F496206

General Info

Members Datasets Scaffolds Average Seq Length
1987 848 1709 354

Family's Representative Sequence

Representative Sequence 3300013104|Ga0157370_10004885|Ga0157370_100048859
Length 412
Sequence MLIFPCNAINLGKRGKLWRLIGIKLHPNMRVRPSQKQAGHAKKRPDTKETSGRQDGMASVEIRDARKAFGAVGILHGVNVGIEDGQFVVLVGPSGCGKSTLLRMIAGLENITSGEIIIGNRVVNTLPPKARDVAMVFQNYALYPHMTVADNMAFSMKLRKAPKKEIDERVQRAAAILGLGPLLGRFPRQLSGGQRQRVAMGRAIVRDPQVFLFDEPLSNLDAKLRVQMRTEIKELHQRLKTTTVYVTHDQIEAMTMADKIVVMHDGIVEQIGSPLELYDRPANLFVAGFIGSPAMNFLKGKIAPNGSASFEGPNGVKLPLGGTAPANSNGKPAIYGIRPEHFTIADDGAEAEIVVVEPTGSETQVFAKLGGEEVVAIFRERHQFNPGDKIRLKPDQRVVHLFDDATGQRLNA

Samples

Sample ID Description Type Environment
1 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
2 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
3 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
4 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
5 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
6 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
7 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
8 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
9 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
10 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
11 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
12 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
13 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
14 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
15 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
16 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
17 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
18 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
19 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
20 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
21 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
22 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
23 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
24 2523231067 Pleomorphomonas oryzae DSM 16300 Isolate Unclassified
25 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
26 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
27 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
28 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
29 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
30 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
31 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
32 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
33 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
34 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
35 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
36 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
37 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
38 2643221551 Mesorhizobium sp. Root1471 Isolate Unclassified
39 2643221555 Mesorhizobium sp. Root554 Isolate Unclassified
40 2643221591 Devosia sp. Root685 Isolate Unclassified
41 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
42 2643221618 Ensifer sp. Root231 Isolate Unclassified
43 2643221626 Ensifer sp. Root31 Isolate Unclassified
44 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
45 2643221655 Ensifer sp. Root1252 Isolate Unclassified
46 2643221659 Ensifer sp. Root127 Isolate Unclassified
47 2643221698 Ensifer sp. Root142 Isolate Unclassified
48 2643221712 Ensifer sp. Root258 Isolate Unclassified
49 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
50 2671180139 Chelativorans sp. A52C2 Isolate Unclassified
51 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
52 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
53 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
54 2738543031 Pleomorphomonas sp. CF100 Isolate Unclassified
55 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
56 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
57 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
58 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
59 2791355199
60 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
61 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
62 2802429633 Rhizobium anhuiense J3 Isolate Nodule
63 2802429634 Rhizobium anhuiense S10 Isolate Nodule
64 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
65 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
66 2802429637 Rhizobium anhuiense C15 Isolate Nodule
67 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
68 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
69 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
70 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
71 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
72 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
73 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
74 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
75 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
76 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
77 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
78 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
79 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
80 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
81 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
82 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
83 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
84 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
85 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
86 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
87 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
88 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
89 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
90 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
91 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
92 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
93 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
94 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
95 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
96 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
97 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
98 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
99 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
100 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
101 2844163670 Ensifer sp. 1H6 Isolate Unclassified
102 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
103 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
104 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
105 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
106 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
107 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
108 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
109 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
110 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
111 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
112 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
113 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
114 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
115 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
116 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
117 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
118 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
119 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
120 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
121 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
122 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
123 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
124 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
125 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
126 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
127 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
128 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
129 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
130 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
131 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
132 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
133 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
134 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
135 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
136 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
137 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
138 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
139 2904699407
140 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
141 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
142 2906610324
143 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
144 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
145 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
146 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
147 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
148 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
149 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
150 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
151 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
152 2922368715
153 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
154 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
155 2922425934
156 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
157 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
158 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
159 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
160 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
161 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
162 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
163 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
164 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
165 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
166 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
167 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
168 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
169 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
170 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
171 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
172 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
173 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
174 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
175 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
176 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
177 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
178 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
179 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
180 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
181 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
182 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
183 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
184 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
185 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
186 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
187 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
188 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
189 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
190 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
191 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
192 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
193 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
194 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
195 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
196 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
197 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
198 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
199 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
200 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
201 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
202 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
203 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
204 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
205 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
206 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
207 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
208 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
209 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
210 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
211 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
212 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
213 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
214 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
215 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
216 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
217 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
218 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
219 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
220 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
221 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
222 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
223 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
224 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
225 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
226 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
227 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
228 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
229 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
230 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
231 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
232 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
233 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
234 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
235 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
236 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
237 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
238 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
239 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
240 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
241 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
242 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
243 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
244 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
245 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
246 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
247 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
248 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
249 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
250 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
251 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
252 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
253 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
254 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
255 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
256 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
257 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
258 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
259 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
260 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
261 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
262 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
263 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
264 3300005276 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1 Metagenome Rhizosphere
265 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
266 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
267 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
268 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
269 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
270 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
271 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
272 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
273 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
274 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
275 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
276 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
277 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
278 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
279 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
280 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
281 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
282 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
283 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
284 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
285 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
286 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
287 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
288 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
289 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
290 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
291 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
292 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
293 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
294 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
295 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
296 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
297 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
298 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
299 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
300 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
301 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
302 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
303 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
304 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
305 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
306 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
307 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
308 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
309 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
310 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
311 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
312 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
313 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
314 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
315 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
316 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
317 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
318 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
319 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
320 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
321 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
322 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
323 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
324 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
325 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
326 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
327 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
328 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
329 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
330 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
331 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
332 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
333 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
334 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
335 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
336 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
337 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
338 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
339 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
340 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
341 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
342 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
343 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
344 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
345 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
346 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
347 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
348 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
349 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
350 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
351 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
352 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
353 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
354 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
355 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
356 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
357 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
358 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
359 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
360 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
361 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
362 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
363 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
364 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
365 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
366 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
367 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
368 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
369 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
370 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
371 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
372 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
373 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
374 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
375 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
376 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
377 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
378 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
379 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
380 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
381 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
382 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
383 3300012480 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.yng.040610 Metagenome Rhizosphere
384 3300012494 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 Metagenome Rhizosphere
385 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
386 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
387 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
388 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
389 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
390 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
391 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
392 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
393 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
394 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
395 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
396 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
397 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
398 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
399 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
400 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
401 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
402 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
403 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
404 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
405 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
406 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
407 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
408 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
409 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
410 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
411 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
412 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
413 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
414 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
415 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
416 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
417 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
418 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
419 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
420 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
421 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
422 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
423 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
424 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
425 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
426 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
427 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
428 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
429 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
430 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
431 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
432 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
433 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
434 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
435 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
436 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
437 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
438 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
439 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
440 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
441 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
442 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
443 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
444 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
445 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
446 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
447 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
448 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
449 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
450 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
451 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
452 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
453 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
454 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
455 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
456 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
457 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
458 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
459 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
460 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
461 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
462 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
463 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
464 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
465 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
466 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
467 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
468 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
469 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
470 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
471 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
472 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
473 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
474 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
475 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
476 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
477 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
478 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
479 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
480 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
481 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
482 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
483 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
484 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
485 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
486 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
487 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
488 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
489 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
490 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
491 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
492 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
493 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
494 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
495 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
496 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
497 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
498 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
499 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
500 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
501 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
502 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
503 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
504 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
505 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
506 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
507 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
508 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
509 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
510 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
511 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
512 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
513 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
514 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
515 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
516 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
517 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
518 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
519 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
520 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
521 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
522 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
523 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
524 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
525 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
526 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
527 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
528 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
529 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
530 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
531 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
532 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
533 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
534 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
535 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
536 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
537 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
538 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
539 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
540 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
541 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
542 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
543 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
544 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
545 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
546 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
547 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
548 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
549 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
550 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
551 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
552 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
553 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
554 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
555 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
556 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
557 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
558 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
559 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
560 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
561 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
562 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
563 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
564 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
565 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
566 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
567 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
568 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
569 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
570 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
571 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
572 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
573 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
574 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
575 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
576 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
577 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
578 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
579 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
580 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
581 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
582 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
583 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
584 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
585 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
586 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
587 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
588 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
589 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
590 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
591 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
592 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
593 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
594 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
595 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
596 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
597 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
598 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
599 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
600 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
601 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
602 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
603 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
604 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
605 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
606 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
607 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
608 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
609 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
610 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
611 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
612 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
613 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
614 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
615 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
616 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
617 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
618 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
619 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
620 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
621 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
622 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
623 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
624 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
625 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
626 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
627 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
628 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
629 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
630 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
631 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
632 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
633 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
634 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
635 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
636 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
637 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
638 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
639 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
640 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
641 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
642 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
643 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
644 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
645 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
646 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
647 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
648 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
649 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
650 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
651 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
652 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
653 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
654 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
655 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
656 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
657 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
658 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
659 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
660 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
661 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
662 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
663 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
664 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
665 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
666 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
667 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
668 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
669 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
670 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
671 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
672 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
673 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
674 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
675 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
676 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
677 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
678 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
679 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
680 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
681 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
682 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
683 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
684 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
685 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
686 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
687 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
688 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
689 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
690 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
691 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
692 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
693 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
694 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
695 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
696 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
697 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
698 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
699 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
700 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
701 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
702 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
703 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
704 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
705 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
706 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
707 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
708 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
709 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
710 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
711 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
712 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
713 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
714 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
715 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
716 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
717 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
718 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
719 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
720 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
721 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
722 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
723 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
724 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
725 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
726 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
727 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
728 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
729 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
730 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
731 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
732 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
733 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
734 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
735 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
736 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
737 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
738 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
739 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
740 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
741 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
742 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
743 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
744 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
745 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
746 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
747 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
748 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
749 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
750 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
751 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
752 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
753 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
754 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
755 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
756 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
757 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
758 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
759 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
760 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
761 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
762 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
763 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
764 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
765 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
766 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
767 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
768 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
769 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
770 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
771 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
772 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
773 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
774 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
775 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
776 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
777 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
778 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
779 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
780 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
781 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
782 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
783 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
784 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
785 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
786 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
787 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
788 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
789 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
790 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
791 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
792 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
793 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
794 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
795 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
796 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
797 3300053722 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere Metagenome Endosphere
798 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
799 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
800 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
801 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
802 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
803 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
804 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
805 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
806 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
807 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
808 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
809 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
810 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
811 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
812 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
813 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
814 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
815 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
816 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
817 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
818 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
819 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
820 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
821 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
822 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
823 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
824 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
825 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
826 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
827 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
828 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
829 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
830 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
831 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
832 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
833 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
834 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
835 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
836 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
837 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
838 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
839 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
840 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
841 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
842 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
843 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
844 8054563764 Acuticoccus kalidii M5D2P5 Isolate Unclassified
845 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
846 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
847 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
848 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 85.42
Metatranscriptomes 0.81
Isolates 13.77

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.15
Nodule 10.17
Rhizoplane 4.93
Rhizosphere 70.31
Stem 0
Stem Tuber 0
Unclassified 7.45

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 ARSoilYngRDRAFT_c00128 3300000042 Bacteria 12742
2 ARSoilOldRDRAFT_c000297 3300000044 Bacteria 6916
3 ARCol0yngRDRAFT_1000069 3300000652 Bacteria 18965
4 JGI24746J21847_1000078 3300001977 Bacteria 10426
5 JGI24740J21852_10030484 3300001979 Bacteria 1753
6 JGI24739J22299_10002225 3300001989 Bacteria 7452
7 JGI24737J22298_10001972 3300001990 Bacteria 7332
8 JGI24750J21931_1000188 3300002070 Bacteria 10321
9 JGI24745J21846_1000126 3300002073 Bacteria 5829
10 JGI24738J21930_10000068 3300002075 Bacteria 21789
11 JGI24749J21850_1000122 3300002076 Bacteria 13176
12 JGI24034J26672_10000519 3300002239 Bacteria 4969
13 JGI24742J22300_10000082 3300002244 Bacteria 13679
14 JGI25159J45721_1000210 3300002987 Bacteria 27456
15 JGI25151J46595_10000600 3300003187 Bacteria 31910
16 JGI25406J46586_10000093 3300003203 Bacteria 41100
17 JGI25406J46586_10007700 3300003203 Bacteria 4899
18 JGI25153J46596_10000462 3300003215 Bacteria 25965
19 JGI25153J46596_10002895 3300003215 Bacteria 9737
20 JGI25153J46596_10017972 3300003215 Bacteria 2764
21 JGI25160J50197_1000069 3300003354 Bacteria 112571
22 JGI25160J50197_1000323 3300003354 Bacteria 33055
23 JGI25161J50226_1000049 3300003374 Bacteria 112571
24 JGI25161J50226_1003863 3300003374 Bacteria 3284
25 Ga0007429J51699_1107255 3300003579 Bacteria 1522
26 Ga0055539_1001746 3300003752 Bacteria 3772
27 Ga0055526_1002692 3300003771 Bacteria 11838
28 Ga0055524_1000709 3300003775 Bacteria 23001
29 Ga0055536_1002798 3300003781 Bacteria 9640
30 Ga0055536_1003653 3300003781 Bacteria 8193
31 Ga0055528_1001863 3300003790 Bacteria 12011
32 Ga0055540_1004229 3300003792 Bacteria 6594
33 Ga0055540_1010264 3300003792 Bacteria 3129
34 Ga0055531_10002995 3300003794 Bacteria 10969
35 Ga0055543_1000024 3300004625 Bacteria 140022
36 Ga0055543_1000636 3300004625 Bacteria 18807
37 Ga0055543_1021435 3300004625 Bacteria 1178
38 Ga0065165_1000202 3300005262 Bacteria 103290
39 Ga0065165_1004658 3300005262 Bacteria 8306
40 Ga0065165_1005992 3300005262 Bacteria 6558
41 Ga0065717_1000293 3300005276 Bacteria 1462
42 Ga0065715_10089172 3300005293 Bacteria 13154
43 Ga0065715_10193766 3300005293 Bacteria 1392
44 Ga0070658_10063326 3300005327 Bacteria 3014
45 Ga0070676_10000363 3300005328 Bacteria 20801
46 Ga0070676_10026577 3300005328 Bacteria 3278
47 Ga0070676_10110574 3300005328 Bacteria 1710
48 Ga0070676_10138318 3300005328 Bacteria 1547
49 Ga0070683_100004718 3300005329 Bacteria 11267
50 Ga0070683_100020818 3300005329 Bacteria 5843
51 Ga0070683_100049938 3300005329 Bacteria 3870
52 Ga0070683_100078282 3300005329 Bacteria 3093
53 Ga0070683_100163207 3300005329 Bacteria 2114
54 Ga0070683_100244054 3300005329 Bacteria 1708
55 Ga0070690_100001828 3300005330 Bacteria 11279
56 Ga0070690_100015808 3300005330 Bacteria 4509
57 Ga0070690_100044913 3300005330 Bacteria 2805
58 Ga0070690_100106185 3300005330 Bacteria 1868
59 Ga0070690_100110382 3300005330 Bacteria 1835
60 Ga0070670_100000403 3300005331 Bacteria 35526
61 Ga0070670_100001134 3300005331 Bacteria 21148
62 Ga0070670_100099778 3300005331 Bacteria 2498
63 Ga0070677_10000301 3300005333 Bacteria 17280
64 Ga0070677_10000815 3300005333 Bacteria 10310
65 Ga0068869_100006712 3300005334 Bacteria 7314
66 Ga0070666_10039593 3300005335 Bacteria 3143
67 Ga0070680_100005574 3300005336 Bacteria 9532
68 Ga0070680_100014945 3300005336 Bacteria 6076
69 Ga0070680_100019341 3300005336 Bacteria 5396
70 Ga0070680_100148433 3300005336 Bacteria 1968
71 Ga0070682_100000719 3300005337 Bacteria 19838
72 Ga0070682_100001130 3300005337 Bacteria 15253
73 Ga0070682_100048011 3300005337 Bacteria 2656
74 Ga0070682_100096655 3300005337 Bacteria 1942
75 Ga0068868_100010138 3300005338 Bacteria 6809
76 Ga0068868_100013587 3300005338 Bacteria 5978
77 Ga0068868_100027002 3300005338 Bacteria 4378
78 Ga0068868_100229841 3300005338 Bacteria 1556
79 Ga0070660_100000730 3300005339 Bacteria 21778
80 Ga0070660_100006450 3300005339 Bacteria 8133
81 Ga0070660_100050497 3300005339 Bacteria 3200
82 Ga0070660_100122390 3300005339 Bacteria 2077
83 Ga0070689_100000601 3300005340 Bacteria 21783
84 Ga0070689_100025910 3300005340 Bacteria 4409
85 Ga0070689_100041110 3300005340 Bacteria 3547
86 Ga0070689_100142846 3300005340 Bacteria 1926
87 Ga0070691_10001015 3300005341 Bacteria 11523
88 Ga0070691_10017707 3300005341 Bacteria 3279
89 Ga0070691_10060361 3300005341 Bacteria 1823
90 Ga0070687_100000253 3300005343 Bacteria 18199
91 Ga0070687_100045959 3300005343 Bacteria 2233
92 Ga0070661_100003564 3300005344 Bacteria 10720
93 Ga0070661_100197315 3300005344 Bacteria 1537
94 Ga0070692_10000060 3300005345 Bacteria 21392
95 Ga0070692_10005786 3300005345 Bacteria 5315
96 Ga0070692_10032255 3300005345 Bacteria 2633
97 Ga0070668_100001851 3300005347 Bacteria 15430
98 Ga0070668_100132143 3300005347 Bacteria 2004
99 Ga0070668_100246197 3300005347 Bacteria 1482
100 Ga0070669_100000888 3300005353 Bacteria 21753
101 Ga0070669_100042856 3300005353 Bacteria 3295
102 Ga0070669_100065319 3300005353 Bacteria 2680
103 Ga0070669_100068388 3300005353 Bacteria 2622
104 Ga0070675_100000441 3300005354 Bacteria 28206
105 Ga0070675_100039312 3300005354 Bacteria 3860
106 Ga0070675_100192696 3300005354 Bacteria 1767
107 Ga0070671_100001180 3300005355 Bacteria 19534
108 Ga0070671_100007098 3300005355 Bacteria 8963
109 Ga0070671_100015695 3300005355 Bacteria 6122
110 Ga0070671_100019902 3300005355 Bacteria 5468
111 Ga0070671_100042459 3300005355 Bacteria 3780
112 Ga0070671_100044735 3300005355 Bacteria 3679
113 Ga0070671_100075870 3300005355 Bacteria 2809
114 Ga0070674_100000723 3300005356 Bacteria 16855
115 Ga0070674_100051273 3300005356 Bacteria 2843
116 Ga0070674_100052446 3300005356 Bacteria 2814
117 Ga0070674_100084906 3300005356 Bacteria 2271
118 Ga0070674_100108322 3300005356 Bacteria 2036
119 Ga0070673_100000456 3300005364 Bacteria 21637
120 Ga0070673_100014070 3300005364 Bacteria 5558
121 Ga0070673_100038037 3300005364 Bacteria 3671
122 Ga0070673_100150225 3300005364 Bacteria 1972
123 Ga0070673_100343751 3300005364 Bacteria 1323
124 Ga0070688_100000483 3300005365 Bacteria 20204
125 Ga0070688_100010309 3300005365 Bacteria 5149
126 Ga0070688_100027362 3300005365 Bacteria 3396
127 Ga0070688_100046419 3300005365 Bacteria 2690
128 Ga0070659_100001763 3300005366 Bacteria 15553
129 Ga0070659_100047189 3300005366 Bacteria 3378
130 Ga0070659_100124787 3300005366 Bacteria 2088
131 Ga0070659_100162952 3300005366 Bacteria 1824
132 Ga0070667_100004366 3300005367 Bacteria 11932
133 Ga0070667_100029031 3300005367 Bacteria 4606
134 Ga0070667_100035458 3300005367 Bacteria 4179
135 Ga0070667_100046573 3300005367 Bacteria 3648
136 Ga0070667_100114480 3300005367 Bacteria 2342
137 Ga0070667_100152500 3300005367 Bacteria 2030
138 Ga0070667_100357862 3300005367 Bacteria 1322
139 Ga0070703_10002031 3300005406 Bacteria 5916
140 Ga0070703_10013855 3300005406 Bacteria 2292
141 Ga0070709_10015742 3300005434 Bacteria 4307
142 Ga0070709_10079029 3300005434 Bacteria 2142
143 Ga0070709_10119364 3300005434 Bacteria 1785
144 Ga0070714_100019885 3300005435 Bacteria 5478
145 Ga0070714_100045925 3300005435 Bacteria 3704
146 Ga0070714_100046922 3300005435 Bacteria 3667
147 Ga0070714_100089770 3300005435 Bacteria 2691
148 Ga0070714_100123907 3300005435 Bacteria 2302
149 Ga0070713_100022697 3300005436 Bacteria 4853
150 Ga0070713_100052199 3300005436 Bacteria 3384
151 Ga0070713_100131027 3300005436 Bacteria 2211
152 Ga0070710_10000567 3300005437 Bacteria 17537
153 Ga0070710_10001957 3300005437 Bacteria 9755
154 Ga0070710_10010719 3300005437 Bacteria 4507
155 Ga0070710_10026259 3300005437 Bacteria 3092
156 Ga0070710_10030961 3300005437 Bacteria 2883
157 Ga0070710_10064128 3300005437 Bacteria 2100
158 Ga0070701_10000150 3300005438 Bacteria 21357
159 Ga0070701_10029193 3300005438 Bacteria 2718
160 Ga0070711_100000801 3300005439 Bacteria 16448
161 Ga0070711_100003646 3300005439 Bacteria 8999
162 Ga0070711_100008716 3300005439 Bacteria 6223
163 Ga0070711_100043909 3300005439 Bacteria 3030
164 Ga0070711_100053717 3300005439 Bacteria 2777
165 Ga0070711_100132478 3300005439 Bacteria 1858
166 Ga0070711_100169817 3300005439 Bacteria 1661
167 Ga0070705_100003099 3300005440 Bacteria 8178
168 Ga0070705_100150225 3300005440 Bacteria 1544
169 Ga0070700_100001083 3300005441 Bacteria 13532
170 Ga0070700_100053677 3300005441 Bacteria 2516
171 Ga0070694_100094512 3300005444 Bacteria 2103
172 Ga0070708_100013928 3300005445 Bacteria 6606
173 Ga0070708_100170803 3300005445 Bacteria 2030
174 Ga0070708_100244001 3300005445 Bacteria 1687
175 Ga0070708_100304044 3300005445 Bacteria 1502
176 Ga0070663_100001801 3300005455 Bacteria 11920
177 Ga0070663_100024121 3300005455 Bacteria 4088
178 Ga0070663_100071433 3300005455 Bacteria 2526
179 Ga0070663_100074832 3300005455 Bacteria 2473
180 Ga0070663_100090820 3300005455 Bacteria 2262
181 Ga0070663_100247118 3300005455 Bacteria 1411
182 Ga0070663_100338757 3300005455 Bacteria 1214
183 Ga0070678_100000199 3300005456 Bacteria 26434
184 Ga0070678_100028678 3300005456 Bacteria 3800
185 Ga0070678_100105370 3300005456 Bacteria 2195
186 Ga0070678_100160175 3300005456 Bacteria 1822
187 Ga0070662_100016138 3300005457 Bacteria 5011
188 Ga0070662_100103150 3300005457 Bacteria 2162
189 Ga0070662_100125536 3300005457 Bacteria 1972
190 Ga0070681_10001398 3300005458 Bacteria 21148
191 Ga0070681_10017437 3300005458 Bacteria 7177
192 Ga0070681_10061567 3300005458 Bacteria 3727
193 Ga0070681_10195720 3300005458 Bacteria 1940
194 Ga0068867_100001623 3300005459 Bacteria 15640
195 Ga0068867_100012724 3300005459 Bacteria 5953
196 Ga0068867_100085008 3300005459 Bacteria 2391
197 Ga0068867_100214950 3300005459 Bacteria 1546
198 Ga0070685_10000782 3300005466 Bacteria 17256
199 Ga0070685_10007883 3300005466 Bacteria 5455
200 Ga0070685_10015377 3300005466 Bacteria 4063
201 Ga0070685_10045926 3300005466 Bacteria 2506
202 Ga0070706_100190434 3300005467 Bacteria 1917
203 Ga0070679_100018692 3300005530 Bacteria 6727
204 Ga0070679_100028756 3300005530 Bacteria 5483
205 Ga0070679_100035744 3300005530 Bacteria 4929
206 Ga0070679_100042533 3300005530 Bacteria 4525
207 Ga0070679_100171156 3300005530 Bacteria 2145
208 Ga0070679_100231671 3300005530 Bacteria 1806
209 Ga0070684_100001802 3300005535 Bacteria 15671
210 Ga0070684_100017238 3300005535 Bacteria 5922
211 Ga0070684_100028452 3300005535 Bacteria 4728
212 Ga0070684_100036280 3300005535 Bacteria 4224
213 Ga0070684_100125269 3300005535 Bacteria 2314
214 Ga0070697_100058284 3300005536 Bacteria 3143
215 Ga0068853_100001448 3300005539 Bacteria 17189
216 Ga0068853_100002281 3300005539 Bacteria 14329
217 Ga0068853_100056883 3300005539 Bacteria 3374
218 Ga0068853_100074704 3300005539 Bacteria 2957
219 Ga0068853_100143530 3300005539 Bacteria 2144
220 Ga0068853_100284496 3300005539 Bacteria 1525
221 Ga0070672_100001622 3300005543 Bacteria 13990
222 Ga0070672_100024941 3300005543 Bacteria 4427
223 Ga0070686_100000746 3300005544 Bacteria 18847
224 Ga0070686_100004148 3300005544 Bacteria 7974
225 Ga0070686_100018778 3300005544 Bacteria 4064
226 Ga0070686_100124308 3300005544 Bacteria 1775
227 Ga0070695_100000553 3300005545 Bacteria 19808
228 Ga0070695_100033941 3300005545 Bacteria 3194
229 Ga0070696_100001299 3300005546 Bacteria 16280
230 Ga0070696_100030835 3300005546 Bacteria 3672
231 Ga0070696_100051897 3300005546 Bacteria 2852
232 Ga0070696_100158942 3300005546 Bacteria 1664
233 Ga0070693_100000613 3300005547 Bacteria 15823
234 Ga0070693_100003449 3300005547 Bacteria 7375
235 Ga0070693_100016956 3300005547 Bacteria 3778
236 Ga0070665_100022442 3300005548 Bacteria 6352
237 Ga0070665_100063622 3300005548 Bacteria 3699
238 Ga0070665_100106738 3300005548 Bacteria 2802
239 Ga0070665_100107687 3300005548 Bacteria 2789
240 Ga0070704_100000423 3300005549 Bacteria 19666
241 Ga0070704_100265590 3300005549 Bacteria 1416
242 Ga0068855_100004415 3300005563 Bacteria 17183
243 Ga0068855_100034249 3300005563 Bacteria 6059
244 Ga0068855_100098794 3300005563 Bacteria 3362
245 Ga0068855_100198832 3300005563 Bacteria 2257
246 Ga0068855_100436312 3300005563 Bacteria 1431
247 Ga0070664_100001312 3300005564 Bacteria 19866
248 Ga0070664_100024128 3300005564 Bacteria 5028
249 Ga0070664_100029501 3300005564 Bacteria 4573
250 Ga0070664_100173668 3300005564 Bacteria 1912
251 Ga0070664_100188915 3300005564 Bacteria 1835
252 Ga0068857_100007906 3300005577 Bacteria 9173
253 Ga0068857_100277970 3300005577 Bacteria 1540
254 Ga0068857_100408846 3300005577 Bacteria 1264
255 Ga0068854_100000827 3300005578 Bacteria 18476
256 Ga0068854_100141681 3300005578 Bacteria 1845
257 Ga0068854_100197451 3300005578 Bacteria 1580
258 Ga0068854_100335245 3300005578 Bacteria 1234
259 Ga0068856_100000020 3300005614 Bacteria 146775
260 Ga0068856_100001340 3300005614 Bacteria 25903
261 Ga0068852_100002288 3300005616 Bacteria 13173
262 Ga0068852_100007064 3300005616 Bacteria 8177
263 Ga0068852_100013291 3300005616 Bacteria 6297
264 Ga0068852_100024490 3300005616 Bacteria 4879
265 Ga0068852_100063539 3300005616 Bacteria 3215
266 Ga0068859_100001767 3300005617 Bacteria 21986
267 Ga0068859_100061270 3300005617 Bacteria 3791
268 Ga0068859_100070871 3300005617 Bacteria 3521
269 Ga0068859_100132349 3300005617 Bacteria 2566
270 Ga0068859_100135465 3300005617 Bacteria 2535
271 Ga0068859_100205452 3300005617 Bacteria 2055
272 Ga0068864_100003544 3300005618 Bacteria 12907
273 Ga0068864_100059172 3300005618 Bacteria 3314
274 Ga0068864_100162047 3300005618 Bacteria 2033
275 Ga0068866_10000372 3300005718 Bacteria 21128
276 Ga0068866_10022582 3300005718 Bacteria 2913
277 Ga0068861_100001202 3300005719 Bacteria 16126
278 Ga0068861_100003340 3300005719 Bacteria 10628
279 Ga0068861_100024078 3300005719 Bacteria 4399
280 Ga0068861_100093014 3300005719 Bacteria 2383
281 Ga0068851_10077448 3300005834 Bacteria 1731
282 Ga0068870_10000207 3300005840 Bacteria 21125
283 Ga0068870_10044340 3300005840 Bacteria 2323
284 Ga0068863_100003062 3300005841 Bacteria 16530
285 Ga0068863_100020579 3300005841 Bacteria 6306
286 Ga0068858_100004999 3300005842 Bacteria 12990
287 Ga0068858_100087413 3300005842 Bacteria 2899
288 Ga0068858_100307706 3300005842 Bacteria 1513
289 Ga0068860_100007079 3300005843 Bacteria 11224
290 Ga0068860_100008652 3300005843 Bacteria 10141
291 Ga0068860_100042971 3300005843 Bacteria 4313
292 Ga0068860_100050876 3300005843 Bacteria 3943
293 Ga0068860_100064769 3300005843 Bacteria 3471
294 Ga0068860_100474333 3300005843 Bacteria 1246
295 Ga0068862_100002236 3300005844 Bacteria 17352
296 Ga0068862_100032372 3300005844 Bacteria 4418
297 Ga0068862_100163998 3300005844 Bacteria 1985
298 Ga0068862_100383957 3300005844 Bacteria 1311
299 Ga0081455_10005602 3300005937 Bacteria 13727
300 Ga0081455_10006534 3300005937 Bacteria 12482
301 Ga0081455_10006892 3300005937 Bacteria 12092
302 Ga0081455_10012847 3300005937 Bacteria 8316
303 Ga0081455_10035882 3300005937 Bacteria 4422
304 Ga0081455_10121166 3300005937 Bacteria 2061
305 Ga0081538_10055740 3300005981 Bacteria 2323
306 Ga0081540_1000933 3300005983 Bacteria 26285
307 Ga0081540_1002812 3300005983 Bacteria 14092
308 Ga0081540_1005876 3300005983 Bacteria 9072
309 Ga0081540_1006330 3300005983 Bacteria 8647
310 Ga0081540_1016900 3300005983 Bacteria 4542
311 Ga0081540_1021448 3300005983 Bacteria 3845
312 Ga0081540_1029356 3300005983 Bacteria 3065
313 Ga0081539_10000140 3300005985 Bacteria 166746
314 Ga0081539_10003950 3300005985 Bacteria 17174
315 Ga0081539_10017410 3300005985 Bacteria 5048
316 Ga0081539_10026648 3300005985 Bacteria 3682
317 Ga0070717_10004566 3300006028 Bacteria 10020
318 Ga0070717_10047085 3300006028 Bacteria 3531
319 Ga0070717_10134551 3300006028 Bacteria 2128
320 Ga0070717_10292120 3300006028 Bacteria 1447
321 Ga0070717_10313860 3300006028 Bacteria 1396
322 Ga0075365_10008099 3300006038 Bacteria 5937
323 Ga0075365_10070687 3300006038 Bacteria 2348
324 Ga0075365_10076733 3300006038 Bacteria 2257
325 Ga0075365_10239829 3300006038 Bacteria 1273
326 Ga0075368_10002671 3300006042 Bacteria 5866
327 Ga0075368_10012864 3300006042 Bacteria 3064
328 Ga0075363_100002429 3300006048 Bacteria 7609
329 Ga0075363_100038616 3300006048 Bacteria 2511
330 Ga0075364_10004240 3300006051 Bacteria 8232
331 Ga0075364_10007885 3300006051 Bacteria 6341
332 Ga0070715_10070358 3300006163 Bacteria 1562
333 Ga0070716_100002662 3300006173 Bacteria 8261
334 Ga0070712_100032973 3300006175 Bacteria 3500
335 Ga0070712_100145116 3300006175 Bacteria 1815
336 Ga0070712_100162464 3300006175 Bacteria 1726
337 Ga0070712_100211177 3300006175 Bacteria 1530
338 Ga0070712_100214257 3300006175 Bacteria 1521
339 Ga0075362_10000500 3300006177 Bacteria 11446
340 Ga0075362_10012691 3300006177 Bacteria 3353
341 Ga0075367_10002117 3300006178 Bacteria 8922
342 Ga0075367_10010400 3300006178 Bacteria 4888
343 Ga0075367_10088217 3300006178 Bacteria 1885
344 Ga0075367_10142445 3300006178 Bacteria 1485
345 Ga0075369_10003007 3300006186 Bacteria 6099
346 Ga0075369_10005033 3300006186 Bacteria 4922
347 Ga0075366_10004256 3300006195 Bacteria 7676
348 Ga0075366_10016935 3300006195 Bacteria 4189
349 Ga0075366_10169765 3300006195 Bacteria 1323
350 Ga0097621_100002408 3300006237 Bacteria 12812
351 Ga0097621_100035810 3300006237 Bacteria 3967
352 Ga0097621_100037422 3300006237 Bacteria 3887
353 Ga0068871_100002267 3300006358 Bacteria 13082
354 Ga0068871_100076440 3300006358 Bacteria 2765
355 Ga0068871_100129629 3300006358 Bacteria 2137
356 Ga0075428_100019515 3300006844 Bacteria 7503
357 Ga0075428_100031362 3300006844 Bacteria 5877
358 Ga0075428_100036724 3300006844 Bacteria 5395
359 Ga0075428_100067331 3300006844 Bacteria 3920
360 Ga0075428_100321987 3300006844 Bacteria 1661
361 Ga0075430_100004728 3300006846 Bacteria 11452
362 Ga0075430_100030141 3300006846 Bacteria 4607
363 Ga0075431_100000986 3300006847 Bacteria 25337
364 Ga0075431_100007073 3300006847 Bacteria 11148
365 Ga0075431_100060543 3300006847 Bacteria 3906
366 Ga0075431_100108731 3300006847 Bacteria 2861
367 Ga0075431_100371159 3300006847 Bacteria 1436
368 Ga0075433_10025950 3300006852 Bacteria 4956
369 Ga0075433_10039549 3300006852 Bacteria 4079
370 Ga0075434_100007264 3300006871 Bacteria 10249
371 Ga0075434_100016025 3300006871 Bacteria 7201
372 Ga0075434_100029369 3300006871 Bacteria 5408
373 Ga0075434_100044598 3300006871 Bacteria 4398
374 Ga0075434_100080389 3300006871 Bacteria 3256
375 Ga0075434_100274145 3300006871 Bacteria 1706
376 Ga0075434_100520669 3300006871 Bacteria 1209
377 Ga0075429_100205242 3300006880 Bacteria 1727
378 Ga0075429_100258172 3300006880 Bacteria 1526
379 Ga0068865_100000537 3300006881 Bacteria 21125
380 Ga0068865_100003331 3300006881 Bacteria 9618
381 Ga0068865_100083233 3300006881 Bacteria 2303
382 Ga0097620_100001767 3300006931 Bacteria 21986
383 Ga0097620_100061272 3300006931 Bacteria 3791
384 Ga0097620_100070859 3300006931 Bacteria 3521
385 Ga0097620_100132356 3300006931 Bacteria 2566
386 Ga0097620_100135460 3300006931 Bacteria 2535
387 Ga0097620_100205450 3300006931 Bacteria 2055
388 Ga0099824_1018476 3300006942 Bacteria 5716
389 Ga0099822_1042608 3300006943 Bacteria 2360
390 Ga0099823_1035886 3300006944 Bacteria 3840
391 Ga0075435_100014461 3300007076 Bacteria 5899
392 Ga0075435_100024058 3300007076 Bacteria 4721
393 Ga0075435_100030713 3300007076 Bacteria 4227
394 Ga0075435_100085093 3300007076 Bacteria 2603
395 Ga0075435_100193375 3300007076 Bacteria 1723
396 Ga0075435_100218695 3300007076 Bacteria 1617
397 Ga0075435_100330204 3300007076 Bacteria 1306
398 Ga0099794_10054680 3300007265 Bacteria 1927
399 Ga0099794_10054754 3300007265 Bacteria 1926
400 Ga0105251_10037885 3300009011 Bacteria 2364
401 Ga0105240_10000013 3300009093 Bacteria 483458
402 Ga0105240_10011032 3300009093 Bacteria 12637
403 Ga0105240_10011470 3300009093 Bacteria 12342
404 Ga0105240_10222983 3300009093 Bacteria 2195
405 Ga0111539_10004508 3300009094 Bacteria 18213
406 Ga0111539_10004845 3300009094 Bacteria 17538
407 Ga0111539_10008569 3300009094 Bacteria 12982
408 Ga0111539_10010943 3300009094 Bacteria 11418
409 Ga0111539_10011182 3300009094 Bacteria 11280
410 Ga0111539_10017014 3300009094 Bacteria 8999
411 Ga0111539_10136297 3300009094 Bacteria 2875
412 Ga0105245_10000888 3300009098 Bacteria 27206
413 Ga0105245_10019909 3300009098 Bacteria 5883
414 Ga0105245_10045759 3300009098 Bacteria 3908
415 Ga0105245_10048198 3300009098 Bacteria 3811
416 Ga0105245_10072768 3300009098 Bacteria 3123
417 Ga0105245_10096894 3300009098 Bacteria 2723
418 Ga0105247_10001292 3300009101 Bacteria 18486
419 Ga0105247_10007990 3300009101 Bacteria 6464
420 Ga0105247_10030643 3300009101 Bacteria 3260
421 Ga0105247_10040354 3300009101 Bacteria 2853
422 Ga0114129_10004791 3300009147 Bacteria 19126
423 Ga0114129_10011980 3300009147 Bacteria 12334
424 Ga0114129_10014380 3300009147 Bacteria 11281
425 Ga0114129_10033315 3300009147 Bacteria 7280
426 Ga0114129_10039254 3300009147 Bacteria 6675
427 Ga0114129_10081529 3300009147 Bacteria 4497
428 Ga0114129_10084982 3300009147 Bacteria 4391
429 Ga0105243_10004521 3300009148 Bacteria 10993
430 Ga0105243_10052213 3300009148 Bacteria 3238
431 Ga0105243_10238346 3300009148 Bacteria 1618
432 Ga0105241_10000662 3300009174 Bacteria 25854
433 Ga0105241_10016979 3300009174 Bacteria 5342
434 Ga0105241_10054453 3300009174 Bacteria 3062
435 Ga0105241_10062168 3300009174 Bacteria 2878
436 Ga0105241_10179290 3300009174 Bacteria 1756
437 Ga0105242_10001202 3300009176 Bacteria 20446
438 Ga0105242_10033477 3300009176 Bacteria 4114
439 Ga0105242_10053798 3300009176 Bacteria 3288
440 Ga0105248_10000471 3300009177 Bacteria 45843
441 Ga0105248_10002336 3300009177 Bacteria 21042
442 Ga0105248_10063028 3300009177 Bacteria 4161
443 Ga0105248_10072434 3300009177 Bacteria 3872
444 Ga0105237_10007434 3300009545 Bacteria 11991
445 Ga0105237_10009082 3300009545 Bacteria 10682
446 Ga0105237_10010293 3300009545 Bacteria 9963
447 Ga0105237_10020331 3300009545 Bacteria 6847
448 Ga0105237_10053429 3300009545 Bacteria 4052
449 Ga0105237_10138222 3300009545 Bacteria 2431
450 Ga0105237_10142679 3300009545 Bacteria 2389
451 Ga0105238_10035579 3300009551 Bacteria 5062
452 Ga0105238_10044782 3300009551 Bacteria 4472
453 Ga0105238_10232571 3300009551 Bacteria 1820
454 Ga0105249_10001808 3300009553 Bacteria 18605
455 Ga0105249_10405042 3300009553 Bacteria 1395
456 Ga0105239_10014249 3300010375 Bacteria 8826
457 Ga0105239_10018370 3300010375 Bacteria 7730
458 Ga0105239_10031739 3300010375 Bacteria 5805
459 Ga0105239_10050388 3300010375 Bacteria 4567
460 Ga0105239_10056652 3300010375 Bacteria 4299
461 Ga0105239_10060609 3300010375 Bacteria 4153
462 Ga0105239_10068450 3300010375 Bacteria 3901
463 Ga0105239_10103533 3300010375 Bacteria 3151
464 Ga0105239_10133487 3300010375 Bacteria 2763
465 Ga0105239_10170978 3300010375 Bacteria 2430
466 Ga0105246_10004623 3300011119 Bacteria 8378
467 Ga0105246_10013849 3300011119 Bacteria 5062
468 Ga0105246_10240447 3300011119 Bacteria 1431
469 Ga0157346_1000487 3300012480 Bacteria 1671
470 Ga0157341_1000902 3300012494 Bacteria 1653
471 Ga0157339_1001172 3300012505 Bacteria 1544
472 Ga0157373_10011956 3300013100 Bacteria 6377
473 Ga0157371_10027329 3300013102 Bacteria 4139
474 Ga0157370_10000548 3300013104 Bacteria 46830
475 Ga0157370_10004885 3300013104 Bacteria 15203
476 Ga0157370_10030134 3300013104 Bacteria 5318
477 Ga0157370_10101270 3300013104 Bacteria 2698
478 Ga0157370_10103522 3300013104 Bacteria 2665
479 Ga0157370_10209417 3300013104 Bacteria 1807
480 Ga0157369_10016501 3300013105 Bacteria 8306
481 Ga0157369_10066123 3300013105 Bacteria 3890
482 Ga0157374_10002267 3300013296 Bacteria 16192
483 Ga0157374_10005674 3300013296 Bacteria 10522
484 Ga0157374_10030713 3300013296 Bacteria 4881
485 Ga0157374_10050875 3300013296 Bacteria 3853
486 Ga0157374_10066448 3300013296 Bacteria 3389
487 Ga0157378_10100657 3300013297 Bacteria 2639
488 Ga0163162_10006607 3300013306 Bacteria 11234
489 Ga0163162_10009182 3300013306 Bacteria 9623
490 Ga0163162_10015064 3300013306 Bacteria 7553
491 Ga0163162_10035411 3300013306 Bacteria 4973
492 Ga0163162_10284195 3300013306 Bacteria 1786
493 Ga0157372_10005926 3300013307 Bacteria 12999
494 Ga0157372_10011471 3300013307 Bacteria 9424
495 Ga0157372_10277014 3300013307 Bacteria 1950
496 Ga0157375_10001031 3300013308 Bacteria 24026
497 Ga0157375_10019981 3300013308 Bacteria 6108
498 Ga0157375_10052928 3300013308 Bacteria 3993
499 Ga0157375_10184396 3300013308 Bacteria 2240
500 Ga0157375_10189355 3300013308 Bacteria 2212
501 Ga0157375_10204719 3300013308 Bacteria 2130
502 Ga0157375_10216761 3300013308 Bacteria 2072
503 Ga0163163_10003057 3300014325 Bacteria 14159
504 Ga0163163_10003323 3300014325 Bacteria 13641
505 Ga0163163_10038122 3300014325 Bacteria 4680
506 Ga0163163_10113030 3300014325 Bacteria 2745
507 Ga0157380_10000726 3300014326 Bacteria 20528
508 Ga0157380_10005881 3300014326 Bacteria 8581
509 Ga0157380_10048489 3300014326 Bacteria 3345
510 Ga0157377_10000324 3300014745 Bacteria 21481
511 Ga0157379_10001193 3300014968 Bacteria 21154
512 Ga0157379_10013061 3300014968 Bacteria 7273
513 Ga0157379_10027074 3300014968 Bacteria 5103
514 Ga0157376_10003383 3300014969 Bacteria 10978
515 Ga0157376_10066060 3300014969 Bacteria 3056
516 Ga0157376_10209517 3300014969 Bacteria 1799
517 Ga0157376_10337305 3300014969 Bacteria 1439
518 Ga0182007_10011275 3300015262 Bacteria 3483
519 Ga0182005_1002419 3300015265 Bacteria 6679
520 Ga0163161_10001040 3300017792 Bacteria 21136
521 Ga0163161_10116279 3300017792 Bacteria 2005
522 Ga0197907_10592444 3300020069 Bacteria 2888
523 Ga0206356_10283358 3300020070 Bacteria 1841
524 Ga0206356_11623307 3300020070 Bacteria 2815
525 Ga0206355_1301277 3300020076 Bacteria 1122
526 Ga0206351_10620691 3300020077 Bacteria 1431
527 Ga0206350_10527760 3300020080 Bacteria 1845
528 Ga0206350_11111889 3300020080 Bacteria 2770
529 Ga0206353_10224996 3300020082 Bacteria 1394
530 Ga0206353_11232580 3300020082 Bacteria 1904
531 Ga0214544_1000002 3300021320 Bacteria 753857
532 Ga0214542_1000001 3300021321 Bacteria 1018696
533 Ga0214545_1000001 3300021324 Bacteria 1092817
534 Ga0214543_1000001 3300021327 Bacteria 776921
535 Ga0213876_10013313 3300021384 Bacteria 4371
536 Ga0213875_10016415 3300021388 Bacteria 3590
537 Ga0224712_10000671 3300022467 Bacteria 7045
538 Ga0224712_10006030 3300022467 Bacteria 3426
539 Ga0224712_10011398 3300022467 Bacteria 2758
540 Ga0224712_10037983 3300022467 Bacteria 1796
541 Ga0228711_1013535 3300022739 Bacteria 9546
542 Ga0228710_1013900 3300022740 Bacteria 9412
543 Ga0209563_102298 3300025230 Bacteria 4396
544 Ga0207427_101277 3300025231 Bacteria 9577
545 Ga0207425_1011256 3300025245 Bacteria 2141
546 Ga0209677_101018 3300025253 Bacteria 13392
547 Ga0209677_101344 3300025253 Bacteria 10806
548 Ga0209677_105484 3300025253 Bacteria 3295
549 Ga0209148_1000475 3300025254 Bacteria 42476
550 Ga0209129_1000367 3300025258 Bacteria 36845
551 Ga0209233_1000358 3300025261 Bacteria 41919
552 Ga0209233_1002540 3300025261 Bacteria 6665
553 Ga0209233_1010781 3300025261 Bacteria 2719
554 Ga0209233_1020784 3300025261 Bacteria 1713
555 Ga0207666_1000034 3300025271 Bacteria 28645
556 Ga0209455_1001935 3300025272 Bacteria 8555
557 Ga0209673_1000872 3300025273 Bacteria 39153
558 Ga0209130_1000013 3300025284 Bacteria 412810
559 Ga0207673_1000073 3300025290 Bacteria 8700
560 Ga0209676_1000580 3300025292 Bacteria 55127
561 Ga0209676_1005236 3300025292 Bacteria 6871
562 Ga0209025_1000228 3300025294 Bacteria 132088
563 Ga0209564_1000763 3300025295 Bacteria 45281
564 Ga0209564_1010443 3300025295 Bacteria 4275
565 Ga0209758_1000113 3300025297 Bacteria 202528
566 Ga0209758_1000684 3300025297 Bacteria 50528
567 Ga0209758_1001509 3300025297 Bacteria 27022
568 Ga0209758_1001768 3300025297 Bacteria 23963
569 Ga0209758_1003468 3300025297 Bacteria 14294
570 Ga0209758_1007908 3300025297 Bacteria 7058
571 Ga0209758_1030049 3300025297 Bacteria 2257
572 Ga0209050_1011385 3300025298 Bacteria 4226
573 Ga0209050_1027177 3300025298 Bacteria 1893
574 Ga0209256_1001449 3300025299 Bacteria 24483
575 Ga0209256_1006564 3300025299 Bacteria 6103
576 Ga0207426_1000022 3300025302 Bacteria 547377
577 Ga0207426_1000307 3300025302 Bacteria 96085
578 Ga0207426_1000855 3300025302 Bacteria 32019
579 Ga0207426_1013721 3300025302 Bacteria 2990
580 Ga0209051_1004819 3300025303 Bacteria 8127
581 Ga0209257_1001372 3300025304 Bacteria 29358
582 Ga0209257_1001932 3300025304 Bacteria 22369
583 Ga0207697_10000280 3300025315 Bacteria 28276
584 Ga0207656_10068821 3300025321 Bacteria 1570
585 Ga0207656_10092070 3300025321 Bacteria 1378
586 Ga0207653_10001427 3300025885 Bacteria 7746
587 Ga0207682_10000134 3300025893 Bacteria 33520
588 Ga0207682_10001129 3300025893 Bacteria 12342
589 Ga0207682_10002016 3300025893 Bacteria 9198
590 Ga0207692_10002168 3300025898 Bacteria 7504
591 Ga0207692_10002762 3300025898 Bacteria 6763
592 Ga0207692_10009738 3300025898 Bacteria 4024
593 Ga0207692_10142815 3300025898 Bacteria 1363
594 Ga0207642_10008502 3300025899 Bacteria 3525
595 Ga0207642_10083998 3300025899 Bacteria 1554
596 Ga0207710_10001541 3300025900 Bacteria 11350
597 Ga0207710_10006028 3300025900 Bacteria 5195
598 Ga0207710_10027029 3300025900 Bacteria 2482
599 Ga0207710_10032588 3300025900 Bacteria 2283
600 Ga0207688_10000526 3300025901 Bacteria 18554
601 Ga0207688_10000663 3300025901 Bacteria 16993
602 Ga0207688_10028561 3300025901 Bacteria 3068
603 Ga0207688_10095742 3300025901 Bacteria 1709
604 Ga0207688_10112576 3300025901 Bacteria 1581
605 Ga0207680_10037146 3300025903 Bacteria 2810
606 Ga0207647_10003350 3300025904 Bacteria 12019
607 Ga0207647_10007263 3300025904 Bacteria 8019
608 Ga0207647_10011872 3300025904 Bacteria 6086
609 Ga0207685_10008122 3300025905 Bacteria 2969
610 Ga0207699_10000508 3300025906 Bacteria 19334
611 Ga0207699_10024497 3300025906 Bacteria 3301
612 Ga0207699_10025852 3300025906 Bacteria 3229
613 Ga0207699_10049502 3300025906 Bacteria 2474
614 Ga0207645_10001617 3300025907 Bacteria 18370
615 Ga0207645_10023769 3300025907 Bacteria 3979
616 Ga0207645_10030200 3300025907 Bacteria 3492
617 Ga0207643_10000756 3300025908 Bacteria 19870
618 Ga0207643_10000808 3300025908 Bacteria 19021
619 Ga0207643_10072110 3300025908 Bacteria 1989
620 Ga0207684_10002166 3300025910 Bacteria 20113
621 Ga0207654_10011329 3300025911 Bacteria 4550
622 Ga0207654_10061692 3300025911 Bacteria 2194
623 Ga0207654_10067398 3300025911 Bacteria 2114
624 Ga0207654_10068775 3300025911 Bacteria 2096
625 Ga0207707_10000359 3300025912 Bacteria 47942
626 Ga0207707_10001961 3300025912 Bacteria 18703
627 Ga0207707_10002112 3300025912 Bacteria 17984
628 Ga0207707_10003260 3300025912 Bacteria 14418
629 Ga0207707_10003603 3300025912 Bacteria 13734
630 Ga0207695_10000008 3300025913 Bacteria 1058268
631 Ga0207695_10000044 3300025913 Bacteria 440819
632 Ga0207695_10113902 3300025913 Bacteria 2680
633 Ga0207695_10126627 3300025913 Bacteria 2515
634 Ga0207671_10006361 3300025914 Bacteria 10531
635 Ga0207671_10010828 3300025914 Bacteria 7480
636 Ga0207671_10030827 3300025914 Bacteria 3997
637 Ga0207671_10031017 3300025914 Bacteria 3985
638 Ga0207671_10036337 3300025914 Bacteria 3653
639 Ga0207671_10084264 3300025914 Bacteria 2387
640 Ga0207671_10092604 3300025914 Bacteria 2279
641 Ga0207693_10000581 3300025915 Bacteria 32715
642 Ga0207693_10002467 3300025915 Bacteria 16076
643 Ga0207693_10030563 3300025915 Bacteria 4255
644 Ga0207693_10032713 3300025915 Bacteria 4104
645 Ga0207693_10039890 3300025915 Bacteria 3698
646 Ga0207693_10071283 3300025915 Bacteria 2719
647 Ga0207693_10116468 3300025915 Bacteria 2098
648 Ga0207663_10000084 3300025916 Bacteria 44454
649 Ga0207663_10040483 3300025916 Bacteria 2833
650 Ga0207663_10044561 3300025916 Bacteria 2724
651 Ga0207663_10211677 3300025916 Bacteria 1405
652 Ga0207663_10214559 3300025916 Bacteria 1397
653 Ga0207660_10001335 3300025917 Bacteria 16500
654 Ga0207660_10008111 3300025917 Bacteria 6793
655 Ga0207660_10013662 3300025917 Bacteria 5325
656 Ga0207660_10044293 3300025917 Bacteria 3130
657 Ga0207660_10047556 3300025917 Bacteria 3033
658 Ga0207660_10078384 3300025917 Bacteria 2421
659 Ga0207660_10242940 3300025917 Bacteria 1419
660 Ga0207662_10000341 3300025918 Bacteria 21083
661 Ga0207662_10007966 3300025918 Bacteria 5773
662 Ga0207662_10055341 3300025918 Bacteria 2367
663 Ga0207657_10002888 3300025919 Bacteria 18459
664 Ga0207657_10012009 3300025919 Bacteria 8567
665 Ga0207657_10018566 3300025919 Bacteria 6631
666 Ga0207657_10021585 3300025919 Bacteria 6055
667 Ga0207657_10022947 3300025919 Bacteria 5823
668 Ga0207657_10054672 3300025919 Bacteria 3451
669 Ga0207649_10000271 3300025920 Bacteria 40924
670 Ga0207649_10195265 3300025920 Bacteria 1426
671 Ga0207649_10286747 3300025920 Bacteria 1199
672 Ga0207652_10001830 3300025921 Bacteria 18431
673 Ga0207652_10001857 3300025921 Bacteria 18344
674 Ga0207652_10019118 3300025921 Bacteria 5629
675 Ga0207652_10034193 3300025921 Bacteria 4282
676 Ga0207652_10047300 3300025921 Bacteria 3674
677 Ga0207652_10064689 3300025921 Bacteria 3165
678 Ga0207652_10085656 3300025921 Bacteria 2762
679 Ga0207652_10134157 3300025921 Bacteria 2210
680 Ga0207652_10141779 3300025921 Bacteria 2149
681 Ga0207652_10198169 3300025921 Bacteria 1807
682 Ga0207646_10140901 3300025922 Bacteria 2171
683 Ga0207681_10000658 3300025923 Bacteria 22886
684 Ga0207681_10067166 3300025923 Bacteria 2485
685 Ga0207681_10212643 3300025923 Bacteria 1491
686 Ga0207694_10019649 3300025924 Bacteria 5110
687 Ga0207694_10065256 3300025924 Bacteria 2838
688 Ga0207694_10077851 3300025924 Bacteria 2599
689 Ga0207694_10208429 3300025924 Bacteria 1592
690 Ga0207694_10309219 3300025924 Bacteria 1302
691 Ga0207650_10000408 3300025925 Bacteria 38515
692 Ga0207650_10296655 3300025925 Bacteria 1319
693 Ga0207650_10301547 3300025925 Bacteria 1308
694 Ga0207659_10000177 3300025926 Bacteria 38217
695 Ga0207659_10000256 3300025926 Bacteria 32624
696 Ga0207659_10023619 3300025926 Bacteria 4106
697 Ga0207687_10000495 3300025927 Bacteria 26551
698 Ga0207687_10006623 3300025927 Bacteria 7642
699 Ga0207687_10013921 3300025927 Bacteria 5256
700 Ga0207687_10027876 3300025927 Bacteria 3792
701 Ga0207687_10029353 3300025927 Bacteria 3699
702 Ga0207687_10160216 3300025927 Bacteria 1726
703 Ga0207687_10344897 3300025927 Bacteria 1212
704 Ga0207700_10018872 3300025928 Bacteria 4646
705 Ga0207700_10030543 3300025928 Bacteria 3818
706 Ga0207700_10090460 3300025928 Bacteria 2415
707 Ga0207700_10133971 3300025928 Bacteria 2027
708 Ga0207700_10215152 3300025928 Bacteria 1626
709 Ga0207664_10024979 3300025929 Bacteria 4494
710 Ga0207664_10107250 3300025929 Bacteria 2317
711 Ga0207664_10191702 3300025929 Bacteria 1760
712 Ga0207644_10000279 3300025931 Bacteria 33969
713 Ga0207644_10014331 3300025931 Bacteria 5303
714 Ga0207644_10015516 3300025931 Bacteria 5115
715 Ga0207644_10029940 3300025931 Bacteria 3780
716 Ga0207644_10074660 3300025931 Bacteria 2489
717 Ga0207644_10128507 3300025931 Bacteria 1937
718 Ga0207644_10278256 3300025931 Bacteria 1343
719 Ga0207690_10001557 3300025932 Bacteria 14369
720 Ga0207690_10006785 3300025932 Bacteria 6789
721 Ga0207690_10008986 3300025932 Bacteria 5930
722 Ga0207706_10005939 3300025933 Bacteria 11357
723 Ga0207706_10007308 3300025933 Bacteria 10214
724 Ga0207706_10012772 3300025933 Bacteria 7645
725 Ga0207706_10041280 3300025933 Bacteria 4090
726 Ga0207706_10053602 3300025933 Bacteria 3560
727 Ga0207706_10065929 3300025933 Bacteria 3187
728 Ga0207706_10092877 3300025933 Bacteria 2654
729 Ga0207706_10102247 3300025933 Bacteria 2521
730 Ga0207686_10001383 3300025934 Bacteria 13773
731 Ga0207686_10052401 3300025934 Bacteria 2546
732 Ga0207686_10073324 3300025934 Bacteria 2208
733 Ga0207709_10000952 3300025935 Bacteria 21659
734 Ga0207670_10000491 3300025936 Bacteria 21793
735 Ga0207670_10062155 3300025936 Bacteria 2551
736 Ga0207670_10273891 3300025936 Bacteria 1313
737 Ga0207669_10000649 3300025937 Bacteria 15064
738 Ga0207669_10021526 3300025937 Bacteria 3406
739 Ga0207669_10177271 3300025937 Bacteria 1524
740 Ga0207669_10367063 3300025937 Bacteria 1117
741 Ga0207704_10001342 3300025938 Bacteria 10974
742 Ga0207704_10006681 3300025938 Bacteria 5403
743 Ga0207665_10002422 3300025939 Bacteria 12617
744 Ga0207665_10003511 3300025939 Bacteria 10469
745 Ga0207665_10004210 3300025939 Bacteria 9576
746 Ga0207665_10043152 3300025939 Bacteria 3015
747 Ga0207691_10000360 3300025940 Bacteria 45895
748 Ga0207691_10002815 3300025940 Bacteria 16961
749 Ga0207691_10011566 3300025940 Bacteria 8473
750 Ga0207691_10039366 3300025940 Bacteria 4374
751 Ga0207691_10054159 3300025940 Bacteria 3660
752 Ga0207711_10001570 3300025941 Bacteria 21117
753 Ga0207711_10009143 3300025941 Bacteria 8276
754 Ga0207711_10016743 3300025941 Bacteria 6088
755 Ga0207711_10021793 3300025941 Bacteria 5351
756 Ga0207711_10068152 3300025941 Bacteria 3081
757 Ga0207689_10002449 3300025942 Bacteria 17292
758 Ga0207689_10057982 3300025942 Bacteria 3185
759 Ga0207661_10000642 3300025944 Bacteria 22523
760 Ga0207661_10003486 3300025944 Bacteria 10927
761 Ga0207661_10012908 3300025944 Bacteria 6091
762 Ga0207661_10017816 3300025944 Bacteria 5264
763 Ga0207679_10000046 3300025945 Bacteria 119975
764 Ga0207679_10028026 3300025945 Bacteria 3904
765 Ga0207679_10225010 3300025945 Bacteria 1580
766 Ga0207667_10007962 3300025949 Bacteria 12641
767 Ga0207667_10013915 3300025949 Bacteria 9192
768 Ga0207667_10017447 3300025949 Bacteria 8076
769 Ga0207667_10040700 3300025949 Bacteria 4948
770 Ga0207667_10184243 3300025949 Bacteria 2144
771 Ga0207667_10380115 3300025949 Bacteria 1439
772 Ga0207651_10000214 3300025960 Bacteria 24891
773 Ga0207651_10035381 3300025960 Bacteria 3247
774 Ga0207651_10056778 3300025960 Bacteria 2696
775 Ga0207651_10068414 3300025960 Bacteria 2504
776 Ga0207651_10082135 3300025960 Bacteria 2325
777 Ga0207712_10003297 3300025961 Bacteria 10236
778 Ga0207712_10121130 3300025961 Bacteria 1980
779 Ga0207712_10171984 3300025961 Bacteria 1694
780 Ga0207712_10176649 3300025961 Bacteria 1674
781 Ga0207668_10000537 3300025972 Bacteria 23803
782 Ga0207668_10026242 3300025972 Bacteria 3780
783 Ga0207668_10064228 3300025972 Bacteria 2593
784 Ga0207640_10000765 3300025981 Bacteria 18401
785 Ga0207640_10073819 3300025981 Bacteria 2306
786 Ga0207658_10001147 3300025986 Bacteria 21223
787 Ga0207658_10114269 3300025986 Bacteria 2140
788 Ga0207677_10003377 3300026023 Bacteria 8450
789 Ga0207677_10023214 3300026023 Bacteria 3826
790 Ga0207677_10043687 3300026023 Bacteria 2981
791 Ga0207677_10165636 3300026023 Bacteria 1722
792 Ga0207703_10000940 3300026035 Bacteria 28248
793 Ga0207703_10104329 3300026035 Bacteria 2408
794 Ga0207703_10128879 3300026035 Bacteria 2182
795 Ga0207703_10178802 3300026035 Bacteria 1871
796 Ga0207639_10000852 3300026041 Bacteria 20713
797 Ga0207639_10038053 3300026041 Bacteria 3576
798 Ga0207639_10105528 3300026041 Bacteria 2286
799 Ga0207639_10136104 3300026041 Bacteria 2040
800 Ga0207639_10343701 3300026041 Bacteria 1331
801 Ga0207678_10002525 3300026067 Bacteria 16674
802 Ga0207678_10011036 3300026067 Bacteria 7935
803 Ga0207678_10021682 3300026067 Bacteria 5634
804 Ga0207678_10024738 3300026067 Bacteria 5243
805 Ga0207678_10105768 3300026067 Bacteria 2401
806 Ga0207678_10154890 3300026067 Bacteria 1956
807 Ga0207708_10001006 3300026075 Bacteria 21086
808 Ga0207708_10005549 3300026075 Bacteria 9308
809 Ga0207708_10017098 3300026075 Bacteria 5459
810 Ga0207702_10000126 3300026078 Bacteria 90550
811 Ga0207702_10002642 3300026078 Bacteria 16821
812 Ga0207641_10001370 3300026088 Bacteria 24094
813 Ga0207641_10139531 3300026088 Bacteria 2185
814 Ga0207641_10149185 3300026088 Bacteria 2116
815 Ga0207648_10002036 3300026089 Bacteria 22064
816 Ga0207648_10002249 3300026089 Bacteria 20879
817 Ga0207648_10013101 3300026089 Bacteria 7732
818 Ga0207648_10016754 3300026089 Bacteria 6685
819 Ga0207648_10021939 3300026089 Bacteria 5737
820 Ga0207648_10023261 3300026089 Bacteria 5557
821 Ga0207648_10050432 3300026089 Bacteria 3639
822 Ga0207676_10004314 3300026095 Bacteria 10058
823 Ga0207676_10008222 3300026095 Bacteria 7425
824 Ga0207676_10024360 3300026095 Bacteria 4477
825 Ga0207676_10104391 3300026095 Bacteria 2357
826 Ga0207674_10002956 3300026116 Bacteria 21106
827 Ga0207674_10037457 3300026116 Bacteria 5044
828 Ga0207674_10045708 3300026116 Bacteria 4501
829 Ga0207674_10147506 3300026116 Bacteria 2310
830 Ga0207675_100006209 3300026118 Bacteria 11346
831 Ga0207675_100019635 3300026118 Bacteria 6308
832 Ga0207675_100020315 3300026118 Bacteria 6193
833 Ga0207675_100034484 3300026118 Bacteria 4719
834 Ga0207683_10001099 3300026121 Bacteria 24626
835 Ga0207683_10001904 3300026121 Bacteria 18455
836 Ga0207683_10002624 3300026121 Bacteria 15706
837 Ga0207683_10003821 3300026121 Bacteria 13050
838 Ga0207683_10004971 3300026121 Bacteria 11437
839 Ga0207683_10014537 3300026121 Bacteria 6705
840 Ga0207683_10250912 3300026121 Bacteria 1615
841 Ga0207683_10270064 3300026121 Bacteria 1553
842 Ga0207698_10001980 3300026142 Bacteria 12051
843 Ga0207698_10014902 3300026142 Bacteria 5187
844 Ga0209389_1000040 3300027296 Bacteria 124256
845 Ga0209389_1000123 3300027296 Bacteria 70041
846 Ga0209589_1000001 3300027357 Bacteria 794224
847 Ga0209589_1000036 3300027357 Bacteria 131278
848 Ga0209489_100001 3300027361 Bacteria 794224
849 Ga0209489_100006 3300027361 Bacteria 475698
850 Ga0209489_111662 3300027361 Bacteria 8752
851 Ga0209700_100001 3300027363 Bacteria 794224
852 Ga0209700_100005 3300027363 Bacteria 573969
853 Ga0209999_1020773 3300027543 Bacteria 1206
854 Ga0209983_1006861 3300027665 Bacteria 2336
855 Ga0209588_1014733 3300027671 Bacteria 2398
856 Ga0209974_10000502 3300027876 Bacteria 13050
857 Ga0209974_10036492 3300027876 Bacteria 1632
858 Ga0207428_10002104 3300027907 Bacteria 20069
859 Ga0207428_10002830 3300027907 Bacteria 17218
860 Ga0207428_10002977 3300027907 Bacteria 16750
861 Ga0207428_10005357 3300027907 Bacteria 11969
862 Ga0207428_10027000 3300027907 Bacteria 4783
863 Ga0207428_10061970 3300027907 Bacteria 2958
864 Ga0207428_10182071 3300027907 Bacteria 1587
865 Ga0268266_10019214 3300028379 Bacteria 5819
866 Ga0268266_10020054 3300028379 Bacteria 5698
867 Ga0268266_10038195 3300028379 Bacteria 4088
868 Ga0268266_10042402 3300028379 Bacteria 3886
869 Ga0268266_10048955 3300028379 Bacteria 3623
870 Ga0268266_10092365 3300028379 Bacteria 2655
871 Ga0268266_10132847 3300028379 Bacteria 2227
872 Ga0268265_10000817 3300028380 Bacteria 29538
873 Ga0268265_10009900 3300028380 Bacteria 6441
874 Ga0268265_10079471 3300028380 Bacteria 2583
875 Ga0268265_10120271 3300028380 Bacteria 2162
876 Ga0268264_10000065 3300028381 Bacteria 298403
877 Ga0268264_10001227 3300028381 Bacteria 24655
878 Ga0268264_10024308 3300028381 Bacteria 4947
879 Ga0265337_1002708 3300028556 Bacteria 7954
880 Ga0265326_10010670 3300028558 Bacteria 2723
881 Ga0265319_1004129 3300028563 Bacteria 7301
882 Ga0265334_10001756 3300028573 Bacteria 10354
883 Ga0265334_10042944 3300028573 Bacteria 1761
884 Ga0265318_10040378 3300028577 Bacteria 1776
885 Ga0265323_10001892 3300028653 Bacteria 9875
886 Ga0265336_10003392 3300028666 Bacteria 6258
887 Ga0307517_10000008 3300028786 Bacteria 243202
888 Ga0307515_10000950 3300028794 Bacteria 66308
889 Ga0307515_10026041 3300028794 Bacteria 10090
890 Ga0265338_10000092 3300028800 Bacteria 168538
891 Ga0265338_10000321 3300028800 Bacteria 87046
892 Ga0265324_10019180 3300029957 Bacteria 2465
893 Ga0265330_10037973 3300031235 Bacteria 2141
894 Ga0265325_10000675 3300031241 Bacteria 24875
895 Ga0265325_10010821 3300031241 Bacteria 5262
896 Ga0265325_10030264 3300031241 Bacteria 2904
897 Ga0265325_10042198 3300031241 Bacteria 2386
898 Ga0265325_10044311 3300031241 Bacteria 2317
899 Ga0265329_10018732 3300031242 Bacteria 2361
900 Ga0265340_10005245 3300031247 Bacteria 7193
901 Ga0265340_10008853 3300031247 Bacteria 5422
902 Ga0265339_10030325 3300031249 Bacteria 3062
903 Ga0265331_10023016 3300031250 Bacteria 3171
904 Ga0265331_10037975 3300031250 Bacteria 2356
905 Ga0265331_10075329 3300031250 Bacteria 1574
906 Ga0265316_10015085 3300031344 Bacteria 6771
907 Ga0265316_10032664 3300031344 Bacteria 4246
908 Ga0265316_10116788 3300031344 Bacteria 2017
909 Ga0307513_10070981 3300031456 Bacteria 3637
910 Ga0307408_100068810 3300031548 Bacteria 2608
911 Ga0265313_10020638 3300031595 Bacteria 3629
912 Ga0265313_10030488 3300031595 Bacteria 2776
913 Ga0265313_10039966 3300031595 Bacteria 2322
914 Ga0307508_10000018 3300031616 Bacteria 202701
915 Ga0307508_10021377 3300031616 Bacteria 5883
916 Ga0307508_10189556 3300031616 Bacteria 1658
917 Ga0307508_10212892 3300031616 Bacteria 1533
918 Ga0265314_10004715 3300031711 Bacteria 12517
919 Ga0265314_10009137 3300031711 Bacteria 8412
920 Ga0265314_10011261 3300031711 Bacteria 7398
921 Ga0265314_10021648 3300031711 Bacteria 4937
922 Ga0265342_10011538 3300031712 Bacteria 6039
923 Ga0265342_10017129 3300031712 Bacteria 4719
924 Ga0265342_10075603 3300031712 Bacteria 1954
925 Ga0316576_10151946 3300031727 Bacteria 1745
926 Ga0307516_10014561 3300031730 Bacteria 8313
927 Ga0307516_10063808 3300031730 Bacteria 3565
928 Ga0307516_10068079 3300031730 Bacteria 3429
929 Ga0307405_10058956 3300031731 Bacteria 2418
930 Ga0316577_10005660 3300031733 Bacteria 6558
931 Ga0316577_10083912 3300031733 Bacteria 1782
932 Ga0307410_10027386 3300031852 Bacteria 3603
933 Ga0307406_10004966 3300031901 Bacteria 7246
934 Ga0307406_10118811 3300031901 Bacteria 1834
935 Ga0307412_10011920 3300031911 Bacteria 5048
936 Ga0307412_10055365 3300031911 Bacteria 2638
937 Ga0307409_100067274 3300031995 Bacteria 2829
938 Ga0307409_100103111 3300031995 Bacteria 2372
939 Ga0307409_100159904 3300031995 Bacteria 1968
940 Ga0307416_100040802 3300032002 Bacteria 3610
941 Ga0307416_100449178 3300032002 Bacteria 1341
942 Ga0307414_10014216 3300032004 Bacteria 4763
943 Ga0307411_10015181 3300032005 Bacteria 4317
944 Ga0316593_10032743 3300032168 Bacteria 1699
945 Ga0307510_10008141 3300033180 Bacteria 12485
946 Ga0307510_10026470 3300033180 Bacteria 6665
947 Ga0315911_1000006 3300033442 Bacteria 414563
948 Ga0373930_0000266 3300034816 Bacteria 6666
949 Ga0373930_0001442 3300034816 Bacteria 3537
950 Ga0373948_0000471 3300034817 Bacteria 5018
951 Ga0373950_0000324 3300034818 Bacteria 5986
952 Ga0373958_0000451 3300034819 Bacteria 5021
953 Ga0373959_0000553 3300034820 Bacteria 6642
954 Ga0373938_0000348 3300034957 Bacteria 7337
955 Ga0373938_0006862 3300034957 Bacteria 1984
956 Ga0373926_0002868 3300035083 Bacteria 5523
957 Ga0373928_0001853 3300035084 Bacteria 4124
958 Ga0373929_0000456 3300035085 Bacteria 7768
959 Ga0373929_0004977 3300035085 Bacteria 2383
960 Ga0373940_0001082 3300035088 Bacteria 4724
961 Ga0373940_0003271 3300035088 Bacteria 3283
962 Ga0373944_0017321 3300035089 Bacteria 2044
963 Ga0373949_0002643 3300035090 Bacteria 4522
964 Ga0373949_0004203 3300035090 Bacteria 3325
965 Ga0373949_0005479 3300035090 Bacteria 2829
966 Ga0373951_0001125 3300035091 Bacteria 7115
967 Ga0373951_0001619 3300035091 Bacteria 5914
968 Ga0373951_0023787 3300035091 Bacteria 1416
969 Ga0373952_0000133 3300035092 Bacteria 10703
970 Ga0373923_0029874 3300035111 Bacteria 2188
971 Ga0373923_0031183 3300035111 Bacteria 2147
972 Ga0373923_0047617 3300035111 Bacteria 1787
973 Ga0373932_0000703 3300035112 Bacteria 10116
974 Ga0373932_0001964 3300035112 Bacteria 5434
975 Ga0373932_0056793 3300035112 Bacteria 1178
976 Ga0373936_0007505 3300035113 Bacteria 4101
977 Ga0373936_0028149 3300035113 Bacteria 2208
978 Ga0373936_0028822 3300035113 Bacteria 2184
979 Ga0373936_0048196 3300035113 Bacteria 1719
980 Ga0373936_0050055 3300035113 Bacteria 1689
981 Ga0373939_0000343 3300035114 Bacteria 11867
982 Ga0373939_0005408 3300035114 Bacteria 3041
983 Ga0373941_0001154 3300035115 Bacteria 5508
984 Ga0373941_0002185 3300035115 Bacteria 4269
985 Ga0373941_0003006 3300035115 Bacteria 3776
986 Ga0373945_0004512 3300035116 Bacteria 4424
987 Ga0373953_0012229 3300035117 Bacteria 3035
988 Ga0373954_0002285 3300035118 Bacteria 7983
989 Ga0373954_0003393 3300035118 Bacteria 6745
990 Ga0373954_0005654 3300035118 Bacteria 5418
991 Ga0373954_0022517 3300035118 Bacteria 2859
992 Ga0373956_0002225 3300035119 Bacteria 7993
993 Ga0373956_0021669 3300035119 Bacteria 2742
994 Ga0373956_0072905 3300035119 Bacteria 1568
995 Ga0373957_0002536 3300035120 Bacteria 5231
996 Ga0373957_0009639 3300035120 Bacteria 3165
997 Ga0373957_0010237 3300035120 Bacteria 3093
998 Ga0373960_0002057 3300035121 Bacteria 4526
999 Ga0373960_0002646 3300035121 Bacteria 4050
1000 Ga0373943_0002714 3300035170 Bacteria 8040
1001 Ga0373943_0005039 3300035170 Bacteria 5958
1002 Ga0373943_0008492 3300035170 Bacteria 4606
1003 Ga0373943_0016526 3300035170 Bacteria 3366
1004 Ga0373946_0041554 3300035171 Bacteria 1886
1005 Ga0373955_0001765 3300035172 Bacteria 9276
1006 Ga0373955_0027293 3300035172 Bacteria 2949
1007 Ga0373955_0027657 3300035172 Bacteria 2934
1008 Ga0373955_0069280 3300035172 Bacteria 1967
1009 Ga0373942_0001912 3300035207 Bacteria 5225
1010 Ga0373942_0005068 3300035207 Bacteria 3056
1011 Ga0373961_0004534 3300035241 Bacteria 3357
1012 Ga0373961_0026679 3300035241 Bacteria 1580
1013 Ga0373962_0000253 3300035242 Bacteria 11386
1014 Ga0373924_0005148 3300035410 Bacteria 4615
1015 Ga0373924_0007383 3300035410 Bacteria 3967
1016 Ga0373931_0000714 3300035691 Bacteria 13748
1017 Ga0373931_0001610 3300035691 Bacteria 9775
1018 Ga0373931_0025062 3300035691 Bacteria 3028
1019 Ga0373931_0032400 3300035691 Bacteria 2704
1020 Ga0373935_0000382 3300035692 Bacteria 22745
1021 Ga0373935_0004984 3300035692 Bacteria 7813
1022 Ga0373935_0060881 3300035692 Bacteria 2416
1023 Ga0373935_0110312 3300035692 Bacteria 1825
1024 Ga0373935_0113950 3300035692 Bacteria 1798
1025 Ga0373935_0189356 3300035692 Bacteria 1416
1026 Ga0373927_0002885 3300035695 Bacteria 12521
1027 Ga0373927_0003772 3300035695 Bacteria 10756
1028 Ga0373927_0008081 3300035695 Bacteria 7103
1029 Ga0373927_0009027 3300035695 Bacteria 6696
1030 Ga0373927_0009357 3300035695 Bacteria 6572
1031 Ga0373927_0035894 3300035695 Bacteria 3225
1032 Ga0373933_0000110 3300035724 Bacteria 52519
1033 Ga0373933_0001224 3300035724 Bacteria 15196
1034 Ga0373933_0002094 3300035724 Bacteria 11451
1035 Ga0373933_0144907 3300035724 Bacteria 1501
1036 Ga0373933_0187528 3300035724 Bacteria 1320
1037 Ga0373947_0001850 3300035725 Bacteria 12909
1038 Ga0373947_0005699 3300035725 Bacteria 7261
1039 Ga0373947_0015499 3300035725 Bacteria 4378
1040 Ga0373947_0034544 3300035725 Bacteria 2991
1041 Ga0373947_0036519 3300035725 Bacteria 2914
1042 Ga0373947_0080640 3300035725 Bacteria 2013
1043 Ga0373947_0099267 3300035725 Bacteria 1827
1044 Ga0373947_0119783 3300035725 Bacteria 1671
1045 Ga0373937_0000849 3300036401 Bacteria 26229
1046 Ga0373937_0005174 3300036401 Bacteria 11127
1047 Ga0373937_0027190 3300036401 Bacteria 5171
1048 Ga0373937_0030627 3300036401 Bacteria 4872
1049 Ga0373937_0040820 3300036401 Bacteria 4230
1050 Ga0373937_0194250 3300036401 Bacteria 1907
1051 Ga0316582_0024005 3300036647 Bacteria 3642
1052 Ga0316584_0194540 3300036712 Bacteria 1498
1053 Ga0373925_0007329 3300037068 Bacteria 8054
1054 Ga0373925_0009418 3300037068 Bacteria 7112
1055 Ga0373925_0013981 3300037068 Bacteria 5810
1056 Ga0373925_0020372 3300037068 Bacteria 4828
1057 Ga0373925_0022711 3300037068 Bacteria 4577
1058 Ga0373925_0029279 3300037068 Bacteria 4039
1059 Ga0373925_0030911 3300037068 Bacteria 3933
1060 Ga0373925_0037118 3300037068 Bacteria 3596
1061 Ga0373925_0065256 3300037068 Bacteria 2742
1062 Ga0395899_0008367 3300037312 Bacteria 7963
1063 Ga0395899_0124691 3300037312 Bacteria 1842
1064 Ga0395899_0124850 3300037312 Bacteria 1841
1065 Ga0395900_0000940 3300037418 Bacteria 38072
1066 Ga0395900_0018516 3300037418 Bacteria 7103
1067 Ga0395900_0042832 3300037418 Bacteria 4664
1068 Ga0395898_0006219 3300037466 Bacteria 12789
1069 Ga0395898_0007511 3300037466 Bacteria 11584
1070 Ga0395898_0048176 3300037466 Bacteria 4180
1071 Ga0395898_0066370 3300037466 Bacteria 3496
1072 Ga0395898_0116297 3300037466 Bacteria 2562
1073 Ga0395898_0441700 3300037466 Bacteria 1239
1074 Ga0395905_0001756 3300037471 Bacteria 25281
1075 Ga0395905_0004739 3300037471 Bacteria 14053
1076 Ga0395905_0087304 3300037471 Bacteria 2924
1077 Ga0436364_0351617 3300037853 Bacteria 5329
1078 Ga0395901_0011181 3300038443 Bacteria 9096
1079 Ga0395901_0020828 3300038443 Bacteria 6713
1080 Ga0395901_0080714 3300038443 Bacteria 3397
1081 Ga0395901_0364460 3300038443 Bacteria 1489
1082 Ga0400485_12741 3300038735 Bacteria 28195
1083 Ga0400486_20716 3300038742 Bacteria 2309
1084 Ga0400489_28284 3300039093 Bacteria 3122
1085 Ga0400487_27495 3300039110 Bacteria 2340
1086 Ga0436365_0225834 3300039437 Bacteria 3126
1087 Ga0436365_0684140 3300039437 Bacteria 1123
1088 Ga0436365_0771718 3300039437 Bacteria 1518
1089 Ga0436365_1077710 3300039437 Bacteria 12347
1090 Ga0436365_1332159 3300039437 Bacteria 25414
1091 Ga0436363_1328249 3300039450 Bacteria 3168
1092 Ga0436362_0123159 3300039453 Bacteria 1181
1093 Ga0436362_0716278 3300039453 Bacteria 4751
1094 Ga0439448_0037983 3300042005 Bacteria 1549
1095 Ga0439435_0041066 3300042436 Bacteria 1295
1096 Ga0451577_0013112 3300042876 Bacteria 7769
1097 Ga0451577_0036995 3300042876 Bacteria 4394
1098 Ga0466972_0001455 3300044658 Bacteria 11506
1099 Ga0466972_0004207 3300044658 Bacteria 7191
1100 Ga0453683_0016653 3300044673 Bacteria 4739
1101 Ga0466965_0050746 3300044683 Bacteria 2057
1102 Ga0466966_0000065 3300044684 Bacteria 71994
1103 Ga0466961_0000154 3300044693 Bacteria 46518
1104 Ga0466963_0030858 3300044694 Bacteria 3461
1105 Ga0466964_0026404 3300044706 Bacteria 2273
1106 Ga0466968_0034723 3300044735 Bacteria 2106
1107 Ga0466960_0010379 3300044901 Bacteria 3866
1108 Ga0466960_0047808 3300044901 Bacteria 2053
1109 Ga0466959_0004864 3300045049 Bacteria 9087
1110 Ga0466959_0028283 3300045049 Bacteria 4157
1111 Ga0451576_0004860 3300045051 Bacteria 17216
1112 Ga0451576_0007753 3300045051 Bacteria 12749
1113 Ga0466967_0001722 3300045976 Bacteria 13037
1114 Ga0466967_0007434 3300045976 Bacteria 7901
1115 Ga0466967_0062148 3300045976 Bacteria 3315
1116 Ga0466967_0062586 3300045976 Bacteria 3304
1117 Ga0495617_051367 3300046452 Bacteria 1370
1118 Ga0495592_0003334 3300046454 Bacteria 11496
1119 Ga0495592_0008695 3300046454 Bacteria 7623
1120 Ga0495592_0026610 3300046454 Bacteria 4384
1121 Ga0495592_0047700 3300046454 Bacteria 3189
1122 Ga0495592_0048320 3300046454 Bacteria 3165
1123 Ga0495592_0132609 3300046454 Bacteria 1741
1124 Ga0495603_0000191 3300046455 Bacteria 32052
1125 Ga0495603_0007025 3300046455 Bacteria 6757
1126 Ga0495603_0012838 3300046455 Bacteria 5065
1127 Ga0495603_0044614 3300046455 Bacteria 2645
1128 Ga0495629_0000500 3300046459 Bacteria 32861
1129 Ga0495629_0001281 3300046459 Bacteria 19758
1130 Ga0495629_0002009 3300046459 Bacteria 15810
1131 Ga0495629_0015849 3300046459 Bacteria 5414
1132 Ga0495629_0065989 3300046459 Bacteria 2526
1133 Ga0495629_0115401 3300046459 Bacteria 1871
1134 Ga0495629_0141597 3300046459 Bacteria 1673
1135 Ga0495629_0148235 3300046459 Bacteria 1631
1136 Ga0495638_0017268 3300046460 Bacteria 4816
1137 Ga0495638_0032724 3300046460 Bacteria 3330
1138 Ga0495638_0125884 3300046460 Bacteria 1510
1139 Ga0495641_0001436 3300046461 Bacteria 20225
1140 Ga0495641_0078328 3300046461 Bacteria 1481
1141 Ga0495641_0106583 3300046461 Bacteria 1250
1142 Ga0495651_0000821 3300046462 Bacteria 24117
1143 Ga0495651_0009095 3300046462 Bacteria 7624
1144 Ga0495651_0036961 3300046462 Bacteria 3802
1145 Ga0495651_0062573 3300046462 Bacteria 2847
1146 Ga0495653_0002307 3300046463 Bacteria 15112
1147 Ga0495653_0004970 3300046463 Bacteria 10793
1148 Ga0495653_0010292 3300046463 Bacteria 7654
1149 Ga0495653_0041256 3300046463 Bacteria 3603
1150 Ga0495653_0053810 3300046463 Bacteria 3078
1151 Ga0495653_0079954 3300046463 Bacteria 2420
1152 Ga0495580_0004694 3300046472 Bacteria 11461
1153 Ga0495580_0009608 3300046472 Bacteria 7596
1154 Ga0495580_0040570 3300046472 Bacteria 3324
1155 Ga0495582_0000251 3300046473 Bacteria 29816
1156 Ga0495582_0009496 3300046473 Bacteria 5359
1157 Ga0495582_0012182 3300046473 Bacteria 4737
1158 Ga0495582_0045732 3300046473 Bacteria 2411
1159 Ga0495582_0086417 3300046473 Bacteria 1745
1160 Ga0495639_0000077 3300046475 Bacteria 46394
1161 Ga0495639_0006383 3300046475 Bacteria 5069
1162 Ga0495639_0032533 3300046475 Bacteria 2326
1163 Ga0495662_0000826 3300046476 Bacteria 15060
1164 Ga0495662_0014265 3300046476 Bacteria 3864
1165 Ga0495664_0009436 3300046477 Bacteria 5459
1166 Ga0495664_0024516 3300046477 Bacteria 3507
1167 Ga0495664_0034171 3300046477 Bacteria 2990
1168 Ga0495664_0111696 3300046477 Bacteria 1650
1169 Ga0495584_0073949 3300046491 Bacteria 1713
1170 Ga0495585_0094237 3300046492 Bacteria 1609
1171 Ga0495585_0139672 3300046492 Bacteria 1269
1172 Ga0495594_0000648 3300046499 Bacteria 17955
1173 Ga0495594_0046269 3300046499 Bacteria 2389
1174 Ga0495596_0063043 3300046500 Bacteria 1442
1175 Ga0495583_0003990 3300046506 Bacteria 10891
1176 Ga0495606_0008377 3300046507 Bacteria 8999
1177 Ga0495606_0034264 3300046507 Bacteria 3487
1178 Ga0495606_0085500 3300046507 Bacteria 1951
1179 Ga0495608_0002352 3300046511 Bacteria 13621
1180 Ga0495608_0004206 3300046511 Bacteria 10314
1181 Ga0495610_0084361 3300046512 Bacteria 1452
1182 Ga0495618_0004363 3300046514 Bacteria 8701
1183 Ga0495618_0011914 3300046514 Bacteria 5277
1184 Ga0495618_0050692 3300046514 Bacteria 2622
1185 Ga0495620_0100369 3300046515 Bacteria 1154
1186 Ga0495628_0007652 3300046516 Bacteria 9339
1187 Ga0495628_0012115 3300046516 Bacteria 7269
1188 Ga0495628_0015917 3300046516 Bacteria 6275
1189 Ga0495628_0042818 3300046516 Bacteria 3609
1190 Ga0495628_0085728 3300046516 Bacteria 2443
1191 Ga0495628_0125348 3300046516 Bacteria 1968
1192 Ga0495630_0001279 3300046517 Bacteria 17334
1193 Ga0495630_0040014 3300046517 Bacteria 3503
1194 Ga0495643_0055480 3300046522 Bacteria 2118
1195 Ga0495666_0008087 3300046526 Bacteria 5272
1196 Ga0495666_0027327 3300046526 Bacteria 2809
1197 Ga0495666_0029598 3300046526 Bacteria 2694
1198 Ga0495652_0009266 3300046529 Bacteria 8947
1199 Ga0495652_0023802 3300046529 Bacteria 5426
1200 Ga0495652_0069642 3300046529 Bacteria 2944
1201 Ga0495652_0084854 3300046529 Bacteria 2603
1202 Ga0495665_0005139 3300046531 Bacteria 7058
1203 Ga0495640_0003320 3300046533 Bacteria 12954
1204 Ga0495640_0004102 3300046533 Bacteria 11651
1205 Ga0495640_0048507 3300046533 Bacteria 2934
1206 Ga0495640_0055553 3300046533 Bacteria 2708
1207 Ga0495640_0157445 3300046533 Bacteria 1457
1208 Ga0495586_0002128 3300046535 Bacteria 10768
1209 Ga0495587_0003095 3300046536 Bacteria 11115
1210 Ga0495587_0011112 3300046536 Bacteria 5711
1211 Ga0495587_0011231 3300046536 Bacteria 5677
1212 Ga0495587_0013122 3300046536 Bacteria 5209
1213 Ga0495621_0002390 3300046539 Bacteria 5053
1214 Ga0495621_0015571 3300046539 Bacteria 2427
1215 Ga0495645_0003434 3300046543 Bacteria 10742
1216 Ga0495645_0010291 3300046543 Bacteria 6556
1217 Ga0495645_0020403 3300046543 Bacteria 4779
1218 Ga0495645_0063652 3300046543 Bacteria 2670
1219 Ga0495633_0010291 3300046558 Bacteria 5114
1220 Ga0495667_0001067 3300046559 Bacteria 17817
1221 Ga0495667_0002892 3300046559 Bacteria 11514
1222 Ga0495667_0011827 3300046559 Bacteria 5912
1223 Ga0495667_0040012 3300046559 Bacteria 3114
1224 Ga0495667_0050531 3300046559 Bacteria 2744
1225 Ga0495656_0010707 3300046615 Bacteria 3341
1226 Ga0495668_0014263 3300046616 Bacteria 4664
1227 Ga0495668_0081063 3300046616 Bacteria 1781
1228 Ga0495668_0130456 3300046616 Bacteria 1376
1229 Ga0495634_0001976 3300046642 Bacteria 17475
1230 Ga0495634_0015373 3300046642 Bacteria 5502
1231 Ga0495634_0085415 3300046642 Bacteria 2056
1232 Ga0495634_0127946 3300046642 Bacteria 1621
1233 Ga0495625_0009866 3300046660 Bacteria 7942
1234 Ga0495625_0243030 3300046660 Bacteria 1171
1235 Ga0495635_0002471 3300046663 Bacteria 12619
1236 Ga0495635_0004431 3300046663 Bacteria 9729
1237 Ga0495635_0019246 3300046663 Bacteria 4761
1238 Ga0495635_0021691 3300046663 Bacteria 4476
1239 Ga0495635_0102187 3300046663 Bacteria 1959
1240 Ga0495659_0002989 3300046664 Bacteria 5423
1241 Ga0495588_0004422 3300046674 Bacteria 6213
1242 Ga0495588_0004700 3300046674 Bacteria 6032
1243 Ga0495588_0036562 3300046674 Bacteria 2492
1244 Ga0495657_0007463 3300046675 Bacteria 8451
1245 Ga0495657_0007949 3300046675 Bacteria 8132
1246 Ga0495657_0025281 3300046675 Bacteria 4220
1247 Ga0495657_0028310 3300046675 Bacteria 3943
1248 Ga0495657_0028576 3300046675 Bacteria 3920
1249 Ga0495599_0005682 3300046678 Bacteria 7482
1250 Ga0495599_0006005 3300046678 Bacteria 7306
1251 Ga0495599_0006827 3300046678 Bacteria 6900
1252 Ga0495599_0028649 3300046678 Bacteria 3489
1253 Ga0495623_0004291 3300046679 Bacteria 9385
1254 Ga0495623_0006077 3300046679 Bacteria 7851
1255 Ga0495623_0011175 3300046679 Bacteria 5808
1256 Ga0495623_0107574 3300046679 Bacteria 1693
1257 Ga0495646_0002070 3300046680 Bacteria 12167
1258 Ga0495646_0006456 3300046680 Bacteria 7438
1259 Ga0495646_0020774 3300046680 Bacteria 4152
1260 Ga0495646_0087876 3300046680 Bacteria 1801
1261 Ga0495647_0053033 3300046681 Bacteria 1580
1262 Ga0495658_0001175 3300046683 Bacteria 13809
1263 Ga0495658_0001615 3300046683 Bacteria 11744
1264 Ga0495669_0006510 3300046684 Bacteria 4882
1265 Ga0495613_0011644 3300046689 Bacteria 6538
1266 Ga0495613_0012697 3300046689 Bacteria 6263
1267 Ga0495613_0022371 3300046689 Bacteria 4711
1268 Ga0495613_0170594 3300046689 Bacteria 1544
1269 Ga0495624_0002021 3300046690 Bacteria 15445
1270 Ga0495624_0062978 3300046690 Bacteria 2319
1271 Ga0495600_0001546 3300046809 Bacteria 12799
1272 Ga0495600_0004625 3300046809 Bacteria 8248
1273 Ga0495600_0037714 3300046809 Bacteria 3143
1274 Ga0495600_0039665 3300046809 Bacteria 3066
1275 Ga0495581_0000503 3300047315 Bacteria 19983
1276 Ga0495581_0033250 3300047315 Bacteria 2985
1277 Ga0495581_0034285 3300047315 Bacteria 2937
1278 Ga0495581_0061937 3300047315 Bacteria 2162
1279 Ga0495604_0003694 3300047317 Bacteria 12194
1280 Ga0495604_0011558 3300047317 Bacteria 7015
1281 Ga0495604_0018158 3300047317 Bacteria 5631
1282 Ga0495604_0023789 3300047317 Bacteria 4889
1283 Ga0495604_0027799 3300047317 Bacteria 4498
1284 Ga0495604_0094279 3300047317 Bacteria 2213
1285 Ga0495674_0001342 3300047319 Bacteria 23999
1286 Ga0495674_0026245 3300047319 Bacteria 5332
1287 Ga0495674_0032084 3300047319 Bacteria 4767
1288 Ga0495674_0044803 3300047319 Bacteria 3931
1289 Ga0495674_0052198 3300047319 Bacteria 3599
1290 Ga0495674_0117877 3300047319 Bacteria 2245
1291 Ga0495672_0032635 3300047320 Bacteria 3236
1292 Ga0495676_0021687 3300047321 Bacteria 5605
1293 Ga0495676_0050478 3300047321 Bacteria 3336
1294 Ga0495676_0142177 3300047321 Bacteria 1718
1295 Ga0495680_0008204 3300047322 Bacteria 9519
1296 Ga0495680_0012767 3300047322 Bacteria 7367
1297 Ga0495680_0018195 3300047322 Bacteria 5974
1298 Ga0495680_0022767 3300047322 Bacteria 5217
1299 Ga0495680_0036916 3300047322 Bacteria 3918
1300 Ga0495687_012474 3300047443 Bacteria 4490
1301 Ga0495675_0001338 3300047444 Bacteria 14916
1302 Ga0495675_0002401 3300047444 Bacteria 11186
1303 Ga0495675_0004135 3300047444 Bacteria 8786
1304 Ga0495675_0012731 3300047444 Bacteria 5297
1305 Ga0495675_0039422 3300047444 Bacteria 3008
1306 Ga0495673_0057791 3300047469 Bacteria 1674
1307 Ga0495684_0002991 3300047471 Bacteria 13304
1308 Ga0495684_0006000 3300047471 Bacteria 9439
1309 Ga0495684_0050791 3300047471 Bacteria 3165
1310 Ga0495684_0088193 3300047471 Bacteria 2351
1311 Ga0495686_0005497 3300047472 Bacteria 9970
1312 Ga0495593_0000192 3300047673 Bacteria 32140
1313 Ga0495593_0001200 3300047673 Bacteria 15172
1314 Ga0495593_0007939 3300047673 Bacteria 6183
1315 Ga0495593_0009818 3300047673 Bacteria 5555
1316 Ga0495593_0027391 3300047673 Bacteria 3138
1317 Ga0495602_0002373 3300048088 Bacteria 19095
1318 Ga0495602_0002392 3300048088 Bacteria 19051
1319 Ga0495602_0007064 3300048088 Bacteria 11787
1320 Ga0495602_0017778 3300048088 Bacteria 7118
1321 Ga0495614_0062655 3300048089 Bacteria 1598
1322 Ga0496100_0003962 3300048903 Bacteria 7781
1323 Ga0496100_0004161 3300048903 Bacteria 7628
1324 Ga0496100_0005504 3300048903 Bacteria 6830
1325 Ga0496100_0023159 3300048903 Bacteria 3768
1326 Ga0496100_0059662 3300048903 Bacteria 2508
1327 Ga0496101_0001185 3300048904 Bacteria 15593
1328 Ga0496101_0014484 3300048904 Bacteria 5301
1329 Ga0496101_0052455 3300048904 Bacteria 2941
1330 Ga0496101_0067099 3300048904 Bacteria 2618
1331 Ga0496102_0001427 3300048905 Bacteria 21201
1332 Ga0496102_0002571 3300048905 Bacteria 15468
1333 Ga0496102_0010740 3300048905 Bacteria 7887
1334 Ga0496102_0018426 3300048905 Bacteria 6136
1335 Ga0496102_0021189 3300048905 Bacteria 5747
1336 Ga0496102_0033644 3300048905 Bacteria 4607
1337 Ga0496102_0053452 3300048905 Bacteria 3681
1338 Ga0496103_0001145 3300048906 Bacteria 18320
1339 Ga0496103_0011657 3300048906 Bacteria 5214
1340 Ga0496103_0012446 3300048906 Bacteria 5046
1341 Ga0496103_0028524 3300048906 Bacteria 3388
1342 Ga0496103_0068689 3300048906 Bacteria 2214
1343 Ga0496104_0000800 3300048907 Bacteria 27054
1344 Ga0496104_0001608 3300048907 Bacteria 19461
1345 Ga0496104_0004653 3300048907 Bacteria 11941
1346 Ga0496104_0024050 3300048907 Bacteria 5605
1347 Ga0496104_0034040 3300048907 Bacteria 4748
1348 Ga0496104_0040661 3300048907 Bacteria 4359
1349 Ga0496104_0080146 3300048907 Bacteria 3113
1350 Ga0496105_0013595 3300048908 Bacteria 6464
1351 Ga0496105_0014766 3300048908 Bacteria 6217
1352 Ga0496105_0019467 3300048908 Bacteria 5474
1353 Ga0496105_0061032 3300048908 Bacteria 3110
1354 Ga0496105_0062915 3300048908 Bacteria 3062
1355 Ga0496106_0000644 3300048909 Bacteria 24997
1356 Ga0496106_0004195 3300048909 Bacteria 10741
1357 Ga0496106_0015891 3300048909 Bacteria 5568
1358 Ga0496106_0016692 3300048909 Bacteria 5432
1359 Ga0496106_0038434 3300048909 Bacteria 3581
1360 Ga0496106_0114552 3300048909 Bacteria 2102
1361 Ga0496106_0194970 3300048909 Bacteria 1611
1362 Ga0496107_0000844 3300048910 Bacteria 17921
1363 Ga0496107_0002006 3300048910 Bacteria 12986
1364 Ga0496107_0005355 3300048910 Bacteria 8778
1365 Ga0496107_0009798 3300048910 Bacteria 6645
1366 Ga0496107_0014142 3300048910 Bacteria 5587
1367 Ga0496107_0031969 3300048910 Bacteria 3758
1368 Ga0496107_0033348 3300048910 Bacteria 3683
1369 Ga0496107_0132845 3300048910 Bacteria 1838
1370 Ga0496107_0407875 3300048910 Bacteria 1011
1371 Ga0496108_0002310 3300048911 Bacteria 15266
1372 Ga0496108_0002624 3300048911 Bacteria 14402
1373 Ga0496108_0057494 3300048911 Bacteria 3268
1374 Ga0496108_0079607 3300048911 Bacteria 2774
1375 Ga0496109_0002891 3300048912 Bacteria 14365
1376 Ga0496109_0003011 3300048912 Bacteria 14061
1377 Ga0496109_0011996 3300048912 Bacteria 7463
1378 Ga0496109_0159657 3300048912 Bacteria 2112
1379 Ga0496110_0002024 3300048913 Bacteria 15093
1380 Ga0496110_0005701 3300048913 Bacteria 9777
1381 Ga0496110_0006680 3300048913 Bacteria 9168
1382 Ga0496110_0013610 3300048913 Bacteria 6734
1383 Ga0496110_0063334 3300048913 Bacteria 3267
1384 Ga0496110_0121716 3300048913 Bacteria 2351
1385 Ga0496110_0329352 3300048913 Bacteria 1391
1386 Ga0496111_0003300 3300048914 Bacteria 9978
1387 Ga0496111_0016639 3300048914 Bacteria 5071
1388 Ga0496111_0020931 3300048914 Bacteria 4560
1389 Ga0496111_0025629 3300048914 Bacteria 4161
1390 Ga0496111_0027351 3300048914 Bacteria 4034
1391 Ga0496111_0029166 3300048914 Bacteria 3917
1392 Ga0496111_0178753 3300048914 Bacteria 1577
1393 Ga0496112_0000004 3300048915 Bacteria 553294
1394 Ga0496112_0010399 3300048915 Bacteria 8437
1395 Ga0496112_0013933 3300048915 Bacteria 7438
1396 Ga0496112_0015385 3300048915 Bacteria 7138
1397 Ga0496112_0031686 3300048915 Bacteria 5128
1398 Ga0496112_0074323 3300048915 Bacteria 3360
1399 Ga0496112_0202571 3300048915 Bacteria 1943
1400 Ga0496112_0430124 3300048915 Bacteria 1258
1401 Ga0496113_0006037 3300048916 Bacteria 7631
1402 Ga0496113_0010146 3300048916 Bacteria 6216
1403 Ga0496113_0022159 3300048916 Bacteria 4488
1404 Ga0496113_0116201 3300048916 Bacteria 2087
1405 Ga0496114_0010127 3300048917 Bacteria 7500
1406 Ga0496114_0014349 3300048917 Bacteria 6355
1407 Ga0496114_0068992 3300048917 Bacteria 2968
1408 Ga0496114_0086065 3300048917 Bacteria 2663
1409 Ga0496114_0298942 3300048917 Bacteria 1421
1410 Ga0496115_0010097 3300048918 Bacteria 7040
1411 Ga0496115_0016209 3300048918 Bacteria 5670
1412 Ga0496115_0017600 3300048918 Bacteria 5469
1413 Ga0496115_0021136 3300048918 Bacteria 5023
1414 Ga0496115_0029351 3300048918 Bacteria 4319
1415 Ga0496115_0030622 3300048918 Bacteria 4235
1416 Ga0496115_0061514 3300048918 Bacteria 3027
1417 Ga0496115_0115841 3300048918 Bacteria 2204
1418 Ga0496115_0167310 3300048918 Bacteria 1818
1419 Ga0496116_0033300 3300048919 Bacteria 3658
1420 Ga0496117_0001113 3300048920 Bacteria 40547
1421 Ga0496118_0002207 3300048921 Bacteria 27019
1422 Ga0496118_0021354 3300048921 Bacteria 5701
1423 Ga0496118_0022371 3300048921 Bacteria 5528
1424 Ga0496118_0091952 3300048921 Bacteria 2084
1425 Ga0496119_0003438 3300048922 Bacteria 16444
1426 Ga0496119_0040194 3300048922 Bacteria 2995
1427 Ga0496119_0114844 3300048922 Bacteria 1488
1428 Ga0496120_0018689 3300048923 Bacteria 4457
1429 Ga0496120_0029886 3300048923 Bacteria 3321
1430 Ga0496121_0000458 3300048924 Bacteria 80207
1431 Ga0496121_0000668 3300048924 Bacteria 64093
1432 Ga0496121_0003282 3300048924 Bacteria 23219
1433 Ga0496121_0015952 3300048924 Bacteria 7795
1434 Ga0496121_0023452 3300048924 Bacteria 5942
1435 Ga0496121_0046790 3300048924 Bacteria 3698
1436 Ga0496121_0057763 3300048924 Bacteria 3213
1437 Ga0496121_0058459 3300048924 Bacteria 3188
1438 Ga0496121_0116311 3300048924 Bacteria 2028
1439 Ga0496121_0138248 3300048924 Bacteria 1811
1440 Ga0496122_0003250 3300048925 Bacteria 21566
1441 Ga0496123_0002687 3300048926 Bacteria 21408
1442 Ga0496124_0016929 3300048927 Bacteria 6905
1443 Ga0496124_0018892 3300048927 Bacteria 6435
1444 Ga0496124_0027613 3300048927 Bacteria 5091
1445 Ga0496124_0030532 3300048927 Bacteria 4782
1446 Ga0496125_0002993 3300048928 Bacteria 21169
1447 Ga0496125_0037091 3300048928 Bacteria 4243
1448 Ga0496125_0087127 3300048928 Bacteria 2359
1449 Ga0496126_0004265 3300048929 Bacteria 17195
1450 Ga0496126_0015822 3300048929 Bacteria 7575
1451 Ga0496126_0021670 3300048929 Bacteria 6272
1452 Ga0496126_0059053 3300048929 Bacteria 3455
1453 Ga0496126_0075342 3300048929 Bacteria 2995
1454 Ga0496126_0103663 3300048929 Bacteria 2486
1455 Ga0496126_0121675 3300048929 Bacteria 2262
1456 Ga0496126_0151971 3300048929 Bacteria 1983
1457 Ga0501031_0026605 3300049568 Bacteria 3771
1458 Ga0501031_0028491 3300049568 Bacteria 3641
1459 Ga0501032_0000619 3300049569 Bacteria 28816
1460 Ga0501032_0005134 3300049569 Bacteria 9765
1461 Ga0501032_0017361 3300049569 Bacteria 5053
1462 Ga0501033_0000108 3300049570 Bacteria 79903
1463 Ga0501033_0008940 3300049570 Bacteria 7736
1464 Ga0501033_0034418 3300049570 Bacteria 3800
1465 Ga0501033_0101887 3300049570 Bacteria 2094
1466 Ga0501034_0000100 3300049571 Bacteria 159536
1467 Ga0501034_0001160 3300049571 Bacteria 36511
1468 Ga0501034_0417808 3300049571 Bacteria 1262
1469 Ga0501036_0003243 3300049572 Bacteria 12966
1470 Ga0501036_0005602 3300049572 Bacteria 10187
1471 Ga0501036_0046547 3300049572 Bacteria 3674
1472 Ga0501037_0000153 3300049573 Bacteria 64239
1473 Ga0501037_0002178 3300049573 Bacteria 14167
1474 Ga0501037_0007559 3300049573 Bacteria 7956
1475 Ga0501037_0024884 3300049573 Bacteria 4425
1476 Ga0501037_0041443 3300049573 Bacteria 3386
1477 Ga0501038_0000138 3300049574 Bacteria 62493
1478 Ga0501038_0027593 3300049574 Bacteria 5050
1479 Ga0501038_0044018 3300049574 Bacteria 3880
1480 Ga0501038_0046396 3300049574 Bacteria 3767
1481 Ga0501038_0135773 3300049574 Bacteria 2016
1482 Ga0501039_0001334 3300049575 Bacteria 18048
1483 Ga0501039_0005778 3300049575 Bacteria 9373
1484 Ga0501039_0021206 3300049575 Bacteria 4984
1485 Ga0501039_0151695 3300049575 Bacteria 1820
1486 Ga0501042_0030014 3300049578 Bacteria 3838
1487 Ga0501043_0000072 3300049579 Bacteria 89021
1488 Ga0501043_0000085 3300049579 Bacteria 83544
1489 Ga0501043_0000122 3300049579 Bacteria 71952
1490 Ga0501043_0010595 3300049579 Bacteria 7218
1491 Ga0501043_0059176 3300049579 Bacteria 3006
1492 Ga0501046_0000112 3300049580 Bacteria 86313
1493 Ga0501046_0001536 3300049580 Bacteria 22030
1494 Ga0501046_0009020 3300049580 Bacteria 8649
1495 Ga0501046_0016351 3300049580 Bacteria 6217
1496 Ga0501046_0055778 3300049580 Bacteria 3103
1497 Ga0501046_0056031 3300049580 Bacteria 3095
1498 Ga0501047_0000138 3300049581 Bacteria 89028
1499 Ga0501047_0000221 3300049581 Bacteria 68563
1500 Ga0501047_0001508 3300049581 Bacteria 22710
1501 Ga0501047_0010664 3300049581 Bacteria 8684
1502 Ga0501047_0014013 3300049581 Bacteria 7619
1503 Ga0501047_0150317 3300049581 Bacteria 2205
1504 Ga0501048_0000151 3300049582 Bacteria 42561
1505 Ga0501048_0016360 3300049582 Bacteria 5465
1506 Ga0501048_0028911 3300049582 Bacteria 4023
1507 Ga0501067_0003478 3300049583 Bacteria 8653
1508 Ga0501067_0008205 3300049583 Bacteria 5799
1509 Ga0501068_0000689 3300049584 Bacteria 17292
1510 Ga0501068_0097161 3300049584 Bacteria 1822
1511 Ga0501069_0009070 3300049585 Bacteria 5248
1512 Ga0501069_0019871 3300049585 Bacteria 3634
1513 Ga0501069_0027507 3300049585 Bacteria 3115
1514 Ga0501069_0112356 3300049585 Bacteria 1552
1515 Ga0501070_0005227 3300049586 Bacteria 11067
1516 Ga0501070_0009879 3300049586 Bacteria 8067
1517 Ga0501070_0014416 3300049586 Bacteria 6651
1518 Ga0501070_0070401 3300049586 Bacteria 2896
1519 Ga0501070_0124994 3300049586 Bacteria 2126
1520 Ga0501071_0009224 3300049587 Bacteria 6561
1521 Ga0501071_0093943 3300049587 Bacteria 2205
1522 Ga0501072_0001591 3300049588 Bacteria 16965
1523 Ga0501072_0097197 3300049588 Bacteria 2340
1524 Ga0501072_0243898 3300049588 Bacteria 1431
1525 Ga0501073_0000290 3300049589 Bacteria 33072
1526 Ga0501073_0033251 3300049589 Bacteria 3672
1527 Ga0501073_0047140 3300049589 Bacteria 3028
1528 Ga0501073_0114295 3300049589 Bacteria 1871
1529 Ga0501074_0000094 3300049590 Bacteria 42565
1530 Ga0501074_0010639 3300049590 Bacteria 6679
1531 Ga0501074_0018658 3300049590 Bacteria 5041
1532 Ga0501074_0070101 3300049590 Bacteria 2520
1533 Ga0501074_0135923 3300049590 Bacteria 1758
1534 Ga0501075_0129638 3300049591 Bacteria 1921
1535 Ga0501075_0319266 3300049591 Bacteria 1184
1536 Ga0501076_0009771 3300049592 Bacteria 7087
1537 Ga0501076_0009957 3300049592 Bacteria 7027
1538 Ga0501076_0095072 3300049592 Bacteria 2400
1539 Ga0501076_0103471 3300049592 Bacteria 2297
1540 Ga0501077_0064401 3300049593 Bacteria 2326
1541 Ga0501079_0011578 3300049741 Bacteria 6733
1542 Ga0501079_0021362 3300049741 Bacteria 4951
1543 Ga0501079_0045004 3300049741 Bacteria 3406
1544 Ga0501080_0000104 3300049742 Bacteria 57865
1545 Ga0501080_0000130 3300049742 Bacteria 53465
1546 Ga0501080_0004806 3300049742 Bacteria 12047
1547 Ga0501080_0037162 3300049742 Bacteria 4546
1548 Ga0501080_0070845 3300049742 Bacteria 3242
1549 Ga0501080_0080027 3300049742 Bacteria 3037
1550 Ga0501081_0059062 3300049743 Bacteria 2654
1551 Ga0501083_0000087 3300049744 Bacteria 62691
1552 Ga0501083_0072468 3300049744 Bacteria 2290
1553 Ga0501083_0102558 3300049744 Bacteria 1886
1554 Ga0501083_0107677 3300049744 Bacteria 1834
1555 Ga0501035_0000016 3300049822 Bacteria 243412
1556 Ga0501035_0000127 3300049822 Bacteria 92397
1557 Ga0501035_0000223 3300049822 Bacteria 67732
1558 Ga0501035_0029522 3300049822 Bacteria 5001
1559 Ga0501035_0037803 3300049822 Bacteria 4369
1560 Ga0501035_0115008 3300049822 Bacteria 2355
1561 Ga0501044_0000636 3300049823 Bacteria 42394
1562 Ga0501044_0000970 3300049823 Bacteria 34530
1563 Ga0501044_0035319 3300049823 Bacteria 5236
1564 Ga0501044_0044641 3300049823 Bacteria 4598
1565 Ga0501044_0072975 3300049823 Bacteria 3488
1566 Ga0501044_0093247 3300049823 Bacteria 3036
1567 Ga0501044_0129136 3300049823 Bacteria 2522
1568 Ga0501044_0228567 3300049823 Bacteria 1809
1569 Ga0501045_0024845 3300049824 Bacteria 4303
1570 Ga0501045_0056865 3300049824 Bacteria 2862
1571 nmdc:mga03n38_22876_c1 3300050490 Bacteria 2536
1572 nmdc:mga03n38_4203_c1 3300050490 Bacteria 4738
1573 nmdc:mga00v17_65912_c1 3300050491 Bacteria 2235
1574 nmdc:mga0yw44_4056_c1 3300050492 Bacteria 6630
1575 nmdc:mga0yw44_59988_c1 3300050492 Bacteria 2329
1576 nmdc:mga0yw44_94336_c1 3300050492 Bacteria 1897
1577 nmdc:mga0k408_4525_c1 3300050493 Bacteria 7382
1578 nmdc:mga0k408_69181_c1 3300050493 Bacteria 2060
1579 nmdc:mga0k408_70184_c1 3300050493 Bacteria 2045
1580 nmdc:mga06z11_26425_c1 3300050494 Bacteria 2762
1581 nmdc:mga06z11_5335_c1 3300050494 Bacteria 5149
1582 nmdc:mga04h51_32831_c1 3300050495 Bacteria 1649
1583 nmdc:mga04h51_54496_c1 3300050495 Bacteria 1352
1584 nmdc:mga07m45_145268_c1 3300050496 Bacteria 1375
1585 nmdc:mga07m45_5327_c1 3300050496 Bacteria 6397
1586 nmdc:mga05p37_157565_c1 3300050507 Bacteria 2774
1587 nmdc:mga05p37_3181_c1 3300050507 Bacteria 19102
1588 nmdc:mga05p37_358703_c1 3300050507 Bacteria 1714
1589 nmdc:mga05p37_4809_c1 3300050507 Bacteria 15796
1590 nmdc:mga05p37_59973_c1 3300050507 Bacteria 4684
1591 nmdc:mga05p37_63712_c1 3300050507 Bacteria 4537
1592 nmdc:mga05p37_6528_c1 3300050507 Bacteria 10109
1593 nmdc:mga05p37_9682_c1 3300050507 Bacteria 11423
1594 nmdc:mga09592_2996_c1 3300050508 Bacteria 13695
1595 nmdc:mga09592_327793_c1 3300050508 Bacteria 1326
1596 nmdc:mga09592_3717_c1 3300050508 Bacteria 12298
1597 nmdc:mga0qj67_3244_c1 3300050509 Bacteria 11709
1598 nmdc:mga0qj67_64256_c1 3300050509 Bacteria 2919
1599 nmdc:mga06r32_144049_c1 3300050510 Bacteria 2360
1600 nmdc:mga06r32_208713_c1 3300050510 Bacteria 1941
1601 nmdc:mga06r32_321926_c1 3300050510 Bacteria 1532
1602 nmdc:mga06r32_3795_c1 3300050510 Bacteria 13525
1603 nmdc:mga06r32_4964_c1 3300050510 Bacteria 11991
1604 nmdc:mga06r32_5210_c1 3300050510 Bacteria 11684
1605 nmdc:mga08y16_111162_c1 3300050511 Bacteria 2853
1606 nmdc:mga08y16_194299_c1 3300050511 Bacteria 2104
1607 nmdc:mga08y16_204_c3 3300050511 Bacteria 8325
1608 nmdc:mga08y16_30352_c1 3300050511 Bacteria 5690
1609 nmdc:mga08y16_4659_c1 3300050511 Bacteria 14281
1610 nmdc:mga08y16_5147_c1 3300050511 Bacteria 13664
1611 nmdc:mga08y16_60267_c1 3300050511 Bacteria 3965
1612 nmdc:mga0n895_134904_c1 3300050512 Bacteria 2495
1613 nmdc:mga0n895_1698_c1 3300050512 Bacteria 16639
1614 nmdc:mga0n895_26906_c1 3300050512 Bacteria 5457
1615 nmdc:mga0n895_324652_c1 3300050512 Bacteria 1560
1616 nmdc:mga0n895_35962_c1 3300050512 Bacteria 4779
1617 nmdc:mga0n895_75261_c1 3300050512 Bacteria 3356
1618 nmdc:mga0rr50_157119_c1 3300050513 Bacteria 1843
1619 nmdc:mga0rr50_196493_c1 3300050513 Bacteria 1656
1620 nmdc:mga0rr50_28902_c1 3300050513 Bacteria 3293
1621 nmdc:mga0rr50_289905_c1 3300050513 Bacteria 1367
1622 nmdc:mga08x19_6_c1 3300050514 Bacteria 405679
1623 nmdc:mga0a205_142570_c1 3300050515 Bacteria 2296
1624 nmdc:mga0a205_184989_c1 3300050515 Bacteria 1976
1625 nmdc:mga0a205_195722_c1 3300050515 Bacteria 1912
1626 nmdc:mga0a205_39881_c2 3300050515 Bacteria 3323
1627 nmdc:mga0a205_5270_c1 3300050515 Bacteria 11646
1628 nmdc:mga0a205_66626_c1 3300050515 Bacteria 3479
1629 nmdc:mga0sz30_6269_c1 3300050516 Bacteria 4411
1630 Ga0495601_0000069 3300053077 Bacteria 56291
1631 Ga0495601_0009894 3300053077 Bacteria 5647
1632 Ga0495601_0011998 3300053077 Bacteria 5192
1633 Ga0495601_0012835 3300053077 Bacteria 5028
1634 Ga0495601_0028733 3300053077 Bacteria 3445
1635 Ga0495601_0035833 3300053077 Bacteria 3098
1636 Ga0495601_0089041 3300053077 Bacteria 1985
1637 Ga0495612_0001538 3300053078 Bacteria 9512
1638 Ga0495612_0016126 3300053078 Bacteria 2993
1639 Ga0495612_0021353 3300053078 Bacteria 2597
1640 Ga0500610_0071800 3300053079 Bacteria 1805
1641 Ga0495595_0002192 3300053084 Bacteria 7589
1642 Ga0495595_0003947 3300053084 Bacteria 5924
1643 Ga0495595_0004944 3300053084 Bacteria 5373
1644 Ga0495595_0009528 3300053084 Bacteria 4021
1645 Ga0495595_0019399 3300053084 Bacteria 2949
1646 Ga0495595_0022754 3300053084 Bacteria 2753
1647 Ga0495595_0050933 3300053084 Bacteria 1918
1648 Ga0495619_0000546 3300053085 Bacteria 24865
1649 Ga0495619_0001245 3300053085 Bacteria 16673
1650 Ga0495619_0005933 3300053085 Bacteria 7737
1651 Ga0495619_0013779 3300053085 Bacteria 5101
1652 Ga0495619_0018617 3300053085 Bacteria 4407
1653 Ga0495619_0031858 3300053085 Bacteria 3417
1654 Ga0495619_0037540 3300053085 Bacteria 3157
1655 Ga0495619_0088326 3300053085 Bacteria 2097
1656 Ga0500643_000035 3300053087 Bacteria 184794
1657 Ga0500643_001421 3300053087 Bacteria 13818
1658 Ga0500644_0004088 3300053088 Bacteria 3630
1659 Ga0500647_0026741 3300053091 Bacteria 2723
1660 Ga0500651_0000660 3300053093 Bacteria 17169
1661 Ga0500651_0010557 3300053093 Bacteria 5540
1662 Ga0500566_0000006 3300053094 Bacteria 153632
1663 Ga0500566_0013976 3300053094 Bacteria 4719
1664 Ga0500640_015397 3300053095 Bacteria 3202
1665 Ga0500641_0002427 3300053096 Bacteria 6612
1666 Ga0500641_0006784 3300053096 Bacteria 4074
1667 Ga0500641_0042834 3300053096 Bacteria 1835
1668 Ga0500557_000004 3300053105 Bacteria 202318
1669 Ga0500593_052843 3300053117 Bacteria 1800
1670 Ga0500595_000003 3300053119 Bacteria 419332
1671 Ga0500595_000152 3300053119 Bacteria 45452
1672 Ga0500595_006441 3300053119 Bacteria 4980
1673 Ga0500595_009637 3300053119 Bacteria 3889
1674 Ga0500608_011998 3300053122 Bacteria 3785
1675 Ga0500614_001760 3300053123 Bacteria 5030
1676 Ga0500642_0000133 3300053130 Bacteria 33202
1677 Ga0500658_0078574 3300053134 Bacteria 1407
1678 Ga0500559_0001576 3300053136 Bacteria 12756
1679 Ga0500603_000352 3300053150 Bacteria 12039
1680 Ga0500603_001602 3300053150 Bacteria 5114
1681 Ga0500604_0000229 3300053151 Bacteria 15983
1682 Ga0500604_0010123 3300053151 Bacteria 2519
1683 Ga0500616_0000002 3300053153 Bacteria 1611257
1684 Ga0500616_0000154 3300053153 Bacteria 115039
1685 Ga0500616_0020018 3300053153 Bacteria 3763
1686 Ga0500622_0009106 3300053156 Bacteria 5513
1687 Ga0500627_0108538 3300053158 Bacteria 1249
1688 Ga0500630_000571 3300053159 Bacteria 16714
1689 Ga0500634_0000020 3300053161 Bacteria 106250
1690 Ga0500639_000016 3300053163 Bacteria 118099
1691 Ga0500636_0050949 3300053177 Bacteria 2433
1692 Ga0500636_0101990 3300053177 Bacteria 1630
1693 Ga0500637_0012256 3300053178 Bacteria 4462
1694 Ga0500649_094977 3300053722 Bacteria 1189
1695 Ga0500625_029782 3300053729 Bacteria 2592
1696 Ga0500645_000226 3300053730 Bacteria 42982
1697 Ga0500601_000607 3300053737 Bacteria 5085
1698 Ga0501084_0079121 3300054114 Bacteria 2755
1699 Ga0501084_0113611 3300054114 Bacteria 2276
1700 Ga0501084_0289740 3300054114 Bacteria 1383
1701 Ga0501084_0361105 3300054114 Bacteria 1227
1702 Ga0501084_0426208 3300054114 Bacteria 1121
1703 Ga0587085_008146 3300059506 Bacteria 1329
1704 Ga0501082_0000266 3300060353 Bacteria 46186
1705 Ga0501082_0007768 3300060353 Bacteria 9256
1706 Ga0501082_0101382 3300060353 Bacteria 2490
1707 Ga0466962_0029890 3300061719 Bacteria 2609
1708 Ga0530510_0043777 3300061734 Bacteria 3234
1709 Ga0530510_0256881 3300061734 Bacteria 1303

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046512 Ga0495610_0084361 Ga0495610_0084361_102_1055 305
2 3300035113 Ga0373936_0050055 Ga0373936_0050055_733_1659 308
3 3300035725 Ga0373947_0099267 Ga0373947_0099267_31_957 308
4 3300046674 Ga0495588_0004700 Ga0495588_0004700_34_960 308
5 3300048089 Ga0495614_0062655 Ga0495614_0062655_51_977 308
6 3300048910 Ga0496107_0407875 Ga0496107_0407875_14_940 308
7 3300005456 Ga0070678_100105370 Ga0070678_1001053702 324
8 3300005445 Ga0070708_100170803 Ga0070708_1001708032 327
9 3300005577 Ga0068857_100277970 Ga0068857_1002779701 327
10 3300025910 Ga0207684_10002166 Ga0207684_100021661 327
11 3300050494 nmdc:mga06z11_26425_c1 nmdc:mga06z11_26425_c1_263_1336 327
12 3300050496 nmdc:mga07m45_145268_c1 nmdc:mga07m45_145268_c1_144_1217 327
13 3300037312 Ga0395899_0124850 Ga0395899_0124850_580_1635 328
14 3300037466 Ga0395898_0007511 Ga0395898_0007511_10346_11401 328
15 3300038443 Ga0395901_0011181 Ga0395901_0011181_4441_5496 328
16 3300005985 Ga0081539_10017410 Ga0081539_100174103 332
17 iso_pu_bacteria 2643221618 2644104518 332
18 iso_pu_bacteria 2643221626 2644150118 332
19 iso_pu_bacteria 2643221655 2644307907 332
20 iso_pu_bacteria 2643221659 2644333634 332
21 iso_pu_bacteria 2643221698 2644544615 332
22 iso_pu_bacteria 2643221712 2644614062 332
23 iso_pu_bacteria 2844163670 2844167749 332
24 iso_pu_bacteria 2941499720 2941506154 332
25 3300037312 Ga0395899_0124691 Ga0395899_0124691_27_1037 335
26 3300046506 Ga0495583_0003990 Ga0495583_0003990_9747_10802 337
27 3300050513 nmdc:mga0rr50_157119_c1 nmdc:mga0rr50_157119_c1_29_1042 337
28 3300047315 Ga0495581_0061937 Ga0495581_0061937_12_1028 338
29 3300003187 JGI25151J46595_10000600 JGI25151J46595_1000060021 341
30 3300003215 JGI25153J46596_10002895 JGI25153J46596_100028958 341
31 3300003354 JGI25160J50197_1000323 JGI25160J50197_100032320 341
32 3300003374 JGI25161J50226_1003863 JGI25161J50226_10038631 341
33 3300003771 Ga0055526_1002692 Ga0055526_10026929 341
34 3300003775 Ga0055524_1000709 Ga0055524_10007098 341
35 3300003790 Ga0055528_1001863 Ga0055528_100186310 341
36 3300003792 Ga0055540_1010264 Ga0055540_10102642 341
37 3300004625 Ga0055543_1000636 Ga0055543_100063616 341
38 3300005262 Ga0065165_1005992 Ga0065165_10059924 341
39 3300006177 Ga0075362_10000500 Ga0075362_100005005 341
40 3300006178 Ga0075367_10002117 Ga0075367_100021178 341
41 3300006186 Ga0075369_10003007 Ga0075369_100030076 341
42 3300006195 Ga0075366_10004256 Ga0075366_100042565 341
43 3300006844 Ga0075428_100019515 Ga0075428_1000195155 341
44 3300006846 Ga0075430_100030141 Ga0075430_1000301411 341
45 3300006847 Ga0075431_100000986 Ga0075431_1000009869 341
46 3300009094 Ga0111539_10004845 Ga0111539_100048453 341
47 3300009147 Ga0114129_10004791 Ga0114129_1000479119 341
48 3300025245 Ga0207425_1011256 Ga0207425_10112562 341
49 3300025258 Ga0209129_1000367 Ga0209129_100036712 341
50 3300025273 Ga0209673_1000872 Ga0209673_100087216 341
51 3300025294 Ga0209025_1000228 Ga0209025_100022896 341
52 3300025295 Ga0209564_1000763 Ga0209564_100076337 341
53 3300025297 Ga0209758_1000113 Ga0209758_1000113134 341
54 3300025299 Ga0209256_1001449 Ga0209256_100144915 341
55 3300025302 Ga0207426_1000307 Ga0207426_100030770 341
56 3300027907 Ga0207428_10061970 Ga0207428_100619703 341
57 3300050493 nmdc:mga0k408_4525_c1 nmdc:mga0k408_4525_c1_4164_5225 341
58 3300050496 nmdc:mga07m45_5327_c1 nmdc:mga07m45_5327_c1_1556_2617 341
59 3300050507 nmdc:mga05p37_3181_c1 nmdc:mga05p37_3181_c1_1952_3019 341
60 3300050510 nmdc:mga06r32_3795_c1 nmdc:mga06r32_3795_c1_8175_9242 341
61 3300050511 nmdc:mga08y16_204_c3 nmdc:mga08y16_204_c3_1274_2341 341
62 3300025231 Ga0207427_101277 Ga0207427_1012775 342
63 3300049822 Ga0501035_0037803 Ga0501035_0037803_2362_3462 342
64 iso_pu_bacteria 2509276033 2509441518 342
65 iso_pu_bacteria 2513237103 2513710939 342
66 iso_pu_bacteria 2523231067 2523466473 342
67 iso_pu_bacteria 2529292951 2530649305 342
68 iso_pu_bacteria 2582581308 2585279908 342
69 iso_pu_bacteria 2582581315 2585326543 342
70 iso_pu_bacteria 2585427527 2585531688 342
71 iso_pu_bacteria 2585427528 2585541584 342
72 iso_pu_bacteria 2585427530 2585551365 342
73 iso_pu_bacteria 2585427593 2585840197 342
74 iso_pu_bacteria 2738541333 2739036198 342
75 iso_pu_bacteria 2738543031 2739351386 342
76 iso_pu_bacteria 2765235942 2766069279 342
77 iso_pu_bacteria 2791355259 2793317708 342
78 iso_pu_bacteria 2802429633 2806046301 342
79 iso_pu_bacteria 2802429634 2806053164 342
80 iso_pu_bacteria 2802429635 2806059628 342
81 iso_pu_bacteria 2802429636 2806068633 342
82 iso_pu_bacteria 2802429637 2806075055 342
83 iso_pu_bacteria 2818991453 2819638795 342
84 iso_pu_bacteria 2838042994 2838045322 342
85 iso_pu_bacteria 2842110456 2842111332 342
86 iso_pu_bacteria 2842217011 2842221443 342
87 iso_pu_bacteria 2857516855 2857518206 342
88 iso_pu_bacteria 2933586486 2933587886 342
89 iso_pu_bacteria 2936367885 2936374198 342
90 iso_pu_bacteria 2936375103 2936375290 342
91 iso_pu_bacteria 639633055 639645120 342
92 iso_pu_bacteria 8005376324 8005379994 342
93 iso_pu_bacteria 8005570704 8005572306 342
94 iso_pu_bacteria 8024479707 8024484869 342
95 3300049579 Ga0501043_0000072 Ga0501043_0000072_84955_86094 344
96 3300049580 Ga0501046_0000112 Ga0501046_0000112_82306_83445 344
97 3300049581 Ga0501047_0000138 Ga0501047_0000138_2928_4067 344
98 3300049582 Ga0501048_0016360 Ga0501048_0016360_1486_2625 344
99 3300049823 Ga0501044_0228567 Ga0501044_0228567_103_1242 344
100 3300049824 Ga0501045_0024845 Ga0501045_0024845_2900_4039 344
101 iso_pu_bacteria 2643221551 2643777953 344
102 iso_pu_bacteria 2643221555 2643796401 344
103 3300006844 Ga0075428_100036724 Ga0075428_1000367245 345
104 3300006846 Ga0075430_100004728 Ga0075430_10000472812 345
105 3300006852 Ga0075433_10025950 Ga0075433_100259503 345
106 3300006871 Ga0075434_100016025 Ga0075434_1000160254 345
107 3300006871 Ga0075434_100080389 Ga0075434_1000803893 345
108 3300009094 Ga0111539_10010943 Ga0111539_1001094311 345
109 3300009147 Ga0114129_10014380 Ga0114129_100143803 345
110 3300009147 Ga0114129_10084982 Ga0114129_100849824 345
111 3300027907 Ga0207428_10005357 Ga0207428_100053574 345
112 3300050507 nmdc:mga05p37_358703_c1 nmdc:mga05p37_358703_c1_301_1374 345
113 3300050507 nmdc:mga05p37_9682_c1 nmdc:mga05p37_9682_c1_690_1760 345
114 3300050508 nmdc:mga09592_2996_c1 nmdc:mga09592_2996_c1_11368_12438 345
115 3300050509 nmdc:mga0qj67_3244_c1 nmdc:mga0qj67_3244_c1_9636_10706 345
116 3300050510 nmdc:mga06r32_4964_c1 nmdc:mga06r32_4964_c1_1258_2328 345
117 3300050511 nmdc:mga08y16_5147_c1 nmdc:mga08y16_5147_c1_1226_2296 345
118 3300050512 nmdc:mga0n895_35962_c1 nmdc:mga0n895_35962_c1_2452_3522 345
119 3300050515 nmdc:mga0a205_5270_c1 nmdc:mga0a205_5270_c1_986_2056 345
120 iso_pu_bacteria 2643221595 2643989911 345
121 iso_pu_bacteria 2643221627 2644155217 345
122 iso_pu_bacteria 2854896431 2854900086 345
123 3300003215 JGI25153J46596_10017972 JGI25153J46596_100179722 346
124 3300003781 Ga0055536_1002798 Ga0055536_10027986 346
125 3300005548 Ga0070665_100022442 Ga0070665_1000224423 346
126 3300005563 Ga0068855_100436312 Ga0068855_1004363121 346
127 3300005834 Ga0068851_10077448 Ga0068851_100774482 346
128 3300009093 Ga0105240_10000013 Ga0105240_10000013248 346
129 3300009545 Ga0105237_10007434 Ga0105237_1000743410 346
130 3300010375 Ga0105239_10014249 Ga0105239_100142491 346
131 3300013104 Ga0157370_10000548 Ga0157370_1000054813 346
132 3300015262 Ga0182007_10011275 Ga0182007_100112753 346
133 3300015265 Ga0182005_1002419 Ga0182005_10024199 346
134 3300025253 Ga0209677_105484 Ga0209677_1054844 346
135 3300025261 Ga0209233_1000358 Ga0209233_10003584 346
136 3300025292 Ga0209676_1005236 Ga0209676_10052366 346
137 3300025297 Ga0209758_1000684 Ga0209758_100068411 346
138 3300025298 Ga0209050_1027177 Ga0209050_10271773 346
139 3300025321 Ga0207656_10092070 Ga0207656_100920701 346
140 3300025913 Ga0207695_10000044 Ga0207695_10000044206 346
141 3300025914 Ga0207671_10006361 Ga0207671_100063619 346
142 3300025949 Ga0207667_10380115 Ga0207667_103801151 346
143 3300028379 Ga0268266_10048955 Ga0268266_100489554 346
144 3300046492 Ga0495585_0139672 Ga0495585_0139672_178_1239 346
145 3300048903 Ga0496100_0004161 Ga0496100_0004161_6055_7125 346
146 3300048905 Ga0496102_0002571 Ga0496102_0002571_12773_13843 346
147 3300048906 Ga0496103_0011657 Ga0496103_0011657_2037_3107 346
148 3300048909 Ga0496106_0194970 Ga0496106_0194970_275_1345 346
149 3300048910 Ga0496107_0132845 Ga0496107_0132845_685_1755 346
150 3300048919 Ga0496116_0033300 Ga0496116_0033300_2383_3453 346
151 3300048920 Ga0496117_0001113 Ga0496117_0001113_39243_40313 346
152 3300048921 Ga0496118_0002207 Ga0496118_0002207_22464_23534 346
153 3300048922 Ga0496119_0114844 Ga0496119_0114844_235_1305 346
154 3300048923 Ga0496120_0018689 Ga0496120_0018689_3153_4223 346
155 3300048924 Ga0496121_0003282 Ga0496121_0003282_431_1501 346
156 3300048925 Ga0496122_0003250 Ga0496122_0003250_15131_16201 346
157 3300048926 Ga0496123_0002687 Ga0496123_0002687_7055_8125 346
158 3300048927 Ga0496124_0016929 Ga0496124_0016929_4298_5368 346
159 3300048928 Ga0496125_0002993 Ga0496125_0002993_15241_16311 346
160 3300048929 Ga0496126_0151971 Ga0496126_0151971_522_1592 346
161 iso_pu_bacteria 2510917026 2511169270 346
162 iso_pu_bacteria 2919171160 2919174071 346
163 iso_pu_bacteria 8054563764 8054566958 346
164 3300009553 Ga0105249_10405042 Ga0105249_104050421 347
165 3300013306 Ga0163162_10006607 Ga0163162_100066076 347
166 3300039093 Ga0400489_28284 Ga0400489_28284_1960_3099 347
167 3300050515 nmdc:mga0a205_66626_c1 nmdc:mga0a205_66626_c1_230_1276 347
168 3300053161 Ga0500634_0000020 Ga0500634_0000020_43904_44947 347
169 iso_pu_bacteria 2643221591 2643965462 347
170 iso_pu_bacteria 8019565922 8019569063 347
171 3300053153 Ga0500616_0000154 Ga0500616_0000154_22568_23635 348
172 3300053158 Ga0500627_0108538 Ga0500627_0108538_26_1093 348
173 iso_pu_bacteria 2852387548 2852394356 348
174 iso_pu_bacteria 8054563764 8054566968 348
175 3300028800 Ga0265338_10000092 Ga0265338_10000092130 349
176 3300031901 Ga0307406_10118811 Ga0307406_101188111 349
177 3300042876 Ga0451577_0036995 Ga0451577_0036995_1774_2826 349
178 3300046616 Ga0495668_0130456 Ga0495668_0130456_167_1225 349
179 3300046660 Ga0495625_0009866 Ga0495625_0009866_1678_2736 349
180 3300049586 Ga0501070_0124994 Ga0501070_0124994_119_1168 349
181 3300053151 Ga0500604_0010123 Ga0500604_0010123_1450_2508 349
182 3300054114 Ga0501084_0289740 Ga0501084_0289740_282_1334 349
183 iso_pu_bacteria 2503198000 2503199806 349
184 iso_pu_bacteria 2507262055 2507508304 349
185 iso_pu_bacteria 2508501009 2508542370 349
186 iso_pu_bacteria 2508501042 2508691875 349
187 iso_pu_bacteria 2508501128 2509151623 349
188 iso_pu_bacteria 2513237094 2513640614 349
189 iso_pu_bacteria 2515154112 2515627194 349
190 iso_pu_bacteria 2528768022 2528848586 349
191 iso_pu_bacteria 2791355197 2793068819 349
192 iso_pu_bacteria 2824600985 2824602450 349
193 iso_pu_bacteria 2824609381 2824610435 349
194 iso_pu_bacteria 2824653114 2824657387 349
195 iso_pu_bacteria 2824661429 2824661473 349
196 iso_pu_bacteria 2844315083 2844319328 349
197 iso_pu_bacteria 2874590934 2874598330 349
198 iso_pu_bacteria 2874628541 2874632161 349
199 iso_pu_bacteria 2874645413 2874652614 349
200 iso_pu_bacteria 2876761206 2876764860 349
201 iso_pu_bacteria 2876771140 2876778192 349
202 iso_pu_bacteria 2876818435 2876825939 349
203 iso_pu_bacteria 2879074833 2879081986 349
204 iso_pu_bacteria 2879099564 2879104577 349
205 iso_pu_bacteria 2879127579 2879135108 349
206 iso_pu_bacteria 2879142872 2879149792 349
207 iso_pu_bacteria 2885409591 2885410472 349
208 iso_pu_bacteria 2888388044 2888393536 349
209 iso_pu_bacteria 2888419890 2888424810 349
210 iso_pu_bacteria 2903727486 2903734269 349
211 iso_pu_bacteria 2906602504 2906605514 349
212 iso_pu_bacteria 2922368715 2922374745 349
213 iso_pu_bacteria 2929615660 2929621818 349
214 iso_pu_bacteria 2929624759 2929629875 349
215 iso_pu_bacteria 2932784394 2932788678 349
216 iso_pu_bacteria 2932794094 2932798079 349
217 iso_pu_bacteria 2932801729 2932807065 349
218 iso_pu_bacteria 2932809354 2932817381 349
219 iso_pu_bacteria 2932818245 2932826150 349
220 iso_pu_bacteria 2932828146 2932830326 349
221 iso_pu_bacteria 2933577622 2933583906 349
222 iso_pu_bacteria 2935608549 2935609211 349
223 iso_pu_bacteria 2935616580 2935616617 349
224 iso_pu_bacteria 2935638405 2935642053 349
225 iso_pu_bacteria 2935648319 2935650987 349
226 iso_pu_bacteria 2935656913 2935659168 349
227 iso_pu_bacteria 2935665750 2935672563 349
228 iso_pu_bacteria 2935675223 2935675966 349
229 iso_pu_bacteria 2935684952 2935685963 349
230 iso_pu_bacteria 2935694250 2935697792 349
231 iso_pu_bacteria 2935703347 2935705804 349
232 iso_pu_bacteria 2935713505 2935714515 349
233 iso_pu_bacteria 2935722832 2935725134 349
234 iso_pu_bacteria 2935732158 2935732506 349
235 iso_pu_bacteria 2935741537 2935741885 349
236 iso_pu_bacteria 2935750917 2935751928 349
237 iso_pu_bacteria 2935760218 2935765181 349
238 iso_pu_bacteria 2935769743 2935771777 349
239 iso_pu_bacteria 2935777560 2935778784 349
240 iso_pu_bacteria 2935785616 2935788828 349
241 iso_pu_bacteria 2935793552 2935795372 349
242 iso_pu_bacteria 2935801545 2935802801 349
243 iso_pu_bacteria 2935810662 2935813367 349
244 iso_pu_bacteria 2935819856 2935822371 349
245 iso_pu_bacteria 2935827899 2935830220 349
246 iso_pu_bacteria 2935837841 2935838117 349
247 iso_pu_bacteria 2935847175 2935847953 349
248 iso_pu_bacteria 2935855204 2935855241 349
249 iso_pu_bacteria 2935864058 2935867496 349
250 iso_pu_bacteria 2935873716 2935875666 349
251 iso_pu_bacteria 2935883170 2935886807 349
252 iso_pu_bacteria 2935908558 2935908827 349
253 iso_pu_bacteria 2935916978 2935919547 349
254 iso_pu_bacteria 2935926038 2935926599 349
255 iso_pu_bacteria 2935934488 2935935049 349
256 iso_pu_bacteria 2935942939 2935943499 349
257 iso_pu_bacteria 2935951376 2935951937 349
258 iso_pu_bacteria 2935959822 2935960695 349
259 iso_pu_bacteria 2935967501 2935968062 349
260 iso_pu_bacteria 2935975950 2935978688 349
261 iso_pu_bacteria 2935984226 2935987440 349
262 iso_pu_bacteria 2935992306 2935996349 349
263 iso_pu_bacteria 2936002035 2936003632 349
264 iso_pu_bacteria 2936011229 2936013583 349
265 iso_pu_bacteria 2936019824 2936022290 349
266 iso_pu_bacteria 2936028420 2936030736 349
267 iso_pu_bacteria 2936037263 2936042316 349
268 iso_pu_bacteria 2936046547 2936048549 349
269 iso_pu_bacteria 2936055302 2936058763 349
270 iso_pu_bacteria 2940556831 2940557269 349
271 iso_pu_bacteria 2941531003 2941533087 349
272 iso_pu_bacteria 2941538514 2941539216 349
273 iso_pu_bacteria 3005594810 3005599516 349
274 iso_pu_bacteria 3005710791 3005715187 349
275 iso_pu_bacteria 3005718088 3005722574 349
276 iso_pu_bacteria 8016511872 8016521978 349
277 iso_pu_bacteria 8016522445 8016529336 349
278 iso_pu_bacteria 8016530956 8016534551 349
279 iso_pu_bacteria 8016539877 8016547769 349
280 iso_pu_bacteria 8016548790 8016554367 349
281 iso_pu_bacteria 8016557553 8016562735 349
282 iso_pu_bacteria 8016575299 8016577052 349
283 iso_pu_bacteria 8016595262 8016600519 349
284 iso_pu_bacteria 8016603502 8016610227 349
285 iso_pu_bacteria 8016613128 8016614706 349
286 iso_pu_bacteria 8016622563 8016626284 349
287 iso_pu_bacteria 8016630954 8016640022 349
288 iso_pu_bacteria 8017057580 8017063687 349
289 iso_pu_bacteria 8019530166 8019534314 349
290 iso_pu_bacteria 8019538911 8019545146 349
291 iso_pu_bacteria 8019547302 8019553377 349
292 iso_pu_bacteria 8019576017 8019583017 349
293 iso_pu_bacteria 8019586578 8019590814 349
294 iso_pu_bacteria 8019597564 8019600535 349
295 iso_pu_bacteria 8019608314 8019618012 349
296 iso_pu_bacteria 8019619141 8019628489 349
297 iso_pu_bacteria 8019629233 8019634145 349
298 iso_pu_bacteria 8019659431 8019662024 349
299 iso_pu_bacteria 8019678201 8019684555 349
300 iso_pu_bacteria 8019687851 8019690364 349
301 iso_pu_bacteria 8055742211 8055746016 349
302 iso_pu_bacteria 8056967851 8056968304 349
303 3300003781 Ga0055536_1003653 Ga0055536_10036536 350
304 3300003792 Ga0055540_1004229 Ga0055540_10042292 350
305 3300003794 Ga0055531_10002995 Ga0055531_100029958 350
306 3300009093 Ga0105240_10011470 Ga0105240_100114705 350
307 3300010375 Ga0105239_10031739 Ga0105239_100317394 350
308 3300025292 Ga0209676_1000580 Ga0209676_100058048 350
309 3300025297 Ga0209758_1001509 Ga0209758_100150919 350
310 3300025298 Ga0209050_1011385 Ga0209050_10113853 350
311 3300025303 Ga0209051_1004819 Ga0209051_10048192 350
312 3300025304 Ga0209257_1001372 Ga0209257_100137222 350
313 3300044706 Ga0466964_0026404 Ga0466964_0026404_766_1818 350
314 3300048910 Ga0496107_0014142 Ga0496107_0014142_2736_3788 350
315 3300048913 Ga0496110_0329352 Ga0496110_0329352_67_1122 350
316 3300048921 Ga0496118_0091952 Ga0496118_0091952_795_1847 350
317 3300053153 Ga0500616_0020018 Ga0500616_0020018_2263_3315 350
318 3300053156 Ga0500622_0009106 Ga0500622_0009106_195_1247 350
319 iso_pu_bacteria 2513237160 2514008676 350
320 iso_pu_bacteria 2671180139 2671695655 350
321 iso_pu_bacteria 2928521798 2928522500 350
322 iso_pu_bacteria 2954011201 2954014104 350
323 iso_pu_bacteria 2960631154 2960633617 350
324 iso_pu_bacteria 2970122695 2970128005 350
325 3300006051 Ga0075364_10004240 Ga0075364_100042406 351
326 3300006844 Ga0075428_100321987 Ga0075428_1003219872 351
327 3300006847 Ga0075431_100108731 Ga0075431_1001087312 351
328 3300006880 Ga0075429_100205242 Ga0075429_1002052421 351
329 3300025901 Ga0207688_10028561 Ga0207688_100285611 351
330 3300025937 Ga0207669_10177271 Ga0207669_101772711 351
331 3300031995 Ga0307409_100103111 Ga0307409_1001031112 351
332 3300045051 Ga0451576_0007753 Ga0451576_0007753_5076_6137 351
333 3300046615 Ga0495656_0010707 Ga0495656_0010707_1305_2381 351
334 3300049574 Ga0501038_0046396 Ga0501038_0046396_389_1453 351
335 3300049592 Ga0501076_0009957 Ga0501076_0009957_2969_4033 351
336 3300050510 nmdc:mga06r32_208713_c1 nmdc:mga06r32_208713_c1_745_1830 351
337 3300061734 Ga0530510_0256881 Ga0530510_0256881_118_1182 351
338 iso_pu_bacteria 2513237092 2513622434 351
339 iso_pu_bacteria 2513237095 2513645541 351
340 iso_pu_bacteria 2513237096 2513657851 351
341 iso_pu_bacteria 2513237101 2513692864 351
342 iso_pu_bacteria 2513237102 2513702390 351
343 iso_pu_bacteria 2513237104 2513718473 351
344 iso_pu_bacteria 2513237137 2513855551 351
345 iso_pu_bacteria 2513237139 2513873052 351
346 iso_pu_bacteria 2513237145 2513920056 351
347 iso_pu_bacteria 2513237161 2514015650 351
348 iso_pu_bacteria 2517093001 2517102761 351
349 iso_pu_bacteria 2517572143 2517892096 351
350 iso_pu_bacteria 2524023205 2524437632 351
351 iso_pu_bacteria 2524023228 2524534180 351
352 iso_pu_bacteria 2617270735 2617347085 351
353 iso_pu_bacteria 2617270741 2617375480 351
354 iso_pu_bacteria 2643221547 2643758383 351
355 iso_pu_bacteria 2667528175 2671121866 351
356 iso_pu_bacteria 2721755755 2723844769 351
357 iso_pu_bacteria 2728368998 2728751100 351
358 iso_pu_bacteria 2744054633 2745079565 351
359 iso_pu_bacteria 2791355196 2793062685 351
360 iso_pu_bacteria 2791355199 2793079887 351
361 iso_pu_bacteria 2802429603 2805915049 351
362 iso_pu_bacteria 2816332527 2818238588 351
363 iso_pu_bacteria 2824617872 2824618012 351
364 iso_pu_bacteria 2824626560 2824626680 351
365 iso_pu_bacteria 2824635225 2824636685 351
366 iso_pu_bacteria 2824644064 2824648988 351
367 iso_pu_bacteria 2824671348 2824674905 351
368 iso_pu_bacteria 2824679649 2824685820 351
369 iso_pu_bacteria 2824687955 2824691330 351
370 iso_pu_bacteria 2824696289 2824699490 351
371 iso_pu_bacteria 2824704595 2824711558 351
372 iso_pu_bacteria 2824714736 2824719276 351
373 iso_pu_bacteria 2824723954 2824729681 351
374 iso_pu_bacteria 2824732956 2824733358 351
375 iso_pu_bacteria 2824746037 2824746515 351
376 iso_pu_bacteria 2824753945 2824754262 351
377 iso_pu_bacteria 2824763712 2824768999 351
378 iso_pu_bacteria 2824773399 2824775343 351
379 iso_pu_bacteria 2838122688 2838123441 351
380 iso_pu_bacteria 2841941048 2841947786 351
381 iso_pu_bacteria 2841949485 2841949543 351
382 iso_pu_bacteria 2841957949 2841964138 351
383 iso_pu_bacteria 2841966195 2841971950 351
384 iso_pu_bacteria 2841974524 2841974707 351
385 iso_pu_bacteria 2841983080 2841983735 351
386 iso_pu_bacteria 2842038055 2842040095 351
387 iso_pu_bacteria 2842045827 2842046960 351
388 iso_pu_bacteria 2847930680 2847936507 351
389 iso_pu_bacteria 2847939898 2847946853 351
390 iso_pu_bacteria 2849076700 2849079044 351
391 iso_pu_bacteria 2857509624 2857516706 351
392 iso_pu_bacteria 2874604998 2874605510 351
393 iso_pu_bacteria 2874612657 2874619465 351
394 iso_pu_bacteria 2874620515 2874627519 351
395 iso_pu_bacteria 2876808645 2876813056 351
396 iso_pu_bacteria 2879083081 2879089457 351
397 iso_pu_bacteria 2879110137 2879115830 351
398 iso_pu_bacteria 2881364244 2881368569 351
399 iso_pu_bacteria 2881665667 2881672616 351
400 iso_pu_bacteria 2885366525 2885369178 351
401 iso_pu_bacteria 2885374607 2885381711 351
402 iso_pu_bacteria 2888378607 2888384382 351
403 iso_pu_bacteria 2889033259 2889039468 351
404 iso_pu_bacteria 2903748898 2903753390 351
405 iso_pu_bacteria 2904666416 2904673161 351
406 iso_pu_bacteria 2904690495 2904694838 351
407 iso_pu_bacteria 2904699407 2904702218 351
408 iso_pu_bacteria 2904711408 2904714985 351
409 iso_pu_bacteria 2906610324 2906617227 351
410 iso_pu_bacteria 2906626472 2906633616 351
411 iso_pu_bacteria 2906635258 2906643384 351
412 iso_pu_bacteria 2906643746 2906651294 351
413 iso_pu_bacteria 2906660503 2906662485 351
414 iso_pu_bacteria 2908739725 2908742376 351
415 iso_pu_bacteria 2908756301 2908760058 351
416 iso_pu_bacteria 2908775508 2908780460 351
417 iso_pu_bacteria 2922361189 2922365646 351
418 iso_pu_bacteria 2922386360 2922391261 351
419 iso_pu_bacteria 2922393267 2922400515 351
420 iso_pu_bacteria 2922425934 2922430602 351
421 iso_pu_bacteria 2935630451 2935631233 351
422 iso_pu_bacteria 2941507105 2941509974 351
423 iso_pu_bacteria 2941515067 2941518939 351
424 iso_pu_bacteria 2941523033 2941525373 351
425 iso_pu_bacteria 3005474847 3005480512 351
426 iso_pu_bacteria 3005483717 3005484601 351
427 iso_pu_bacteria 3005506211 3005510599 351
428 iso_pu_bacteria 3005587118 3005587761 351
429 iso_pu_bacteria 8006926726 8006931535 351
430 iso_pu_bacteria 8006933436 8006940264 351
431 iso_pu_bacteria 8006964411 8006967021 351
432 iso_pu_bacteria 8006973647 8006980042 351
433 iso_pu_bacteria 8006984368 8006987975 351
434 iso_pu_bacteria 8006994254 8006995705 351
435 iso_pu_bacteria 8019555841 8019556247 351
436 iso_pu_bacteria 8019648815 8019658828 351
437 iso_pu_bacteria 8056673599 8056677661 351
438 iso_pu_bacteria 8056689827 8056694252 351
439 3300002987 JGI25159J45721_1000210 JGI25159J45721_100021011 352
440 3300003354 JGI25160J50197_1000069 JGI25160J50197_100006925 352
441 3300003374 JGI25161J50226_1000049 JGI25161J50226_100004995 352
442 3300004625 Ga0055543_1000024 Ga0055543_100002480 352
443 3300005262 Ga0065165_1000202 Ga0065165_100020260 352
444 3300005355 Ga0070671_100007098 Ga0070671_1000070983 352
445 3300006175 Ga0070712_100211177 Ga0070712_1002111771 352
446 3300009177 Ga0105248_10000471 Ga0105248_1000047125 352
447 3300013306 Ga0163162_10035411 Ga0163162_100354113 352
448 3300020070 Ga0206356_10283358 Ga0206356_102833581 352
449 3300020077 Ga0206351_10620691 Ga0206351_106206911 352
450 3300020080 Ga0206350_10527760 Ga0206350_105277602 352
451 3300020082 Ga0206353_10224996 Ga0206353_102249961 352
452 3300022467 Ga0224712_10037983 Ga0224712_100379831 352
453 3300025284 Ga0209130_1000013 Ga0209130_1000013132 352
454 3300025302 Ga0207426_1000022 Ga0207426_1000022250 352
455 3300025931 Ga0207644_10014331 Ga0207644_100143313 352
456 3300025941 Ga0207711_10009143 Ga0207711_1000914310 352
457 3300028794 Ga0307515_10000950 Ga0307515_1000095028 352
458 3300031730 Ga0307516_10063808 Ga0307516_100638083 352
459 3300031852 Ga0307410_10027386 Ga0307410_100273863 352
460 3300048922 Ga0496119_0040194 Ga0496119_0040194_279_1352 352
461 3300048924 Ga0496121_0023452 Ga0496121_0023452_2783_3856 352
462 3300048928 Ga0496125_0087127 Ga0496125_0087127_553_1611 352
463 3300049591 Ga0501075_0319266 Ga0501075_0319266_83_1150 352
464 3300053151 Ga0500604_0000229 Ga0500604_0000229_4416_5483 352
465 3300003752 Ga0055539_1001746 Ga0055539_10017462 353
466 3300004625 Ga0055543_1021435 Ga0055543_10214351 353
467 3300005262 Ga0065165_1004658 Ga0065165_10046582 353
468 3300005434 Ga0070709_10015742 Ga0070709_100157423 353
469 3300005435 Ga0070714_100019885 Ga0070714_1000198852 353
470 3300005435 Ga0070714_100046922 Ga0070714_1000469222 353
471 3300005435 Ga0070714_100123907 Ga0070714_1001239071 353
472 3300005436 Ga0070713_100131027 Ga0070713_1001310272 353
473 3300005437 Ga0070710_10000567 Ga0070710_1000056711 353
474 3300005439 Ga0070711_100003646 Ga0070711_1000036465 353
475 3300005455 Ga0070663_100338757 Ga0070663_1003387571 353
476 3300005458 Ga0070681_10061567 Ga0070681_100615672 353
477 3300005459 Ga0068867_100214950 Ga0068867_1002149501 353
478 3300005539 Ga0068853_100074704 Ga0068853_1000747042 353
479 3300005549 Ga0070704_100265590 Ga0070704_1002655901 353
480 3300005578 Ga0068854_100335245 Ga0068854_1003352452 353
481 3300005616 Ga0068852_100002288 Ga0068852_1000022883 353
482 3300005617 Ga0068859_100135465 Ga0068859_1001354652 353
483 3300005983 Ga0081540_1005876 Ga0081540_10058768 353
484 3300006038 Ga0075365_10239829 Ga0075365_102398292 353
485 3300006175 Ga0070712_100032973 Ga0070712_1000329732 353
486 3300006847 Ga0075431_100060543 Ga0075431_1000605433 353
487 3300006931 Ga0097620_100135460 Ga0097620_1001354602 353
488 3300009093 Ga0105240_10011032 Ga0105240_1001103210 353
489 3300009147 Ga0114129_10039254 Ga0114129_100392544 353
490 3300009174 Ga0105241_10054453 Ga0105241_100544532 353
491 3300009545 Ga0105237_10009082 Ga0105237_1000908210 353
492 3300010375 Ga0105239_10068450 Ga0105239_100684502 353
493 3300013104 Ga0157370_10030134 Ga0157370_100301343 353
494 3300013104 Ga0157370_10103522 Ga0157370_101035222 353
495 3300025230 Ga0209563_102298 Ga0209563_1022982 353
496 3300025253 Ga0209677_101018 Ga0209677_1010185 353
497 3300025253 Ga0209677_101344 Ga0209677_1013444 353
498 3300025254 Ga0209148_1000475 Ga0209148_100047524 353
499 3300025261 Ga0209233_1002540 Ga0209233_10025403 353
500 3300025261 Ga0209233_1010781 Ga0209233_10107812 353
501 3300025272 Ga0209455_1001935 Ga0209455_10019353 353
502 3300025297 Ga0209758_1007908 Ga0209758_10079083 353
503 3300025898 Ga0207692_10009738 Ga0207692_100097382 353
504 3300025911 Ga0207654_10067398 Ga0207654_100673981 353
505 3300025913 Ga0207695_10000008 Ga0207695_1000000857 353
506 3300025914 Ga0207671_10010828 Ga0207671_100108282 353
507 3300025915 Ga0207693_10000581 Ga0207693_1000058111 353
508 3300025916 Ga0207663_10000084 Ga0207663_1000008418 353
509 3300025916 Ga0207663_10214559 Ga0207663_102145592 353
510 3300025919 Ga0207657_10018566 Ga0207657_100185664 353
511 3300025928 Ga0207700_10133971 Ga0207700_101339712 353
512 3300025929 Ga0207664_10024979 Ga0207664_100249792 353
513 3300025929 Ga0207664_10107250 Ga0207664_101072502 353
514 3300025933 Ga0207706_10102247 Ga0207706_101022471 353
515 3300025939 Ga0207665_10003511 Ga0207665_100035117 353
516 3300026023 Ga0207677_10043687 Ga0207677_100436872 353
517 3300026067 Ga0207678_10024738 Ga0207678_100247382 353
518 3300026089 Ga0207648_10050432 Ga0207648_100504323 353
519 3300028379 Ga0268266_10092365 Ga0268266_100923651 353
520 3300028556 Ga0265337_1002708 Ga0265337_10027082 353
521 3300028558 Ga0265326_10010670 Ga0265326_100106702 353
522 3300028563 Ga0265319_1004129 Ga0265319_10041292 353
523 3300028573 Ga0265334_10001756 Ga0265334_100017563 353
524 3300028653 Ga0265323_10001892 Ga0265323_100018927 353
525 3300028666 Ga0265336_10003392 Ga0265336_100033922 353
526 3300028800 Ga0265338_10000321 Ga0265338_1000032112 353
527 3300029957 Ga0265324_10019180 Ga0265324_100191801 353
528 3300031241 Ga0265325_10000675 Ga0265325_1000067520 353
529 3300031241 Ga0265325_10010821 Ga0265325_100108213 353
530 3300031247 Ga0265340_10005245 Ga0265340_100052454 353
531 3300031250 Ga0265331_10037975 Ga0265331_100379752 353
532 3300031595 Ga0265313_10020638 Ga0265313_100206382 353
533 3300031616 Ga0307508_10189556 Ga0307508_101895561 353
534 3300031711 Ga0265314_10009137 Ga0265314_100091372 353
535 3300031711 Ga0265314_10011261 Ga0265314_100112615 353
536 3300031712 Ga0265342_10017129 Ga0265342_100171293 353
537 3300033180 Ga0307510_10008141 Ga0307510_100081419 353
538 3300035117 Ga0373953_0012229 Ga0373953_0012229_136_1197 353
539 3300035120 Ga0373957_0010237 Ga0373957_0010237_1097_2158 353
540 3300035172 Ga0373955_0027657 Ga0373955_0027657_1007_2068 353
541 3300035724 Ga0373933_0187528 Ga0373933_0187528_120_1181 353
542 3300036401 Ga0373937_0027190 Ga0373937_0027190_3858_4919 353
543 3300037466 Ga0395898_0048176 Ga0395898_0048176_444_1517 353
544 3300037466 Ga0395898_0441700 Ga0395898_0441700_45_1106 353
545 3300037471 Ga0395905_0087304 Ga0395905_0087304_1176_2237 353
546 3300038443 Ga0395901_0364460 Ga0395901_0364460_52_1125 353
547 3300039437 Ga0436365_0771718 Ga0436365_0771718_364_1425 353
548 3300039453 Ga0436362_0716278 Ga0436362_0716278_1819_2880 353
549 3300044684 Ga0466966_0000065 Ga0466966_0000065_2396_3457 353
550 3300044693 Ga0466961_0000154 Ga0466961_0000154_30264_31325 353
551 3300044694 Ga0466963_0030858 Ga0466963_0030858_153_1214 353
552 3300045049 Ga0466959_0004864 Ga0466959_0004864_5043_6104 353
553 3300045976 Ga0466967_0007434 Ga0466967_0007434_440_1501 353
554 3300045976 Ga0466967_0062586 Ga0466967_0062586_1566_2627 353
555 3300046455 Ga0495603_0044614 Ga0495603_0044614_1391_2452 353
556 3300046459 Ga0495629_0015849 Ga0495629_0015849_3022_4083 353
557 3300046459 Ga0495629_0148235 Ga0495629_0148235_430_1491 353
558 3300046460 Ga0495638_0017268 Ga0495638_0017268_2915_3976 353
559 3300046462 Ga0495651_0000821 Ga0495651_0000821_8345_9406 353
560 3300046462 Ga0495651_0062573 Ga0495651_0062573_1619_2680 353
561 3300046463 Ga0495653_0053810 Ga0495653_0053810_289_1350 353
562 3300046507 Ga0495606_0008377 Ga0495606_0008377_2591_3652 353
563 3300046516 Ga0495628_0042818 Ga0495628_0042818_1041_2102 353
564 3300046516 Ga0495628_0125348 Ga0495628_0125348_286_1347 353
565 3300046522 Ga0495643_0055480 Ga0495643_0055480_732_1793 353
566 3300046529 Ga0495652_0084854 Ga0495652_0084854_1503_2564 353
567 3300046533 Ga0495640_0048507 Ga0495640_0048507_1004_2065 353
568 3300046536 Ga0495587_0011112 Ga0495587_0011112_3886_4947 353
569 3300046536 Ga0495587_0011231 Ga0495587_0011231_1010_2071 353
570 3300046559 Ga0495667_0050531 Ga0495667_0050531_1664_2725 353
571 3300046663 Ga0495635_0002471 Ga0495635_0002471_7467_8528 353
572 3300046663 Ga0495635_0102187 Ga0495635_0102187_796_1857 353
573 3300046675 Ga0495657_0025281 Ga0495657_0025281_658_1719 353
574 3300046675 Ga0495657_0028310 Ga0495657_0028310_1753_2814 353
575 3300046678 Ga0495599_0005682 Ga0495599_0005682_4108_5169 353
576 3300046678 Ga0495599_0006827 Ga0495599_0006827_2774_3835 353
577 3300046679 Ga0495623_0006077 Ga0495623_0006077_2533_3594 353
578 3300046680 Ga0495646_0087876 Ga0495646_0087876_590_1651 353
579 3300046689 Ga0495613_0170594 Ga0495613_0170594_267_1328 353
580 3300046690 Ga0495624_0062978 Ga0495624_0062978_667_1728 353
581 3300046809 Ga0495600_0039665 Ga0495600_0039665_979_2040 353
582 3300047317 Ga0495604_0018158 Ga0495604_0018158_1349_2410 353
583 3300047322 Ga0495680_0008204 Ga0495680_0008204_6253_7314 353
584 3300047322 Ga0495680_0022767 Ga0495680_0022767_641_1702 353
585 3300047444 Ga0495675_0012731 Ga0495675_0012731_1906_2967 353
586 3300047444 Ga0495675_0039422 Ga0495675_0039422_1780_2841 353
587 3300048088 Ga0495602_0002373 Ga0495602_0002373_16448_17509 353
588 3300048907 Ga0496104_0001608 Ga0496104_0001608_7713_8774 353
589 3300048907 Ga0496104_0040661 Ga0496104_0040661_1637_2719 353
590 3300048908 Ga0496105_0013595 Ga0496105_0013595_250_1311 353
591 3300048909 Ga0496106_0004195 Ga0496106_0004195_6350_7411 353
592 3300048909 Ga0496106_0114552 Ga0496106_0114552_555_1616 353
593 3300048910 Ga0496107_0005355 Ga0496107_0005355_3947_5008 353
594 3300048912 Ga0496109_0002891 Ga0496109_0002891_5660_6721 353
595 3300048913 Ga0496110_0006680 Ga0496110_0006680_2601_3683 353
596 3300048914 Ga0496111_0027351 Ga0496111_0027351_1455_2537 353
597 3300048915 Ga0496112_0015385 Ga0496112_0015385_4826_5887 353
598 3300048917 Ga0496114_0298942 Ga0496114_0298942_310_1392 353
599 3300048918 Ga0496115_0167310 Ga0496115_0167310_736_1797 353
600 3300048921 Ga0496118_0021354 Ga0496118_0021354_1235_2299 353
601 3300048922 Ga0496119_0003438 Ga0496119_0003438_3103_4164 353
602 3300048923 Ga0496120_0029886 Ga0496120_0029886_1970_3031 353
603 3300048924 Ga0496121_0015952 Ga0496121_0015952_4314_5378 353
604 3300048924 Ga0496121_0057763 Ga0496121_0057763_624_1685 353
605 3300048924 Ga0496121_0138248 Ga0496121_0138248_428_1489 353
606 3300048927 Ga0496124_0027613 Ga0496124_0027613_3450_4511 353
607 3300048927 Ga0496124_0030532 Ga0496124_0030532_2327_3388 353
608 3300048928 Ga0496125_0037091 Ga0496125_0037091_3154_4215 353
609 3300048929 Ga0496126_0004265 Ga0496126_0004265_1441_2502 353
610 3300048929 Ga0496126_0021670 Ga0496126_0021670_2870_3931 353
611 3300048929 Ga0496126_0059053 Ga0496126_0059053_1033_2094 353
612 3300048929 Ga0496126_0075342 Ga0496126_0075342_334_1395 353
613 3300048929 Ga0496126_0103663 Ga0496126_0103663_1119_2186 353
614 3300049568 Ga0501031_0026605 Ga0501031_0026605_1437_2498 353
615 3300049569 Ga0501032_0000619 Ga0501032_0000619_13741_14802 353
616 3300049570 Ga0501033_0000108 Ga0501033_0000108_26041_27102 353
617 3300049570 Ga0501033_0008940 Ga0501033_0008940_3199_4287 353
618 3300049571 Ga0501034_0000100 Ga0501034_0000100_123108_124169 353
619 3300049572 Ga0501036_0005602 Ga0501036_0005602_4632_5720 353
620 3300049573 Ga0501037_0000153 Ga0501037_0000153_7271_8332 353
621 3300049573 Ga0501037_0007559 Ga0501037_0007559_5756_6844 353
622 3300049574 Ga0501038_0000138 Ga0501038_0000138_56142_57203 353
623 3300049575 Ga0501039_0001334 Ga0501039_0001334_10801_11862 353
624 3300049575 Ga0501039_0021206 Ga0501039_0021206_538_1626 353
625 3300049578 Ga0501042_0030014 Ga0501042_0030014_2174_3235 353
626 3300049579 Ga0501043_0000085 Ga0501043_0000085_52167_53228 353
627 3300049579 Ga0501043_0000122 Ga0501043_0000122_1678_2766 353
628 3300049580 Ga0501046_0001536 Ga0501046_0001536_20064_21152 353
629 3300049581 Ga0501047_0000221 Ga0501047_0000221_40307_41368 353
630 3300049582 Ga0501048_0028911 Ga0501048_0028911_468_1556 353
631 3300049583 Ga0501067_0003478 Ga0501067_0003478_847_1908 353
632 3300049584 Ga0501068_0000689 Ga0501068_0000689_14467_15528 353
633 3300049585 Ga0501069_0009070 Ga0501069_0009070_947_2008 353
634 3300049585 Ga0501069_0019871 Ga0501069_0019871_1591_2652 353
635 3300049585 Ga0501069_0112356 Ga0501069_0112356_312_1400 353
636 3300049586 Ga0501070_0009879 Ga0501070_0009879_4375_5463 353
637 3300049586 Ga0501070_0070401 Ga0501070_0070401_1318_2379 353
638 3300049587 Ga0501071_0009224 Ga0501071_0009224_1369_2430 353
639 3300049588 Ga0501072_0001591 Ga0501072_0001591_4306_5367 353
640 3300049588 Ga0501072_0243898 Ga0501072_0243898_223_1311 353
641 3300049589 Ga0501073_0000290 Ga0501073_0000290_16250_17311 353
642 3300049590 Ga0501074_0000094 Ga0501074_0000094_29895_30956 353
643 3300049741 Ga0501079_0011578 Ga0501079_0011578_4525_5586 353
644 3300049742 Ga0501080_0000104 Ga0501080_0000104_3416_4504 353
645 3300049742 Ga0501080_0004806 Ga0501080_0004806_7331_8392 353
646 3300049744 Ga0501083_0000087 Ga0501083_0000087_45548_46609 353
647 3300049822 Ga0501035_0000016 Ga0501035_0000016_237856_238944 353
648 3300049822 Ga0501035_0000127 Ga0501035_0000127_82017_83078 353
649 3300049822 Ga0501035_0000223 Ga0501035_0000223_46097_47158 353
650 3300049822 Ga0501035_0029522 Ga0501035_0029522_2977_4050 353
651 3300049823 Ga0501044_0000970 Ga0501044_0000970_1375_2436 353
652 3300049823 Ga0501044_0093247 Ga0501044_0093247_1099_2172 353
653 3300049824 Ga0501045_0056865 Ga0501045_0056865_645_1733 353
654 3300050507 nmdc:mga05p37_157565_c1 nmdc:mga05p37_157565_c1_1299_2378 353
655 3300050510 nmdc:mga06r32_144049_c1 nmdc:mga06r32_144049_c1_489_1550 353
656 3300053077 Ga0495601_0009894 Ga0495601_0009894_1409_2470 353
657 3300053078 Ga0495612_0016126 Ga0495612_0016126_1205_2266 353
658 3300053084 Ga0495595_0022754 Ga0495595_0022754_1653_2714 353
659 3300053087 Ga0500643_000035 Ga0500643_000035_83159_84220 353
660 3300053091 Ga0500647_0026741 Ga0500647_0026741_896_1957 353
661 3300053093 Ga0500651_0000660 Ga0500651_0000660_5712_6776 353
662 3300053094 Ga0500566_0000006 Ga0500566_0000006_82050_83111 353
663 3300053095 Ga0500640_015397 Ga0500640_015397_1419_2480 353
664 3300053096 Ga0500641_0006784 Ga0500641_0006784_2288_3349 353
665 3300053105 Ga0500557_000004 Ga0500557_000004_69572_70633 353
666 3300053119 Ga0500595_006441 Ga0500595_006441_3309_4373 353
667 3300053122 Ga0500608_011998 Ga0500608_011998_979_2040 353
668 3300053123 Ga0500614_001760 Ga0500614_001760_61_1122 353
669 3300053130 Ga0500642_0000133 Ga0500642_0000133_25071_26132 353
670 3300053136 Ga0500559_0001576 Ga0500559_0001576_2603_3664 353
671 3300053150 Ga0500603_001602 Ga0500603_001602_1467_2528 353
672 3300053159 Ga0500630_000571 Ga0500630_000571_13566_14627 353
673 3300053163 Ga0500639_000016 Ga0500639_000016_65640_66701 353
674 3300053177 Ga0500636_0050949 Ga0500636_0050949_465_1526 353
675 3300053177 Ga0500636_0101990 Ga0500636_0101990_351_1412 353
676 3300053722 Ga0500649_094977 Ga0500649_094977_17_1078 353
677 3300053729 Ga0500625_029782 Ga0500625_029782_286_1347 353
678 3300053737 Ga0500601_000607 Ga0500601_000607_1784_2845 353
679 3300054114 Ga0501084_0079121 Ga0501084_0079121_1582_2643 353
680 3300060353 Ga0501082_0007768 Ga0501082_0007768_4886_5947 353
681 3300061719 Ga0466962_0029890 Ga0466962_0029890_476_1537 353
682 3300003579 Ga0007429J51699_1107255 Ga0007429J51699_11072552 354
683 3300005331 Ga0070670_100000403 Ga0070670_10000040320 354
684 3300005331 Ga0070670_100099778 Ga0070670_1000997782 354
685 3300005338 Ga0068868_100027002 Ga0068868_1000270024 354
686 3300005364 Ga0070673_100014070 Ga0070673_1000140704 354
687 3300005459 Ga0068867_100085008 Ga0068867_1000850082 354
688 3300005548 Ga0070665_100106738 Ga0070665_1001067382 354
689 3300005564 Ga0070664_100173668 Ga0070664_1001736682 354
690 3300005618 Ga0068864_100162047 Ga0068864_1001620472 354
691 3300005840 Ga0068870_10044340 Ga0068870_100443402 354
692 3300009098 Ga0105245_10045759 Ga0105245_100457593 354
693 3300009101 Ga0105247_10030643 Ga0105247_100306432 354
694 3300009147 Ga0114129_10081529 Ga0114129_100815292 354
695 3300013308 Ga0157375_10216761 Ga0157375_102167612 354
696 3300022739 Ga0228711_1013535 Ga0228711_10135355 354
697 3300022740 Ga0228710_1013900 Ga0228710_10139005 354
698 3300025893 Ga0207682_10001129 Ga0207682_1000112910 354
699 3300025900 Ga0207710_10032588 Ga0207710_100325882 354
700 3300025925 Ga0207650_10000408 Ga0207650_1000040812 354
701 3300025926 Ga0207659_10000256 Ga0207659_1000025611 354
702 3300025927 Ga0207687_10029353 Ga0207687_100293532 354
703 3300025931 Ga0207644_10015516 Ga0207644_100155164 354
704 3300025940 Ga0207691_10000360 Ga0207691_1000036024 354
705 3300025960 Ga0207651_10068414 Ga0207651_100684143 354
706 3300026089 Ga0207648_10023261 Ga0207648_100232615 354
707 3300026095 Ga0207676_10008222 Ga0207676_100082222 354
708 3300026121 Ga0207683_10003821 Ga0207683_100038211 354
709 3300031548 Ga0307408_100068810 Ga0307408_1000688103 354
710 3300031727 Ga0316576_10151946 Ga0316576_101519462 354
711 3300031733 Ga0316577_10005660 Ga0316577_100056604 354
712 3300031733 Ga0316577_10083912 Ga0316577_100839122 354
713 3300031901 Ga0307406_10004966 Ga0307406_100049663 354
714 3300031911 Ga0307412_10011920 Ga0307412_100119204 354
715 3300031995 Ga0307409_100067274 Ga0307409_1000672743 354
716 3300032004 Ga0307414_10014216 Ga0307414_100142161 354
717 3300032005 Ga0307411_10015181 Ga0307411_100151814 354
718 3300032168 Ga0316593_10032743 Ga0316593_100327432 354
719 3300036647 Ga0316582_0024005 Ga0316582_0024005_1156_2259 354
720 3300036712 Ga0316584_0194540 Ga0316584_0194540_146_1249 354
721 3300042876 Ga0451577_0013112 Ga0451577_0013112_2859_3929 354
722 3300049581 Ga0501047_0150317 Ga0501047_0150317_1016_2080 354
723 3300050507 nmdc:mga05p37_59973_c1 nmdc:mga05p37_59973_c1_1747_2850 354
724 3300000042 ARSoilYngRDRAFT_c00128 ARSoilYngRDRAFT_0012818 355
725 3300000044 ARSoilOldRDRAFT_c000297 ARSoilOldRDRAFT_0002974 355
726 3300000652 ARCol0yngRDRAFT_1000069 ARCol0yngRDRAFT_100006928 355
727 3300001977 JGI24746J21847_1000078 JGI24746J21847_10000784 355
728 3300001979 JGI24740J21852_10030484 JGI24740J21852_100304841 355
729 3300001989 JGI24739J22299_10002225 JGI24739J22299_100022253 355
730 3300001990 JGI24737J22298_10001972 JGI24737J22298_100019723 355
731 3300002070 JGI24750J21931_1000188 JGI24750J21931_100018811 355
732 3300002073 JGI24745J21846_1000126 JGI24745J21846_10001261 355
733 3300002075 JGI24738J21930_10000068 JGI24738J21930_100000686 355
734 3300002076 JGI24749J21850_1000122 JGI24749J21850_10001223 355
735 3300002239 JGI24034J26672_10000519 JGI24034J26672_100005193 355
736 3300002244 JGI24742J22300_10000082 JGI24742J22300_100000822 355
737 3300003203 JGI25406J46586_10000093 JGI25406J46586_100000933 355
738 3300003203 JGI25406J46586_10007700 JGI25406J46586_100077003 355
739 3300003215 JGI25153J46596_10000462 JGI25153J46596_1000046211 355
740 3300005276 Ga0065717_1000293 Ga0065717_10002931 355
741 3300005293 Ga0065715_10089172 Ga0065715_100891724 355
742 3300005293 Ga0065715_10193766 Ga0065715_101937662 355
743 3300005327 Ga0070658_10063326 Ga0070658_100633261 355
744 3300005328 Ga0070676_10000363 Ga0070676_100003637 355
745 3300005328 Ga0070676_10026577 Ga0070676_100265773 355
746 3300005328 Ga0070676_10110574 Ga0070676_101105742 355
747 3300005328 Ga0070676_10138318 Ga0070676_101383182 355
748 3300005329 Ga0070683_100004718 Ga0070683_1000047183 355
749 3300005329 Ga0070683_100020818 Ga0070683_1000208185 355
750 3300005329 Ga0070683_100049938 Ga0070683_1000499384 355
751 3300005329 Ga0070683_100078282 Ga0070683_1000782822 355
752 3300005329 Ga0070683_100163207 Ga0070683_1001632072 355
753 3300005329 Ga0070683_100244054 Ga0070683_1002440542 355
754 3300005330 Ga0070690_100001828 Ga0070690_10000182811 355
755 3300005330 Ga0070690_100015808 Ga0070690_1000158084 355
756 3300005330 Ga0070690_100044913 Ga0070690_1000449132 355
757 3300005330 Ga0070690_100106185 Ga0070690_1001061852 355
758 3300005330 Ga0070690_100110382 Ga0070690_1001103822 355
759 3300005331 Ga0070670_100001134 Ga0070670_10000113411 355
760 3300005333 Ga0070677_10000301 Ga0070677_100003017 355
761 3300005333 Ga0070677_10000815 Ga0070677_100008156 355
762 3300005334 Ga0068869_100006712 Ga0068869_1000067123 355
763 3300005335 Ga0070666_10039593 Ga0070666_100395932 355
764 3300005336 Ga0070680_100005574 Ga0070680_1000055742 355
765 3300005336 Ga0070680_100014945 Ga0070680_1000149453 355
766 3300005336 Ga0070680_100019341 Ga0070680_1000193412 355
767 3300005336 Ga0070680_100148433 Ga0070680_1001484332 355
768 3300005337 Ga0070682_100000719 Ga0070682_10000071910 355
769 3300005337 Ga0070682_100001130 Ga0070682_10000113014 355
770 3300005337 Ga0070682_100048011 Ga0070682_1000480112 355
771 3300005337 Ga0070682_100096655 Ga0070682_1000966552 355
772 3300005338 Ga0068868_100010138 Ga0068868_1000101383 355
773 3300005338 Ga0068868_100013587 Ga0068868_1000135871 355
774 3300005338 Ga0068868_100229841 Ga0068868_1002298411 355
775 3300005339 Ga0070660_100000730 Ga0070660_10000073013 355
776 3300005339 Ga0070660_100006450 Ga0070660_1000064503 355
777 3300005339 Ga0070660_100050497 Ga0070660_1000504972 355
778 3300005339 Ga0070660_100122390 Ga0070660_1001223902 355
779 3300005340 Ga0070689_100000601 Ga0070689_10000060113 355
780 3300005340 Ga0070689_100025910 Ga0070689_1000259102 355
781 3300005340 Ga0070689_100041110 Ga0070689_1000411103 355
782 3300005340 Ga0070689_100142846 Ga0070689_1001428462 355
783 3300005341 Ga0070691_10001015 Ga0070691_100010154 355
784 3300005341 Ga0070691_10017707 Ga0070691_100177072 355
785 3300005341 Ga0070691_10060361 Ga0070691_100603612 355
786 3300005343 Ga0070687_100000253 Ga0070687_10000025311 355
787 3300005343 Ga0070687_100045959 Ga0070687_1000459592 355
788 3300005344 Ga0070661_100003564 Ga0070661_10000356410 355
789 3300005344 Ga0070661_100197315 Ga0070661_1001973152 355
790 3300005345 Ga0070692_10000060 Ga0070692_1000006012 355
791 3300005345 Ga0070692_10005786 Ga0070692_100057864 355
792 3300005345 Ga0070692_10032255 Ga0070692_100322552 355
793 3300005347 Ga0070668_100001851 Ga0070668_1000018517 355
794 3300005347 Ga0070668_100132143 Ga0070668_1001321431 355
795 3300005347 Ga0070668_100246197 Ga0070668_1002461971 355
796 3300005353 Ga0070669_100000888 Ga0070669_1000008887 355
797 3300005353 Ga0070669_100042856 Ga0070669_1000428563 355
798 3300005353 Ga0070669_100065319 Ga0070669_1000653192 355
799 3300005353 Ga0070669_100068388 Ga0070669_1000683882 355
800 3300005354 Ga0070675_100000441 Ga0070675_10000044119 355
801 3300005354 Ga0070675_100039312 Ga0070675_1000393122 355
802 3300005354 Ga0070675_100192696 Ga0070675_1001926962 355
803 3300005355 Ga0070671_100001180 Ga0070671_10000118010 355
804 3300005355 Ga0070671_100015695 Ga0070671_1000156952 355
805 3300005355 Ga0070671_100019902 Ga0070671_1000199022 355
806 3300005355 Ga0070671_100042459 Ga0070671_1000424592 355
807 3300005355 Ga0070671_100044735 Ga0070671_1000447351 355
808 3300005355 Ga0070671_100075870 Ga0070671_1000758702 355
809 3300005356 Ga0070674_100000723 Ga0070674_10000072311 355
810 3300005356 Ga0070674_100051273 Ga0070674_1000512732 355
811 3300005356 Ga0070674_100052446 Ga0070674_1000524462 355
812 3300005356 Ga0070674_100084906 Ga0070674_1000849062 355
813 3300005356 Ga0070674_100108322 Ga0070674_1001083222 355
814 3300005364 Ga0070673_100000456 Ga0070673_1000004567 355
815 3300005364 Ga0070673_100038037 Ga0070673_1000380373 355
816 3300005364 Ga0070673_100150225 Ga0070673_1001502252 355
817 3300005364 Ga0070673_100343751 Ga0070673_1003437511 355
818 3300005365 Ga0070688_100000483 Ga0070688_1000004837 355
819 3300005365 Ga0070688_100010309 Ga0070688_1000103094 355
820 3300005365 Ga0070688_100027362 Ga0070688_1000273621 355
821 3300005365 Ga0070688_100046419 Ga0070688_1000464192 355
822 3300005366 Ga0070659_100001763 Ga0070659_1000017637 355
823 3300005366 Ga0070659_100047189 Ga0070659_1000471893 355
824 3300005366 Ga0070659_100124787 Ga0070659_1001247872 355
825 3300005366 Ga0070659_100162952 Ga0070659_1001629522 355
826 3300005367 Ga0070667_100004366 Ga0070667_1000043663 355
827 3300005367 Ga0070667_100029031 Ga0070667_1000290312 355
828 3300005367 Ga0070667_100035458 Ga0070667_1000354582 355
829 3300005367 Ga0070667_100046573 Ga0070667_1000465733 355
830 3300005367 Ga0070667_100114480 Ga0070667_1001144802 355
831 3300005367 Ga0070667_100152500 Ga0070667_1001525002 355
832 3300005367 Ga0070667_100357862 Ga0070667_1003578621 355
833 3300005406 Ga0070703_10002031 Ga0070703_100020313 355
834 3300005406 Ga0070703_10013855 Ga0070703_100138551 355
835 3300005434 Ga0070709_10079029 Ga0070709_100790292 355
836 3300005434 Ga0070709_10119364 Ga0070709_101193642 355
837 3300005435 Ga0070714_100045925 Ga0070714_1000459252 355
838 3300005435 Ga0070714_100089770 Ga0070714_1000897702 355
839 3300005436 Ga0070713_100022697 Ga0070713_1000226973 355
840 3300005436 Ga0070713_100052199 Ga0070713_1000521992 355
841 3300005437 Ga0070710_10001957 Ga0070710_100019573 355
842 3300005437 Ga0070710_10010719 Ga0070710_100107194 355
843 3300005437 Ga0070710_10026259 Ga0070710_100262592 355
844 3300005437 Ga0070710_10030961 Ga0070710_100309611 355
845 3300005437 Ga0070710_10064128 Ga0070710_100641281 355
846 3300005438 Ga0070701_10000150 Ga0070701_100001507 355
847 3300005438 Ga0070701_10029193 Ga0070701_100291932 355
848 3300005439 Ga0070711_100000801 Ga0070711_10000080115 355
849 3300005439 Ga0070711_100008716 Ga0070711_1000087163 355
850 3300005439 Ga0070711_100043909 Ga0070711_1000439093 355
851 3300005439 Ga0070711_100053717 Ga0070711_1000537172 355
852 3300005439 Ga0070711_100132478 Ga0070711_1001324781 355
853 3300005439 Ga0070711_100169817 Ga0070711_1001698172 355
854 3300005440 Ga0070705_100003099 Ga0070705_1000030995 355
855 3300005440 Ga0070705_100150225 Ga0070705_1001502251 355
856 3300005441 Ga0070700_100001083 Ga0070700_1000010834 355
857 3300005441 Ga0070700_100053677 Ga0070700_1000536772 355
858 3300005444 Ga0070694_100094512 Ga0070694_1000945122 355
859 3300005445 Ga0070708_100013928 Ga0070708_1000139283 355
860 3300005445 Ga0070708_100244001 Ga0070708_1002440012 355
861 3300005445 Ga0070708_100304044 Ga0070708_1003040442 355
862 3300005455 Ga0070663_100001801 Ga0070663_1000018018 355
863 3300005455 Ga0070663_100024121 Ga0070663_1000241212 355
864 3300005455 Ga0070663_100071433 Ga0070663_1000714332 355
865 3300005455 Ga0070663_100074832 Ga0070663_1000748322 355
866 3300005455 Ga0070663_100090820 Ga0070663_1000908202 355
867 3300005455 Ga0070663_100247118 Ga0070663_1002471182 355
868 3300005456 Ga0070678_100000199 Ga0070678_10000019918 355
869 3300005456 Ga0070678_100028678 Ga0070678_1000286784 355
870 3300005456 Ga0070678_100160175 Ga0070678_1001601752 355
871 3300005457 Ga0070662_100016138 Ga0070662_1000161383 355
872 3300005457 Ga0070662_100103150 Ga0070662_1001031502 355
873 3300005457 Ga0070662_100125536 Ga0070662_1001255362 355
874 3300005458 Ga0070681_10001398 Ga0070681_1000139811 355
875 3300005458 Ga0070681_10017437 Ga0070681_100174375 355
876 3300005458 Ga0070681_10195720 Ga0070681_101957202 355
877 3300005459 Ga0068867_100001623 Ga0068867_1000016239 355
878 3300005459 Ga0068867_100012724 Ga0068867_1000127246 355
879 3300005466 Ga0070685_10000782 Ga0070685_100007827 355
880 3300005466 Ga0070685_10007883 Ga0070685_100078833 355
881 3300005466 Ga0070685_10015377 Ga0070685_100153773 355
882 3300005466 Ga0070685_10045926 Ga0070685_100459262 355
883 3300005467 Ga0070706_100190434 Ga0070706_1001904341 355
884 3300005530 Ga0070679_100018692 Ga0070679_1000186922 355
885 3300005530 Ga0070679_100028756 Ga0070679_1000287564 355
886 3300005530 Ga0070679_100035744 Ga0070679_1000357443 355
887 3300005530 Ga0070679_100042533 Ga0070679_1000425332 355
888 3300005530 Ga0070679_100171156 Ga0070679_1001711562 355
889 3300005530 Ga0070679_100231671 Ga0070679_1002316712 355
890 3300005535 Ga0070684_100001802 Ga0070684_1000018027 355
891 3300005535 Ga0070684_100017238 Ga0070684_1000172383 355
892 3300005535 Ga0070684_100028452 Ga0070684_1000284524 355
893 3300005535 Ga0070684_100036280 Ga0070684_1000362802 355
894 3300005535 Ga0070684_100125269 Ga0070684_1001252692 355
895 3300005536 Ga0070697_100058284 Ga0070697_1000582842 355
896 3300005539 Ga0068853_100001448 Ga0068853_1000014484 355
897 3300005539 Ga0068853_100002281 Ga0068853_1000022815 355
898 3300005539 Ga0068853_100056883 Ga0068853_1000568832 355
899 3300005539 Ga0068853_100143530 Ga0068853_1001435302 355
900 3300005539 Ga0068853_100284496 Ga0068853_1002844961 355
901 3300005543 Ga0070672_100001622 Ga0070672_1000016226 355
902 3300005543 Ga0070672_100024941 Ga0070672_1000249412 355
903 3300005544 Ga0070686_100000746 Ga0070686_1000007467 355
904 3300005544 Ga0070686_100004148 Ga0070686_1000041485 355
905 3300005544 Ga0070686_100018778 Ga0070686_1000187783 355
906 3300005544 Ga0070686_100124308 Ga0070686_1001243082 355
907 3300005545 Ga0070695_100000553 Ga0070695_10000055310 355
908 3300005545 Ga0070695_100033941 Ga0070695_1000339412 355
909 3300005546 Ga0070696_100001299 Ga0070696_1000012994 355
910 3300005546 Ga0070696_100030835 Ga0070696_1000308352 355
911 3300005546 Ga0070696_100051897 Ga0070696_1000518972 355
912 3300005546 Ga0070696_100158942 Ga0070696_1001589422 355
913 3300005547 Ga0070693_100000613 Ga0070693_1000006136 355
914 3300005547 Ga0070693_100003449 Ga0070693_1000034493 355
915 3300005547 Ga0070693_100016956 Ga0070693_1000169563 355
916 3300005548 Ga0070665_100063622 Ga0070665_1000636222 355
917 3300005548 Ga0070665_100107687 Ga0070665_1001076873 355
918 3300005549 Ga0070704_100000423 Ga0070704_1000004237 355
919 3300005563 Ga0068855_100004415 Ga0068855_1000044156 355
920 3300005563 Ga0068855_100034249 Ga0068855_1000342494 355
921 3300005563 Ga0068855_100098794 Ga0068855_1000987942 355
922 3300005563 Ga0068855_100198832 Ga0068855_1001988323 355
923 3300005564 Ga0070664_100001312 Ga0070664_1000013129 355
924 3300005564 Ga0070664_100024128 Ga0070664_1000241283 355
925 3300005564 Ga0070664_100029501 Ga0070664_1000295011 355
926 3300005564 Ga0070664_100188915 Ga0070664_1001889152 355
927 3300005577 Ga0068857_100007906 Ga0068857_1000079066 355
928 3300005577 Ga0068857_100408846 Ga0068857_1004088461 355
929 3300005578 Ga0068854_100000827 Ga0068854_1000008277 355
930 3300005578 Ga0068854_100141681 Ga0068854_1001416812 355
931 3300005578 Ga0068854_100197451 Ga0068854_1001974511 355
932 3300005614 Ga0068856_100000020 Ga0068856_10000002075 355
933 3300005614 Ga0068856_100001340 Ga0068856_10000134016 355
934 3300005616 Ga0068852_100007064 Ga0068852_1000070643 355
935 3300005616 Ga0068852_100013291 Ga0068852_1000132912 355
936 3300005616 Ga0068852_100024490 Ga0068852_1000244903 355
937 3300005616 Ga0068852_100063539 Ga0068852_1000635392 355
938 3300005617 Ga0068859_100001767 Ga0068859_10000176712 355
939 3300005617 Ga0068859_100061270 Ga0068859_1000612701 355
940 3300005617 Ga0068859_100070871 Ga0068859_1000708713 355
941 3300005617 Ga0068859_100132349 Ga0068859_1001323493 355
942 3300005617 Ga0068859_100205452 Ga0068859_1002054522 355
943 3300005618 Ga0068864_100003544 Ga0068864_1000035444 355
944 3300005618 Ga0068864_100059172 Ga0068864_1000591723 355
945 3300005718 Ga0068866_10000372 Ga0068866_1000037210 355
946 3300005718 Ga0068866_10022582 Ga0068866_100225822 355
947 3300005719 Ga0068861_100001202 Ga0068861_1000012024 355
948 3300005719 Ga0068861_100003340 Ga0068861_1000033408 355
949 3300005719 Ga0068861_100024078 Ga0068861_1000240783 355
950 3300005719 Ga0068861_100093014 Ga0068861_1000930142 355
951 3300005840 Ga0068870_10000207 Ga0068870_1000020710 355
952 3300005841 Ga0068863_100003062 Ga0068863_1000030624 355
953 3300005841 Ga0068863_100020579 Ga0068863_1000205791 355
954 3300005842 Ga0068858_100004999 Ga0068858_10000499916 355
955 3300005842 Ga0068858_100087413 Ga0068858_1000874133 355
956 3300005842 Ga0068858_100307706 Ga0068858_1003077061 355
957 3300005843 Ga0068860_100007079 Ga0068860_1000070793 355
958 3300005843 Ga0068860_100008652 Ga0068860_1000086523 355
959 3300005843 Ga0068860_100042971 Ga0068860_1000429711 355
960 3300005843 Ga0068860_100050876 Ga0068860_1000508762 355
961 3300005843 Ga0068860_100064769 Ga0068860_1000647694 355
962 3300005843 Ga0068860_100474333 Ga0068860_1004743332 355
963 3300005844 Ga0068862_100002236 Ga0068862_10000223610 355
964 3300005844 Ga0068862_100032372 Ga0068862_1000323725 355
965 3300005844 Ga0068862_100163998 Ga0068862_1001639981 355
966 3300005844 Ga0068862_100383957 Ga0068862_1003839571 355
967 3300005937 Ga0081455_10005602 Ga0081455_100056023 355
968 3300005937 Ga0081455_10006534 Ga0081455_100065348 355
969 3300005937 Ga0081455_10006892 Ga0081455_100068922 355
970 3300005937 Ga0081455_10012847 Ga0081455_100128476 355
971 3300005937 Ga0081455_10035882 Ga0081455_100358822 355
972 3300005937 Ga0081455_10121166 Ga0081455_101211661 355
973 3300005981 Ga0081538_10055740 Ga0081538_100557402 355
974 3300005983 Ga0081540_1000933 Ga0081540_100093314 355
975 3300005983 Ga0081540_1002812 Ga0081540_10028125 355
976 3300005983 Ga0081540_1006330 Ga0081540_10063305 355
977 3300005983 Ga0081540_1016900 Ga0081540_10169003 355
978 3300005983 Ga0081540_1021448 Ga0081540_10214483 355
979 3300005983 Ga0081540_1029356 Ga0081540_10293563 355
980 3300005985 Ga0081539_10000140 Ga0081539_1000014021 355
981 3300005985 Ga0081539_10003950 Ga0081539_100039507 355
982 3300005985 Ga0081539_10026648 Ga0081539_100266482 355
983 3300006028 Ga0070717_10004566 Ga0070717_100045668 355
984 3300006028 Ga0070717_10047085 Ga0070717_100470852 355
985 3300006028 Ga0070717_10134551 Ga0070717_101345511 355
986 3300006028 Ga0070717_10292120 Ga0070717_102921202 355
987 3300006028 Ga0070717_10313860 Ga0070717_103138602 355
988 3300006038 Ga0075365_10008099 Ga0075365_100080996 355
989 3300006038 Ga0075365_10070687 Ga0075365_100706872 355
990 3300006038 Ga0075365_10076733 Ga0075365_100767332 355
991 3300006042 Ga0075368_10002671 Ga0075368_100026716 355
992 3300006042 Ga0075368_10012864 Ga0075368_100128641 355
993 3300006048 Ga0075363_100002429 Ga0075363_1000024294 355
994 3300006048 Ga0075363_100038616 Ga0075363_1000386162 355
995 3300006051 Ga0075364_10007885 Ga0075364_100078856 355
996 3300006163 Ga0070715_10070358 Ga0070715_100703582 355
997 3300006173 Ga0070716_100002662 Ga0070716_1000026625 355
998 3300006175 Ga0070712_100145116 Ga0070712_1001451162 355
999 3300006175 Ga0070712_100162464 Ga0070712_1001624642 355
1000 3300006175 Ga0070712_100214257 Ga0070712_1002142572 355
1001 3300006177 Ga0075362_10012691 Ga0075362_100126912 355
1002 3300006178 Ga0075367_10010400 Ga0075367_100104003 355
1003 3300006178 Ga0075367_10088217 Ga0075367_100882171 355
1004 3300006178 Ga0075367_10142445 Ga0075367_101424451 355
1005 3300006186 Ga0075369_10005033 Ga0075369_100050331 355
1006 3300006195 Ga0075366_10016935 Ga0075366_100169351 355
1007 3300006195 Ga0075366_10169765 Ga0075366_101697651 355
1008 3300006237 Ga0097621_100002408 Ga0097621_1000024086 355
1009 3300006237 Ga0097621_100035810 Ga0097621_1000358102 355
1010 3300006237 Ga0097621_100037422 Ga0097621_1000374222 355
1011 3300006358 Ga0068871_100002267 Ga0068871_1000022676 355
1012 3300006358 Ga0068871_100076440 Ga0068871_1000764401 355
1013 3300006358 Ga0068871_100129629 Ga0068871_1001296292 355
1014 3300006844 Ga0075428_100031362 Ga0075428_1000313624 355
1015 3300006844 Ga0075428_100067331 Ga0075428_1000673312 355
1016 3300006847 Ga0075431_100007073 Ga0075431_10000707311 355
1017 3300006847 Ga0075431_100371159 Ga0075431_1003711591 355
1018 3300006852 Ga0075433_10039549 Ga0075433_100395493 355
1019 3300006871 Ga0075434_100007264 Ga0075434_1000072643 355
1020 3300006871 Ga0075434_100029369 Ga0075434_1000293692 355
1021 3300006871 Ga0075434_100044598 Ga0075434_1000445983 355
1022 3300006871 Ga0075434_100274145 Ga0075434_1002741452 355
1023 3300006871 Ga0075434_100520669 Ga0075434_1005206691 355
1024 3300006880 Ga0075429_100258172 Ga0075429_1002581722 355
1025 3300006881 Ga0068865_100000537 Ga0068865_1000005377 355
1026 3300006881 Ga0068865_100003331 Ga0068865_1000033319 355
1027 3300006881 Ga0068865_100083233 Ga0068865_1000832332 355
1028 3300006931 Ga0097620_100001767 Ga0097620_10000176712 355
1029 3300006931 Ga0097620_100061272 Ga0097620_1000612724 355
1030 3300006931 Ga0097620_100070859 Ga0097620_1000708591 355
1031 3300006931 Ga0097620_100132356 Ga0097620_1001323563 355
1032 3300006931 Ga0097620_100205450 Ga0097620_1002054502 355
1033 3300006942 Ga0099824_1018476 Ga0099824_10184765 355
1034 3300006943 Ga0099822_1042608 Ga0099822_10426082 355
1035 3300006944 Ga0099823_1035886 Ga0099823_10358862 355
1036 3300007076 Ga0075435_100014461 Ga0075435_1000144612 355
1037 3300007076 Ga0075435_100024058 Ga0075435_1000240582 355
1038 3300007076 Ga0075435_100030713 Ga0075435_1000307134 355
1039 3300007076 Ga0075435_100085093 Ga0075435_1000850932 355
1040 3300007076 Ga0075435_100193375 Ga0075435_1001933752 355
1041 3300007076 Ga0075435_100218695 Ga0075435_1002186952 355
1042 3300007076 Ga0075435_100330204 Ga0075435_1003302041 355
1043 3300007265 Ga0099794_10054680 Ga0099794_100546802 355
1044 3300007265 Ga0099794_10054754 Ga0099794_100547542 355
1045 3300009011 Ga0105251_10037885 Ga0105251_100378852 355
1046 3300009093 Ga0105240_10222983 Ga0105240_102229832 355
1047 3300009094 Ga0111539_10004508 Ga0111539_100045086 355
1048 3300009094 Ga0111539_10008569 Ga0111539_100085696 355
1049 3300009094 Ga0111539_10011182 Ga0111539_100111822 355
1050 3300009094 Ga0111539_10017014 Ga0111539_100170145 355
1051 3300009094 Ga0111539_10136297 Ga0111539_101362972 355
1052 3300009098 Ga0105245_10000888 Ga0105245_1000088821 355
1053 3300009098 Ga0105245_10019909 Ga0105245_100199094 355
1054 3300009098 Ga0105245_10048198 Ga0105245_100481982 355
1055 3300009098 Ga0105245_10072768 Ga0105245_100727682 355
1056 3300009098 Ga0105245_10096894 Ga0105245_100968942 355
1057 3300009101 Ga0105247_10001292 Ga0105247_100012928 355
1058 3300009101 Ga0105247_10007990 Ga0105247_100079902 355
1059 3300009101 Ga0105247_10040354 Ga0105247_100403541 355
1060 3300009147 Ga0114129_10011980 Ga0114129_100119803 355
1061 3300009147 Ga0114129_10033315 Ga0114129_100333157 355
1062 3300009148 Ga0105243_10004521 Ga0105243_100045216 355
1063 3300009148 Ga0105243_10052213 Ga0105243_100522133 355
1064 3300009148 Ga0105243_10238346 Ga0105243_102383462 355
1065 3300009174 Ga0105241_10000662 Ga0105241_1000066220 355
1066 3300009174 Ga0105241_10016979 Ga0105241_100169793 355
1067 3300009174 Ga0105241_10062168 Ga0105241_100621682 355
1068 3300009174 Ga0105241_10179290 Ga0105241_101792902 355
1069 3300009176 Ga0105242_10001202 Ga0105242_100012027 355
1070 3300009176 Ga0105242_10033477 Ga0105242_100334773 355
1071 3300009176 Ga0105242_10053798 Ga0105242_100537983 355
1072 3300009177 Ga0105248_10002336 Ga0105248_100023367 355
1073 3300009177 Ga0105248_10063028 Ga0105248_100630283 355
1074 3300009177 Ga0105248_10072434 Ga0105248_100724343 355
1075 3300009545 Ga0105237_10010293 Ga0105237_100102937 355
1076 3300009545 Ga0105237_10020331 Ga0105237_100203316 355
1077 3300009545 Ga0105237_10053429 Ga0105237_100534293 355
1078 3300009545 Ga0105237_10138222 Ga0105237_101382222 355
1079 3300009545 Ga0105237_10142679 Ga0105237_101426791 355
1080 3300009551 Ga0105238_10035579 Ga0105238_100355794 355
1081 3300009551 Ga0105238_10044782 Ga0105238_100447823 355
1082 3300009551 Ga0105238_10232571 Ga0105238_102325712 355
1083 3300009553 Ga0105249_10001808 Ga0105249_100018087 355
1084 3300010375 Ga0105239_10018370 Ga0105239_100183707 355
1085 3300010375 Ga0105239_10050388 Ga0105239_100503881 355
1086 3300010375 Ga0105239_10056652 Ga0105239_100566523 355
1087 3300010375 Ga0105239_10060609 Ga0105239_100606094 355
1088 3300010375 Ga0105239_10103533 Ga0105239_101035332 355
1089 3300010375 Ga0105239_10133487 Ga0105239_101334873 355
1090 3300010375 Ga0105239_10170978 Ga0105239_101709782 355
1091 3300011119 Ga0105246_10004623 Ga0105246_100046239 355
1092 3300011119 Ga0105246_10013849 Ga0105246_100138492 355
1093 3300011119 Ga0105246_10240447 Ga0105246_102404471 355
1094 3300012480 Ga0157346_1000487 Ga0157346_10004872 355
1095 3300012494 Ga0157341_1000902 Ga0157341_10009022 355
1096 3300012505 Ga0157339_1001172 Ga0157339_10011722 355
1097 3300013100 Ga0157373_10011956 Ga0157373_100119565 355
1098 3300013102 Ga0157371_10027329 Ga0157371_100273292 355
1099 3300013104 Ga0157370_10004885 Ga0157370_100048859 355
1100 3300013104 Ga0157370_10101270 Ga0157370_101012703 355
1101 3300013104 Ga0157370_10209417 Ga0157370_102094172 355
1102 3300013105 Ga0157369_10016501 Ga0157369_100165018 355
1103 3300013105 Ga0157369_10066123 Ga0157369_100661233 355
1104 3300013296 Ga0157374_10002267 Ga0157374_100022677 355
1105 3300013296 Ga0157374_10005674 Ga0157374_100056742 355
1106 3300013296 Ga0157374_10030713 Ga0157374_100307135 355
1107 3300013296 Ga0157374_10050875 Ga0157374_100508752 355
1108 3300013296 Ga0157374_10066448 Ga0157374_100664483 355
1109 3300013297 Ga0157378_10100657 Ga0157378_101006572 355
1110 3300013306 Ga0163162_10009182 Ga0163162_100091824 355
1111 3300013306 Ga0163162_10015064 Ga0163162_100150648 355
1112 3300013306 Ga0163162_10284195 Ga0163162_102841952 355
1113 3300013307 Ga0157372_10005926 Ga0157372_100059266 355
1114 3300013307 Ga0157372_10011471 Ga0157372_100114716 355
1115 3300013307 Ga0157372_10277014 Ga0157372_102770142 355
1116 3300013308 Ga0157375_10001031 Ga0157375_100010317 355
1117 3300013308 Ga0157375_10019981 Ga0157375_100199816 355
1118 3300013308 Ga0157375_10052928 Ga0157375_100529284 355
1119 3300013308 Ga0157375_10184396 Ga0157375_101843962 355
1120 3300013308 Ga0157375_10189355 Ga0157375_101893552 355
1121 3300013308 Ga0157375_10204719 Ga0157375_102047192 355
1122 3300014325 Ga0163163_10003057 Ga0163163_1000305713 355
1123 3300014325 Ga0163163_10003323 Ga0163163_1000332310 355
1124 3300014325 Ga0163163_10038122 Ga0163163_100381223 355
1125 3300014325 Ga0163163_10113030 Ga0163163_101130302 355
1126 3300014326 Ga0157380_10000726 Ga0157380_1000072610 355
1127 3300014326 Ga0157380_10005881 Ga0157380_100058813 355
1128 3300014326 Ga0157380_10048489 Ga0157380_100484891 355
1129 3300014745 Ga0157377_10000324 Ga0157377_1000032411 355
1130 3300014968 Ga0157379_10001193 Ga0157379_1000119310 355
1131 3300014968 Ga0157379_10013061 Ga0157379_100130613 355
1132 3300014968 Ga0157379_10027074 Ga0157379_100270744 355
1133 3300014969 Ga0157376_10003383 Ga0157376_100033834 355
1134 3300014969 Ga0157376_10066060 Ga0157376_100660602 355
1135 3300014969 Ga0157376_10209517 Ga0157376_102095172 355
1136 3300014969 Ga0157376_10337305 Ga0157376_103373051 355
1137 3300017792 Ga0163161_10001040 Ga0163161_100010407 355
1138 3300017792 Ga0163161_10116279 Ga0163161_101162792 355
1139 3300020069 Ga0197907_10592444 Ga0197907_105924443 355
1140 3300020070 Ga0206356_11623307 Ga0206356_116233071 355
1141 3300020076 Ga0206355_1301277 Ga0206355_13012771 355
1142 3300020080 Ga0206350_11111889 Ga0206350_111118893 355
1143 3300020082 Ga0206353_11232580 Ga0206353_112325801 355
1144 3300021320 Ga0214544_1000002 Ga0214544_1000002162 355
1145 3300021321 Ga0214542_1000001 Ga0214542_1000001512 355
1146 3300021324 Ga0214545_1000001 Ga0214545_1000001578 355
1147 3300021327 Ga0214543_1000001 Ga0214543_1000001618 355
1148 3300021384 Ga0213876_10013313 Ga0213876_100133132 355
1149 3300021388 Ga0213875_10016415 Ga0213875_100164153 355
1150 3300022467 Ga0224712_10000671 Ga0224712_100006713 355
1151 3300022467 Ga0224712_10006030 Ga0224712_100060303 355
1152 3300022467 Ga0224712_10011398 Ga0224712_100113983 355
1153 3300025261 Ga0209233_1020784 Ga0209233_10207841 355
1154 3300025271 Ga0207666_1000034 Ga0207666_10000347 355
1155 3300025290 Ga0207673_1000073 Ga0207673_10000736 355
1156 3300025295 Ga0209564_1010443 Ga0209564_10104433 355
1157 3300025297 Ga0209758_1001768 Ga0209758_100176818 355
1158 3300025297 Ga0209758_1003468 Ga0209758_100346811 355
1159 3300025297 Ga0209758_1030049 Ga0209758_10300492 355
1160 3300025299 Ga0209256_1006564 Ga0209256_10065643 355
1161 3300025302 Ga0207426_1000855 Ga0207426_100085521 355
1162 3300025302 Ga0207426_1013721 Ga0207426_10137212 355
1163 3300025304 Ga0209257_1001932 Ga0209257_100193222 355
1164 3300025315 Ga0207697_10000280 Ga0207697_100002807 355
1165 3300025321 Ga0207656_10068821 Ga0207656_100688211 355
1166 3300025885 Ga0207653_10001427 Ga0207653_100014273 355
1167 3300025893 Ga0207682_10000134 Ga0207682_1000013424 355
1168 3300025893 Ga0207682_10002016 Ga0207682_100020167 355
1169 3300025898 Ga0207692_10002168 Ga0207692_100021683 355
1170 3300025898 Ga0207692_10002762 Ga0207692_100027622 355
1171 3300025898 Ga0207692_10142815 Ga0207692_101428151 355
1172 3300025899 Ga0207642_10008502 Ga0207642_100085022 355
1173 3300025899 Ga0207642_10083998 Ga0207642_100839981 355
1174 3300025900 Ga0207710_10001541 Ga0207710_100015415 355
1175 3300025900 Ga0207710_10006028 Ga0207710_100060283 355
1176 3300025900 Ga0207710_10027029 Ga0207710_100270292 355
1177 3300025901 Ga0207688_10000526 Ga0207688_1000052610 355
1178 3300025901 Ga0207688_10000663 Ga0207688_100006633 355
1179 3300025901 Ga0207688_10095742 Ga0207688_100957421 355
1180 3300025901 Ga0207688_10112576 Ga0207688_101125761 355
1181 3300025903 Ga0207680_10037146 Ga0207680_100371463 355
1182 3300025904 Ga0207647_10003350 Ga0207647_100033506 355
1183 3300025904 Ga0207647_10007263 Ga0207647_100072633 355
1184 3300025904 Ga0207647_10011872 Ga0207647_100118723 355
1185 3300025905 Ga0207685_10008122 Ga0207685_100081222 355
1186 3300025906 Ga0207699_10000508 Ga0207699_1000050815 355
1187 3300025906 Ga0207699_10024497 Ga0207699_100244972 355
1188 3300025906 Ga0207699_10025852 Ga0207699_100258523 355
1189 3300025906 Ga0207699_10049502 Ga0207699_100495022 355
1190 3300025907 Ga0207645_10001617 Ga0207645_100016177 355
1191 3300025907 Ga0207645_10023769 Ga0207645_100237693 355
1192 3300025907 Ga0207645_10030200 Ga0207645_100302003 355
1193 3300025908 Ga0207643_10000756 Ga0207643_100007567 355
1194 3300025908 Ga0207643_10000808 Ga0207643_100008086 355
1195 3300025908 Ga0207643_10072110 Ga0207643_100721102 355
1196 3300025911 Ga0207654_10011329 Ga0207654_100113292 355
1197 3300025911 Ga0207654_10061692 Ga0207654_100616922 355
1198 3300025911 Ga0207654_10068775 Ga0207654_100687752 355
1199 3300025912 Ga0207707_10000359 Ga0207707_100003593 355
1200 3300025912 Ga0207707_10001961 Ga0207707_1000196117 355
1201 3300025912 Ga0207707_10002112 Ga0207707_100021127 355
1202 3300025912 Ga0207707_10003260 Ga0207707_1000326014 355
1203 3300025912 Ga0207707_10003603 Ga0207707_100036035 355
1204 3300025913 Ga0207695_10113902 Ga0207695_101139022 355
1205 3300025913 Ga0207695_10126627 Ga0207695_101266272 355
1206 3300025914 Ga0207671_10030827 Ga0207671_100308272 355
1207 3300025914 Ga0207671_10031017 Ga0207671_100310174 355
1208 3300025914 Ga0207671_10036337 Ga0207671_100363371 355
1209 3300025914 Ga0207671_10084264 Ga0207671_100842642 355
1210 3300025914 Ga0207671_10092604 Ga0207671_100926043 355
1211 3300025915 Ga0207693_10002467 Ga0207693_1000246712 355
1212 3300025915 Ga0207693_10030563 Ga0207693_100305632 355
1213 3300025915 Ga0207693_10032713 Ga0207693_100327133 355
1214 3300025915 Ga0207693_10039890 Ga0207693_100398903 355
1215 3300025915 Ga0207693_10071283 Ga0207693_100712832 355
1216 3300025915 Ga0207693_10116468 Ga0207693_101164681 355
1217 3300025916 Ga0207663_10040483 Ga0207663_100404833 355
1218 3300025916 Ga0207663_10044561 Ga0207663_100445612 355
1219 3300025916 Ga0207663_10211677 Ga0207663_102116772 355
1220 3300025917 Ga0207660_10001335 Ga0207660_1000133510 355
1221 3300025917 Ga0207660_10008111 Ga0207660_100081114 355
1222 3300025917 Ga0207660_10013662 Ga0207660_100136623 355
1223 3300025917 Ga0207660_10044293 Ga0207660_100442932 355
1224 3300025917 Ga0207660_10047556 Ga0207660_100475562 355
1225 3300025917 Ga0207660_10078384 Ga0207660_100783842 355
1226 3300025917 Ga0207660_10242940 Ga0207660_102429402 355
1227 3300025918 Ga0207662_10000341 Ga0207662_1000034110 355
1228 3300025918 Ga0207662_10007966 Ga0207662_100079662 355
1229 3300025918 Ga0207662_10055341 Ga0207662_100553412 355
1230 3300025919 Ga0207657_10002888 Ga0207657_100028888 355
1231 3300025919 Ga0207657_10012009 Ga0207657_100120099 355
1232 3300025919 Ga0207657_10021585 Ga0207657_100215852 355
1233 3300025919 Ga0207657_10022947 Ga0207657_100229474 355
1234 3300025919 Ga0207657_10054672 Ga0207657_100546723 355
1235 3300025920 Ga0207649_10000271 Ga0207649_100002717 355
1236 3300025920 Ga0207649_10195265 Ga0207649_101952651 355
1237 3300025920 Ga0207649_10286747 Ga0207649_102867471 355
1238 3300025921 Ga0207652_10001830 Ga0207652_100018307 355
1239 3300025921 Ga0207652_10001857 Ga0207652_1000185716 355
1240 3300025921 Ga0207652_10019118 Ga0207652_100191184 355
1241 3300025921 Ga0207652_10034193 Ga0207652_100341933 355
1242 3300025921 Ga0207652_10047300 Ga0207652_100473002 355
1243 3300025921 Ga0207652_10064689 Ga0207652_100646893 355
1244 3300025921 Ga0207652_10085656 Ga0207652_100856563 355
1245 3300025921 Ga0207652_10134157 Ga0207652_101341571 355
1246 3300025921 Ga0207652_10141779 Ga0207652_101417792 355
1247 3300025921 Ga0207652_10198169 Ga0207652_101981692 355
1248 3300025922 Ga0207646_10140901 Ga0207646_101409012 355
1249 3300025923 Ga0207681_10000658 Ga0207681_100006587 355
1250 3300025923 Ga0207681_10067166 Ga0207681_100671662 355
1251 3300025923 Ga0207681_10212643 Ga0207681_102126431 355
1252 3300025924 Ga0207694_10019649 Ga0207694_100196495 355
1253 3300025924 Ga0207694_10065256 Ga0207694_100652562 355
1254 3300025924 Ga0207694_10077851 Ga0207694_100778512 355
1255 3300025924 Ga0207694_10208429 Ga0207694_102084292 355
1256 3300025924 Ga0207694_10309219 Ga0207694_103092191 355
1257 3300025925 Ga0207650_10296655 Ga0207650_102966551 355
1258 3300025925 Ga0207650_10301547 Ga0207650_103015471 355
1259 3300025926 Ga0207659_10000177 Ga0207659_1000017717 355
1260 3300025926 Ga0207659_10023619 Ga0207659_100236193 355
1261 3300025927 Ga0207687_10000495 Ga0207687_100004957 355
1262 3300025927 Ga0207687_10006623 Ga0207687_100066232 355
1263 3300025927 Ga0207687_10013921 Ga0207687_100139212 355
1264 3300025927 Ga0207687_10027876 Ga0207687_100278763 355
1265 3300025927 Ga0207687_10160216 Ga0207687_101602162 355
1266 3300025927 Ga0207687_10344897 Ga0207687_103448971 355
1267 3300025928 Ga0207700_10018872 Ga0207700_100188724 355
1268 3300025928 Ga0207700_10030543 Ga0207700_100305432 355
1269 3300025928 Ga0207700_10090460 Ga0207700_100904602 355
1270 3300025928 Ga0207700_10215152 Ga0207700_102151522 355
1271 3300025929 Ga0207664_10191702 Ga0207664_101917022 355
1272 3300025931 Ga0207644_10000279 Ga0207644_100002796 355
1273 3300025931 Ga0207644_10029940 Ga0207644_100299403 355
1274 3300025931 Ga0207644_10074660 Ga0207644_100746602 355
1275 3300025931 Ga0207644_10128507 Ga0207644_101285072 355
1276 3300025931 Ga0207644_10278256 Ga0207644_102782561 355
1277 3300025932 Ga0207690_10001557 Ga0207690_100015577 355
1278 3300025932 Ga0207690_10006785 Ga0207690_100067852 355
1279 3300025932 Ga0207690_10008986 Ga0207690_100089862 355
1280 3300025933 Ga0207706_10005939 Ga0207706_1000593910 355
1281 3300025933 Ga0207706_10007308 Ga0207706_1000730810 355
1282 3300025933 Ga0207706_10012772 Ga0207706_100127727 355
1283 3300025933 Ga0207706_10041280 Ga0207706_100412802 355
1284 3300025933 Ga0207706_10053602 Ga0207706_100536022 355
1285 3300025933 Ga0207706_10065929 Ga0207706_100659293 355
1286 3300025933 Ga0207706_10092877 Ga0207706_100928774 355
1287 3300025934 Ga0207686_10001383 Ga0207686_100013839 355
1288 3300025934 Ga0207686_10052401 Ga0207686_100524012 355
1289 3300025934 Ga0207686_10073324 Ga0207686_100733241 355
1290 3300025935 Ga0207709_10000952 Ga0207709_100009527 355
1291 3300025936 Ga0207670_10000491 Ga0207670_100004917 355
1292 3300025936 Ga0207670_10062155 Ga0207670_100621552 355
1293 3300025936 Ga0207670_10273891 Ga0207670_102738912 355
1294 3300025937 Ga0207669_10000649 Ga0207669_100006496 355
1295 3300025937 Ga0207669_10021526 Ga0207669_100215263 355
1296 3300025937 Ga0207669_10367063 Ga0207669_103670631 355
1297 3300025938 Ga0207704_10001342 Ga0207704_100013424 355
1298 3300025938 Ga0207704_10006681 Ga0207704_100066812 355
1299 3300025939 Ga0207665_10002422 Ga0207665_100024228 355
1300 3300025939 Ga0207665_10004210 Ga0207665_100042104 355
1301 3300025939 Ga0207665_10043152 Ga0207665_100431522 355
1302 3300025940 Ga0207691_10002815 Ga0207691_100028156 355
1303 3300025940 Ga0207691_10011566 Ga0207691_100115666 355
1304 3300025940 Ga0207691_10039366 Ga0207691_100393662 355
1305 3300025940 Ga0207691_10054159 Ga0207691_100541594 355
1306 3300025941 Ga0207711_10001570 Ga0207711_100015707 355
1307 3300025941 Ga0207711_10016743 Ga0207711_100167433 355
1308 3300025941 Ga0207711_10021793 Ga0207711_100217933 355
1309 3300025941 Ga0207711_10068152 Ga0207711_100681522 355
1310 3300025942 Ga0207689_10002449 Ga0207689_100024497 355
1311 3300025942 Ga0207689_10057982 Ga0207689_100579822 355
1312 3300025944 Ga0207661_10000642 Ga0207661_1000064210 355
1313 3300025944 Ga0207661_10003486 Ga0207661_100034866 355
1314 3300025944 Ga0207661_10012908 Ga0207661_100129083 355
1315 3300025944 Ga0207661_10017816 Ga0207661_100178162 355
1316 3300025945 Ga0207679_10000046 Ga0207679_1000004615 355
1317 3300025945 Ga0207679_10028026 Ga0207679_100280263 355
1318 3300025945 Ga0207679_10225010 Ga0207679_102250102 355
1319 3300025949 Ga0207667_10007962 Ga0207667_100079624 355
1320 3300025949 Ga0207667_10013915 Ga0207667_100139153 355
1321 3300025949 Ga0207667_10017447 Ga0207667_100174475 355
1322 3300025949 Ga0207667_10040700 Ga0207667_100407004 355
1323 3300025949 Ga0207667_10184243 Ga0207667_101842432 355
1324 3300025960 Ga0207651_10000214 Ga0207651_100002147 355
1325 3300025960 Ga0207651_10035381 Ga0207651_100353812 355
1326 3300025960 Ga0207651_10056778 Ga0207651_100567783 355
1327 3300025960 Ga0207651_10082135 Ga0207651_100821352 355
1328 3300025961 Ga0207712_10003297 Ga0207712_100032973 355
1329 3300025961 Ga0207712_10121130 Ga0207712_101211302 355
1330 3300025961 Ga0207712_10171984 Ga0207712_101719842 355
1331 3300025961 Ga0207712_10176649 Ga0207712_101766492 355
1332 3300025972 Ga0207668_10000537 Ga0207668_100005377 355
1333 3300025972 Ga0207668_10026242 Ga0207668_100262422 355
1334 3300025972 Ga0207668_10064228 Ga0207668_100642282 355
1335 3300025981 Ga0207640_10000765 Ga0207640_100007657 355
1336 3300025981 Ga0207640_10073819 Ga0207640_100738192 355
1337 3300025986 Ga0207658_10001147 Ga0207658_1000114711 355
1338 3300025986 Ga0207658_10114269 Ga0207658_101142692 355
1339 3300026023 Ga0207677_10003377 Ga0207677_100033778 355
1340 3300026023 Ga0207677_10023214 Ga0207677_100232142 355
1341 3300026023 Ga0207677_10165636 Ga0207677_101656362 355
1342 3300026035 Ga0207703_10000940 Ga0207703_1000094019 355
1343 3300026035 Ga0207703_10104329 Ga0207703_101043292 355
1344 3300026035 Ga0207703_10128879 Ga0207703_101288792 355
1345 3300026035 Ga0207703_10178802 Ga0207703_101788022 355
1346 3300026041 Ga0207639_10000852 Ga0207639_100008527 355
1347 3300026041 Ga0207639_10038053 Ga0207639_100380532 355
1348 3300026041 Ga0207639_10105528 Ga0207639_101055282 355
1349 3300026041 Ga0207639_10136104 Ga0207639_101361042 355
1350 3300026041 Ga0207639_10343701 Ga0207639_103437011 355
1351 3300026067 Ga0207678_10002525 Ga0207678_100025257 355
1352 3300026067 Ga0207678_10011036 Ga0207678_100110363 355
1353 3300026067 Ga0207678_10021682 Ga0207678_100216822 355
1354 3300026067 Ga0207678_10105768 Ga0207678_101057681 355
1355 3300026067 Ga0207678_10154890 Ga0207678_101548902 355
1356 3300026075 Ga0207708_10001006 Ga0207708_1000100610 355
1357 3300026075 Ga0207708_10005549 Ga0207708_100055493 355
1358 3300026075 Ga0207708_10017098 Ga0207708_100170983 355
1359 3300026078 Ga0207702_10000126 Ga0207702_1000012673 355
1360 3300026078 Ga0207702_10002642 Ga0207702_1000264217 355
1361 3300026088 Ga0207641_10001370 Ga0207641_100013707 355
1362 3300026088 Ga0207641_10139531 Ga0207641_101395312 355
1363 3300026088 Ga0207641_10149185 Ga0207641_101491852 355
1364 3300026089 Ga0207648_10002036 Ga0207648_100020367 355
1365 3300026089 Ga0207648_10002249 Ga0207648_1000224915 355
1366 3300026089 Ga0207648_10013101 Ga0207648_100131012 355
1367 3300026089 Ga0207648_10016754 Ga0207648_100167543 355
1368 3300026089 Ga0207648_10021939 Ga0207648_100219393 355
1369 3300026095 Ga0207676_10004314 Ga0207676_100043144 355
1370 3300026095 Ga0207676_10024360 Ga0207676_100243603 355
1371 3300026095 Ga0207676_10104391 Ga0207676_101043912 355
1372 3300026116 Ga0207674_10002956 Ga0207674_100029567 355
1373 3300026116 Ga0207674_10037457 Ga0207674_100374573 355
1374 3300026116 Ga0207674_10045708 Ga0207674_100457082 355
1375 3300026116 Ga0207674_10147506 Ga0207674_101475062 355
1376 3300026118 Ga0207675_100006209 Ga0207675_10000620910 355
1377 3300026118 Ga0207675_100019635 Ga0207675_1000196352 355
1378 3300026118 Ga0207675_100020315 Ga0207675_1000203155 355
1379 3300026118 Ga0207675_100034484 Ga0207675_1000344842 355
1380 3300026121 Ga0207683_10001099 Ga0207683_1000109925 355
1381 3300026121 Ga0207683_10001904 Ga0207683_100019048 355
1382 3300026121 Ga0207683_10002624 Ga0207683_1000262413 355
1383 3300026121 Ga0207683_10004971 Ga0207683_100049719 355
1384 3300026121 Ga0207683_10014537 Ga0207683_100145373 355
1385 3300026121 Ga0207683_10250912 Ga0207683_102509121 355
1386 3300026121 Ga0207683_10270064 Ga0207683_102700641 355
1387 3300026142 Ga0207698_10001980 Ga0207698_100019805 355
1388 3300026142 Ga0207698_10014902 Ga0207698_100149022 355
1389 3300027296 Ga0209389_1000040 Ga0209389_100004057 355
1390 3300027296 Ga0209389_1000123 Ga0209389_100012344 355
1391 3300027357 Ga0209589_1000001 Ga0209589_1000001215 355
1392 3300027357 Ga0209589_1000036 Ga0209589_100003644 355
1393 3300027361 Ga0209489_100001 Ga0209489_100001215 355
1394 3300027361 Ga0209489_100006 Ga0209489_100006372 355
1395 3300027361 Ga0209489_111662 Ga0209489_1116625 355
1396 3300027363 Ga0209700_100001 Ga0209700_100001215 355
1397 3300027363 Ga0209700_100005 Ga0209700_100005242 355
1398 3300027543 Ga0209999_1020773 Ga0209999_10207731 355
1399 3300027665 Ga0209983_1006861 Ga0209983_10068612 355
1400 3300027671 Ga0209588_1014733 Ga0209588_10147332 355
1401 3300027876 Ga0209974_10000502 Ga0209974_100005026 355
1402 3300027876 Ga0209974_10036492 Ga0209974_100364922 355
1403 3300027907 Ga0207428_10002104 Ga0207428_100021047 355
1404 3300027907 Ga0207428_10002830 Ga0207428_1000283015 355
1405 3300027907 Ga0207428_10002977 Ga0207428_100029776 355
1406 3300027907 Ga0207428_10027000 Ga0207428_100270004 355
1407 3300027907 Ga0207428_10182071 Ga0207428_101820711 355
1408 3300028379 Ga0268266_10019214 Ga0268266_100192143 355
1409 3300028379 Ga0268266_10020054 Ga0268266_100200542 355
1410 3300028379 Ga0268266_10038195 Ga0268266_100381951 355
1411 3300028379 Ga0268266_10042402 Ga0268266_100424023 355
1412 3300028379 Ga0268266_10132847 Ga0268266_101328472 355
1413 3300028380 Ga0268265_10000817 Ga0268265_1000081719 355
1414 3300028380 Ga0268265_10009900 Ga0268265_100099004 355
1415 3300028380 Ga0268265_10079471 Ga0268265_100794712 355
1416 3300028380 Ga0268265_10120271 Ga0268265_101202712 355
1417 3300028381 Ga0268264_10000065 Ga0268264_10000065230 355
1418 3300028381 Ga0268264_10001227 Ga0268264_100012277 355
1419 3300028381 Ga0268264_10024308 Ga0268264_100243083 355
1420 3300028573 Ga0265334_10042944 Ga0265334_100429442 355
1421 3300028577 Ga0265318_10040378 Ga0265318_100403782 355
1422 3300028786 Ga0307517_10000008 Ga0307517_100000089 355
1423 3300028794 Ga0307515_10026041 Ga0307515_100260419 355
1424 3300031235 Ga0265330_10037973 Ga0265330_100379731 355
1425 3300031241 Ga0265325_10030264 Ga0265325_100302642 355
1426 3300031241 Ga0265325_10042198 Ga0265325_100421982 355
1427 3300031241 Ga0265325_10044311 Ga0265325_100443112 355
1428 3300031242 Ga0265329_10018732 Ga0265329_100187322 355
1429 3300031247 Ga0265340_10008853 Ga0265340_100088532 355
1430 3300031249 Ga0265339_10030325 Ga0265339_100303252 355
1431 3300031250 Ga0265331_10023016 Ga0265331_100230163 355
1432 3300031250 Ga0265331_10075329 Ga0265331_100753292 355
1433 3300031344 Ga0265316_10015085 Ga0265316_100150856 355
1434 3300031344 Ga0265316_10032664 Ga0265316_100326643 355
1435 3300031344 Ga0265316_10116788 Ga0265316_101167881 355
1436 3300031456 Ga0307513_10070981 Ga0307513_100709812 355
1437 3300031595 Ga0265313_10030488 Ga0265313_100304882 355
1438 3300031595 Ga0265313_10039966 Ga0265313_100399662 355
1439 3300031616 Ga0307508_10000018 Ga0307508_10000018114 355
1440 3300031616 Ga0307508_10021377 Ga0307508_100213773 355
1441 3300031616 Ga0307508_10212892 Ga0307508_102128922 355
1442 3300031711 Ga0265314_10004715 Ga0265314_100047152 355
1443 3300031711 Ga0265314_10021648 Ga0265314_100216484 355
1444 3300031712 Ga0265342_10011538 Ga0265342_100115386 355
1445 3300031712 Ga0265342_10075603 Ga0265342_100756032 355
1446 3300031730 Ga0307516_10014561 Ga0307516_100145611 355
1447 3300031730 Ga0307516_10068079 Ga0307516_100680791 355
1448 3300031731 Ga0307405_10058956 Ga0307405_100589562 355
1449 3300031911 Ga0307412_10055365 Ga0307412_100553652 355
1450 3300031995 Ga0307409_100159904 Ga0307409_1001599042 355
1451 3300032002 Ga0307416_100040802 Ga0307416_1000408022 355
1452 3300032002 Ga0307416_100449178 Ga0307416_1004491781 355
1453 3300033180 Ga0307510_10026470 Ga0307510_100264703 355
1454 3300033442 Ga0315911_1000006 Ga0315911_1000006321 355
1455 3300034816 Ga0373930_0000266 Ga0373930_0000266_362_1429 355
1456 3300034816 Ga0373930_0001442 Ga0373930_0001442_1676_2743 355
1457 3300034817 Ga0373948_0000471 Ga0373948_0000471_3735_4802 355
1458 3300034818 Ga0373950_0000324 Ga0373950_0000324_3045_4112 355
1459 3300034819 Ga0373958_0000451 Ga0373958_0000451_1627_2694 355
1460 3300034820 Ga0373959_0000553 Ga0373959_0000553_823_1890 355
1461 3300034957 Ga0373938_0000348 Ga0373938_0000348_849_1916 355
1462 3300034957 Ga0373938_0006862 Ga0373938_0006862_521_1588 355
1463 3300035083 Ga0373926_0002868 Ga0373926_0002868_3067_4134 355
1464 3300035084 Ga0373928_0001853 Ga0373928_0001853_1656_2723 355
1465 3300035085 Ga0373929_0000456 Ga0373929_0000456_800_1867 355
1466 3300035085 Ga0373929_0004977 Ga0373929_0004977_858_1925 355
1467 3300035088 Ga0373940_0001082 Ga0373940_0001082_2889_3956 355
1468 3300035088 Ga0373940_0003271 Ga0373940_0003271_623_1690 355
1469 3300035089 Ga0373944_0017321 Ga0373944_0017321_496_1563 355
1470 3300035090 Ga0373949_0002643 Ga0373949_0002643_3172_4239 355
1471 3300035090 Ga0373949_0004203 Ga0373949_0004203_1740_2807 355
1472 3300035090 Ga0373949_0005479 Ga0373949_0005479_977_2044 355
1473 3300035091 Ga0373951_0001125 Ga0373951_0001125_2326_3393 355
1474 3300035091 Ga0373951_0001619 Ga0373951_0001619_578_1645 355
1475 3300035091 Ga0373951_0023787 Ga0373951_0023787_110_1177 355
1476 3300035092 Ga0373952_0000133 Ga0373952_0000133_4917_5984 355
1477 3300035111 Ga0373923_0029874 Ga0373923_0029874_236_1303 355
1478 3300035111 Ga0373923_0031183 Ga0373923_0031183_154_1221 355
1479 3300035111 Ga0373923_0047617 Ga0373923_0047617_525_1592 355
1480 3300035112 Ga0373932_0000703 Ga0373932_0000703_662_1729 355
1481 3300035112 Ga0373932_0001964 Ga0373932_0001964_4006_5073 355
1482 3300035112 Ga0373932_0056793 Ga0373932_0056793_43_1110 355
1483 3300035113 Ga0373936_0007505 Ga0373936_0007505_1852_2919 355
1484 3300035113 Ga0373936_0028149 Ga0373936_0028149_57_1124 355
1485 3300035113 Ga0373936_0028822 Ga0373936_0028822_797_1864 355
1486 3300035113 Ga0373936_0048196 Ga0373936_0048196_327_1394 355
1487 3300035114 Ga0373939_0000343 Ga0373939_0000343_2765_3832 355
1488 3300035114 Ga0373939_0005408 Ga0373939_0005408_849_1916 355
1489 3300035115 Ga0373941_0001154 Ga0373941_0001154_3248_4315 355
1490 3300035115 Ga0373941_0002185 Ga0373941_0002185_2996_4063 355
1491 3300035115 Ga0373941_0003006 Ga0373941_0003006_287_1357 355
1492 3300035116 Ga0373945_0004512 Ga0373945_0004512_2046_3113 355
1493 3300035118 Ga0373954_0002285 Ga0373954_0002285_4362_5429 355
1494 3300035118 Ga0373954_0003393 Ga0373954_0003393_5479_6546 355
1495 3300035118 Ga0373954_0005654 Ga0373954_0005654_3682_4749 355
1496 3300035118 Ga0373954_0022517 Ga0373954_0022517_423_1490 355
1497 3300035119 Ga0373956_0002225 Ga0373956_0002225_4914_5981 355
1498 3300035119 Ga0373956_0021669 Ga0373956_0021669_395_1462 355
1499 3300035119 Ga0373956_0072905 Ga0373956_0072905_163_1230 355
1500 3300035120 Ga0373957_0002536 Ga0373957_0002536_2567_3634 355
1501 3300035120 Ga0373957_0009639 Ga0373957_0009639_695_1762 355
1502 3300035121 Ga0373960_0002057 Ga0373960_0002057_530_1597 355
1503 3300035121 Ga0373960_0002646 Ga0373960_0002646_2633_3700 355
1504 3300035170 Ga0373943_0002714 Ga0373943_0002714_4724_5791 355
1505 3300035170 Ga0373943_0005039 Ga0373943_0005039_2746_3813 355
1506 3300035170 Ga0373943_0008492 Ga0373943_0008492_3338_4405 355
1507 3300035170 Ga0373943_0016526 Ga0373943_0016526_574_1641 355
1508 3300035171 Ga0373946_0041554 Ga0373946_0041554_59_1126 355
1509 3300035172 Ga0373955_0001765 Ga0373955_0001765_3322_4389 355
1510 3300035172 Ga0373955_0027293 Ga0373955_0027293_896_1963 355
1511 3300035172 Ga0373955_0069280 Ga0373955_0069280_581_1648 355
1512 3300035207 Ga0373942_0001912 Ga0373942_0001912_374_1441 355
1513 3300035207 Ga0373942_0005068 Ga0373942_0005068_1628_2695 355
1514 3300035241 Ga0373961_0004534 Ga0373961_0004534_307_1374 355
1515 3300035241 Ga0373961_0026679 Ga0373961_0026679_446_1513 355
1516 3300035242 Ga0373962_0000253 Ga0373962_0000253_5762_6829 355
1517 3300035410 Ga0373924_0005148 Ga0373924_0005148_1104_2171 355
1518 3300035410 Ga0373924_0007383 Ga0373924_0007383_2580_3647 355
1519 3300035691 Ga0373931_0000714 Ga0373931_0000714_9478_10545 355
1520 3300035691 Ga0373931_0001610 Ga0373931_0001610_4482_5549 355
1521 3300035691 Ga0373931_0025062 Ga0373931_0025062_1599_2666 355
1522 3300035691 Ga0373931_0032400 Ga0373931_0032400_852_1919 355
1523 3300035692 Ga0373935_0000382 Ga0373935_0000382_9315_10382 355
1524 3300035692 Ga0373935_0004984 Ga0373935_0004984_1276_2343 355
1525 3300035692 Ga0373935_0060881 Ga0373935_0060881_557_1624 355
1526 3300035692 Ga0373935_0110312 Ga0373935_0110312_726_1793 355
1527 3300035692 Ga0373935_0113950 Ga0373935_0113950_240_1307 355
1528 3300035692 Ga0373935_0189356 Ga0373935_0189356_132_1199 355
1529 3300035695 Ga0373927_0002885 Ga0373927_0002885_1285_2352 355
1530 3300035695 Ga0373927_0003772 Ga0373927_0003772_7694_8761 355
1531 3300035695 Ga0373927_0008081 Ga0373927_0008081_3217_4284 355
1532 3300035695 Ga0373927_0009027 Ga0373927_0009027_2261_3328 355
1533 3300035695 Ga0373927_0009357 Ga0373927_0009357_4543_5610 355
1534 3300035695 Ga0373927_0035894 Ga0373927_0035894_68_1135 355
1535 3300035724 Ga0373933_0000110 Ga0373933_0000110_9243_10310 355
1536 3300035724 Ga0373933_0001224 Ga0373933_0001224_10860_11927 355
1537 3300035724 Ga0373933_0002094 Ga0373933_0002094_3036_4103 355
1538 3300035724 Ga0373933_0144907 Ga0373933_0144907_171_1238 355
1539 3300035725 Ga0373947_0001850 Ga0373947_0001850_2103_3170 355
1540 3300035725 Ga0373947_0005699 Ga0373947_0005699_2536_3603 355
1541 3300035725 Ga0373947_0015499 Ga0373947_0015499_2303_3370 355
1542 3300035725 Ga0373947_0034544 Ga0373947_0034544_1628_2695 355
1543 3300035725 Ga0373947_0036519 Ga0373947_0036519_1334_2401 355
1544 3300035725 Ga0373947_0080640 Ga0373947_0080640_319_1386 355
1545 3300035725 Ga0373947_0119783 Ga0373947_0119783_210_1277 355
1546 3300036401 Ga0373937_0000849 Ga0373937_0000849_178_1245 355
1547 3300036401 Ga0373937_0005174 Ga0373937_0005174_3070_4137 355
1548 3300036401 Ga0373937_0030627 Ga0373937_0030627_2006_3073 355
1549 3300036401 Ga0373937_0040820 Ga0373937_0040820_1780_2847 355
1550 3300036401 Ga0373937_0194250 Ga0373937_0194250_64_1131 355
1551 3300037068 Ga0373925_0007329 Ga0373925_0007329_744_1811 355
1552 3300037068 Ga0373925_0009418 Ga0373925_0009418_4668_5735 355
1553 3300037068 Ga0373925_0013981 Ga0373925_0013981_2616_3683 355
1554 3300037068 Ga0373925_0020372 Ga0373925_0020372_2346_3413 355
1555 3300037068 Ga0373925_0022711 Ga0373925_0022711_505_1572 355
1556 3300037068 Ga0373925_0029279 Ga0373925_0029279_443_1510 355
1557 3300037068 Ga0373925_0030911 Ga0373925_0030911_922_1989 355
1558 3300037068 Ga0373925_0037118 Ga0373925_0037118_2342_3409 355
1559 3300037068 Ga0373925_0065256 Ga0373925_0065256_753_1820 355
1560 3300037312 Ga0395899_0008367 Ga0395899_0008367_4099_5166 355
1561 3300037418 Ga0395900_0000940 Ga0395900_0000940_10881_11948 355
1562 3300037418 Ga0395900_0018516 Ga0395900_0018516_566_1636 355
1563 3300037418 Ga0395900_0042832 Ga0395900_0042832_1949_3016 355
1564 3300037466 Ga0395898_0006219 Ga0395898_0006219_8948_10015 355
1565 3300037466 Ga0395898_0066370 Ga0395898_0066370_366_1433 355
1566 3300037466 Ga0395898_0116297 Ga0395898_0116297_747_1814 355
1567 3300037471 Ga0395905_0001756 Ga0395905_0001756_23860_24927 355
1568 3300037471 Ga0395905_0004739 Ga0395905_0004739_8574_9644 355
1569 3300037853 Ga0436364_0351617 Ga0436364_0351617_945_2012 355
1570 3300038443 Ga0395901_0020828 Ga0395901_0020828_5011_6078 355
1571 3300038443 Ga0395901_0080714 Ga0395901_0080714_481_1551 355
1572 3300038735 Ga0400485_12741 Ga0400485_12741_21522_22640 355
1573 3300038742 Ga0400486_20716 Ga0400486_20716_994_2148 355
1574 3300039110 Ga0400487_27495 Ga0400487_27495_1104_2222 355
1575 3300039437 Ga0436365_0225834 Ga0436365_0225834_2030_3097 355
1576 3300039437 Ga0436365_0684140 Ga0436365_0684140_28_1095 355
1577 3300039437 Ga0436365_1077710 Ga0436365_1077710_1284_2351 355
1578 3300039437 Ga0436365_1332159 Ga0436365_1332159_13719_14786 355
1579 3300039450 Ga0436363_1328249 Ga0436363_1328249_1720_2787 355
1580 3300039453 Ga0436362_0123159 Ga0436362_0123159_68_1135 355
1581 3300042005 Ga0439448_0037983 Ga0439448_0037983_407_1474 355
1582 3300042436 Ga0439435_0041066 Ga0439435_0041066_182_1249 355
1583 3300044658 Ga0466972_0001455 Ga0466972_0001455_7813_8880 355
1584 3300044658 Ga0466972_0004207 Ga0466972_0004207_2432_3499 355
1585 3300044673 Ga0453683_0016653 Ga0453683_0016653_2492_3583 355
1586 3300044683 Ga0466965_0050746 Ga0466965_0050746_911_1978 355
1587 3300044735 Ga0466968_0034723 Ga0466968_0034723_923_1990 355
1588 3300044901 Ga0466960_0010379 Ga0466960_0010379_2513_3580 355
1589 3300044901 Ga0466960_0047808 Ga0466960_0047808_93_1160 355
1590 3300045049 Ga0466959_0028283 Ga0466959_0028283_2708_3775 355
1591 3300045051 Ga0451576_0004860 Ga0451576_0004860_14961_16052 355
1592 3300045976 Ga0466967_0001722 Ga0466967_0001722_1256_2323 355
1593 3300045976 Ga0466967_0062148 Ga0466967_0062148_913_1980 355
1594 3300046452 Ga0495617_051367 Ga0495617_051367_145_1212 355
1595 3300046454 Ga0495592_0003334 Ga0495592_0003334_4151_5218 355
1596 3300046454 Ga0495592_0008695 Ga0495592_0008695_3339_4406 355
1597 3300046454 Ga0495592_0026610 Ga0495592_0026610_248_1315 355
1598 3300046454 Ga0495592_0047700 Ga0495592_0047700_1543_2610 355
1599 3300046454 Ga0495592_0048320 Ga0495592_0048320_746_1813 355
1600 3300046454 Ga0495592_0132609 Ga0495592_0132609_305_1372 355
1601 3300046455 Ga0495603_0000191 Ga0495603_0000191_26677_27744 355
1602 3300046455 Ga0495603_0007025 Ga0495603_0007025_1081_2148 355
1603 3300046455 Ga0495603_0012838 Ga0495603_0012838_3424_4491 355
1604 3300046459 Ga0495629_0000500 Ga0495629_0000500_5790_6857 355
1605 3300046459 Ga0495629_0001281 Ga0495629_0001281_7794_8861 355
1606 3300046459 Ga0495629_0002009 Ga0495629_0002009_9881_10948 355
1607 3300046459 Ga0495629_0065989 Ga0495629_0065989_57_1124 355
1608 3300046459 Ga0495629_0115401 Ga0495629_0115401_768_1835 355
1609 3300046459 Ga0495629_0141597 Ga0495629_0141597_237_1304 355
1610 3300046460 Ga0495638_0032724 Ga0495638_0032724_1443_2510 355
1611 3300046460 Ga0495638_0125884 Ga0495638_0125884_392_1459 355
1612 3300046461 Ga0495641_0001436 Ga0495641_0001436_13852_14919 355
1613 3300046461 Ga0495641_0078328 Ga0495641_0078328_178_1245 355
1614 3300046461 Ga0495641_0106583 Ga0495641_0106583_83_1150 355
1615 3300046462 Ga0495651_0009095 Ga0495651_0009095_1598_2665 355
1616 3300046462 Ga0495651_0036961 Ga0495651_0036961_866_1933 355
1617 3300046463 Ga0495653_0002307 Ga0495653_0002307_6278_7345 355
1618 3300046463 Ga0495653_0004970 Ga0495653_0004970_7546_8613 355
1619 3300046463 Ga0495653_0010292 Ga0495653_0010292_1511_2578 355
1620 3300046463 Ga0495653_0041256 Ga0495653_0041256_1213_2280 355
1621 3300046463 Ga0495653_0079954 Ga0495653_0079954_285_1352 355
1622 3300046472 Ga0495580_0004694 Ga0495580_0004694_3858_4925 355
1623 3300046472 Ga0495580_0009608 Ga0495580_0009608_3972_5039 355
1624 3300046472 Ga0495580_0040570 Ga0495580_0040570_158_1225 355
1625 3300046473 Ga0495582_0000251 Ga0495582_0000251_6739_7806 355
1626 3300046473 Ga0495582_0009496 Ga0495582_0009496_3217_4284 355
1627 3300046473 Ga0495582_0012182 Ga0495582_0012182_2715_3782 355
1628 3300046473 Ga0495582_0045732 Ga0495582_0045732_778_1845 355
1629 3300046473 Ga0495582_0086417 Ga0495582_0086417_505_1572 355
1630 3300046475 Ga0495639_0000077 Ga0495639_0000077_26954_28021 355
1631 3300046475 Ga0495639_0006383 Ga0495639_0006383_71_1138 355
1632 3300046475 Ga0495639_0032533 Ga0495639_0032533_238_1365 355
1633 3300046476 Ga0495662_0000826 Ga0495662_0000826_1525_2592 355
1634 3300046476 Ga0495662_0014265 Ga0495662_0014265_1761_2828 355
1635 3300046477 Ga0495664_0009436 Ga0495664_0009436_998_2065 355
1636 3300046477 Ga0495664_0024516 Ga0495664_0024516_319_1386 355
1637 3300046477 Ga0495664_0034171 Ga0495664_0034171_993_2060 355
1638 3300046477 Ga0495664_0111696 Ga0495664_0111696_387_1454 355
1639 3300046491 Ga0495584_0073949 Ga0495584_0073949_211_1278 355
1640 3300046492 Ga0495585_0094237 Ga0495585_0094237_338_1405 355
1641 3300046499 Ga0495594_0000648 Ga0495594_0000648_5471_6538 355
1642 3300046499 Ga0495594_0046269 Ga0495594_0046269_33_1100 355
1643 3300046500 Ga0495596_0063043 Ga0495596_0063043_336_1403 355
1644 3300046507 Ga0495606_0034264 Ga0495606_0034264_275_1342 355
1645 3300046507 Ga0495606_0085500 Ga0495606_0085500_445_1512 355
1646 3300046511 Ga0495608_0002352 Ga0495608_0002352_9334_10401 355
1647 3300046511 Ga0495608_0004206 Ga0495608_0004206_7146_8213 355
1648 3300046514 Ga0495618_0004363 Ga0495618_0004363_3356_4423 355
1649 3300046514 Ga0495618_0011914 Ga0495618_0011914_2529_3596 355
1650 3300046514 Ga0495618_0050692 Ga0495618_0050692_1524_2591 355
1651 3300046515 Ga0495620_0100369 Ga0495620_0100369_63_1130 355
1652 3300046516 Ga0495628_0007652 Ga0495628_0007652_3945_5012 355
1653 3300046516 Ga0495628_0012115 Ga0495628_0012115_1371_2438 355
1654 3300046516 Ga0495628_0015917 Ga0495628_0015917_1497_2564 355
1655 3300046516 Ga0495628_0085728 Ga0495628_0085728_382_1449 355
1656 3300046517 Ga0495630_0001279 Ga0495630_0001279_6493_7560 355
1657 3300046517 Ga0495630_0040014 Ga0495630_0040014_2376_3443 355
1658 3300046526 Ga0495666_0008087 Ga0495666_0008087_714_1781 355
1659 3300046526 Ga0495666_0027327 Ga0495666_0027327_1688_2755 355
1660 3300046526 Ga0495666_0029598 Ga0495666_0029598_354_1421 355
1661 3300046529 Ga0495652_0009266 Ga0495652_0009266_3602_4669 355
1662 3300046529 Ga0495652_0023802 Ga0495652_0023802_191_1258 355
1663 3300046529 Ga0495652_0069642 Ga0495652_0069642_645_1712 355
1664 3300046531 Ga0495665_0005139 Ga0495665_0005139_4649_5716 355
1665 3300046533 Ga0495640_0003320 Ga0495640_0003320_8689_9756 355
1666 3300046533 Ga0495640_0004102 Ga0495640_0004102_5359_6426 355
1667 3300046533 Ga0495640_0055553 Ga0495640_0055553_1571_2638 355
1668 3300046533 Ga0495640_0157445 Ga0495640_0157445_204_1271 355
1669 3300046535 Ga0495586_0002128 Ga0495586_0002128_9042_10109 355
1670 3300046536 Ga0495587_0003095 Ga0495587_0003095_3059_4126 355
1671 3300046536 Ga0495587_0013122 Ga0495587_0013122_1598_2665 355
1672 3300046539 Ga0495621_0002390 Ga0495621_0002390_1581_2648 355
1673 3300046539 Ga0495621_0015571 Ga0495621_0015571_796_1863 355
1674 3300046543 Ga0495645_0003434 Ga0495645_0003434_5972_7039 355
1675 3300046543 Ga0495645_0010291 Ga0495645_0010291_3559_4626 355
1676 3300046543 Ga0495645_0020403 Ga0495645_0020403_2328_3395 355
1677 3300046543 Ga0495645_0063652 Ga0495645_0063652_893_1960 355
1678 3300046558 Ga0495633_0010291 Ga0495633_0010291_2900_3967 355
1679 3300046559 Ga0495667_0001067 Ga0495667_0001067_3270_4337 355
1680 3300046559 Ga0495667_0002892 Ga0495667_0002892_6279_7346 355
1681 3300046559 Ga0495667_0011827 Ga0495667_0011827_3452_4519 355
1682 3300046559 Ga0495667_0040012 Ga0495667_0040012_1358_2425 355
1683 3300046616 Ga0495668_0014263 Ga0495668_0014263_850_1917 355
1684 3300046616 Ga0495668_0081063 Ga0495668_0081063_313_1380 355
1685 3300046642 Ga0495634_0001976 Ga0495634_0001976_12381_13448 355
1686 3300046642 Ga0495634_0015373 Ga0495634_0015373_2530_3597 355
1687 3300046642 Ga0495634_0085415 Ga0495634_0085415_576_1643 355
1688 3300046642 Ga0495634_0127946 Ga0495634_0127946_391_1458 355
1689 3300046660 Ga0495625_0243030 Ga0495625_0243030_65_1132 355
1690 3300046663 Ga0495635_0004431 Ga0495635_0004431_3994_5061 355
1691 3300046663 Ga0495635_0019246 Ga0495635_0019246_2958_4025 355
1692 3300046663 Ga0495635_0021691 Ga0495635_0021691_1237_2304 355
1693 3300046664 Ga0495659_0002989 Ga0495659_0002989_2892_3959 355
1694 3300046674 Ga0495588_0004422 Ga0495588_0004422_4235_5302 355
1695 3300046674 Ga0495588_0036562 Ga0495588_0036562_190_1257 355
1696 3300046675 Ga0495657_0007463 Ga0495657_0007463_1186_2253 355
1697 3300046675 Ga0495657_0007949 Ga0495657_0007949_4862_5929 355
1698 3300046675 Ga0495657_0028576 Ga0495657_0028576_2154_3221 355
1699 3300046678 Ga0495599_0006005 Ga0495599_0006005_2072_3139 355
1700 3300046678 Ga0495599_0028649 Ga0495599_0028649_192_1259 355
1701 3300046679 Ga0495623_0004291 Ga0495623_0004291_6577_7644 355
1702 3300046679 Ga0495623_0011175 Ga0495623_0011175_3144_4211 355
1703 3300046679 Ga0495623_0107574 Ga0495623_0107574_548_1615 355
1704 3300046680 Ga0495646_0002070 Ga0495646_0002070_3042_4109 355
1705 3300046680 Ga0495646_0006456 Ga0495646_0006456_3474_4541 355
1706 3300046680 Ga0495646_0020774 Ga0495646_0020774_1267_2334 355
1707 3300046681 Ga0495647_0053033 Ga0495647_0053033_496_1563 355
1708 3300046683 Ga0495658_0001175 Ga0495658_0001175_3226_4293 355
1709 3300046683 Ga0495658_0001615 Ga0495658_0001615_8978_10045 355
1710 3300046684 Ga0495669_0006510 Ga0495669_0006510_1935_3002 355
1711 3300046689 Ga0495613_0011644 Ga0495613_0011644_1127_2194 355
1712 3300046689 Ga0495613_0012697 Ga0495613_0012697_2288_3355 355
1713 3300046689 Ga0495613_0022371 Ga0495613_0022371_127_1194 355
1714 3300046690 Ga0495624_0002021 Ga0495624_0002021_12347_13414 355
1715 3300046809 Ga0495600_0001546 Ga0495600_0001546_4454_5521 355
1716 3300046809 Ga0495600_0004625 Ga0495600_0004625_4123_5190 355
1717 3300046809 Ga0495600_0037714 Ga0495600_0037714_1610_2677 355
1718 3300047315 Ga0495581_0000503 Ga0495581_0000503_6555_7622 355
1719 3300047315 Ga0495581_0033250 Ga0495581_0033250_1290_2357 355
1720 3300047315 Ga0495581_0034285 Ga0495581_0034285_367_1434 355
1721 3300047317 Ga0495604_0003694 Ga0495604_0003694_8058_9125 355
1722 3300047317 Ga0495604_0011558 Ga0495604_0011558_1598_2665 355
1723 3300047317 Ga0495604_0023789 Ga0495604_0023789_3361_4428 355
1724 3300047317 Ga0495604_0027799 Ga0495604_0027799_2835_3902 355
1725 3300047317 Ga0495604_0094279 Ga0495604_0094279_822_1889 355
1726 3300047319 Ga0495674_0001342 Ga0495674_0001342_21025_22092 355
1727 3300047319 Ga0495674_0026245 Ga0495674_0026245_3891_4958 355
1728 3300047319 Ga0495674_0032084 Ga0495674_0032084_3054_4121 355
1729 3300047319 Ga0495674_0044803 Ga0495674_0044803_957_2024 355
1730 3300047319 Ga0495674_0052198 Ga0495674_0052198_524_1591 355
1731 3300047319 Ga0495674_0117877 Ga0495674_0117877_518_1585 355
1732 3300047320 Ga0495672_0032635 Ga0495672_0032635_1985_3052 355
1733 3300047321 Ga0495676_0021687 Ga0495676_0021687_681_1748 355
1734 3300047321 Ga0495676_0050478 Ga0495676_0050478_494_1561 355
1735 3300047321 Ga0495676_0142177 Ga0495676_0142177_33_1100 355
1736 3300047322 Ga0495680_0012767 Ga0495680_0012767_4060_5127 355
1737 3300047322 Ga0495680_0018195 Ga0495680_0018195_3267_4334 355
1738 3300047322 Ga0495680_0036916 Ga0495680_0036916_1485_2552 355
1739 3300047443 Ga0495687_012474 Ga0495687_012474_752_1819 355
1740 3300047444 Ga0495675_0001338 Ga0495675_0001338_3062_4129 355
1741 3300047444 Ga0495675_0002401 Ga0495675_0002401_6950_8017 355
1742 3300047444 Ga0495675_0004135 Ga0495675_0004135_7111_8178 355
1743 3300047469 Ga0495673_0057791 Ga0495673_0057791_377_1444 355
1744 3300047471 Ga0495684_0002991 Ga0495684_0002991_4960_6027 355
1745 3300047471 Ga0495684_0006000 Ga0495684_0006000_6953_8020 355
1746 3300047471 Ga0495684_0050791 Ga0495684_0050791_751_1818 355
1747 3300047471 Ga0495684_0088193 Ga0495684_0088193_138_1205 355
1748 3300047472 Ga0495686_0005497 Ga0495686_0005497_7858_8937 355
1749 3300047673 Ga0495593_0000192 Ga0495593_0000192_4169_5236 355
1750 3300047673 Ga0495593_0001200 Ga0495593_0001200_7934_9001 355
1751 3300047673 Ga0495593_0007939 Ga0495593_0007939_2408_3475 355
1752 3300047673 Ga0495593_0009818 Ga0495593_0009818_3094_4161 355
1753 3300047673 Ga0495593_0027391 Ga0495593_0027391_1862_2929 355
1754 3300048088 Ga0495602_0002392 Ga0495602_0002392_14915_15982 355
1755 3300048088 Ga0495602_0007064 Ga0495602_0007064_1379_2446 355
1756 3300048088 Ga0495602_0017778 Ga0495602_0017778_4454_5521 355
1757 3300048903 Ga0496100_0003962 Ga0496100_0003962_6118_7185 355
1758 3300048903 Ga0496100_0005504 Ga0496100_0005504_1622_2689 355
1759 3300048903 Ga0496100_0023159 Ga0496100_0023159_751_1818 355
1760 3300048903 Ga0496100_0059662 Ga0496100_0059662_446_1513 355
1761 3300048904 Ga0496101_0001185 Ga0496101_0001185_12347_13414 355
1762 3300048904 Ga0496101_0014484 Ga0496101_0014484_864_1931 355
1763 3300048904 Ga0496101_0052455 Ga0496101_0052455_1009_2076 355
1764 3300048904 Ga0496101_0067099 Ga0496101_0067099_22_1089 355
1765 3300048905 Ga0496102_0001427 Ga0496102_0001427_7730_8797 355
1766 3300048905 Ga0496102_0010740 Ga0496102_0010740_894_1961 355
1767 3300048905 Ga0496102_0018426 Ga0496102_0018426_2406_3473 355
1768 3300048905 Ga0496102_0021189 Ga0496102_0021189_727_1794 355
1769 3300048905 Ga0496102_0033644 Ga0496102_0033644_1923_2990 355
1770 3300048905 Ga0496102_0053452 Ga0496102_0053452_1521_2588 355
1771 3300048906 Ga0496103_0001145 Ga0496103_0001145_4078_5145 355
1772 3300048906 Ga0496103_0012446 Ga0496103_0012446_1232_2299 355
1773 3300048906 Ga0496103_0028524 Ga0496103_0028524_933_2000 355
1774 3300048906 Ga0496103_0068689 Ga0496103_0068689_484_1551 355
1775 3300048907 Ga0496104_0000800 Ga0496104_0000800_10902_11969 355
1776 3300048907 Ga0496104_0004653 Ga0496104_0004653_4985_6052 355
1777 3300048907 Ga0496104_0024050 Ga0496104_0024050_3451_4518 355
1778 3300048907 Ga0496104_0034040 Ga0496104_0034040_1866_2933 355
1779 3300048907 Ga0496104_0080146 Ga0496104_0080146_527_1594 355
1780 3300048908 Ga0496105_0014766 Ga0496105_0014766_894_1961 355
1781 3300048908 Ga0496105_0019467 Ga0496105_0019467_2879_3946 355
1782 3300048908 Ga0496105_0061032 Ga0496105_0061032_405_1472 355
1783 3300048908 Ga0496105_0062915 Ga0496105_0062915_799_1866 355
1784 3300048909 Ga0496106_0000644 Ga0496106_0000644_12431_13498 355
1785 3300048909 Ga0496106_0015891 Ga0496106_0015891_793_1860 355
1786 3300048909 Ga0496106_0016692 Ga0496106_0016692_2933_4000 355
1787 3300048909 Ga0496106_0038434 Ga0496106_0038434_1137_2204 355
1788 3300048910 Ga0496107_0000844 Ga0496107_0000844_9801_10868 355
1789 3300048910 Ga0496107_0002006 Ga0496107_0002006_6551_7618 355
1790 3300048910 Ga0496107_0009798 Ga0496107_0009798_2984_4051 355
1791 3300048910 Ga0496107_0031969 Ga0496107_0031969_1795_2862 355
1792 3300048910 Ga0496107_0033348 Ga0496107_0033348_1055_2122 355
1793 3300048911 Ga0496108_0002310 Ga0496108_0002310_427_1494 355
1794 3300048911 Ga0496108_0002624 Ga0496108_0002624_4861_5928 355
1795 3300048911 Ga0496108_0057494 Ga0496108_0057494_822_1889 355
1796 3300048911 Ga0496108_0079607 Ga0496108_0079607_207_1274 355
1797 3300048912 Ga0496109_0003011 Ga0496109_0003011_10503_11570 355
1798 3300048912 Ga0496109_0011996 Ga0496109_0011996_3322_4389 355
1799 3300048912 Ga0496109_0159657 Ga0496109_0159657_114_1181 355
1800 3300048913 Ga0496110_0002024 Ga0496110_0002024_8281_9348 355
1801 3300048913 Ga0496110_0005701 Ga0496110_0005701_2885_3952 355
1802 3300048913 Ga0496110_0013610 Ga0496110_0013610_3244_4311 355
1803 3300048913 Ga0496110_0063334 Ga0496110_0063334_555_1622 355
1804 3300048913 Ga0496110_0121716 Ga0496110_0121716_1010_2077 355
1805 3300048914 Ga0496111_0003300 Ga0496111_0003300_8416_9483 355
1806 3300048914 Ga0496111_0016639 Ga0496111_0016639_3730_4797 355
1807 3300048914 Ga0496111_0020931 Ga0496111_0020931_2706_3773 355
1808 3300048914 Ga0496111_0025629 Ga0496111_0025629_3039_4106 355
1809 3300048914 Ga0496111_0029166 Ga0496111_0029166_1161_2228 355
1810 3300048914 Ga0496111_0178753 Ga0496111_0178753_14_1081 355
1811 3300048915 Ga0496112_0000004 Ga0496112_0000004_318810_319877 355
1812 3300048915 Ga0496112_0010399 Ga0496112_0010399_6752_7819 355
1813 3300048915 Ga0496112_0013933 Ga0496112_0013933_832_1899 355
1814 3300048915 Ga0496112_0031686 Ga0496112_0031686_2824_3891 355
1815 3300048915 Ga0496112_0074323 Ga0496112_0074323_1296_2363 355
1816 3300048915 Ga0496112_0202571 Ga0496112_0202571_163_1230 355
1817 3300048915 Ga0496112_0430124 Ga0496112_0430124_147_1214 355
1818 3300048916 Ga0496113_0006037 Ga0496113_0006037_851_1918 355
1819 3300048916 Ga0496113_0010146 Ga0496113_0010146_719_1786 355
1820 3300048916 Ga0496113_0022159 Ga0496113_0022159_783_1850 355
1821 3300048916 Ga0496113_0116201 Ga0496113_0116201_31_1098 355
1822 3300048917 Ga0496114_0010127 Ga0496114_0010127_2190_3257 355
1823 3300048917 Ga0496114_0014349 Ga0496114_0014349_3957_5024 355
1824 3300048917 Ga0496114_0068992 Ga0496114_0068992_1461_2528 355
1825 3300048917 Ga0496114_0086065 Ga0496114_0086065_1316_2383 355
1826 3300048918 Ga0496115_0010097 Ga0496115_0010097_3675_4742 355
1827 3300048918 Ga0496115_0016209 Ga0496115_0016209_1943_3010 355
1828 3300048918 Ga0496115_0017600 Ga0496115_0017600_414_1481 355
1829 3300048918 Ga0496115_0021136 Ga0496115_0021136_3037_4104 355
1830 3300048918 Ga0496115_0029351 Ga0496115_0029351_50_1117 355
1831 3300048918 Ga0496115_0030622 Ga0496115_0030622_1648_2715 355
1832 3300048918 Ga0496115_0061514 Ga0496115_0061514_1353_2420 355
1833 3300048918 Ga0496115_0115841 Ga0496115_0115841_839_1906 355
1834 3300048921 Ga0496118_0022371 Ga0496118_0022371_2156_3223 355
1835 3300048924 Ga0496121_0000458 Ga0496121_0000458_78200_79267 355
1836 3300048924 Ga0496121_0000668 Ga0496121_0000668_38490_39557 355
1837 3300048924 Ga0496121_0046790 Ga0496121_0046790_1102_2169 355
1838 3300048924 Ga0496121_0058459 Ga0496121_0058459_1807_2874 355
1839 3300048924 Ga0496121_0116311 Ga0496121_0116311_695_1762 355
1840 3300048927 Ga0496124_0018892 Ga0496124_0018892_3690_4757 355
1841 3300048929 Ga0496126_0015822 Ga0496126_0015822_572_1639 355
1842 3300048929 Ga0496126_0121675 Ga0496126_0121675_156_1223 355
1843 3300049568 Ga0501031_0028491 Ga0501031_0028491_195_1262 355
1844 3300049569 Ga0501032_0005134 Ga0501032_0005134_6286_7356 355
1845 3300049569 Ga0501032_0017361 Ga0501032_0017361_3587_4657 355
1846 3300049570 Ga0501033_0034418 Ga0501033_0034418_1774_2844 355
1847 3300049570 Ga0501033_0101887 Ga0501033_0101887_295_1365 355
1848 3300049571 Ga0501034_0001160 Ga0501034_0001160_31060_32130 355
1849 3300049571 Ga0501034_0417808 Ga0501034_0417808_134_1204 355
1850 3300049572 Ga0501036_0003243 Ga0501036_0003243_6284_7354 355
1851 3300049572 Ga0501036_0046547 Ga0501036_0046547_691_1758 355
1852 3300049573 Ga0501037_0002178 Ga0501037_0002178_2363_3433 355
1853 3300049573 Ga0501037_0024884 Ga0501037_0024884_1857_2927 355
1854 3300049573 Ga0501037_0041443 Ga0501037_0041443_776_1846 355
1855 3300049574 Ga0501038_0027593 Ga0501038_0027593_2761_3831 355
1856 3300049574 Ga0501038_0044018 Ga0501038_0044018_1652_2719 355
1857 3300049574 Ga0501038_0135773 Ga0501038_0135773_810_1901 355
1858 3300049575 Ga0501039_0005778 Ga0501039_0005778_3927_4997 355
1859 3300049575 Ga0501039_0151695 Ga0501039_0151695_373_1443 355
1860 3300049579 Ga0501043_0010595 Ga0501043_0010595_6083_7153 355
1861 3300049579 Ga0501043_0059176 Ga0501043_0059176_623_1693 355
1862 3300049580 Ga0501046_0009020 Ga0501046_0009020_6529_7599 355
1863 3300049580 Ga0501046_0016351 Ga0501046_0016351_2224_3291 355
1864 3300049580 Ga0501046_0055778 Ga0501046_0055778_1407_2477 355
1865 3300049580 Ga0501046_0056031 Ga0501046_0056031_831_1901 355
1866 3300049581 Ga0501047_0001508 Ga0501047_0001508_17526_18596 355
1867 3300049581 Ga0501047_0010664 Ga0501047_0010664_4543_5610 355
1868 3300049581 Ga0501047_0014013 Ga0501047_0014013_1674_2744 355
1869 3300049582 Ga0501048_0000151 Ga0501048_0000151_32483_33553 355
1870 3300049583 Ga0501067_0008205 Ga0501067_0008205_2570_3637 355
1871 3300049584 Ga0501068_0097161 Ga0501068_0097161_568_1638 355
1872 3300049585 Ga0501069_0027507 Ga0501069_0027507_1952_3022 355
1873 3300049586 Ga0501070_0005227 Ga0501070_0005227_252_1322 355
1874 3300049586 Ga0501070_0014416 Ga0501070_0014416_2080_3147 355
1875 3300049587 Ga0501071_0093943 Ga0501071_0093943_94_1164 355
1876 3300049588 Ga0501072_0097197 Ga0501072_0097197_912_1982 355
1877 3300049589 Ga0501073_0033251 Ga0501073_0033251_1937_3004 355
1878 3300049589 Ga0501073_0047140 Ga0501073_0047140_1085_2155 355
1879 3300049589 Ga0501073_0114295 Ga0501073_0114295_708_1778 355
1880 3300049590 Ga0501074_0010639 Ga0501074_0010639_3808_4875 355
1881 3300049590 Ga0501074_0018658 Ga0501074_0018658_1372_2442 355
1882 3300049590 Ga0501074_0070101 Ga0501074_0070101_377_1447 355
1883 3300049590 Ga0501074_0135923 Ga0501074_0135923_313_1383 355
1884 3300049591 Ga0501075_0129638 Ga0501075_0129638_694_1761 355
1885 3300049592 Ga0501076_0009771 Ga0501076_0009771_5510_6577 355
1886 3300049592 Ga0501076_0095072 Ga0501076_0095072_926_1993 355
1887 3300049592 Ga0501076_0103471 Ga0501076_0103471_612_1682 355
1888 3300049593 Ga0501077_0064401 Ga0501077_0064401_906_1973 355
1889 3300049741 Ga0501079_0021362 Ga0501079_0021362_3559_4626 355
1890 3300049741 Ga0501079_0045004 Ga0501079_0045004_1116_2186 355
1891 3300049742 Ga0501080_0000130 Ga0501080_0000130_30483_31553 355
1892 3300049742 Ga0501080_0037162 Ga0501080_0037162_240_1307 355
1893 3300049742 Ga0501080_0070845 Ga0501080_0070845_962_2032 355
1894 3300049742 Ga0501080_0080027 Ga0501080_0080027_17_1084 355
1895 3300049743 Ga0501081_0059062 Ga0501081_0059062_1359_2426 355
1896 3300049744 Ga0501083_0072468 Ga0501083_0072468_497_1564 355
1897 3300049744 Ga0501083_0102558 Ga0501083_0102558_350_1417 355
1898 3300049744 Ga0501083_0107677 Ga0501083_0107677_429_1496 355
1899 3300049822 Ga0501035_0115008 Ga0501035_0115008_1105_2175 355
1900 3300049823 Ga0501044_0000636 Ga0501044_0000636_32511_33581 355
1901 3300049823 Ga0501044_0035319 Ga0501044_0035319_832_1899 355
1902 3300049823 Ga0501044_0044641 Ga0501044_0044641_2695_3762 355
1903 3300049823 Ga0501044_0072975 Ga0501044_0072975_1208_2278 355
1904 3300049823 Ga0501044_0129136 Ga0501044_0129136_496_1566 355
1905 3300050490 nmdc:mga03n38_22876_c1 nmdc:mga03n38_22876_c1_1374_2441 355
1906 3300050490 nmdc:mga03n38_4203_c1 nmdc:mga03n38_4203_c1_3204_4271 355
1907 3300050491 nmdc:mga00v17_65912_c1 nmdc:mga00v17_65912_c1_884_1951 355
1908 3300050492 nmdc:mga0yw44_4056_c1 nmdc:mga0yw44_4056_c1_4422_5489 355
1909 3300050492 nmdc:mga0yw44_59988_c1 nmdc:mga0yw44_59988_c1_1225_2292 355
1910 3300050492 nmdc:mga0yw44_94336_c1 nmdc:mga0yw44_94336_c1_656_1723 355
1911 3300050493 nmdc:mga0k408_69181_c1 nmdc:mga0k408_69181_c1_849_1916 355
1912 3300050493 nmdc:mga0k408_70184_c1 nmdc:mga0k408_70184_c1_930_1997 355
1913 3300050494 nmdc:mga06z11_5335_c1 nmdc:mga06z11_5335_c1_1787_2854 355
1914 3300050495 nmdc:mga04h51_32831_c1 nmdc:mga04h51_32831_c1_316_1383 355
1915 3300050495 nmdc:mga04h51_54496_c1 nmdc:mga04h51_54496_c1_79_1146 355
1916 3300050507 nmdc:mga05p37_4809_c1 nmdc:mga05p37_4809_c1_13118_14188 355
1917 3300050507 nmdc:mga05p37_63712_c1 nmdc:mga05p37_63712_c1_1717_2784 355
1918 3300050507 nmdc:mga05p37_6528_c1 nmdc:mga05p37_6528_c1_4912_5982 355
1919 3300050508 nmdc:mga09592_327793_c1 nmdc:mga09592_327793_c1_223_1290 355
1920 3300050508 nmdc:mga09592_3717_c1 nmdc:mga09592_3717_c1_9970_11040 355
1921 3300050509 nmdc:mga0qj67_64256_c1 nmdc:mga0qj67_64256_c1_99_1169 355
1922 3300050510 nmdc:mga06r32_321926_c1 nmdc:mga06r32_321926_c1_150_1217 355
1923 3300050510 nmdc:mga06r32_5210_c1 nmdc:mga06r32_5210_c1_9356_10426 355
1924 3300050511 nmdc:mga08y16_111162_c1 nmdc:mga08y16_111162_c1_1774_2841 355
1925 3300050511 nmdc:mga08y16_194299_c1 nmdc:mga08y16_194299_c1_374_1441 355
1926 3300050511 nmdc:mga08y16_30352_c1 nmdc:mga08y16_30352_c1_3197_4264 355
1927 3300050511 nmdc:mga08y16_4659_c1 nmdc:mga08y16_4659_c1_11061_12131 355
1928 3300050511 nmdc:mga08y16_60267_c1 nmdc:mga08y16_60267_c1_2180_3247 355
1929 3300050512 nmdc:mga0n895_134904_c1 nmdc:mga0n895_134904_c1_962_2032 355
1930 3300050512 nmdc:mga0n895_1698_c1 nmdc:mga0n895_1698_c1_7461_8528 355
1931 3300050512 nmdc:mga0n895_26906_c1 nmdc:mga0n895_26906_c1_957_2024 355
1932 3300050512 nmdc:mga0n895_324652_c1 nmdc:mga0n895_324652_c1_36_1103 355
1933 3300050512 nmdc:mga0n895_75261_c1 nmdc:mga0n895_75261_c1_1084_2154 355
1934 3300050513 nmdc:mga0rr50_196493_c1 nmdc:mga0rr50_196493_c1_30_1100 355
1935 3300050513 nmdc:mga0rr50_28902_c1 nmdc:mga0rr50_28902_c1_376_1443 355
1936 3300050513 nmdc:mga0rr50_289905_c1 nmdc:mga0rr50_289905_c1_137_1204 355
1937 3300050514 nmdc:mga08x19_6_c1 nmdc:mga08x19_6_c1_319988_321055 355
1938 3300050515 nmdc:mga0a205_142570_c1 nmdc:mga0a205_142570_c1_311_1378 355
1939 3300050515 nmdc:mga0a205_184989_c1 nmdc:mga0a205_184989_c1_179_1246 355
1940 3300050515 nmdc:mga0a205_195722_c1 nmdc:mga0a205_195722_c1_703_1770 355
1941 3300050515 nmdc:mga0a205_39881_c2 nmdc:mga0a205_39881_c2_531_1598 355
1942 3300050516 nmdc:mga0sz30_6269_c1 nmdc:mga0sz30_6269_c1_2357_3424 355
1943 3300053077 Ga0495601_0000069 Ga0495601_0000069_5011_6078 355
1944 3300053077 Ga0495601_0011998 Ga0495601_0011998_3351_4418 355
1945 3300053077 Ga0495601_0012835 Ga0495601_0012835_857_1924 355
1946 3300053077 Ga0495601_0028733 Ga0495601_0028733_882_1949 355
1947 3300053077 Ga0495601_0035833 Ga0495601_0035833_1873_2940 355
1948 3300053077 Ga0495601_0089041 Ga0495601_0089041_38_1105 355
1949 3300053078 Ga0495612_0001538 Ga0495612_0001538_3523_4590 355
1950 3300053078 Ga0495612_0021353 Ga0495612_0021353_120_1187 355
1951 3300053079 Ga0500610_0071800 Ga0500610_0071800_222_1289 355
1952 3300053084 Ga0495595_0002192 Ga0495595_0002192_3049_4116 355
1953 3300053084 Ga0495595_0003947 Ga0495595_0003947_1821_2888 355
1954 3300053084 Ga0495595_0004944 Ga0495595_0004944_3018_4085 355
1955 3300053084 Ga0495595_0009528 Ga0495595_0009528_1367_2434 355
1956 3300053084 Ga0495595_0019399 Ga0495595_0019399_503_1570 355
1957 3300053084 Ga0495595_0050933 Ga0495595_0050933_10_1077 355
1958 3300053085 Ga0495619_0000546 Ga0495619_0000546_7999_9066 355
1959 3300053085 Ga0495619_0001245 Ga0495619_0001245_10745_11812 355
1960 3300053085 Ga0495619_0005933 Ga0495619_0005933_1374_2441 355
1961 3300053085 Ga0495619_0013779 Ga0495619_0013779_1023_2090 355
1962 3300053085 Ga0495619_0018617 Ga0495619_0018617_217_1284 355
1963 3300053085 Ga0495619_0031858 Ga0495619_0031858_2231_3298 355
1964 3300053085 Ga0495619_0037540 Ga0495619_0037540_71_1138 355
1965 3300053085 Ga0495619_0088326 Ga0495619_0088326_159_1226 355
1966 3300053087 Ga0500643_001421 Ga0500643_001421_1089_2156 355
1967 3300053088 Ga0500644_0004088 Ga0500644_0004088_1366_2433 355
1968 3300053093 Ga0500651_0010557 Ga0500651_0010557_206_1273 355
1969 3300053094 Ga0500566_0013976 Ga0500566_0013976_3511_4578 355
1970 3300053096 Ga0500641_0002427 Ga0500641_0002427_1728_2795 355
1971 3300053096 Ga0500641_0042834 Ga0500641_0042834_490_1557 355
1972 3300053117 Ga0500593_052843 Ga0500593_052843_380_1447 355
1973 3300053119 Ga0500595_000003 Ga0500595_000003_391089_392156 355
1974 3300053119 Ga0500595_000152 Ga0500595_000152_19627_20694 355
1975 3300053119 Ga0500595_009637 Ga0500595_009637_2667_3734 355
1976 3300053134 Ga0500658_0078574 Ga0500658_0078574_11_1078 355
1977 3300053150 Ga0500603_000352 Ga0500603_000352_7422_8489 355
1978 3300053153 Ga0500616_0000002 Ga0500616_0000002_1577706_1578773 355
1979 3300053178 Ga0500637_0012256 Ga0500637_0012256_2425_3492 355
1980 3300053730 Ga0500645_000226 Ga0500645_000226_33785_34852 355
1981 3300054114 Ga0501084_0113611 Ga0501084_0113611_912_1982 355
1982 3300054114 Ga0501084_0361105 Ga0501084_0361105_73_1140 355
1983 3300054114 Ga0501084_0426208 Ga0501084_0426208_18_1085 355
1984 3300059506 Ga0587085_008146 Ga0587085_008146_186_1253 355
1985 3300060353 Ga0501082_0000266 Ga0501082_0000266_33387_34454 355
1986 3300060353 Ga0501082_0101382 Ga0501082_0101382_142_1209 355
1987 3300061734 Ga0530510_0043777 Ga0530510_0043777_132_1199 355

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

75

218

0.97

PF17912

OB_MalK

MalK OB fold domain

291

342

0.97

PF03459

TOBE

TOBE domain

350

401

0.91

PF08402

TOBE_2

TOBE domain

335

402

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
7x0q-assembly1.cif.gz_A crystal structure of atpase clo1313_2554 from clostridium thermocellum 0.962 4 354
4tqu-assembly1.cif.gz_T crystal structure of a bacterial abc transporter involved in the import of the acidic polysaccharide alginate 0.9555 2 352
4khz-assembly1.cif.gz_B crystal structure of the maltose-binding protein/maltose transporter complex in an pre-translocation conformation bound to maltoheptaose 0.9513 3 352
2xiw-assembly1.cif.gz_B-2 crystal structure of the sac7d-derived igg1-binder c3-c24s 0.95 295 321
7x0q-assembly1.cif.gz_A crystal structure of atpase clo1313_2554 from clostridium thermocellum 0.9488 4 354
ID Description Score Start End Superfamily
2awoD01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9881 3 216 3.40.50.300
af_P77795_1_218_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9777 1 217 3.40.50.300
2awnC01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9754 3 238 3.40.50.300
2awoD01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9745 3 216 3.40.50.300
af_P77795_1_218_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9689 1 217 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A7J9YE84-F1-model_v4 ATP-binding cassette domain-containing protein 0.9879 1 221 GO:0005524
GO:0016887
GO:0055052
AF-A0A382V5S9-F1-model_v4 ABC transporter domain-containing protein 0.9879 48 191 GO:0005524
GO:0016887
GO:0055052
AF-A0A0D6JVA7-F1-model_v4 Molybdate/tungstate import ATP-binding protein WtpC (EC 7.3.2.6) 0.9826 1 235 GO:0005524
GO:0016887
AF-A0A382V5S9-F1-model_v4 ABC transporter domain-containing protein 0.9811 48 191 GO:0005524
GO:0016887
GO:0055052
AF-A0A379D261-F1-model_v4 deleted 0.9801 1 225

Feature Viewer

pLDDT pTM Quality
93.42 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map