1813 3300050516 nmdc:mga0sz30_110075_c1 nmdc:mga0sz30_110075_c1_249_569 105
1814 3300050516 nmdc:mga0sz30_182077_c1 nmdc:mga0sz30_182077_c1_454_774 105
1815 3300050516 nmdc:mga0sz30_237048_c1 nmdc:mga0sz30_237048_c1_113_430 105
1816 3300050516 nmdc:mga0sz30_302959_c1 nmdc:mga0sz30_302959_c1_259_576 105
1817 3300050516 nmdc:mga0sz30_31337_c1 nmdc:mga0sz30_31337_c1_68_388 105
1818 3300050516 nmdc:mga0sz30_417251_c1 nmdc:mga0sz30_417251_c1_150_467 105
1819 3300053077 Ga0495601_0035469 Ga0495601_0035469_2175_2492 105
1820 3300053077 Ga0495601_0119683 Ga0495601_0119683_1333_1653 105
1821 3300053077 Ga0495601_0167446 Ga0495601_0167446_986_1306 105
1822 3300053077 Ga0495601_0290673 Ga0495601_0290673_177_497 105
1823 3300053077 Ga0495601_0303104 Ga0495601_0303104_638_958 105
1824 3300053077 Ga0495601_0481337 Ga0495601_0481337_327_647 105
1825 3300053078 Ga0495612_0021447 Ga0495612_0021447_2052_2372 105
1826 3300053078 Ga0495612_0026650 Ga0495612_0026650_942_1262 105
1827 3300053078 Ga0495612_0271320 Ga0495612_0271320_42_362 105
1828 3300053078 Ga0495612_0285759 Ga0495612_0285759_52_372 105
1829 3300053078 Ga0495612_0311032 Ga0495612_0311032_77_394 105
1830 3300053079 Ga0500610_0246899 Ga0500610_0246899_55_375 105
1831 3300053079 Ga0500610_0383668 Ga0500610_0383668_241_558 105
1832 3300053080 Ga0500635_0017787 Ga0500635_0017787_1596_1916 105
1833 3300053080 Ga0500635_0305917 Ga0500635_0305917_199_519 105
1834 3300053083 Ga0495655_0018190 Ga0495655_0018190_690_1010 105
1835 3300053083 Ga0495655_0144557 Ga0495655_0144557_151_468 105
1836 3300053084 Ga0495595_0009899 Ga0495595_0009899_2187_2507 105
1837 3300053084 Ga0495595_0031623 Ga0495595_0031623_1127_1447 105
1838 3300053084 Ga0495595_0477595 Ga0495595_0477595_304_624 105
1839 3300053085 Ga0495619_0022726 Ga0495619_0022726_1968_2285 105
1840 3300053085 Ga0495619_0232266 Ga0495619_0232266_833_1153 105
1841 3300053085 Ga0495619_0424691 Ga0495619_0424691_577_897 105
1842 3300053085 Ga0495619_0748151 Ga0495619_0748151_30_350 105
1843 3300053086 Ga0500578_0140992 Ga0500578_0140992_173_490 105
1844 3300053086 Ga0500578_0745454 Ga0500578_0745454_99_416 105
1845 3300053087 Ga0500643_000150 Ga0500643_000150_66311_66628 105
1846 3300053088 Ga0500644_0067878 Ga0500644_0067878_606_923 105
1847 3300053088 Ga0500644_0309256 Ga0500644_0309256_202_522 105
1848 3300053091 Ga0500647_0127758 Ga0500647_0127758_401_718 105
1849 3300053092 Ga0500583_0279806 Ga0500583_0279806_478_795 105
1850 3300053093 Ga0500651_0035391 Ga0500651_0035391_929_1249 105
1851 3300053093 Ga0500651_0592872 Ga0500651_0592872_224_541 105
1852 3300053094 Ga0500566_0000293 Ga0500566_0000293_13977_14297 105
1853 3300053094 Ga0500566_0000412 Ga0500566_0000412_13570_13887 105
1854 3300053094 Ga0500566_0338387 Ga0500566_0338387_190_507 105
1855 3300053095 Ga0500640_077058 Ga0500640_077058_599_916 105
1856 3300053096 Ga0500641_0007243 Ga0500641_0007243_3048_3368 105
1857 3300053096 Ga0500641_0009681 Ga0500641_0009681_445_765 105
1858 3300053096 Ga0500641_0034843 Ga0500641_0034843_153_473 105
1859 3300053096 Ga0500641_0104391 Ga0500641_0104391_98_415 105
1860 3300053098 Ga0500650_0064410 Ga0500650_0064410_25_345 105
1861 3300053098 Ga0500650_0245775 Ga0500650_0245775_132_449 105
1862 3300053098 Ga0500650_0310615 Ga0500650_0310615_313_633 105
1863 3300053101 Ga0500553_196389 Ga0500553_196389_52_369 105
1864 3300053102 Ga0500554_004219 Ga0500554_004219_1805_2125 105
1865 3300053102 Ga0500554_032547 Ga0500554_032547_400_720 105
1866 3300053103 Ga0500555_001186 Ga0500555_001186_7425_7742 105
1867 3300053103 Ga0500555_079476 Ga0500555_079476_157_477 105
1868 3300053104 Ga0500556_0011102 Ga0500556_0011102_1837_2154 105
1869 3300053104 Ga0500556_0288254 Ga0500556_0288254_128_448 105
1870 3300053105 Ga0500557_000062 Ga0500557_000062_39523_39840 105
1871 3300053106 Ga0500558_185678 Ga0500558_185678_125_442 105
1872 3300053108 Ga0500562_103782 Ga0500562_103782_44_364 105
1873 3300053109 Ga0500569_142289 Ga0500569_142289_175_492 105
1874 3300053109 Ga0500569_176213 Ga0500569_176213_235_552 105
1875 3300053111 Ga0500572_001006 Ga0500572_001006_2637_2957 105
1876 3300053111 Ga0500572_041328 Ga0500572_041328_487_804 105
1877 3300053118 Ga0500594_0119191 Ga0500594_0119191_413_730 105
1878 3300053118 Ga0500594_0175492 Ga0500594_0175492_13_330 105
1879 3300053118 Ga0500594_0207880 Ga0500594_0207880_277_597 105
1880 3300053119 Ga0500595_000395 Ga0500595_000395_25429_25749 105
1881 3300053119 Ga0500595_000496 Ga0500595_000496_15916_16236 105
1882 3300053119 Ga0500595_016839 Ga0500595_016839_2225_2545 105
1883 3300053119 Ga0500595_029608 Ga0500595_029608_403_723 105
1884 3300053119 Ga0500595_030732 Ga0500595_030732_43_360 105
1885 3300053119 Ga0500595_117287 Ga0500595_117287_400_723 105
1886 3300053120 Ga0500597_247483 Ga0500597_247483_324_644 105
1887 3300053121 Ga0500607_022647 Ga0500607_022647_3174_3491 105
1888 3300053121 Ga0500607_260016 Ga0500607_260016_109_426 105
1889 3300053122 Ga0500608_031229 Ga0500608_031229_1835_2152 105
1890 3300053122 Ga0500608_129309 Ga0500608_129309_438_755 105
1891 3300053123 Ga0500614_018221 Ga0500614_018221_849_1166 105
1892 3300053126 Ga0500621_258808 Ga0500621_258808_199_519 105
1893 3300053128 Ga0500626_033792 Ga0500626_033792_985_1302 105
1894 3300053130 Ga0500642_0000127 Ga0500642_0000127_21111_21428 105
1895 3300053130 Ga0500642_0042964 Ga0500642_0042964_898_1218 105
1896 3300053130 Ga0500642_0415122 Ga0500642_0415122_64_387 105
1897 3300053131 Ga0500652_040054 Ga0500652_040054_51_374 105
1898 3300053131 Ga0500652_194514 Ga0500652_194514_114_431 105
1899 3300053133 Ga0500655_011686 Ga0500655_011686_354_674 105
1900 3300053134 Ga0500658_0267966 Ga0500658_0267966_98_415 105
1901 3300053134 Ga0500658_0393663 Ga0500658_0393663_114_434 105
1902 3300053136 Ga0500559_0001342 Ga0500559_0001342_11561_11881 105
1903 3300053136 Ga0500559_0039859 Ga0500559_0039859_19_336 105
1904 3300053136 Ga0500559_0135222 Ga0500559_0135222_815_1132 105
1905 3300053136 Ga0500559_0342745 Ga0500559_0342745_336_656 105
1906 3300053137 Ga0500561_0025887 Ga0500561_0025887_391_711 105
1907 3300053138 Ga0500564_130498 Ga0500564_130498_68_385 105
1908 3300053139 Ga0500568_0288196 Ga0500568_0288196_147_464 105
1909 3300053139 Ga0500568_0292854 Ga0500568_0292854_165_482 105
1910 3300053139 Ga0500568_0345049 Ga0500568_0345049_40_360 105
1911 3300053146 Ga0500588_0065495 Ga0500588_0065495_122_442 105
1912 3300053146 Ga0500588_0292940 Ga0500588_0292940_104_421 105
1913 3300053146 Ga0500588_0393314 Ga0500588_0393314_132_455 105
1914 3300053147 Ga0500589_080197 Ga0500589_080197_478_795 105
1915 3300053148 Ga0500590_133266 Ga0500590_133266_376_693 105
1916 3300053148 Ga0500590_186072 Ga0500590_186072_353_673 105
1917 3300053150 Ga0500603_006349 Ga0500603_006349_881_1201 105
1918 3300053151 Ga0500604_0018478 Ga0500604_0018478_826_1143 105
1919 3300053153 Ga0500616_0042038 Ga0500616_0042038_1072_1389 105
1920 3300053153 Ga0500616_0087462 Ga0500616_0087462_100_420 105
1921 3300053153 Ga0500616_0145973 Ga0500616_0145973_474_797 105
1922 3300053154 Ga0500619_111911 Ga0500619_111911_184_501 105
1923 3300053155 Ga0500620_262571 Ga0500620_262571_216_533 105
1924 3300053156 Ga0500622_0062318 Ga0500622_0062318_1147_1464 105
1925 3300053156 Ga0500622_0063763 Ga0500622_0063763_761_1081 105
1926 3300053156 Ga0500622_0074084 Ga0500622_0074084_806_1126 105
1927 3300053157 Ga0500624_007439 Ga0500624_007439_862_1179 105
1928 3300053158 Ga0500627_0018363 Ga0500627_0018363_729_1046 105
1929 3300053158 Ga0500627_0026749 Ga0500627_0026749_1457_1777 105
1930 3300053158 Ga0500627_0039239 Ga0500627_0039239_1339_1659 105
1931 3300053161 Ga0500634_0209048 Ga0500634_0209048_504_824 105
1932 3300053162 Ga0500638_000370 Ga0500638_000370_7393_7713 105
1933 3300053162 Ga0500638_022359 Ga0500638_022359_1942_2259 105
1934 3300053162 Ga0500638_216215 Ga0500638_216215_117_434 105
1935 3300053162 Ga0500638_260636 Ga0500638_260636_315_635 105
1936 3300053163 Ga0500639_004522 Ga0500639_004522_4088_4408 105
1937 3300053177 Ga0500636_0000041 Ga0500636_0000041_17935_18252 105
1938 3300053177 Ga0500636_0088163 Ga0500636_0088163_856_1173 105
1939 3300053177 Ga0500636_0163495 Ga0500636_0163495_167_484 105
1940 3300053177 Ga0500636_0325885 Ga0500636_0325885_374_691 105
1941 3300053178 Ga0500637_0000026 Ga0500637_0000026_36231_36551 105
1942 3300053178 Ga0500637_0079586 Ga0500637_0079586_680_1000 105
1943 3300053178 Ga0500637_0103093 Ga0500637_0103093_580_900 105
1944 3300053178 Ga0500637_0619463 Ga0500637_0619463_71_394 105
1945 3300053725 Ga0500576_001460 Ga0500576_001460_5544_5864 105
1946 3300053727 Ga0500611_090875 Ga0500611_090875_59_379 105
1947 3300053729 Ga0500625_015049 Ga0500625_015049_2851_3168 105
1948 3300053730 Ga0500645_010714 Ga0500645_010714_2645_2962 105
1949 3300053730 Ga0500645_066730 Ga0500645_066730_613_933 105
1950 3300053731 Ga0500609_026905 Ga0500609_026905_37_354 105
1951 3300053735 Ga0500596_011400 Ga0500596_011400_372_692 105
1952 3300053736 Ga0500599_018322 Ga0500599_018322_568_885 105
1953 3300053737 Ga0500601_000306 Ga0500601_000306_1001_1318 105
1954 3300055283 Ga0500661_001127 Ga0500661_001127_197_517 105
1955 3300055283 Ga0500661_011645 Ga0500661_011645_1106_1423 105
1956 3300055283 Ga0500661_043445 Ga0500661_043445_295_612 105
1957 3300060353 Ga0501082_0404079 Ga0501082_0404079_247_567 105
1958 3300061719 Ga0466962_0026115 Ga0466962_0026115_2372_2689 105
1959 3300061734 Ga0530510_0350435 Ga0530510_0350435_143_463 105
1960 3300005436 Ga0070713_101947650 Ga0070713_1019476501 106
1961 3300005437 Ga0070710_10213194 Ga0070710_102131943 106
1962 3300005842 Ga0068858_102590619 Ga0068858_1025906192 106
1963 3300006048 Ga0075363_101056800 Ga0075363_1010568002 106
1964 3300020078 Ga0206352_10451840 Ga0206352_104518402 106
1965 3300021384 Ga0213876_10161332 Ga0213876_101613322 106
1966 3300025253 Ga0209677_105663 Ga0209677_1056634 106
1967 3300025261 Ga0209233_1056447 Ga0209233_10564472 106
1968 3300025272 Ga0209455_1015698 Ga0209455_10156983 106
1969 3300025939 Ga0207665_10596888 Ga0207665_105968883 106
1970 3300027866 Ga0209813_10259960 Ga0209813_102599602 106
1971 3300036459 Ga0372808_002915 Ga0372808_002915_1346_1669 106
1972 3300037853 Ga0436364_0231314 Ga0436364_0231314_1413_1736 106
1973 3300039437 Ga0436365_0350393 Ga0436365_0350393_236_559 106
1974 3300039437 Ga0436365_1425854 Ga0436365_1425854_1841_2164 106
1975 3300044842 Ga0466957_0402361 Ga0466957_0402361_325_648 106
1976 3300045049 Ga0466959_0238621 Ga0466959_0238621_214_537 106
1977 3300045976 Ga0466967_1065175 Ga0466967_1065175_363_686 106
1978 3300048920 Ga0496117_0174193 Ga0496117_0174193_386_709 106
1979 3300048921 Ga0496118_0009891 Ga0496118_0009891_4483_4806 106
1980 3300048924 Ga0496121_0014245 Ga0496121_0014245_3036_3359 106
1981 3300048924 Ga0496121_0048593 Ga0496121_0048593_2388_2711 106
1982 3300048924 Ga0496121_0195694 Ga0496121_0195694_826_1149 106
1983 3300048928 Ga0496125_0488082 Ga0496125_0488082_301_624 106
1984 3300048929 Ga0496126_0117860 Ga0496126_0117860_388_711 106
1985 3300048929 Ga0496126_0244448 Ga0496126_0244448_633_956 106
1986 3300048929 Ga0496126_0300360 Ga0496126_0300360_170_493 106
1987 3300053177 Ga0500636_0053870 Ga0500636_0053870_1445_1768 106
1988 3300053177 Ga0500636_0207473 Ga0500636_0207473_186_509 106
1989 3300046533 Ga0495640_0007124 Ga0495640_0007124_5893_6267 113
1990 3300026023 Ga0207677_11040851 Ga0207677_110408512 116
1991 3300041492 Ga0451835_0589013 Ga0451835_0589013_138_515 124
1992 3300001989 JGI24739J22299_10116025 JGI24739J22299_101160252 134

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08770

SoxZ

Sulphur oxidation protein SoxZ

6

102

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
2oxg-assembly4.cif.gz_E the soxyz complex of paracoccus pantotrophus 0.8846 2 104
2ox5-assembly3.cif.gz_C the soxyz complex of paracoccus pantotrophus 0.8711 2 104
2oxg-assembly3.cif.gz_C the soxyz complex of paracoccus pantotrophus 0.8704 2 103
2oxg-assembly4.cif.gz_E the soxyz complex of paracoccus pantotrophus 0.8517 2 104
2nnc-assembly1.cif.gz_A structure of the sulfur carrier protein soxy from chlorobium limicola f thiosulfatophilum 0.8258 3 104
ID Description Score Start End Superfamily
2oxgE00 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.8846 2 104 2.60.40.10
2oxgE00 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.8517 2 104 2.60.40.10
2nncA00 Mainly Beta;Sandwich;Immunoglobulin-like;SoxY domain 0.8258 3 104 2.60.40.2470
1v8hB00 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.8018 3 103 2.60.40.10
4brvA00 Mainly Beta;Sandwich;Immunoglobulin-like;SOR catalytic domain 0.7776 3 104 2.60.40.730
ID Description Score Start End GO Terms
AF-A0A6P1B118-F1-model_v4 deleted 0.9119 40 103
AF-W7QMR9-F1-model_v4 Sulphur oxidation protein SoxZ domain-containing protein 0.8988 40 103
AF-A0A2R6CSS4-F1-model_v4 CARDB domain-containing protein 0.8751 3 104
AF-A0A651FJ43-F1-model_v4 Sulfur oxidation protein 0.8693 3 104
AF-W7QMR9-F1-model_v4 Sulphur oxidation protein SoxZ domain-containing protein 0.8617 40 103

Feature Viewer

pLDDT pTM Quality
76.92 0.64 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map