F496206
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1987 | 848 | 1709 | 354 |
Family's Representative Sequence
| Representative Sequence | 3300013104|Ga0157370_10004885|Ga0157370_100048859 |
| Length | 412 |
| Sequence | MLIFPCNAINLGKRGKLWRLIGIKLHPNMRVRPSQKQAGHAKKRPDTKETSGRQDGMASVEIRDARKAFGAVGILHGVNVGIEDGQFVVLVGPSGCGKSTLLRMIAGLENITSGEIIIGNRVVNTLPPKARDVAMVFQNYALYPHMTVADNMAFSMKLRKAPKKEIDERVQRAAAILGLGPLLGRFPRQLSGGQRQRVAMGRAIVRDPQVFLFDEPLSNLDAKLRVQMRTEIKELHQRLKTTTVYVTHDQIEAMTMADKIVVMHDGIVEQIGSPLELYDRPANLFVAGFIGSPAMNFLKGKIAPNGSASFEGPNGVKLPLGGTAPANSNGKPAIYGIRPEHFTIADDGAEAEIVVVEPTGSETQVFAKLGGEEVVAIFRERHQFNPGDKIRLKPDQRVVHLFDDATGQRLNA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2503198000 | Mesorhizobium opportunistum WSM2075 | Isolate | Nodule |
| 2 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 3 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 4 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 5 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 6 | 2509276033 | Rhizobium leguminosarum bv. trifolii WSM2012 | Isolate | Nodule |
| 7 | 2510917026 | Rhizobium sp. CF80 | Isolate | Rhizosphere |
| 8 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 9 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 10 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 11 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 12 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 13 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 14 | 2513237103 | Rhizobium leguminosarum bv. viciae VF39 | Isolate | Nodule |
| 15 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 16 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 17 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 18 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 19 | 2513237160 | Sinorhizobium medicae WSM244 | Isolate | Nodule |
| 20 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 21 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 22 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 23 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 24 | 2523231067 | Pleomorphomonas oryzae DSM 16300 | Isolate | Unclassified |
| 25 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 26 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 27 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 28 | 2529292951 | Rhizobium sp. CCGE 510 | Isolate | Nodule |
| 29 | 2582581308 | Rhizobium sp. OK494 | Isolate | Rhizosphere |
| 30 | 2582581315 | Agrobacterium rhizogenes YR147 | Isolate | Rhizosphere |
| 31 | 2585427527 | Rhizobium lusitanum YR374 | Isolate | Rhizosphere |
| 32 | 2585427528 | Rhizobium leguminosarum CF307 | Isolate | Rhizosphere |
| 33 | 2585427530 | Rhizobium tropici YR635 | Isolate | Rhizosphere |
| 34 | 2585427593 | Rhizobium tropici CF286 | Isolate | Rhizosphere |
| 35 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 36 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 37 | 2643221547 | Pseudolabrys sp. Root1462 | Isolate | Unclassified |
| 38 | 2643221551 | Mesorhizobium sp. Root1471 | Isolate | Unclassified |
| 39 | 2643221555 | Mesorhizobium sp. Root554 | Isolate | Unclassified |
| 40 | 2643221591 | Devosia sp. Root685 | Isolate | Unclassified |
| 41 | 2643221595 | Mesorhizobium sp. Root695 | Isolate | Unclassified |
| 42 | 2643221618 | Ensifer sp. Root231 | Isolate | Unclassified |
| 43 | 2643221626 | Ensifer sp. Root31 | Isolate | Unclassified |
| 44 | 2643221627 | Mesorhizobium sp. Root102 | Isolate | Unclassified |
| 45 | 2643221655 | Ensifer sp. Root1252 | Isolate | Unclassified |
| 46 | 2643221659 | Ensifer sp. Root127 | Isolate | Unclassified |
| 47 | 2643221698 | Ensifer sp. Root142 | Isolate | Unclassified |
| 48 | 2643221712 | Ensifer sp. Root258 | Isolate | Unclassified |
| 49 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 50 | 2671180139 | Chelativorans sp. A52C2 | Isolate | Unclassified |
| 51 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 52 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 53 | 2738541333 | Rhizobium sophoriradicis CCBAU 03470 | Isolate | Unclassified |
| 54 | 2738543031 | Pleomorphomonas sp. CF100 | Isolate | Unclassified |
| 55 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 56 | 2765235942 | Rhizobium sp. WYCCWR10014 | Isolate | Nodule |
| 57 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 58 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 59 | 2791355199 | |||
| 60 | 2791355259 | Rhizobium hidalgonense FH14 | Isolate | Nodule |
| 61 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 62 | 2802429633 | Rhizobium anhuiense J3 | Isolate | Nodule |
| 63 | 2802429634 | Rhizobium anhuiense S10 | Isolate | Nodule |
| 64 | 2802429635 | Rhizobium anhuiense Y27 | Isolate | Nodule |
| 65 | 2802429636 | Rhizobium anhuiense JX3 | Isolate | Nodule |
| 66 | 2802429637 | Rhizobium anhuiense C15 | Isolate | Nodule |
| 67 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 68 | 2818991453 | Rhizobium lusitanum 1158 | Isolate | Unclassified |
| 69 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 70 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 71 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 72 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 73 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 74 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 75 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 76 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 77 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 78 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 79 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 80 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 81 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 82 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 83 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 84 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 85 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 86 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 87 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 88 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 89 | 2838042994 | Rhizobium esperanzae SEMIA 4089 | Isolate | Nodule |
| 90 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 91 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 92 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 93 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 94 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 95 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 96 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 97 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 98 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 99 | 2842110456 | Rhizobium esperanzae SEMIA 414 | Isolate | Nodule |
| 100 | 2842217011 | Rhizobium leguminosarum SEMIA 475 | Isolate | Nodule |
| 101 | 2844163670 | Ensifer sp. 1H6 | Isolate | Unclassified |
| 102 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 103 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 104 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 105 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 106 | 2852387548 | Rhizobium jaguaris CCGE525 | Isolate | Unclassified |
| 107 | 2854896431 | Neorhizobium alkalisoli DSM 21826 | Isolate | Unclassified |
| 108 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 109 | 2857516855 | Rhizobium sp. R-72456 | Isolate | Unclassified |
| 110 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 111 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 112 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 113 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 114 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 115 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 116 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 117 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 118 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 119 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 120 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 121 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 122 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 123 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 124 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 125 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 126 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 127 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 128 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 129 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 130 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 131 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 132 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 133 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 134 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 135 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 136 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 137 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 138 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 139 | 2904699407 | |||
| 140 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 141 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 142 | 2906610324 | |||
| 143 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 144 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 145 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 146 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 147 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 148 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 149 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 150 | 2919171160 | Neorhizobium sp. 2083 | Isolate | Unclassified |
| 151 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 152 | 2922368715 | |||
| 153 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 154 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 155 | 2922425934 | |||
| 156 | 2928521798 | Phyllobacterium ifriqiyense 1451 | Isolate | Rhizosphere |
| 157 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 158 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 159 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 160 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 161 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 162 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 163 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 164 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 165 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 166 | 2933586486 | Rhizobium leguminosarum SEMIA 4039 | Isolate | Nodule |
| 167 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 168 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 169 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 170 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 171 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 172 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 173 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 174 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 175 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 176 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 177 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 178 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 179 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 180 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 181 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 182 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 183 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 184 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 185 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 186 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 187 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 188 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 189 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 190 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 191 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 192 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 193 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 194 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 195 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 196 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 197 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 198 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 199 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 200 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 201 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 202 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 203 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 204 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 205 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 206 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 207 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 208 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 209 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 210 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 211 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 212 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 213 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 214 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 215 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 216 | 2936367885 | Rhizobium changzhiense WYCCWR 11290 | Isolate | Nodule |
| 217 | 2936375103 | Rhizobium changzhiense WYCCWR 11317 | Isolate | Nodule |
| 218 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 219 | 2941499720 | Ensifer sp. 4252 | Isolate | Rhizosphere |
| 220 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 221 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 222 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 223 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 224 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 225 | 2954011201 | Phyllobacterium ifrigiyense W4I11 | Isolate | Rhizosphere |
| 226 | 2960631154 | Sinorhizobium medicae USDA1629 | Isolate | Nodule |
| 227 | 2970122695 | Sinorhizobium medicae 3082 | Isolate | Nodule |
| 228 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 229 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 230 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 231 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 232 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 233 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 234 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 235 | 3300000042 | Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young | Metagenome | Rhizosphere |
| 236 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 237 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 238 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 239 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 240 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 241 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 242 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 243 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 244 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 245 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 246 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 247 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 248 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 249 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 250 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 251 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 252 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 253 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 254 | 3300003579 | Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 255 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 256 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 257 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 258 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 259 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 260 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 261 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 262 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 263 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 264 | 3300005276 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1 | Metagenome | Rhizosphere |
| 265 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 266 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 267 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 268 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 269 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 270 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 271 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 272 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 273 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 274 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 275 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 276 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 277 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 278 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 279 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 280 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 281 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 282 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 283 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 284 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 285 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 286 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 287 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 288 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 289 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 290 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 291 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 292 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 293 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 294 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 295 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 296 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 297 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 298 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 299 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 300 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 301 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 302 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 303 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 304 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 305 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 306 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 307 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 308 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 309 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 310 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 311 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 312 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 313 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 314 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 315 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 316 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 317 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 318 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 319 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 320 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 321 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 322 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 323 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 324 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 325 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 326 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 327 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 328 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 329 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 330 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 331 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 332 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 333 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 334 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 335 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 336 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 337 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 338 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 339 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 340 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 341 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 342 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 343 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 344 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 345 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 346 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 347 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 348 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 349 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 350 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 351 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 352 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 353 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 354 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 355 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 356 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 357 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 358 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 359 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 360 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 361 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 362 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 363 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 364 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 365 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 366 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 367 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 368 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 369 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 370 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 371 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 372 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 373 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 374 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 375 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 376 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 377 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 378 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 379 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 380 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 381 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 382 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 383 | 3300012480 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.yng.040610 | Metagenome | Rhizosphere |
| 384 | 3300012494 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 | Metagenome | Rhizosphere |
| 385 | 3300012505 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 | Metagenome | Rhizosphere |
| 386 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 387 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 388 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 389 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 390 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 391 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 392 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 393 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 394 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 395 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 396 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 397 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 398 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 399 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 400 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 401 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 402 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 403 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 404 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 405 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 406 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 407 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 408 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 409 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 410 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 411 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 412 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 413 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 414 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 415 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 416 | 3300022739 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules | Metagenome | Nodule |
| 417 | 3300022740 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules | Metagenome | Nodule |
| 418 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 419 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 420 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 421 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 422 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 423 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 424 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 425 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 426 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 427 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 428 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 429 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 430 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 431 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 432 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 433 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 434 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 435 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 436 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 437 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 438 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 439 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 440 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 441 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 442 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 443 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 444 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 445 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 446 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 447 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 448 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 449 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 450 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 451 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 452 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 453 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 454 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 455 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 456 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 457 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 458 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 459 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 460 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 461 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 462 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 463 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 464 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 465 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 466 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 467 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 468 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 469 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 470 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 471 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 472 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 473 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 474 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 475 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 476 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 477 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 478 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 479 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 480 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 481 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 482 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 483 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 484 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 485 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 486 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 487 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 488 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 489 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 490 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 491 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 492 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 493 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 494 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 495 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 496 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 497 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 498 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 499 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 500 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 501 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 502 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 503 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 504 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 505 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 506 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 507 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 508 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 509 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 510 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 511 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 512 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 513 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 514 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 515 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 516 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 517 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 518 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 519 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 520 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 521 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 522 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 523 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 524 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 525 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 526 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 527 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 528 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 529 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 530 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 531 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 532 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 533 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 534 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 535 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 536 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 537 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 538 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 539 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 540 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 541 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 542 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 543 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 544 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 545 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 546 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 547 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 548 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 549 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 550 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 551 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 552 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 553 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 554 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 555 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 556 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 557 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 558 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 559 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 560 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 561 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 562 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 563 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 564 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 565 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 566 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 567 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 568 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 569 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 570 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 571 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 572 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 573 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 574 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 575 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 576 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 577 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 578 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 579 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 580 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 581 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 582 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 583 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 584 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 585 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 586 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 587 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 588 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 589 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 590 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 591 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 592 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 593 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 594 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 595 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 596 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 597 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 598 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 599 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 600 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 601 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 602 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 603 | 3300038735 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 | Metagenome | Unclassified |
| 604 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 605 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 606 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 607 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 608 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 609 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 610 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 611 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 612 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 613 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 614 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 615 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 616 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 617 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 618 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 619 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 620 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 621 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 622 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 623 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 624 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 625 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 626 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 627 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 628 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 629 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 630 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 631 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 632 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 633 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 634 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 635 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 636 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 637 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 638 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 639 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 640 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 641 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 642 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 643 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 644 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 645 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 646 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 647 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 648 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 649 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 650 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 651 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 652 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 653 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 654 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 655 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 656 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 657 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 658 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 659 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 660 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 661 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 662 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 663 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 664 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 665 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 666 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 667 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 668 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 669 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 670 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 671 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 672 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 673 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 674 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 675 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 676 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 677 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 678 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 679 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 680 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 681 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 682 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 683 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 684 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 685 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 686 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 687 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 688 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 689 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 690 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 691 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 692 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 693 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 694 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 695 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 696 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 697 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 698 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 699 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 700 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 701 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 702 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 703 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 704 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 705 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 706 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 707 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 708 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 709 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 710 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 711 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 712 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 713 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 714 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 715 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 716 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 717 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 718 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 719 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 720 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 721 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 722 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 723 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 724 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 725 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 726 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 727 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 728 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 729 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 730 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 731 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 732 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 733 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 734 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 735 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 736 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 737 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 738 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 739 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 740 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 741 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 742 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 743 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 744 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 745 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 746 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 747 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 748 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 749 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 750 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 751 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 752 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 753 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 754 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 755 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 756 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 757 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 758 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 759 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 760 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 761 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 762 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 763 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 764 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 765 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 766 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 767 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 768 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 769 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 770 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 771 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 772 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 773 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 774 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 775 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 776 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 777 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 778 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 779 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 780 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 781 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 782 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 783 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 784 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 785 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 786 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 787 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 788 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 789 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 790 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 791 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 792 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 793 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 794 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 795 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 796 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 797 | 3300053722 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere | Metagenome | Endosphere |
| 798 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 799 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 800 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 801 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 802 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 803 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 804 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 805 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 806 | 639633055 | Rhizobium leguminosarum bv. viciae 3841 | Isolate | Unclassified |
| 807 | 8005376324 | Rhizobium changzhiense WYCCWR 11279 | Isolate | Nodule |
| 808 | 8005570704 | Rhizobium anhuiense bv. trifolii WYCCWR10015 | Isolate | Nodule |
| 809 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 810 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 811 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 812 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 813 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 814 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 815 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 816 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 817 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 818 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 819 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 820 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 821 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 822 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 823 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 824 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 825 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 826 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 827 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 828 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 829 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 830 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 831 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 832 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 833 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 834 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 835 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 836 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 837 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 838 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 839 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 840 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 841 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 842 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 843 | 8024479707 | Rhizobium leguminosarum Tri-43 | Isolate | Nodule |
| 844 | 8054563764 | Acuticoccus kalidii M5D2P5 | Isolate | Unclassified |
| 845 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 846 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 847 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
| 848 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 85.42 |
| Metatranscriptomes | 0.81 |
| Isolates | 13.77 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7.15 |
| Nodule | 10.17 |
| Rhizoplane | 4.93 |
| Rhizosphere | 70.31 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.45 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | ARSoilYngRDRAFT_c00128 | 3300000042 | Bacteria | 12742 |
| 2 | ARSoilOldRDRAFT_c000297 | 3300000044 | Bacteria | 6916 |
| 3 | ARCol0yngRDRAFT_1000069 | 3300000652 | Bacteria | 18965 |
| 4 | JGI24746J21847_1000078 | 3300001977 | Bacteria | 10426 |
| 5 | JGI24740J21852_10030484 | 3300001979 | Bacteria | 1753 |
| 6 | JGI24739J22299_10002225 | 3300001989 | Bacteria | 7452 |
| 7 | JGI24737J22298_10001972 | 3300001990 | Bacteria | 7332 |
| 8 | JGI24750J21931_1000188 | 3300002070 | Bacteria | 10321 |
| 9 | JGI24745J21846_1000126 | 3300002073 | Bacteria | 5829 |
| 10 | JGI24738J21930_10000068 | 3300002075 | Bacteria | 21789 |
| 11 | JGI24749J21850_1000122 | 3300002076 | Bacteria | 13176 |
| 12 | JGI24034J26672_10000519 | 3300002239 | Bacteria | 4969 |
| 13 | JGI24742J22300_10000082 | 3300002244 | Bacteria | 13679 |
| 14 | JGI25159J45721_1000210 | 3300002987 | Bacteria | 27456 |
| 15 | JGI25151J46595_10000600 | 3300003187 | Bacteria | 31910 |
| 16 | JGI25406J46586_10000093 | 3300003203 | Bacteria | 41100 |
| 17 | JGI25406J46586_10007700 | 3300003203 | Bacteria | 4899 |
| 18 | JGI25153J46596_10000462 | 3300003215 | Bacteria | 25965 |
| 19 | JGI25153J46596_10002895 | 3300003215 | Bacteria | 9737 |
| 20 | JGI25153J46596_10017972 | 3300003215 | Bacteria | 2764 |
| 21 | JGI25160J50197_1000069 | 3300003354 | Bacteria | 112571 |
| 22 | JGI25160J50197_1000323 | 3300003354 | Bacteria | 33055 |
| 23 | JGI25161J50226_1000049 | 3300003374 | Bacteria | 112571 |
| 24 | JGI25161J50226_1003863 | 3300003374 | Bacteria | 3284 |
| 25 | Ga0007429J51699_1107255 | 3300003579 | Bacteria | 1522 |
| 26 | Ga0055539_1001746 | 3300003752 | Bacteria | 3772 |
| 27 | Ga0055526_1002692 | 3300003771 | Bacteria | 11838 |
| 28 | Ga0055524_1000709 | 3300003775 | Bacteria | 23001 |
| 29 | Ga0055536_1002798 | 3300003781 | Bacteria | 9640 |
| 30 | Ga0055536_1003653 | 3300003781 | Bacteria | 8193 |
| 31 | Ga0055528_1001863 | 3300003790 | Bacteria | 12011 |
| 32 | Ga0055540_1004229 | 3300003792 | Bacteria | 6594 |
| 33 | Ga0055540_1010264 | 3300003792 | Bacteria | 3129 |
| 34 | Ga0055531_10002995 | 3300003794 | Bacteria | 10969 |
| 35 | Ga0055543_1000024 | 3300004625 | Bacteria | 140022 |
| 36 | Ga0055543_1000636 | 3300004625 | Bacteria | 18807 |
| 37 | Ga0055543_1021435 | 3300004625 | Bacteria | 1178 |
| 38 | Ga0065165_1000202 | 3300005262 | Bacteria | 103290 |
| 39 | Ga0065165_1004658 | 3300005262 | Bacteria | 8306 |
| 40 | Ga0065165_1005992 | 3300005262 | Bacteria | 6558 |
| 41 | Ga0065717_1000293 | 3300005276 | Bacteria | 1462 |
| 42 | Ga0065715_10089172 | 3300005293 | Bacteria | 13154 |
| 43 | Ga0065715_10193766 | 3300005293 | Bacteria | 1392 |
| 44 | Ga0070658_10063326 | 3300005327 | Bacteria | 3014 |
| 45 | Ga0070676_10000363 | 3300005328 | Bacteria | 20801 |
| 46 | Ga0070676_10026577 | 3300005328 | Bacteria | 3278 |
| 47 | Ga0070676_10110574 | 3300005328 | Bacteria | 1710 |
| 48 | Ga0070676_10138318 | 3300005328 | Bacteria | 1547 |
| 49 | Ga0070683_100004718 | 3300005329 | Bacteria | 11267 |
| 50 | Ga0070683_100020818 | 3300005329 | Bacteria | 5843 |
| 51 | Ga0070683_100049938 | 3300005329 | Bacteria | 3870 |
| 52 | Ga0070683_100078282 | 3300005329 | Bacteria | 3093 |
| 53 | Ga0070683_100163207 | 3300005329 | Bacteria | 2114 |
| 54 | Ga0070683_100244054 | 3300005329 | Bacteria | 1708 |
| 55 | Ga0070690_100001828 | 3300005330 | Bacteria | 11279 |
| 56 | Ga0070690_100015808 | 3300005330 | Bacteria | 4509 |
| 57 | Ga0070690_100044913 | 3300005330 | Bacteria | 2805 |
| 58 | Ga0070690_100106185 | 3300005330 | Bacteria | 1868 |
| 59 | Ga0070690_100110382 | 3300005330 | Bacteria | 1835 |
| 60 | Ga0070670_100000403 | 3300005331 | Bacteria | 35526 |
| 61 | Ga0070670_100001134 | 3300005331 | Bacteria | 21148 |
| 62 | Ga0070670_100099778 | 3300005331 | Bacteria | 2498 |
| 63 | Ga0070677_10000301 | 3300005333 | Bacteria | 17280 |
| 64 | Ga0070677_10000815 | 3300005333 | Bacteria | 10310 |
| 65 | Ga0068869_100006712 | 3300005334 | Bacteria | 7314 |
| 66 | Ga0070666_10039593 | 3300005335 | Bacteria | 3143 |
| 67 | Ga0070680_100005574 | 3300005336 | Bacteria | 9532 |
| 68 | Ga0070680_100014945 | 3300005336 | Bacteria | 6076 |
| 69 | Ga0070680_100019341 | 3300005336 | Bacteria | 5396 |
| 70 | Ga0070680_100148433 | 3300005336 | Bacteria | 1968 |
| 71 | Ga0070682_100000719 | 3300005337 | Bacteria | 19838 |
| 72 | Ga0070682_100001130 | 3300005337 | Bacteria | 15253 |
| 73 | Ga0070682_100048011 | 3300005337 | Bacteria | 2656 |
| 74 | Ga0070682_100096655 | 3300005337 | Bacteria | 1942 |
| 75 | Ga0068868_100010138 | 3300005338 | Bacteria | 6809 |
| 76 | Ga0068868_100013587 | 3300005338 | Bacteria | 5978 |
| 77 | Ga0068868_100027002 | 3300005338 | Bacteria | 4378 |
| 78 | Ga0068868_100229841 | 3300005338 | Bacteria | 1556 |
| 79 | Ga0070660_100000730 | 3300005339 | Bacteria | 21778 |
| 80 | Ga0070660_100006450 | 3300005339 | Bacteria | 8133 |
| 81 | Ga0070660_100050497 | 3300005339 | Bacteria | 3200 |
| 82 | Ga0070660_100122390 | 3300005339 | Bacteria | 2077 |
| 83 | Ga0070689_100000601 | 3300005340 | Bacteria | 21783 |
| 84 | Ga0070689_100025910 | 3300005340 | Bacteria | 4409 |
| 85 | Ga0070689_100041110 | 3300005340 | Bacteria | 3547 |
| 86 | Ga0070689_100142846 | 3300005340 | Bacteria | 1926 |
| 87 | Ga0070691_10001015 | 3300005341 | Bacteria | 11523 |
| 88 | Ga0070691_10017707 | 3300005341 | Bacteria | 3279 |
| 89 | Ga0070691_10060361 | 3300005341 | Bacteria | 1823 |
| 90 | Ga0070687_100000253 | 3300005343 | Bacteria | 18199 |
| 91 | Ga0070687_100045959 | 3300005343 | Bacteria | 2233 |
| 92 | Ga0070661_100003564 | 3300005344 | Bacteria | 10720 |
| 93 | Ga0070661_100197315 | 3300005344 | Bacteria | 1537 |
| 94 | Ga0070692_10000060 | 3300005345 | Bacteria | 21392 |
| 95 | Ga0070692_10005786 | 3300005345 | Bacteria | 5315 |
| 96 | Ga0070692_10032255 | 3300005345 | Bacteria | 2633 |
| 97 | Ga0070668_100001851 | 3300005347 | Bacteria | 15430 |
| 98 | Ga0070668_100132143 | 3300005347 | Bacteria | 2004 |
| 99 | Ga0070668_100246197 | 3300005347 | Bacteria | 1482 |
| 100 | Ga0070669_100000888 | 3300005353 | Bacteria | 21753 |
| 101 | Ga0070669_100042856 | 3300005353 | Bacteria | 3295 |
| 102 | Ga0070669_100065319 | 3300005353 | Bacteria | 2680 |
| 103 | Ga0070669_100068388 | 3300005353 | Bacteria | 2622 |
| 104 | Ga0070675_100000441 | 3300005354 | Bacteria | 28206 |
| 105 | Ga0070675_100039312 | 3300005354 | Bacteria | 3860 |
| 106 | Ga0070675_100192696 | 3300005354 | Bacteria | 1767 |
| 107 | Ga0070671_100001180 | 3300005355 | Bacteria | 19534 |
| 108 | Ga0070671_100007098 | 3300005355 | Bacteria | 8963 |
| 109 | Ga0070671_100015695 | 3300005355 | Bacteria | 6122 |
| 110 | Ga0070671_100019902 | 3300005355 | Bacteria | 5468 |
| 111 | Ga0070671_100042459 | 3300005355 | Bacteria | 3780 |
| 112 | Ga0070671_100044735 | 3300005355 | Bacteria | 3679 |
| 113 | Ga0070671_100075870 | 3300005355 | Bacteria | 2809 |
| 114 | Ga0070674_100000723 | 3300005356 | Bacteria | 16855 |
| 115 | Ga0070674_100051273 | 3300005356 | Bacteria | 2843 |
| 116 | Ga0070674_100052446 | 3300005356 | Bacteria | 2814 |
| 117 | Ga0070674_100084906 | 3300005356 | Bacteria | 2271 |
| 118 | Ga0070674_100108322 | 3300005356 | Bacteria | 2036 |
| 119 | Ga0070673_100000456 | 3300005364 | Bacteria | 21637 |
| 120 | Ga0070673_100014070 | 3300005364 | Bacteria | 5558 |
| 121 | Ga0070673_100038037 | 3300005364 | Bacteria | 3671 |
| 122 | Ga0070673_100150225 | 3300005364 | Bacteria | 1972 |
| 123 | Ga0070673_100343751 | 3300005364 | Bacteria | 1323 |
| 124 | Ga0070688_100000483 | 3300005365 | Bacteria | 20204 |
| 125 | Ga0070688_100010309 | 3300005365 | Bacteria | 5149 |
| 126 | Ga0070688_100027362 | 3300005365 | Bacteria | 3396 |
| 127 | Ga0070688_100046419 | 3300005365 | Bacteria | 2690 |
| 128 | Ga0070659_100001763 | 3300005366 | Bacteria | 15553 |
| 129 | Ga0070659_100047189 | 3300005366 | Bacteria | 3378 |
| 130 | Ga0070659_100124787 | 3300005366 | Bacteria | 2088 |
| 131 | Ga0070659_100162952 | 3300005366 | Bacteria | 1824 |
| 132 | Ga0070667_100004366 | 3300005367 | Bacteria | 11932 |
| 133 | Ga0070667_100029031 | 3300005367 | Bacteria | 4606 |
| 134 | Ga0070667_100035458 | 3300005367 | Bacteria | 4179 |
| 135 | Ga0070667_100046573 | 3300005367 | Bacteria | 3648 |
| 136 | Ga0070667_100114480 | 3300005367 | Bacteria | 2342 |
| 137 | Ga0070667_100152500 | 3300005367 | Bacteria | 2030 |
| 138 | Ga0070667_100357862 | 3300005367 | Bacteria | 1322 |
| 139 | Ga0070703_10002031 | 3300005406 | Bacteria | 5916 |
| 140 | Ga0070703_10013855 | 3300005406 | Bacteria | 2292 |
| 141 | Ga0070709_10015742 | 3300005434 | Bacteria | 4307 |
| 142 | Ga0070709_10079029 | 3300005434 | Bacteria | 2142 |
| 143 | Ga0070709_10119364 | 3300005434 | Bacteria | 1785 |
| 144 | Ga0070714_100019885 | 3300005435 | Bacteria | 5478 |
| 145 | Ga0070714_100045925 | 3300005435 | Bacteria | 3704 |
| 146 | Ga0070714_100046922 | 3300005435 | Bacteria | 3667 |
| 147 | Ga0070714_100089770 | 3300005435 | Bacteria | 2691 |
| 148 | Ga0070714_100123907 | 3300005435 | Bacteria | 2302 |
| 149 | Ga0070713_100022697 | 3300005436 | Bacteria | 4853 |
| 150 | Ga0070713_100052199 | 3300005436 | Bacteria | 3384 |
| 151 | Ga0070713_100131027 | 3300005436 | Bacteria | 2211 |
| 152 | Ga0070710_10000567 | 3300005437 | Bacteria | 17537 |
| 153 | Ga0070710_10001957 | 3300005437 | Bacteria | 9755 |
| 154 | Ga0070710_10010719 | 3300005437 | Bacteria | 4507 |
| 155 | Ga0070710_10026259 | 3300005437 | Bacteria | 3092 |
| 156 | Ga0070710_10030961 | 3300005437 | Bacteria | 2883 |
| 157 | Ga0070710_10064128 | 3300005437 | Bacteria | 2100 |
| 158 | Ga0070701_10000150 | 3300005438 | Bacteria | 21357 |
| 159 | Ga0070701_10029193 | 3300005438 | Bacteria | 2718 |
| 160 | Ga0070711_100000801 | 3300005439 | Bacteria | 16448 |
| 161 | Ga0070711_100003646 | 3300005439 | Bacteria | 8999 |
| 162 | Ga0070711_100008716 | 3300005439 | Bacteria | 6223 |
| 163 | Ga0070711_100043909 | 3300005439 | Bacteria | 3030 |
| 164 | Ga0070711_100053717 | 3300005439 | Bacteria | 2777 |
| 165 | Ga0070711_100132478 | 3300005439 | Bacteria | 1858 |
| 166 | Ga0070711_100169817 | 3300005439 | Bacteria | 1661 |
| 167 | Ga0070705_100003099 | 3300005440 | Bacteria | 8178 |
| 168 | Ga0070705_100150225 | 3300005440 | Bacteria | 1544 |
| 169 | Ga0070700_100001083 | 3300005441 | Bacteria | 13532 |
| 170 | Ga0070700_100053677 | 3300005441 | Bacteria | 2516 |
| 171 | Ga0070694_100094512 | 3300005444 | Bacteria | 2103 |
| 172 | Ga0070708_100013928 | 3300005445 | Bacteria | 6606 |
| 173 | Ga0070708_100170803 | 3300005445 | Bacteria | 2030 |
| 174 | Ga0070708_100244001 | 3300005445 | Bacteria | 1687 |
| 175 | Ga0070708_100304044 | 3300005445 | Bacteria | 1502 |
| 176 | Ga0070663_100001801 | 3300005455 | Bacteria | 11920 |
| 177 | Ga0070663_100024121 | 3300005455 | Bacteria | 4088 |
| 178 | Ga0070663_100071433 | 3300005455 | Bacteria | 2526 |
| 179 | Ga0070663_100074832 | 3300005455 | Bacteria | 2473 |
| 180 | Ga0070663_100090820 | 3300005455 | Bacteria | 2262 |
| 181 | Ga0070663_100247118 | 3300005455 | Bacteria | 1411 |
| 182 | Ga0070663_100338757 | 3300005455 | Bacteria | 1214 |
| 183 | Ga0070678_100000199 | 3300005456 | Bacteria | 26434 |
| 184 | Ga0070678_100028678 | 3300005456 | Bacteria | 3800 |
| 185 | Ga0070678_100105370 | 3300005456 | Bacteria | 2195 |
| 186 | Ga0070678_100160175 | 3300005456 | Bacteria | 1822 |
| 187 | Ga0070662_100016138 | 3300005457 | Bacteria | 5011 |
| 188 | Ga0070662_100103150 | 3300005457 | Bacteria | 2162 |
| 189 | Ga0070662_100125536 | 3300005457 | Bacteria | 1972 |
| 190 | Ga0070681_10001398 | 3300005458 | Bacteria | 21148 |
| 191 | Ga0070681_10017437 | 3300005458 | Bacteria | 7177 |
| 192 | Ga0070681_10061567 | 3300005458 | Bacteria | 3727 |
| 193 | Ga0070681_10195720 | 3300005458 | Bacteria | 1940 |
| 194 | Ga0068867_100001623 | 3300005459 | Bacteria | 15640 |
| 195 | Ga0068867_100012724 | 3300005459 | Bacteria | 5953 |
| 196 | Ga0068867_100085008 | 3300005459 | Bacteria | 2391 |
| 197 | Ga0068867_100214950 | 3300005459 | Bacteria | 1546 |
| 198 | Ga0070685_10000782 | 3300005466 | Bacteria | 17256 |
| 199 | Ga0070685_10007883 | 3300005466 | Bacteria | 5455 |
| 200 | Ga0070685_10015377 | 3300005466 | Bacteria | 4063 |
| 201 | Ga0070685_10045926 | 3300005466 | Bacteria | 2506 |
| 202 | Ga0070706_100190434 | 3300005467 | Bacteria | 1917 |
| 203 | Ga0070679_100018692 | 3300005530 | Bacteria | 6727 |
| 204 | Ga0070679_100028756 | 3300005530 | Bacteria | 5483 |
| 205 | Ga0070679_100035744 | 3300005530 | Bacteria | 4929 |
| 206 | Ga0070679_100042533 | 3300005530 | Bacteria | 4525 |
| 207 | Ga0070679_100171156 | 3300005530 | Bacteria | 2145 |
| 208 | Ga0070679_100231671 | 3300005530 | Bacteria | 1806 |
| 209 | Ga0070684_100001802 | 3300005535 | Bacteria | 15671 |
| 210 | Ga0070684_100017238 | 3300005535 | Bacteria | 5922 |
| 211 | Ga0070684_100028452 | 3300005535 | Bacteria | 4728 |
| 212 | Ga0070684_100036280 | 3300005535 | Bacteria | 4224 |
| 213 | Ga0070684_100125269 | 3300005535 | Bacteria | 2314 |
| 214 | Ga0070697_100058284 | 3300005536 | Bacteria | 3143 |
| 215 | Ga0068853_100001448 | 3300005539 | Bacteria | 17189 |
| 216 | Ga0068853_100002281 | 3300005539 | Bacteria | 14329 |
| 217 | Ga0068853_100056883 | 3300005539 | Bacteria | 3374 |
| 218 | Ga0068853_100074704 | 3300005539 | Bacteria | 2957 |
| 219 | Ga0068853_100143530 | 3300005539 | Bacteria | 2144 |
| 220 | Ga0068853_100284496 | 3300005539 | Bacteria | 1525 |
| 221 | Ga0070672_100001622 | 3300005543 | Bacteria | 13990 |
| 222 | Ga0070672_100024941 | 3300005543 | Bacteria | 4427 |
| 223 | Ga0070686_100000746 | 3300005544 | Bacteria | 18847 |
| 224 | Ga0070686_100004148 | 3300005544 | Bacteria | 7974 |
| 225 | Ga0070686_100018778 | 3300005544 | Bacteria | 4064 |
| 226 | Ga0070686_100124308 | 3300005544 | Bacteria | 1775 |
| 227 | Ga0070695_100000553 | 3300005545 | Bacteria | 19808 |
| 228 | Ga0070695_100033941 | 3300005545 | Bacteria | 3194 |
| 229 | Ga0070696_100001299 | 3300005546 | Bacteria | 16280 |
| 230 | Ga0070696_100030835 | 3300005546 | Bacteria | 3672 |
| 231 | Ga0070696_100051897 | 3300005546 | Bacteria | 2852 |
| 232 | Ga0070696_100158942 | 3300005546 | Bacteria | 1664 |
| 233 | Ga0070693_100000613 | 3300005547 | Bacteria | 15823 |
| 234 | Ga0070693_100003449 | 3300005547 | Bacteria | 7375 |
| 235 | Ga0070693_100016956 | 3300005547 | Bacteria | 3778 |
| 236 | Ga0070665_100022442 | 3300005548 | Bacteria | 6352 |
| 237 | Ga0070665_100063622 | 3300005548 | Bacteria | 3699 |
| 238 | Ga0070665_100106738 | 3300005548 | Bacteria | 2802 |
| 239 | Ga0070665_100107687 | 3300005548 | Bacteria | 2789 |
| 240 | Ga0070704_100000423 | 3300005549 | Bacteria | 19666 |
| 241 | Ga0070704_100265590 | 3300005549 | Bacteria | 1416 |
| 242 | Ga0068855_100004415 | 3300005563 | Bacteria | 17183 |
| 243 | Ga0068855_100034249 | 3300005563 | Bacteria | 6059 |
| 244 | Ga0068855_100098794 | 3300005563 | Bacteria | 3362 |
| 245 | Ga0068855_100198832 | 3300005563 | Bacteria | 2257 |
| 246 | Ga0068855_100436312 | 3300005563 | Bacteria | 1431 |
| 247 | Ga0070664_100001312 | 3300005564 | Bacteria | 19866 |
| 248 | Ga0070664_100024128 | 3300005564 | Bacteria | 5028 |
| 249 | Ga0070664_100029501 | 3300005564 | Bacteria | 4573 |
| 250 | Ga0070664_100173668 | 3300005564 | Bacteria | 1912 |
| 251 | Ga0070664_100188915 | 3300005564 | Bacteria | 1835 |
| 252 | Ga0068857_100007906 | 3300005577 | Bacteria | 9173 |
| 253 | Ga0068857_100277970 | 3300005577 | Bacteria | 1540 |
| 254 | Ga0068857_100408846 | 3300005577 | Bacteria | 1264 |
| 255 | Ga0068854_100000827 | 3300005578 | Bacteria | 18476 |
| 256 | Ga0068854_100141681 | 3300005578 | Bacteria | 1845 |
| 257 | Ga0068854_100197451 | 3300005578 | Bacteria | 1580 |
| 258 | Ga0068854_100335245 | 3300005578 | Bacteria | 1234 |
| 259 | Ga0068856_100000020 | 3300005614 | Bacteria | 146775 |
| 260 | Ga0068856_100001340 | 3300005614 | Bacteria | 25903 |
| 261 | Ga0068852_100002288 | 3300005616 | Bacteria | 13173 |
| 262 | Ga0068852_100007064 | 3300005616 | Bacteria | 8177 |
| 263 | Ga0068852_100013291 | 3300005616 | Bacteria | 6297 |
| 264 | Ga0068852_100024490 | 3300005616 | Bacteria | 4879 |
| 265 | Ga0068852_100063539 | 3300005616 | Bacteria | 3215 |
| 266 | Ga0068859_100001767 | 3300005617 | Bacteria | 21986 |
| 267 | Ga0068859_100061270 | 3300005617 | Bacteria | 3791 |
| 268 | Ga0068859_100070871 | 3300005617 | Bacteria | 3521 |
| 269 | Ga0068859_100132349 | 3300005617 | Bacteria | 2566 |
| 270 | Ga0068859_100135465 | 3300005617 | Bacteria | 2535 |
| 271 | Ga0068859_100205452 | 3300005617 | Bacteria | 2055 |
| 272 | Ga0068864_100003544 | 3300005618 | Bacteria | 12907 |
| 273 | Ga0068864_100059172 | 3300005618 | Bacteria | 3314 |
| 274 | Ga0068864_100162047 | 3300005618 | Bacteria | 2033 |
| 275 | Ga0068866_10000372 | 3300005718 | Bacteria | 21128 |
| 276 | Ga0068866_10022582 | 3300005718 | Bacteria | 2913 |
| 277 | Ga0068861_100001202 | 3300005719 | Bacteria | 16126 |
| 278 | Ga0068861_100003340 | 3300005719 | Bacteria | 10628 |
| 279 | Ga0068861_100024078 | 3300005719 | Bacteria | 4399 |
| 280 | Ga0068861_100093014 | 3300005719 | Bacteria | 2383 |
| 281 | Ga0068851_10077448 | 3300005834 | Bacteria | 1731 |
| 282 | Ga0068870_10000207 | 3300005840 | Bacteria | 21125 |
| 283 | Ga0068870_10044340 | 3300005840 | Bacteria | 2323 |
| 284 | Ga0068863_100003062 | 3300005841 | Bacteria | 16530 |
| 285 | Ga0068863_100020579 | 3300005841 | Bacteria | 6306 |
| 286 | Ga0068858_100004999 | 3300005842 | Bacteria | 12990 |
| 287 | Ga0068858_100087413 | 3300005842 | Bacteria | 2899 |
| 288 | Ga0068858_100307706 | 3300005842 | Bacteria | 1513 |
| 289 | Ga0068860_100007079 | 3300005843 | Bacteria | 11224 |
| 290 | Ga0068860_100008652 | 3300005843 | Bacteria | 10141 |
| 291 | Ga0068860_100042971 | 3300005843 | Bacteria | 4313 |
| 292 | Ga0068860_100050876 | 3300005843 | Bacteria | 3943 |
| 293 | Ga0068860_100064769 | 3300005843 | Bacteria | 3471 |
| 294 | Ga0068860_100474333 | 3300005843 | Bacteria | 1246 |
| 295 | Ga0068862_100002236 | 3300005844 | Bacteria | 17352 |
| 296 | Ga0068862_100032372 | 3300005844 | Bacteria | 4418 |
| 297 | Ga0068862_100163998 | 3300005844 | Bacteria | 1985 |
| 298 | Ga0068862_100383957 | 3300005844 | Bacteria | 1311 |
| 299 | Ga0081455_10005602 | 3300005937 | Bacteria | 13727 |
| 300 | Ga0081455_10006534 | 3300005937 | Bacteria | 12482 |
| 301 | Ga0081455_10006892 | 3300005937 | Bacteria | 12092 |
| 302 | Ga0081455_10012847 | 3300005937 | Bacteria | 8316 |
| 303 | Ga0081455_10035882 | 3300005937 | Bacteria | 4422 |
| 304 | Ga0081455_10121166 | 3300005937 | Bacteria | 2061 |
| 305 | Ga0081538_10055740 | 3300005981 | Bacteria | 2323 |
| 306 | Ga0081540_1000933 | 3300005983 | Bacteria | 26285 |
| 307 | Ga0081540_1002812 | 3300005983 | Bacteria | 14092 |
| 308 | Ga0081540_1005876 | 3300005983 | Bacteria | 9072 |
| 309 | Ga0081540_1006330 | 3300005983 | Bacteria | 8647 |
| 310 | Ga0081540_1016900 | 3300005983 | Bacteria | 4542 |
| 311 | Ga0081540_1021448 | 3300005983 | Bacteria | 3845 |
| 312 | Ga0081540_1029356 | 3300005983 | Bacteria | 3065 |
| 313 | Ga0081539_10000140 | 3300005985 | Bacteria | 166746 |
| 314 | Ga0081539_10003950 | 3300005985 | Bacteria | 17174 |
| 315 | Ga0081539_10017410 | 3300005985 | Bacteria | 5048 |
| 316 | Ga0081539_10026648 | 3300005985 | Bacteria | 3682 |
| 317 | Ga0070717_10004566 | 3300006028 | Bacteria | 10020 |
| 318 | Ga0070717_10047085 | 3300006028 | Bacteria | 3531 |
| 319 | Ga0070717_10134551 | 3300006028 | Bacteria | 2128 |
| 320 | Ga0070717_10292120 | 3300006028 | Bacteria | 1447 |
| 321 | Ga0070717_10313860 | 3300006028 | Bacteria | 1396 |
| 322 | Ga0075365_10008099 | 3300006038 | Bacteria | 5937 |
| 323 | Ga0075365_10070687 | 3300006038 | Bacteria | 2348 |
| 324 | Ga0075365_10076733 | 3300006038 | Bacteria | 2257 |
| 325 | Ga0075365_10239829 | 3300006038 | Bacteria | 1273 |
| 326 | Ga0075368_10002671 | 3300006042 | Bacteria | 5866 |
| 327 | Ga0075368_10012864 | 3300006042 | Bacteria | 3064 |
| 328 | Ga0075363_100002429 | 3300006048 | Bacteria | 7609 |
| 329 | Ga0075363_100038616 | 3300006048 | Bacteria | 2511 |
| 330 | Ga0075364_10004240 | 3300006051 | Bacteria | 8232 |
| 331 | Ga0075364_10007885 | 3300006051 | Bacteria | 6341 |
| 332 | Ga0070715_10070358 | 3300006163 | Bacteria | 1562 |
| 333 | Ga0070716_100002662 | 3300006173 | Bacteria | 8261 |
| 334 | Ga0070712_100032973 | 3300006175 | Bacteria | 3500 |
| 335 | Ga0070712_100145116 | 3300006175 | Bacteria | 1815 |
| 336 | Ga0070712_100162464 | 3300006175 | Bacteria | 1726 |
| 337 | Ga0070712_100211177 | 3300006175 | Bacteria | 1530 |
| 338 | Ga0070712_100214257 | 3300006175 | Bacteria | 1521 |
| 339 | Ga0075362_10000500 | 3300006177 | Bacteria | 11446 |
| 340 | Ga0075362_10012691 | 3300006177 | Bacteria | 3353 |
| 341 | Ga0075367_10002117 | 3300006178 | Bacteria | 8922 |
| 342 | Ga0075367_10010400 | 3300006178 | Bacteria | 4888 |
| 343 | Ga0075367_10088217 | 3300006178 | Bacteria | 1885 |
| 344 | Ga0075367_10142445 | 3300006178 | Bacteria | 1485 |
| 345 | Ga0075369_10003007 | 3300006186 | Bacteria | 6099 |
| 346 | Ga0075369_10005033 | 3300006186 | Bacteria | 4922 |
| 347 | Ga0075366_10004256 | 3300006195 | Bacteria | 7676 |
| 348 | Ga0075366_10016935 | 3300006195 | Bacteria | 4189 |
| 349 | Ga0075366_10169765 | 3300006195 | Bacteria | 1323 |
| 350 | Ga0097621_100002408 | 3300006237 | Bacteria | 12812 |
| 351 | Ga0097621_100035810 | 3300006237 | Bacteria | 3967 |
| 352 | Ga0097621_100037422 | 3300006237 | Bacteria | 3887 |
| 353 | Ga0068871_100002267 | 3300006358 | Bacteria | 13082 |
| 354 | Ga0068871_100076440 | 3300006358 | Bacteria | 2765 |
| 355 | Ga0068871_100129629 | 3300006358 | Bacteria | 2137 |
| 356 | Ga0075428_100019515 | 3300006844 | Bacteria | 7503 |
| 357 | Ga0075428_100031362 | 3300006844 | Bacteria | 5877 |
| 358 | Ga0075428_100036724 | 3300006844 | Bacteria | 5395 |
| 359 | Ga0075428_100067331 | 3300006844 | Bacteria | 3920 |
| 360 | Ga0075428_100321987 | 3300006844 | Bacteria | 1661 |
| 361 | Ga0075430_100004728 | 3300006846 | Bacteria | 11452 |
| 362 | Ga0075430_100030141 | 3300006846 | Bacteria | 4607 |
| 363 | Ga0075431_100000986 | 3300006847 | Bacteria | 25337 |
| 364 | Ga0075431_100007073 | 3300006847 | Bacteria | 11148 |
| 365 | Ga0075431_100060543 | 3300006847 | Bacteria | 3906 |
| 366 | Ga0075431_100108731 | 3300006847 | Bacteria | 2861 |
| 367 | Ga0075431_100371159 | 3300006847 | Bacteria | 1436 |
| 368 | Ga0075433_10025950 | 3300006852 | Bacteria | 4956 |
| 369 | Ga0075433_10039549 | 3300006852 | Bacteria | 4079 |
| 370 | Ga0075434_100007264 | 3300006871 | Bacteria | 10249 |
| 371 | Ga0075434_100016025 | 3300006871 | Bacteria | 7201 |
| 372 | Ga0075434_100029369 | 3300006871 | Bacteria | 5408 |
| 373 | Ga0075434_100044598 | 3300006871 | Bacteria | 4398 |
| 374 | Ga0075434_100080389 | 3300006871 | Bacteria | 3256 |
| 375 | Ga0075434_100274145 | 3300006871 | Bacteria | 1706 |
| 376 | Ga0075434_100520669 | 3300006871 | Bacteria | 1209 |
| 377 | Ga0075429_100205242 | 3300006880 | Bacteria | 1727 |
| 378 | Ga0075429_100258172 | 3300006880 | Bacteria | 1526 |
| 379 | Ga0068865_100000537 | 3300006881 | Bacteria | 21125 |
| 380 | Ga0068865_100003331 | 3300006881 | Bacteria | 9618 |
| 381 | Ga0068865_100083233 | 3300006881 | Bacteria | 2303 |
| 382 | Ga0097620_100001767 | 3300006931 | Bacteria | 21986 |
| 383 | Ga0097620_100061272 | 3300006931 | Bacteria | 3791 |
| 384 | Ga0097620_100070859 | 3300006931 | Bacteria | 3521 |
| 385 | Ga0097620_100132356 | 3300006931 | Bacteria | 2566 |
| 386 | Ga0097620_100135460 | 3300006931 | Bacteria | 2535 |
| 387 | Ga0097620_100205450 | 3300006931 | Bacteria | 2055 |
| 388 | Ga0099824_1018476 | 3300006942 | Bacteria | 5716 |
| 389 | Ga0099822_1042608 | 3300006943 | Bacteria | 2360 |
| 390 | Ga0099823_1035886 | 3300006944 | Bacteria | 3840 |
| 391 | Ga0075435_100014461 | 3300007076 | Bacteria | 5899 |
| 392 | Ga0075435_100024058 | 3300007076 | Bacteria | 4721 |
| 393 | Ga0075435_100030713 | 3300007076 | Bacteria | 4227 |
| 394 | Ga0075435_100085093 | 3300007076 | Bacteria | 2603 |
| 395 | Ga0075435_100193375 | 3300007076 | Bacteria | 1723 |
| 396 | Ga0075435_100218695 | 3300007076 | Bacteria | 1617 |
| 397 | Ga0075435_100330204 | 3300007076 | Bacteria | 1306 |
| 398 | Ga0099794_10054680 | 3300007265 | Bacteria | 1927 |
| 399 | Ga0099794_10054754 | 3300007265 | Bacteria | 1926 |
| 400 | Ga0105251_10037885 | 3300009011 | Bacteria | 2364 |
| 401 | Ga0105240_10000013 | 3300009093 | Bacteria | 483458 |
| 402 | Ga0105240_10011032 | 3300009093 | Bacteria | 12637 |
| 403 | Ga0105240_10011470 | 3300009093 | Bacteria | 12342 |
| 404 | Ga0105240_10222983 | 3300009093 | Bacteria | 2195 |
| 405 | Ga0111539_10004508 | 3300009094 | Bacteria | 18213 |
| 406 | Ga0111539_10004845 | 3300009094 | Bacteria | 17538 |
| 407 | Ga0111539_10008569 | 3300009094 | Bacteria | 12982 |
| 408 | Ga0111539_10010943 | 3300009094 | Bacteria | 11418 |
| 409 | Ga0111539_10011182 | 3300009094 | Bacteria | 11280 |
| 410 | Ga0111539_10017014 | 3300009094 | Bacteria | 8999 |
| 411 | Ga0111539_10136297 | 3300009094 | Bacteria | 2875 |
| 412 | Ga0105245_10000888 | 3300009098 | Bacteria | 27206 |
| 413 | Ga0105245_10019909 | 3300009098 | Bacteria | 5883 |
| 414 | Ga0105245_10045759 | 3300009098 | Bacteria | 3908 |
| 415 | Ga0105245_10048198 | 3300009098 | Bacteria | 3811 |
| 416 | Ga0105245_10072768 | 3300009098 | Bacteria | 3123 |
| 417 | Ga0105245_10096894 | 3300009098 | Bacteria | 2723 |
| 418 | Ga0105247_10001292 | 3300009101 | Bacteria | 18486 |
| 419 | Ga0105247_10007990 | 3300009101 | Bacteria | 6464 |
| 420 | Ga0105247_10030643 | 3300009101 | Bacteria | 3260 |
| 421 | Ga0105247_10040354 | 3300009101 | Bacteria | 2853 |
| 422 | Ga0114129_10004791 | 3300009147 | Bacteria | 19126 |
| 423 | Ga0114129_10011980 | 3300009147 | Bacteria | 12334 |
| 424 | Ga0114129_10014380 | 3300009147 | Bacteria | 11281 |
| 425 | Ga0114129_10033315 | 3300009147 | Bacteria | 7280 |
| 426 | Ga0114129_10039254 | 3300009147 | Bacteria | 6675 |
| 427 | Ga0114129_10081529 | 3300009147 | Bacteria | 4497 |
| 428 | Ga0114129_10084982 | 3300009147 | Bacteria | 4391 |
| 429 | Ga0105243_10004521 | 3300009148 | Bacteria | 10993 |
| 430 | Ga0105243_10052213 | 3300009148 | Bacteria | 3238 |
| 431 | Ga0105243_10238346 | 3300009148 | Bacteria | 1618 |
| 432 | Ga0105241_10000662 | 3300009174 | Bacteria | 25854 |
| 433 | Ga0105241_10016979 | 3300009174 | Bacteria | 5342 |
| 434 | Ga0105241_10054453 | 3300009174 | Bacteria | 3062 |
| 435 | Ga0105241_10062168 | 3300009174 | Bacteria | 2878 |
| 436 | Ga0105241_10179290 | 3300009174 | Bacteria | 1756 |
| 437 | Ga0105242_10001202 | 3300009176 | Bacteria | 20446 |
| 438 | Ga0105242_10033477 | 3300009176 | Bacteria | 4114 |
| 439 | Ga0105242_10053798 | 3300009176 | Bacteria | 3288 |
| 440 | Ga0105248_10000471 | 3300009177 | Bacteria | 45843 |
| 441 | Ga0105248_10002336 | 3300009177 | Bacteria | 21042 |
| 442 | Ga0105248_10063028 | 3300009177 | Bacteria | 4161 |
| 443 | Ga0105248_10072434 | 3300009177 | Bacteria | 3872 |
| 444 | Ga0105237_10007434 | 3300009545 | Bacteria | 11991 |
| 445 | Ga0105237_10009082 | 3300009545 | Bacteria | 10682 |
| 446 | Ga0105237_10010293 | 3300009545 | Bacteria | 9963 |
| 447 | Ga0105237_10020331 | 3300009545 | Bacteria | 6847 |
| 448 | Ga0105237_10053429 | 3300009545 | Bacteria | 4052 |
| 449 | Ga0105237_10138222 | 3300009545 | Bacteria | 2431 |
| 450 | Ga0105237_10142679 | 3300009545 | Bacteria | 2389 |
| 451 | Ga0105238_10035579 | 3300009551 | Bacteria | 5062 |
| 452 | Ga0105238_10044782 | 3300009551 | Bacteria | 4472 |
| 453 | Ga0105238_10232571 | 3300009551 | Bacteria | 1820 |
| 454 | Ga0105249_10001808 | 3300009553 | Bacteria | 18605 |
| 455 | Ga0105249_10405042 | 3300009553 | Bacteria | 1395 |
| 456 | Ga0105239_10014249 | 3300010375 | Bacteria | 8826 |
| 457 | Ga0105239_10018370 | 3300010375 | Bacteria | 7730 |
| 458 | Ga0105239_10031739 | 3300010375 | Bacteria | 5805 |
| 459 | Ga0105239_10050388 | 3300010375 | Bacteria | 4567 |
| 460 | Ga0105239_10056652 | 3300010375 | Bacteria | 4299 |
| 461 | Ga0105239_10060609 | 3300010375 | Bacteria | 4153 |
| 462 | Ga0105239_10068450 | 3300010375 | Bacteria | 3901 |
| 463 | Ga0105239_10103533 | 3300010375 | Bacteria | 3151 |
| 464 | Ga0105239_10133487 | 3300010375 | Bacteria | 2763 |
| 465 | Ga0105239_10170978 | 3300010375 | Bacteria | 2430 |
| 466 | Ga0105246_10004623 | 3300011119 | Bacteria | 8378 |
| 467 | Ga0105246_10013849 | 3300011119 | Bacteria | 5062 |
| 468 | Ga0105246_10240447 | 3300011119 | Bacteria | 1431 |
| 469 | Ga0157346_1000487 | 3300012480 | Bacteria | 1671 |
| 470 | Ga0157341_1000902 | 3300012494 | Bacteria | 1653 |
| 471 | Ga0157339_1001172 | 3300012505 | Bacteria | 1544 |
| 472 | Ga0157373_10011956 | 3300013100 | Bacteria | 6377 |
| 473 | Ga0157371_10027329 | 3300013102 | Bacteria | 4139 |
| 474 | Ga0157370_10000548 | 3300013104 | Bacteria | 46830 |
| 475 | Ga0157370_10004885 | 3300013104 | Bacteria | 15203 |
| 476 | Ga0157370_10030134 | 3300013104 | Bacteria | 5318 |
| 477 | Ga0157370_10101270 | 3300013104 | Bacteria | 2698 |
| 478 | Ga0157370_10103522 | 3300013104 | Bacteria | 2665 |
| 479 | Ga0157370_10209417 | 3300013104 | Bacteria | 1807 |
| 480 | Ga0157369_10016501 | 3300013105 | Bacteria | 8306 |
| 481 | Ga0157369_10066123 | 3300013105 | Bacteria | 3890 |
| 482 | Ga0157374_10002267 | 3300013296 | Bacteria | 16192 |
| 483 | Ga0157374_10005674 | 3300013296 | Bacteria | 10522 |
| 484 | Ga0157374_10030713 | 3300013296 | Bacteria | 4881 |
| 485 | Ga0157374_10050875 | 3300013296 | Bacteria | 3853 |
| 486 | Ga0157374_10066448 | 3300013296 | Bacteria | 3389 |
| 487 | Ga0157378_10100657 | 3300013297 | Bacteria | 2639 |
| 488 | Ga0163162_10006607 | 3300013306 | Bacteria | 11234 |
| 489 | Ga0163162_10009182 | 3300013306 | Bacteria | 9623 |
| 490 | Ga0163162_10015064 | 3300013306 | Bacteria | 7553 |
| 491 | Ga0163162_10035411 | 3300013306 | Bacteria | 4973 |
| 492 | Ga0163162_10284195 | 3300013306 | Bacteria | 1786 |
| 493 | Ga0157372_10005926 | 3300013307 | Bacteria | 12999 |
| 494 | Ga0157372_10011471 | 3300013307 | Bacteria | 9424 |
| 495 | Ga0157372_10277014 | 3300013307 | Bacteria | 1950 |
| 496 | Ga0157375_10001031 | 3300013308 | Bacteria | 24026 |
| 497 | Ga0157375_10019981 | 3300013308 | Bacteria | 6108 |
| 498 | Ga0157375_10052928 | 3300013308 | Bacteria | 3993 |
| 499 | Ga0157375_10184396 | 3300013308 | Bacteria | 2240 |
| 500 | Ga0157375_10189355 | 3300013308 | Bacteria | 2212 |
| 501 | Ga0157375_10204719 | 3300013308 | Bacteria | 2130 |
| 502 | Ga0157375_10216761 | 3300013308 | Bacteria | 2072 |
| 503 | Ga0163163_10003057 | 3300014325 | Bacteria | 14159 |
| 504 | Ga0163163_10003323 | 3300014325 | Bacteria | 13641 |
| 505 | Ga0163163_10038122 | 3300014325 | Bacteria | 4680 |
| 506 | Ga0163163_10113030 | 3300014325 | Bacteria | 2745 |
| 507 | Ga0157380_10000726 | 3300014326 | Bacteria | 20528 |
| 508 | Ga0157380_10005881 | 3300014326 | Bacteria | 8581 |
| 509 | Ga0157380_10048489 | 3300014326 | Bacteria | 3345 |
| 510 | Ga0157377_10000324 | 3300014745 | Bacteria | 21481 |
| 511 | Ga0157379_10001193 | 3300014968 | Bacteria | 21154 |
| 512 | Ga0157379_10013061 | 3300014968 | Bacteria | 7273 |
| 513 | Ga0157379_10027074 | 3300014968 | Bacteria | 5103 |
| 514 | Ga0157376_10003383 | 3300014969 | Bacteria | 10978 |
| 515 | Ga0157376_10066060 | 3300014969 | Bacteria | 3056 |
| 516 | Ga0157376_10209517 | 3300014969 | Bacteria | 1799 |
| 517 | Ga0157376_10337305 | 3300014969 | Bacteria | 1439 |
| 518 | Ga0182007_10011275 | 3300015262 | Bacteria | 3483 |
| 519 | Ga0182005_1002419 | 3300015265 | Bacteria | 6679 |
| 520 | Ga0163161_10001040 | 3300017792 | Bacteria | 21136 |
| 521 | Ga0163161_10116279 | 3300017792 | Bacteria | 2005 |
| 522 | Ga0197907_10592444 | 3300020069 | Bacteria | 2888 |
| 523 | Ga0206356_10283358 | 3300020070 | Bacteria | 1841 |
| 524 | Ga0206356_11623307 | 3300020070 | Bacteria | 2815 |
| 525 | Ga0206355_1301277 | 3300020076 | Bacteria | 1122 |
| 526 | Ga0206351_10620691 | 3300020077 | Bacteria | 1431 |
| 527 | Ga0206350_10527760 | 3300020080 | Bacteria | 1845 |
| 528 | Ga0206350_11111889 | 3300020080 | Bacteria | 2770 |
| 529 | Ga0206353_10224996 | 3300020082 | Bacteria | 1394 |
| 530 | Ga0206353_11232580 | 3300020082 | Bacteria | 1904 |
| 531 | Ga0214544_1000002 | 3300021320 | Bacteria | 753857 |
| 532 | Ga0214542_1000001 | 3300021321 | Bacteria | 1018696 |
| 533 | Ga0214545_1000001 | 3300021324 | Bacteria | 1092817 |
| 534 | Ga0214543_1000001 | 3300021327 | Bacteria | 776921 |
| 535 | Ga0213876_10013313 | 3300021384 | Bacteria | 4371 |
| 536 | Ga0213875_10016415 | 3300021388 | Bacteria | 3590 |
| 537 | Ga0224712_10000671 | 3300022467 | Bacteria | 7045 |
| 538 | Ga0224712_10006030 | 3300022467 | Bacteria | 3426 |
| 539 | Ga0224712_10011398 | 3300022467 | Bacteria | 2758 |
| 540 | Ga0224712_10037983 | 3300022467 | Bacteria | 1796 |
| 541 | Ga0228711_1013535 | 3300022739 | Bacteria | 9546 |
| 542 | Ga0228710_1013900 | 3300022740 | Bacteria | 9412 |
| 543 | Ga0209563_102298 | 3300025230 | Bacteria | 4396 |
| 544 | Ga0207427_101277 | 3300025231 | Bacteria | 9577 |
| 545 | Ga0207425_1011256 | 3300025245 | Bacteria | 2141 |
| 546 | Ga0209677_101018 | 3300025253 | Bacteria | 13392 |
| 547 | Ga0209677_101344 | 3300025253 | Bacteria | 10806 |
| 548 | Ga0209677_105484 | 3300025253 | Bacteria | 3295 |
| 549 | Ga0209148_1000475 | 3300025254 | Bacteria | 42476 |
| 550 | Ga0209129_1000367 | 3300025258 | Bacteria | 36845 |
| 551 | Ga0209233_1000358 | 3300025261 | Bacteria | 41919 |
| 552 | Ga0209233_1002540 | 3300025261 | Bacteria | 6665 |
| 553 | Ga0209233_1010781 | 3300025261 | Bacteria | 2719 |
| 554 | Ga0209233_1020784 | 3300025261 | Bacteria | 1713 |
| 555 | Ga0207666_1000034 | 3300025271 | Bacteria | 28645 |
| 556 | Ga0209455_1001935 | 3300025272 | Bacteria | 8555 |
| 557 | Ga0209673_1000872 | 3300025273 | Bacteria | 39153 |
| 558 | Ga0209130_1000013 | 3300025284 | Bacteria | 412810 |
| 559 | Ga0207673_1000073 | 3300025290 | Bacteria | 8700 |
| 560 | Ga0209676_1000580 | 3300025292 | Bacteria | 55127 |
| 561 | Ga0209676_1005236 | 3300025292 | Bacteria | 6871 |
| 562 | Ga0209025_1000228 | 3300025294 | Bacteria | 132088 |
| 563 | Ga0209564_1000763 | 3300025295 | Bacteria | 45281 |
| 564 | Ga0209564_1010443 | 3300025295 | Bacteria | 4275 |
| 565 | Ga0209758_1000113 | 3300025297 | Bacteria | 202528 |
| 566 | Ga0209758_1000684 | 3300025297 | Bacteria | 50528 |
| 567 | Ga0209758_1001509 | 3300025297 | Bacteria | 27022 |
| 568 | Ga0209758_1001768 | 3300025297 | Bacteria | 23963 |
| 569 | Ga0209758_1003468 | 3300025297 | Bacteria | 14294 |
| 570 | Ga0209758_1007908 | 3300025297 | Bacteria | 7058 |
| 571 | Ga0209758_1030049 | 3300025297 | Bacteria | 2257 |
| 572 | Ga0209050_1011385 | 3300025298 | Bacteria | 4226 |
| 573 | Ga0209050_1027177 | 3300025298 | Bacteria | 1893 |
| 574 | Ga0209256_1001449 | 3300025299 | Bacteria | 24483 |
| 575 | Ga0209256_1006564 | 3300025299 | Bacteria | 6103 |
| 576 | Ga0207426_1000022 | 3300025302 | Bacteria | 547377 |
| 577 | Ga0207426_1000307 | 3300025302 | Bacteria | 96085 |
| 578 | Ga0207426_1000855 | 3300025302 | Bacteria | 32019 |
| 579 | Ga0207426_1013721 | 3300025302 | Bacteria | 2990 |
| 580 | Ga0209051_1004819 | 3300025303 | Bacteria | 8127 |
| 581 | Ga0209257_1001372 | 3300025304 | Bacteria | 29358 |
| 582 | Ga0209257_1001932 | 3300025304 | Bacteria | 22369 |
| 583 | Ga0207697_10000280 | 3300025315 | Bacteria | 28276 |
| 584 | Ga0207656_10068821 | 3300025321 | Bacteria | 1570 |
| 585 | Ga0207656_10092070 | 3300025321 | Bacteria | 1378 |
| 586 | Ga0207653_10001427 | 3300025885 | Bacteria | 7746 |
| 587 | Ga0207682_10000134 | 3300025893 | Bacteria | 33520 |
| 588 | Ga0207682_10001129 | 3300025893 | Bacteria | 12342 |
| 589 | Ga0207682_10002016 | 3300025893 | Bacteria | 9198 |
| 590 | Ga0207692_10002168 | 3300025898 | Bacteria | 7504 |
| 591 | Ga0207692_10002762 | 3300025898 | Bacteria | 6763 |
| 592 | Ga0207692_10009738 | 3300025898 | Bacteria | 4024 |
| 593 | Ga0207692_10142815 | 3300025898 | Bacteria | 1363 |
| 594 | Ga0207642_10008502 | 3300025899 | Bacteria | 3525 |
| 595 | Ga0207642_10083998 | 3300025899 | Bacteria | 1554 |
| 596 | Ga0207710_10001541 | 3300025900 | Bacteria | 11350 |
| 597 | Ga0207710_10006028 | 3300025900 | Bacteria | 5195 |
| 598 | Ga0207710_10027029 | 3300025900 | Bacteria | 2482 |
| 599 | Ga0207710_10032588 | 3300025900 | Bacteria | 2283 |
| 600 | Ga0207688_10000526 | 3300025901 | Bacteria | 18554 |
| 601 | Ga0207688_10000663 | 3300025901 | Bacteria | 16993 |
| 602 | Ga0207688_10028561 | 3300025901 | Bacteria | 3068 |
| 603 | Ga0207688_10095742 | 3300025901 | Bacteria | 1709 |
| 604 | Ga0207688_10112576 | 3300025901 | Bacteria | 1581 |
| 605 | Ga0207680_10037146 | 3300025903 | Bacteria | 2810 |
| 606 | Ga0207647_10003350 | 3300025904 | Bacteria | 12019 |
| 607 | Ga0207647_10007263 | 3300025904 | Bacteria | 8019 |
| 608 | Ga0207647_10011872 | 3300025904 | Bacteria | 6086 |
| 609 | Ga0207685_10008122 | 3300025905 | Bacteria | 2969 |
| 610 | Ga0207699_10000508 | 3300025906 | Bacteria | 19334 |
| 611 | Ga0207699_10024497 | 3300025906 | Bacteria | 3301 |
| 612 | Ga0207699_10025852 | 3300025906 | Bacteria | 3229 |
| 613 | Ga0207699_10049502 | 3300025906 | Bacteria | 2474 |
| 614 | Ga0207645_10001617 | 3300025907 | Bacteria | 18370 |
| 615 | Ga0207645_10023769 | 3300025907 | Bacteria | 3979 |
| 616 | Ga0207645_10030200 | 3300025907 | Bacteria | 3492 |
| 617 | Ga0207643_10000756 | 3300025908 | Bacteria | 19870 |
| 618 | Ga0207643_10000808 | 3300025908 | Bacteria | 19021 |
| 619 | Ga0207643_10072110 | 3300025908 | Bacteria | 1989 |
| 620 | Ga0207684_10002166 | 3300025910 | Bacteria | 20113 |
| 621 | Ga0207654_10011329 | 3300025911 | Bacteria | 4550 |
| 622 | Ga0207654_10061692 | 3300025911 | Bacteria | 2194 |
| 623 | Ga0207654_10067398 | 3300025911 | Bacteria | 2114 |
| 624 | Ga0207654_10068775 | 3300025911 | Bacteria | 2096 |
| 625 | Ga0207707_10000359 | 3300025912 | Bacteria | 47942 |
| 626 | Ga0207707_10001961 | 3300025912 | Bacteria | 18703 |
| 627 | Ga0207707_10002112 | 3300025912 | Bacteria | 17984 |
| 628 | Ga0207707_10003260 | 3300025912 | Bacteria | 14418 |
| 629 | Ga0207707_10003603 | 3300025912 | Bacteria | 13734 |
| 630 | Ga0207695_10000008 | 3300025913 | Bacteria | 1058268 |
| 631 | Ga0207695_10000044 | 3300025913 | Bacteria | 440819 |
| 632 | Ga0207695_10113902 | 3300025913 | Bacteria | 2680 |
| 633 | Ga0207695_10126627 | 3300025913 | Bacteria | 2515 |
| 634 | Ga0207671_10006361 | 3300025914 | Bacteria | 10531 |
| 635 | Ga0207671_10010828 | 3300025914 | Bacteria | 7480 |
| 636 | Ga0207671_10030827 | 3300025914 | Bacteria | 3997 |
| 637 | Ga0207671_10031017 | 3300025914 | Bacteria | 3985 |
| 638 | Ga0207671_10036337 | 3300025914 | Bacteria | 3653 |
| 639 | Ga0207671_10084264 | 3300025914 | Bacteria | 2387 |
| 640 | Ga0207671_10092604 | 3300025914 | Bacteria | 2279 |
| 641 | Ga0207693_10000581 | 3300025915 | Bacteria | 32715 |
| 642 | Ga0207693_10002467 | 3300025915 | Bacteria | 16076 |
| 643 | Ga0207693_10030563 | 3300025915 | Bacteria | 4255 |
| 644 | Ga0207693_10032713 | 3300025915 | Bacteria | 4104 |
| 645 | Ga0207693_10039890 | 3300025915 | Bacteria | 3698 |
| 646 | Ga0207693_10071283 | 3300025915 | Bacteria | 2719 |
| 647 | Ga0207693_10116468 | 3300025915 | Bacteria | 2098 |
| 648 | Ga0207663_10000084 | 3300025916 | Bacteria | 44454 |
| 649 | Ga0207663_10040483 | 3300025916 | Bacteria | 2833 |
| 650 | Ga0207663_10044561 | 3300025916 | Bacteria | 2724 |
| 651 | Ga0207663_10211677 | 3300025916 | Bacteria | 1405 |
| 652 | Ga0207663_10214559 | 3300025916 | Bacteria | 1397 |
| 653 | Ga0207660_10001335 | 3300025917 | Bacteria | 16500 |
| 654 | Ga0207660_10008111 | 3300025917 | Bacteria | 6793 |
| 655 | Ga0207660_10013662 | 3300025917 | Bacteria | 5325 |
| 656 | Ga0207660_10044293 | 3300025917 | Bacteria | 3130 |
| 657 | Ga0207660_10047556 | 3300025917 | Bacteria | 3033 |
| 658 | Ga0207660_10078384 | 3300025917 | Bacteria | 2421 |
| 659 | Ga0207660_10242940 | 3300025917 | Bacteria | 1419 |
| 660 | Ga0207662_10000341 | 3300025918 | Bacteria | 21083 |
| 661 | Ga0207662_10007966 | 3300025918 | Bacteria | 5773 |
| 662 | Ga0207662_10055341 | 3300025918 | Bacteria | 2367 |
| 663 | Ga0207657_10002888 | 3300025919 | Bacteria | 18459 |
| 664 | Ga0207657_10012009 | 3300025919 | Bacteria | 8567 |
| 665 | Ga0207657_10018566 | 3300025919 | Bacteria | 6631 |
| 666 | Ga0207657_10021585 | 3300025919 | Bacteria | 6055 |
| 667 | Ga0207657_10022947 | 3300025919 | Bacteria | 5823 |
| 668 | Ga0207657_10054672 | 3300025919 | Bacteria | 3451 |
| 669 | Ga0207649_10000271 | 3300025920 | Bacteria | 40924 |
| 670 | Ga0207649_10195265 | 3300025920 | Bacteria | 1426 |
| 671 | Ga0207649_10286747 | 3300025920 | Bacteria | 1199 |
| 672 | Ga0207652_10001830 | 3300025921 | Bacteria | 18431 |
| 673 | Ga0207652_10001857 | 3300025921 | Bacteria | 18344 |
| 674 | Ga0207652_10019118 | 3300025921 | Bacteria | 5629 |
| 675 | Ga0207652_10034193 | 3300025921 | Bacteria | 4282 |
| 676 | Ga0207652_10047300 | 3300025921 | Bacteria | 3674 |
| 677 | Ga0207652_10064689 | 3300025921 | Bacteria | 3165 |
| 678 | Ga0207652_10085656 | 3300025921 | Bacteria | 2762 |
| 679 | Ga0207652_10134157 | 3300025921 | Bacteria | 2210 |
| 680 | Ga0207652_10141779 | 3300025921 | Bacteria | 2149 |
| 681 | Ga0207652_10198169 | 3300025921 | Bacteria | 1807 |
| 682 | Ga0207646_10140901 | 3300025922 | Bacteria | 2171 |
| 683 | Ga0207681_10000658 | 3300025923 | Bacteria | 22886 |
| 684 | Ga0207681_10067166 | 3300025923 | Bacteria | 2485 |
| 685 | Ga0207681_10212643 | 3300025923 | Bacteria | 1491 |
| 686 | Ga0207694_10019649 | 3300025924 | Bacteria | 5110 |
| 687 | Ga0207694_10065256 | 3300025924 | Bacteria | 2838 |
| 688 | Ga0207694_10077851 | 3300025924 | Bacteria | 2599 |
| 689 | Ga0207694_10208429 | 3300025924 | Bacteria | 1592 |
| 690 | Ga0207694_10309219 | 3300025924 | Bacteria | 1302 |
| 691 | Ga0207650_10000408 | 3300025925 | Bacteria | 38515 |
| 692 | Ga0207650_10296655 | 3300025925 | Bacteria | 1319 |
| 693 | Ga0207650_10301547 | 3300025925 | Bacteria | 1308 |
| 694 | Ga0207659_10000177 | 3300025926 | Bacteria | 38217 |
| 695 | Ga0207659_10000256 | 3300025926 | Bacteria | 32624 |
| 696 | Ga0207659_10023619 | 3300025926 | Bacteria | 4106 |
| 697 | Ga0207687_10000495 | 3300025927 | Bacteria | 26551 |
| 698 | Ga0207687_10006623 | 3300025927 | Bacteria | 7642 |
| 699 | Ga0207687_10013921 | 3300025927 | Bacteria | 5256 |
| 700 | Ga0207687_10027876 | 3300025927 | Bacteria | 3792 |
| 701 | Ga0207687_10029353 | 3300025927 | Bacteria | 3699 |
| 702 | Ga0207687_10160216 | 3300025927 | Bacteria | 1726 |
| 703 | Ga0207687_10344897 | 3300025927 | Bacteria | 1212 |
| 704 | Ga0207700_10018872 | 3300025928 | Bacteria | 4646 |
| 705 | Ga0207700_10030543 | 3300025928 | Bacteria | 3818 |
| 706 | Ga0207700_10090460 | 3300025928 | Bacteria | 2415 |
| 707 | Ga0207700_10133971 | 3300025928 | Bacteria | 2027 |
| 708 | Ga0207700_10215152 | 3300025928 | Bacteria | 1626 |
| 709 | Ga0207664_10024979 | 3300025929 | Bacteria | 4494 |
| 710 | Ga0207664_10107250 | 3300025929 | Bacteria | 2317 |
| 711 | Ga0207664_10191702 | 3300025929 | Bacteria | 1760 |
| 712 | Ga0207644_10000279 | 3300025931 | Bacteria | 33969 |
| 713 | Ga0207644_10014331 | 3300025931 | Bacteria | 5303 |
| 714 | Ga0207644_10015516 | 3300025931 | Bacteria | 5115 |
| 715 | Ga0207644_10029940 | 3300025931 | Bacteria | 3780 |
| 716 | Ga0207644_10074660 | 3300025931 | Bacteria | 2489 |
| 717 | Ga0207644_10128507 | 3300025931 | Bacteria | 1937 |
| 718 | Ga0207644_10278256 | 3300025931 | Bacteria | 1343 |
| 719 | Ga0207690_10001557 | 3300025932 | Bacteria | 14369 |
| 720 | Ga0207690_10006785 | 3300025932 | Bacteria | 6789 |
| 721 | Ga0207690_10008986 | 3300025932 | Bacteria | 5930 |
| 722 | Ga0207706_10005939 | 3300025933 | Bacteria | 11357 |
| 723 | Ga0207706_10007308 | 3300025933 | Bacteria | 10214 |
| 724 | Ga0207706_10012772 | 3300025933 | Bacteria | 7645 |
| 725 | Ga0207706_10041280 | 3300025933 | Bacteria | 4090 |
| 726 | Ga0207706_10053602 | 3300025933 | Bacteria | 3560 |
| 727 | Ga0207706_10065929 | 3300025933 | Bacteria | 3187 |
| 728 | Ga0207706_10092877 | 3300025933 | Bacteria | 2654 |
| 729 | Ga0207706_10102247 | 3300025933 | Bacteria | 2521 |
| 730 | Ga0207686_10001383 | 3300025934 | Bacteria | 13773 |
| 731 | Ga0207686_10052401 | 3300025934 | Bacteria | 2546 |
| 732 | Ga0207686_10073324 | 3300025934 | Bacteria | 2208 |
| 733 | Ga0207709_10000952 | 3300025935 | Bacteria | 21659 |
| 734 | Ga0207670_10000491 | 3300025936 | Bacteria | 21793 |
| 735 | Ga0207670_10062155 | 3300025936 | Bacteria | 2551 |
| 736 | Ga0207670_10273891 | 3300025936 | Bacteria | 1313 |
| 737 | Ga0207669_10000649 | 3300025937 | Bacteria | 15064 |
| 738 | Ga0207669_10021526 | 3300025937 | Bacteria | 3406 |
| 739 | Ga0207669_10177271 | 3300025937 | Bacteria | 1524 |
| 740 | Ga0207669_10367063 | 3300025937 | Bacteria | 1117 |
| 741 | Ga0207704_10001342 | 3300025938 | Bacteria | 10974 |
| 742 | Ga0207704_10006681 | 3300025938 | Bacteria | 5403 |
| 743 | Ga0207665_10002422 | 3300025939 | Bacteria | 12617 |
| 744 | Ga0207665_10003511 | 3300025939 | Bacteria | 10469 |
| 745 | Ga0207665_10004210 | 3300025939 | Bacteria | 9576 |
| 746 | Ga0207665_10043152 | 3300025939 | Bacteria | 3015 |
| 747 | Ga0207691_10000360 | 3300025940 | Bacteria | 45895 |
| 748 | Ga0207691_10002815 | 3300025940 | Bacteria | 16961 |
| 749 | Ga0207691_10011566 | 3300025940 | Bacteria | 8473 |
| 750 | Ga0207691_10039366 | 3300025940 | Bacteria | 4374 |
| 751 | Ga0207691_10054159 | 3300025940 | Bacteria | 3660 |
| 752 | Ga0207711_10001570 | 3300025941 | Bacteria | 21117 |
| 753 | Ga0207711_10009143 | 3300025941 | Bacteria | 8276 |
| 754 | Ga0207711_10016743 | 3300025941 | Bacteria | 6088 |
| 755 | Ga0207711_10021793 | 3300025941 | Bacteria | 5351 |
| 756 | Ga0207711_10068152 | 3300025941 | Bacteria | 3081 |
| 757 | Ga0207689_10002449 | 3300025942 | Bacteria | 17292 |
| 758 | Ga0207689_10057982 | 3300025942 | Bacteria | 3185 |
| 759 | Ga0207661_10000642 | 3300025944 | Bacteria | 22523 |
| 760 | Ga0207661_10003486 | 3300025944 | Bacteria | 10927 |
| 761 | Ga0207661_10012908 | 3300025944 | Bacteria | 6091 |
| 762 | Ga0207661_10017816 | 3300025944 | Bacteria | 5264 |
| 763 | Ga0207679_10000046 | 3300025945 | Bacteria | 119975 |
| 764 | Ga0207679_10028026 | 3300025945 | Bacteria | 3904 |
| 765 | Ga0207679_10225010 | 3300025945 | Bacteria | 1580 |
| 766 | Ga0207667_10007962 | 3300025949 | Bacteria | 12641 |
| 767 | Ga0207667_10013915 | 3300025949 | Bacteria | 9192 |
| 768 | Ga0207667_10017447 | 3300025949 | Bacteria | 8076 |
| 769 | Ga0207667_10040700 | 3300025949 | Bacteria | 4948 |
| 770 | Ga0207667_10184243 | 3300025949 | Bacteria | 2144 |
| 771 | Ga0207667_10380115 | 3300025949 | Bacteria | 1439 |
| 772 | Ga0207651_10000214 | 3300025960 | Bacteria | 24891 |
| 773 | Ga0207651_10035381 | 3300025960 | Bacteria | 3247 |
| 774 | Ga0207651_10056778 | 3300025960 | Bacteria | 2696 |
| 775 | Ga0207651_10068414 | 3300025960 | Bacteria | 2504 |
| 776 | Ga0207651_10082135 | 3300025960 | Bacteria | 2325 |
| 777 | Ga0207712_10003297 | 3300025961 | Bacteria | 10236 |
| 778 | Ga0207712_10121130 | 3300025961 | Bacteria | 1980 |
| 779 | Ga0207712_10171984 | 3300025961 | Bacteria | 1694 |
| 780 | Ga0207712_10176649 | 3300025961 | Bacteria | 1674 |
| 781 | Ga0207668_10000537 | 3300025972 | Bacteria | 23803 |
| 782 | Ga0207668_10026242 | 3300025972 | Bacteria | 3780 |
| 783 | Ga0207668_10064228 | 3300025972 | Bacteria | 2593 |
| 784 | Ga0207640_10000765 | 3300025981 | Bacteria | 18401 |
| 785 | Ga0207640_10073819 | 3300025981 | Bacteria | 2306 |
| 786 | Ga0207658_10001147 | 3300025986 | Bacteria | 21223 |
| 787 | Ga0207658_10114269 | 3300025986 | Bacteria | 2140 |
| 788 | Ga0207677_10003377 | 3300026023 | Bacteria | 8450 |
| 789 | Ga0207677_10023214 | 3300026023 | Bacteria | 3826 |
| 790 | Ga0207677_10043687 | 3300026023 | Bacteria | 2981 |
| 791 | Ga0207677_10165636 | 3300026023 | Bacteria | 1722 |
| 792 | Ga0207703_10000940 | 3300026035 | Bacteria | 28248 |
| 793 | Ga0207703_10104329 | 3300026035 | Bacteria | 2408 |
| 794 | Ga0207703_10128879 | 3300026035 | Bacteria | 2182 |
| 795 | Ga0207703_10178802 | 3300026035 | Bacteria | 1871 |
| 796 | Ga0207639_10000852 | 3300026041 | Bacteria | 20713 |
| 797 | Ga0207639_10038053 | 3300026041 | Bacteria | 3576 |
| 798 | Ga0207639_10105528 | 3300026041 | Bacteria | 2286 |
| 799 | Ga0207639_10136104 | 3300026041 | Bacteria | 2040 |
| 800 | Ga0207639_10343701 | 3300026041 | Bacteria | 1331 |
| 801 | Ga0207678_10002525 | 3300026067 | Bacteria | 16674 |
| 802 | Ga0207678_10011036 | 3300026067 | Bacteria | 7935 |
| 803 | Ga0207678_10021682 | 3300026067 | Bacteria | 5634 |
| 804 | Ga0207678_10024738 | 3300026067 | Bacteria | 5243 |
| 805 | Ga0207678_10105768 | 3300026067 | Bacteria | 2401 |
| 806 | Ga0207678_10154890 | 3300026067 | Bacteria | 1956 |
| 807 | Ga0207708_10001006 | 3300026075 | Bacteria | 21086 |
| 808 | Ga0207708_10005549 | 3300026075 | Bacteria | 9308 |
| 809 | Ga0207708_10017098 | 3300026075 | Bacteria | 5459 |
| 810 | Ga0207702_10000126 | 3300026078 | Bacteria | 90550 |
| 811 | Ga0207702_10002642 | 3300026078 | Bacteria | 16821 |
| 812 | Ga0207641_10001370 | 3300026088 | Bacteria | 24094 |
| 813 | Ga0207641_10139531 | 3300026088 | Bacteria | 2185 |
| 814 | Ga0207641_10149185 | 3300026088 | Bacteria | 2116 |
| 815 | Ga0207648_10002036 | 3300026089 | Bacteria | 22064 |
| 816 | Ga0207648_10002249 | 3300026089 | Bacteria | 20879 |
| 817 | Ga0207648_10013101 | 3300026089 | Bacteria | 7732 |
| 818 | Ga0207648_10016754 | 3300026089 | Bacteria | 6685 |
| 819 | Ga0207648_10021939 | 3300026089 | Bacteria | 5737 |
| 820 | Ga0207648_10023261 | 3300026089 | Bacteria | 5557 |
| 821 | Ga0207648_10050432 | 3300026089 | Bacteria | 3639 |
| 822 | Ga0207676_10004314 | 3300026095 | Bacteria | 10058 |
| 823 | Ga0207676_10008222 | 3300026095 | Bacteria | 7425 |
| 824 | Ga0207676_10024360 | 3300026095 | Bacteria | 4477 |
| 825 | Ga0207676_10104391 | 3300026095 | Bacteria | 2357 |
| 826 | Ga0207674_10002956 | 3300026116 | Bacteria | 21106 |
| 827 | Ga0207674_10037457 | 3300026116 | Bacteria | 5044 |
| 828 | Ga0207674_10045708 | 3300026116 | Bacteria | 4501 |
| 829 | Ga0207674_10147506 | 3300026116 | Bacteria | 2310 |
| 830 | Ga0207675_100006209 | 3300026118 | Bacteria | 11346 |
| 831 | Ga0207675_100019635 | 3300026118 | Bacteria | 6308 |
| 832 | Ga0207675_100020315 | 3300026118 | Bacteria | 6193 |
| 833 | Ga0207675_100034484 | 3300026118 | Bacteria | 4719 |
| 834 | Ga0207683_10001099 | 3300026121 | Bacteria | 24626 |
| 835 | Ga0207683_10001904 | 3300026121 | Bacteria | 18455 |
| 836 | Ga0207683_10002624 | 3300026121 | Bacteria | 15706 |
| 837 | Ga0207683_10003821 | 3300026121 | Bacteria | 13050 |
| 838 | Ga0207683_10004971 | 3300026121 | Bacteria | 11437 |
| 839 | Ga0207683_10014537 | 3300026121 | Bacteria | 6705 |
| 840 | Ga0207683_10250912 | 3300026121 | Bacteria | 1615 |
| 841 | Ga0207683_10270064 | 3300026121 | Bacteria | 1553 |
| 842 | Ga0207698_10001980 | 3300026142 | Bacteria | 12051 |
| 843 | Ga0207698_10014902 | 3300026142 | Bacteria | 5187 |
| 844 | Ga0209389_1000040 | 3300027296 | Bacteria | 124256 |
| 845 | Ga0209389_1000123 | 3300027296 | Bacteria | 70041 |
| 846 | Ga0209589_1000001 | 3300027357 | Bacteria | 794224 |
| 847 | Ga0209589_1000036 | 3300027357 | Bacteria | 131278 |
| 848 | Ga0209489_100001 | 3300027361 | Bacteria | 794224 |
| 849 | Ga0209489_100006 | 3300027361 | Bacteria | 475698 |
| 850 | Ga0209489_111662 | 3300027361 | Bacteria | 8752 |
| 851 | Ga0209700_100001 | 3300027363 | Bacteria | 794224 |
| 852 | Ga0209700_100005 | 3300027363 | Bacteria | 573969 |
| 853 | Ga0209999_1020773 | 3300027543 | Bacteria | 1206 |
| 854 | Ga0209983_1006861 | 3300027665 | Bacteria | 2336 |
| 855 | Ga0209588_1014733 | 3300027671 | Bacteria | 2398 |
| 856 | Ga0209974_10000502 | 3300027876 | Bacteria | 13050 |
| 857 | Ga0209974_10036492 | 3300027876 | Bacteria | 1632 |
| 858 | Ga0207428_10002104 | 3300027907 | Bacteria | 20069 |
| 859 | Ga0207428_10002830 | 3300027907 | Bacteria | 17218 |
| 860 | Ga0207428_10002977 | 3300027907 | Bacteria | 16750 |
| 861 | Ga0207428_10005357 | 3300027907 | Bacteria | 11969 |
| 862 | Ga0207428_10027000 | 3300027907 | Bacteria | 4783 |
| 863 | Ga0207428_10061970 | 3300027907 | Bacteria | 2958 |
| 864 | Ga0207428_10182071 | 3300027907 | Bacteria | 1587 |
| 865 | Ga0268266_10019214 | 3300028379 | Bacteria | 5819 |
| 866 | Ga0268266_10020054 | 3300028379 | Bacteria | 5698 |
| 867 | Ga0268266_10038195 | 3300028379 | Bacteria | 4088 |
| 868 | Ga0268266_10042402 | 3300028379 | Bacteria | 3886 |
| 869 | Ga0268266_10048955 | 3300028379 | Bacteria | 3623 |
| 870 | Ga0268266_10092365 | 3300028379 | Bacteria | 2655 |
| 871 | Ga0268266_10132847 | 3300028379 | Bacteria | 2227 |
| 872 | Ga0268265_10000817 | 3300028380 | Bacteria | 29538 |
| 873 | Ga0268265_10009900 | 3300028380 | Bacteria | 6441 |
| 874 | Ga0268265_10079471 | 3300028380 | Bacteria | 2583 |
| 875 | Ga0268265_10120271 | 3300028380 | Bacteria | 2162 |
| 876 | Ga0268264_10000065 | 3300028381 | Bacteria | 298403 |
| 877 | Ga0268264_10001227 | 3300028381 | Bacteria | 24655 |
| 878 | Ga0268264_10024308 | 3300028381 | Bacteria | 4947 |
| 879 | Ga0265337_1002708 | 3300028556 | Bacteria | 7954 |
| 880 | Ga0265326_10010670 | 3300028558 | Bacteria | 2723 |
| 881 | Ga0265319_1004129 | 3300028563 | Bacteria | 7301 |
| 882 | Ga0265334_10001756 | 3300028573 | Bacteria | 10354 |
| 883 | Ga0265334_10042944 | 3300028573 | Bacteria | 1761 |
| 884 | Ga0265318_10040378 | 3300028577 | Bacteria | 1776 |
| 885 | Ga0265323_10001892 | 3300028653 | Bacteria | 9875 |
| 886 | Ga0265336_10003392 | 3300028666 | Bacteria | 6258 |
| 887 | Ga0307517_10000008 | 3300028786 | Bacteria | 243202 |
| 888 | Ga0307515_10000950 | 3300028794 | Bacteria | 66308 |
| 889 | Ga0307515_10026041 | 3300028794 | Bacteria | 10090 |
| 890 | Ga0265338_10000092 | 3300028800 | Bacteria | 168538 |
| 891 | Ga0265338_10000321 | 3300028800 | Bacteria | 87046 |
| 892 | Ga0265324_10019180 | 3300029957 | Bacteria | 2465 |
| 893 | Ga0265330_10037973 | 3300031235 | Bacteria | 2141 |
| 894 | Ga0265325_10000675 | 3300031241 | Bacteria | 24875 |
| 895 | Ga0265325_10010821 | 3300031241 | Bacteria | 5262 |
| 896 | Ga0265325_10030264 | 3300031241 | Bacteria | 2904 |
| 897 | Ga0265325_10042198 | 3300031241 | Bacteria | 2386 |
| 898 | Ga0265325_10044311 | 3300031241 | Bacteria | 2317 |
| 899 | Ga0265329_10018732 | 3300031242 | Bacteria | 2361 |
| 900 | Ga0265340_10005245 | 3300031247 | Bacteria | 7193 |
| 901 | Ga0265340_10008853 | 3300031247 | Bacteria | 5422 |
| 902 | Ga0265339_10030325 | 3300031249 | Bacteria | 3062 |
| 903 | Ga0265331_10023016 | 3300031250 | Bacteria | 3171 |
| 904 | Ga0265331_10037975 | 3300031250 | Bacteria | 2356 |
| 905 | Ga0265331_10075329 | 3300031250 | Bacteria | 1574 |
| 906 | Ga0265316_10015085 | 3300031344 | Bacteria | 6771 |
| 907 | Ga0265316_10032664 | 3300031344 | Bacteria | 4246 |
| 908 | Ga0265316_10116788 | 3300031344 | Bacteria | 2017 |
| 909 | Ga0307513_10070981 | 3300031456 | Bacteria | 3637 |
| 910 | Ga0307408_100068810 | 3300031548 | Bacteria | 2608 |
| 911 | Ga0265313_10020638 | 3300031595 | Bacteria | 3629 |
| 912 | Ga0265313_10030488 | 3300031595 | Bacteria | 2776 |
| 913 | Ga0265313_10039966 | 3300031595 | Bacteria | 2322 |
| 914 | Ga0307508_10000018 | 3300031616 | Bacteria | 202701 |
| 915 | Ga0307508_10021377 | 3300031616 | Bacteria | 5883 |
| 916 | Ga0307508_10189556 | 3300031616 | Bacteria | 1658 |
| 917 | Ga0307508_10212892 | 3300031616 | Bacteria | 1533 |
| 918 | Ga0265314_10004715 | 3300031711 | Bacteria | 12517 |
| 919 | Ga0265314_10009137 | 3300031711 | Bacteria | 8412 |
| 920 | Ga0265314_10011261 | 3300031711 | Bacteria | 7398 |
| 921 | Ga0265314_10021648 | 3300031711 | Bacteria | 4937 |
| 922 | Ga0265342_10011538 | 3300031712 | Bacteria | 6039 |
| 923 | Ga0265342_10017129 | 3300031712 | Bacteria | 4719 |
| 924 | Ga0265342_10075603 | 3300031712 | Bacteria | 1954 |
| 925 | Ga0316576_10151946 | 3300031727 | Bacteria | 1745 |
| 926 | Ga0307516_10014561 | 3300031730 | Bacteria | 8313 |
| 927 | Ga0307516_10063808 | 3300031730 | Bacteria | 3565 |
| 928 | Ga0307516_10068079 | 3300031730 | Bacteria | 3429 |
| 929 | Ga0307405_10058956 | 3300031731 | Bacteria | 2418 |
| 930 | Ga0316577_10005660 | 3300031733 | Bacteria | 6558 |
| 931 | Ga0316577_10083912 | 3300031733 | Bacteria | 1782 |
| 932 | Ga0307410_10027386 | 3300031852 | Bacteria | 3603 |
| 933 | Ga0307406_10004966 | 3300031901 | Bacteria | 7246 |
| 934 | Ga0307406_10118811 | 3300031901 | Bacteria | 1834 |
| 935 | Ga0307412_10011920 | 3300031911 | Bacteria | 5048 |
| 936 | Ga0307412_10055365 | 3300031911 | Bacteria | 2638 |
| 937 | Ga0307409_100067274 | 3300031995 | Bacteria | 2829 |
| 938 | Ga0307409_100103111 | 3300031995 | Bacteria | 2372 |
| 939 | Ga0307409_100159904 | 3300031995 | Bacteria | 1968 |
| 940 | Ga0307416_100040802 | 3300032002 | Bacteria | 3610 |
| 941 | Ga0307416_100449178 | 3300032002 | Bacteria | 1341 |
| 942 | Ga0307414_10014216 | 3300032004 | Bacteria | 4763 |
| 943 | Ga0307411_10015181 | 3300032005 | Bacteria | 4317 |
| 944 | Ga0316593_10032743 | 3300032168 | Bacteria | 1699 |
| 945 | Ga0307510_10008141 | 3300033180 | Bacteria | 12485 |
| 946 | Ga0307510_10026470 | 3300033180 | Bacteria | 6665 |
| 947 | Ga0315911_1000006 | 3300033442 | Bacteria | 414563 |
| 948 | Ga0373930_0000266 | 3300034816 | Bacteria | 6666 |
| 949 | Ga0373930_0001442 | 3300034816 | Bacteria | 3537 |
| 950 | Ga0373948_0000471 | 3300034817 | Bacteria | 5018 |
| 951 | Ga0373950_0000324 | 3300034818 | Bacteria | 5986 |
| 952 | Ga0373958_0000451 | 3300034819 | Bacteria | 5021 |
| 953 | Ga0373959_0000553 | 3300034820 | Bacteria | 6642 |
| 954 | Ga0373938_0000348 | 3300034957 | Bacteria | 7337 |
| 955 | Ga0373938_0006862 | 3300034957 | Bacteria | 1984 |
| 956 | Ga0373926_0002868 | 3300035083 | Bacteria | 5523 |
| 957 | Ga0373928_0001853 | 3300035084 | Bacteria | 4124 |
| 958 | Ga0373929_0000456 | 3300035085 | Bacteria | 7768 |
| 959 | Ga0373929_0004977 | 3300035085 | Bacteria | 2383 |
| 960 | Ga0373940_0001082 | 3300035088 | Bacteria | 4724 |
| 961 | Ga0373940_0003271 | 3300035088 | Bacteria | 3283 |
| 962 | Ga0373944_0017321 | 3300035089 | Bacteria | 2044 |
| 963 | Ga0373949_0002643 | 3300035090 | Bacteria | 4522 |
| 964 | Ga0373949_0004203 | 3300035090 | Bacteria | 3325 |
| 965 | Ga0373949_0005479 | 3300035090 | Bacteria | 2829 |
| 966 | Ga0373951_0001125 | 3300035091 | Bacteria | 7115 |
| 967 | Ga0373951_0001619 | 3300035091 | Bacteria | 5914 |
| 968 | Ga0373951_0023787 | 3300035091 | Bacteria | 1416 |
| 969 | Ga0373952_0000133 | 3300035092 | Bacteria | 10703 |
| 970 | Ga0373923_0029874 | 3300035111 | Bacteria | 2188 |
| 971 | Ga0373923_0031183 | 3300035111 | Bacteria | 2147 |
| 972 | Ga0373923_0047617 | 3300035111 | Bacteria | 1787 |
| 973 | Ga0373932_0000703 | 3300035112 | Bacteria | 10116 |
| 974 | Ga0373932_0001964 | 3300035112 | Bacteria | 5434 |
| 975 | Ga0373932_0056793 | 3300035112 | Bacteria | 1178 |
| 976 | Ga0373936_0007505 | 3300035113 | Bacteria | 4101 |
| 977 | Ga0373936_0028149 | 3300035113 | Bacteria | 2208 |
| 978 | Ga0373936_0028822 | 3300035113 | Bacteria | 2184 |
| 979 | Ga0373936_0048196 | 3300035113 | Bacteria | 1719 |
| 980 | Ga0373936_0050055 | 3300035113 | Bacteria | 1689 |
| 981 | Ga0373939_0000343 | 3300035114 | Bacteria | 11867 |
| 982 | Ga0373939_0005408 | 3300035114 | Bacteria | 3041 |
| 983 | Ga0373941_0001154 | 3300035115 | Bacteria | 5508 |
| 984 | Ga0373941_0002185 | 3300035115 | Bacteria | 4269 |
| 985 | Ga0373941_0003006 | 3300035115 | Bacteria | 3776 |
| 986 | Ga0373945_0004512 | 3300035116 | Bacteria | 4424 |
| 987 | Ga0373953_0012229 | 3300035117 | Bacteria | 3035 |
| 988 | Ga0373954_0002285 | 3300035118 | Bacteria | 7983 |
| 989 | Ga0373954_0003393 | 3300035118 | Bacteria | 6745 |
| 990 | Ga0373954_0005654 | 3300035118 | Bacteria | 5418 |
| 991 | Ga0373954_0022517 | 3300035118 | Bacteria | 2859 |
| 992 | Ga0373956_0002225 | 3300035119 | Bacteria | 7993 |
| 993 | Ga0373956_0021669 | 3300035119 | Bacteria | 2742 |
| 994 | Ga0373956_0072905 | 3300035119 | Bacteria | 1568 |
| 995 | Ga0373957_0002536 | 3300035120 | Bacteria | 5231 |
| 996 | Ga0373957_0009639 | 3300035120 | Bacteria | 3165 |
| 997 | Ga0373957_0010237 | 3300035120 | Bacteria | 3093 |
| 998 | Ga0373960_0002057 | 3300035121 | Bacteria | 4526 |
| 999 | Ga0373960_0002646 | 3300035121 | Bacteria | 4050 |
| 1000 | Ga0373943_0002714 | 3300035170 | Bacteria | 8040 |
| 1001 | Ga0373943_0005039 | 3300035170 | Bacteria | 5958 |
| 1002 | Ga0373943_0008492 | 3300035170 | Bacteria | 4606 |
| 1003 | Ga0373943_0016526 | 3300035170 | Bacteria | 3366 |
| 1004 | Ga0373946_0041554 | 3300035171 | Bacteria | 1886 |
| 1005 | Ga0373955_0001765 | 3300035172 | Bacteria | 9276 |
| 1006 | Ga0373955_0027293 | 3300035172 | Bacteria | 2949 |
| 1007 | Ga0373955_0027657 | 3300035172 | Bacteria | 2934 |
| 1008 | Ga0373955_0069280 | 3300035172 | Bacteria | 1967 |
| 1009 | Ga0373942_0001912 | 3300035207 | Bacteria | 5225 |
| 1010 | Ga0373942_0005068 | 3300035207 | Bacteria | 3056 |
| 1011 | Ga0373961_0004534 | 3300035241 | Bacteria | 3357 |
| 1012 | Ga0373961_0026679 | 3300035241 | Bacteria | 1580 |
| 1013 | Ga0373962_0000253 | 3300035242 | Bacteria | 11386 |
| 1014 | Ga0373924_0005148 | 3300035410 | Bacteria | 4615 |
| 1015 | Ga0373924_0007383 | 3300035410 | Bacteria | 3967 |
| 1016 | Ga0373931_0000714 | 3300035691 | Bacteria | 13748 |
| 1017 | Ga0373931_0001610 | 3300035691 | Bacteria | 9775 |
| 1018 | Ga0373931_0025062 | 3300035691 | Bacteria | 3028 |
| 1019 | Ga0373931_0032400 | 3300035691 | Bacteria | 2704 |
| 1020 | Ga0373935_0000382 | 3300035692 | Bacteria | 22745 |
| 1021 | Ga0373935_0004984 | 3300035692 | Bacteria | 7813 |
| 1022 | Ga0373935_0060881 | 3300035692 | Bacteria | 2416 |
| 1023 | Ga0373935_0110312 | 3300035692 | Bacteria | 1825 |
| 1024 | Ga0373935_0113950 | 3300035692 | Bacteria | 1798 |
| 1025 | Ga0373935_0189356 | 3300035692 | Bacteria | 1416 |
| 1026 | Ga0373927_0002885 | 3300035695 | Bacteria | 12521 |
| 1027 | Ga0373927_0003772 | 3300035695 | Bacteria | 10756 |
| 1028 | Ga0373927_0008081 | 3300035695 | Bacteria | 7103 |
| 1029 | Ga0373927_0009027 | 3300035695 | Bacteria | 6696 |
| 1030 | Ga0373927_0009357 | 3300035695 | Bacteria | 6572 |
| 1031 | Ga0373927_0035894 | 3300035695 | Bacteria | 3225 |
| 1032 | Ga0373933_0000110 | 3300035724 | Bacteria | 52519 |
| 1033 | Ga0373933_0001224 | 3300035724 | Bacteria | 15196 |
| 1034 | Ga0373933_0002094 | 3300035724 | Bacteria | 11451 |
| 1035 | Ga0373933_0144907 | 3300035724 | Bacteria | 1501 |
| 1036 | Ga0373933_0187528 | 3300035724 | Bacteria | 1320 |
| 1037 | Ga0373947_0001850 | 3300035725 | Bacteria | 12909 |
| 1038 | Ga0373947_0005699 | 3300035725 | Bacteria | 7261 |
| 1039 | Ga0373947_0015499 | 3300035725 | Bacteria | 4378 |
| 1040 | Ga0373947_0034544 | 3300035725 | Bacteria | 2991 |
| 1041 | Ga0373947_0036519 | 3300035725 | Bacteria | 2914 |
| 1042 | Ga0373947_0080640 | 3300035725 | Bacteria | 2013 |
| 1043 | Ga0373947_0099267 | 3300035725 | Bacteria | 1827 |
| 1044 | Ga0373947_0119783 | 3300035725 | Bacteria | 1671 |
| 1045 | Ga0373937_0000849 | 3300036401 | Bacteria | 26229 |
| 1046 | Ga0373937_0005174 | 3300036401 | Bacteria | 11127 |
| 1047 | Ga0373937_0027190 | 3300036401 | Bacteria | 5171 |
| 1048 | Ga0373937_0030627 | 3300036401 | Bacteria | 4872 |
| 1049 | Ga0373937_0040820 | 3300036401 | Bacteria | 4230 |
| 1050 | Ga0373937_0194250 | 3300036401 | Bacteria | 1907 |
| 1051 | Ga0316582_0024005 | 3300036647 | Bacteria | 3642 |
| 1052 | Ga0316584_0194540 | 3300036712 | Bacteria | 1498 |
| 1053 | Ga0373925_0007329 | 3300037068 | Bacteria | 8054 |
| 1054 | Ga0373925_0009418 | 3300037068 | Bacteria | 7112 |
| 1055 | Ga0373925_0013981 | 3300037068 | Bacteria | 5810 |
| 1056 | Ga0373925_0020372 | 3300037068 | Bacteria | 4828 |
| 1057 | Ga0373925_0022711 | 3300037068 | Bacteria | 4577 |
| 1058 | Ga0373925_0029279 | 3300037068 | Bacteria | 4039 |
| 1059 | Ga0373925_0030911 | 3300037068 | Bacteria | 3933 |
| 1060 | Ga0373925_0037118 | 3300037068 | Bacteria | 3596 |
| 1061 | Ga0373925_0065256 | 3300037068 | Bacteria | 2742 |
| 1062 | Ga0395899_0008367 | 3300037312 | Bacteria | 7963 |
| 1063 | Ga0395899_0124691 | 3300037312 | Bacteria | 1842 |
| 1064 | Ga0395899_0124850 | 3300037312 | Bacteria | 1841 |
| 1065 | Ga0395900_0000940 | 3300037418 | Bacteria | 38072 |
| 1066 | Ga0395900_0018516 | 3300037418 | Bacteria | 7103 |
| 1067 | Ga0395900_0042832 | 3300037418 | Bacteria | 4664 |
| 1068 | Ga0395898_0006219 | 3300037466 | Bacteria | 12789 |
| 1069 | Ga0395898_0007511 | 3300037466 | Bacteria | 11584 |
| 1070 | Ga0395898_0048176 | 3300037466 | Bacteria | 4180 |
| 1071 | Ga0395898_0066370 | 3300037466 | Bacteria | 3496 |
| 1072 | Ga0395898_0116297 | 3300037466 | Bacteria | 2562 |
| 1073 | Ga0395898_0441700 | 3300037466 | Bacteria | 1239 |
| 1074 | Ga0395905_0001756 | 3300037471 | Bacteria | 25281 |
| 1075 | Ga0395905_0004739 | 3300037471 | Bacteria | 14053 |
| 1076 | Ga0395905_0087304 | 3300037471 | Bacteria | 2924 |
| 1077 | Ga0436364_0351617 | 3300037853 | Bacteria | 5329 |
| 1078 | Ga0395901_0011181 | 3300038443 | Bacteria | 9096 |
| 1079 | Ga0395901_0020828 | 3300038443 | Bacteria | 6713 |
| 1080 | Ga0395901_0080714 | 3300038443 | Bacteria | 3397 |
| 1081 | Ga0395901_0364460 | 3300038443 | Bacteria | 1489 |
| 1082 | Ga0400485_12741 | 3300038735 | Bacteria | 28195 |
| 1083 | Ga0400486_20716 | 3300038742 | Bacteria | 2309 |
| 1084 | Ga0400489_28284 | 3300039093 | Bacteria | 3122 |
| 1085 | Ga0400487_27495 | 3300039110 | Bacteria | 2340 |
| 1086 | Ga0436365_0225834 | 3300039437 | Bacteria | 3126 |
| 1087 | Ga0436365_0684140 | 3300039437 | Bacteria | 1123 |
| 1088 | Ga0436365_0771718 | 3300039437 | Bacteria | 1518 |
| 1089 | Ga0436365_1077710 | 3300039437 | Bacteria | 12347 |
| 1090 | Ga0436365_1332159 | 3300039437 | Bacteria | 25414 |
| 1091 | Ga0436363_1328249 | 3300039450 | Bacteria | 3168 |
| 1092 | Ga0436362_0123159 | 3300039453 | Bacteria | 1181 |
| 1093 | Ga0436362_0716278 | 3300039453 | Bacteria | 4751 |
| 1094 | Ga0439448_0037983 | 3300042005 | Bacteria | 1549 |
| 1095 | Ga0439435_0041066 | 3300042436 | Bacteria | 1295 |
| 1096 | Ga0451577_0013112 | 3300042876 | Bacteria | 7769 |
| 1097 | Ga0451577_0036995 | 3300042876 | Bacteria | 4394 |
| 1098 | Ga0466972_0001455 | 3300044658 | Bacteria | 11506 |
| 1099 | Ga0466972_0004207 | 3300044658 | Bacteria | 7191 |
| 1100 | Ga0453683_0016653 | 3300044673 | Bacteria | 4739 |
| 1101 | Ga0466965_0050746 | 3300044683 | Bacteria | 2057 |
| 1102 | Ga0466966_0000065 | 3300044684 | Bacteria | 71994 |
| 1103 | Ga0466961_0000154 | 3300044693 | Bacteria | 46518 |
| 1104 | Ga0466963_0030858 | 3300044694 | Bacteria | 3461 |
| 1105 | Ga0466964_0026404 | 3300044706 | Bacteria | 2273 |
| 1106 | Ga0466968_0034723 | 3300044735 | Bacteria | 2106 |
| 1107 | Ga0466960_0010379 | 3300044901 | Bacteria | 3866 |
| 1108 | Ga0466960_0047808 | 3300044901 | Bacteria | 2053 |
| 1109 | Ga0466959_0004864 | 3300045049 | Bacteria | 9087 |
| 1110 | Ga0466959_0028283 | 3300045049 | Bacteria | 4157 |
| 1111 | Ga0451576_0004860 | 3300045051 | Bacteria | 17216 |
| 1112 | Ga0451576_0007753 | 3300045051 | Bacteria | 12749 |
| 1113 | Ga0466967_0001722 | 3300045976 | Bacteria | 13037 |
| 1114 | Ga0466967_0007434 | 3300045976 | Bacteria | 7901 |
| 1115 | Ga0466967_0062148 | 3300045976 | Bacteria | 3315 |
| 1116 | Ga0466967_0062586 | 3300045976 | Bacteria | 3304 |
| 1117 | Ga0495617_051367 | 3300046452 | Bacteria | 1370 |
| 1118 | Ga0495592_0003334 | 3300046454 | Bacteria | 11496 |
| 1119 | Ga0495592_0008695 | 3300046454 | Bacteria | 7623 |
| 1120 | Ga0495592_0026610 | 3300046454 | Bacteria | 4384 |
| 1121 | Ga0495592_0047700 | 3300046454 | Bacteria | 3189 |
| 1122 | Ga0495592_0048320 | 3300046454 | Bacteria | 3165 |
| 1123 | Ga0495592_0132609 | 3300046454 | Bacteria | 1741 |
| 1124 | Ga0495603_0000191 | 3300046455 | Bacteria | 32052 |
| 1125 | Ga0495603_0007025 | 3300046455 | Bacteria | 6757 |
| 1126 | Ga0495603_0012838 | 3300046455 | Bacteria | 5065 |
| 1127 | Ga0495603_0044614 | 3300046455 | Bacteria | 2645 |
| 1128 | Ga0495629_0000500 | 3300046459 | Bacteria | 32861 |
| 1129 | Ga0495629_0001281 | 3300046459 | Bacteria | 19758 |
| 1130 | Ga0495629_0002009 | 3300046459 | Bacteria | 15810 |
| 1131 | Ga0495629_0015849 | 3300046459 | Bacteria | 5414 |
| 1132 | Ga0495629_0065989 | 3300046459 | Bacteria | 2526 |
| 1133 | Ga0495629_0115401 | 3300046459 | Bacteria | 1871 |
| 1134 | Ga0495629_0141597 | 3300046459 | Bacteria | 1673 |
| 1135 | Ga0495629_0148235 | 3300046459 | Bacteria | 1631 |
| 1136 | Ga0495638_0017268 | 3300046460 | Bacteria | 4816 |
| 1137 | Ga0495638_0032724 | 3300046460 | Bacteria | 3330 |
| 1138 | Ga0495638_0125884 | 3300046460 | Bacteria | 1510 |
| 1139 | Ga0495641_0001436 | 3300046461 | Bacteria | 20225 |
| 1140 | Ga0495641_0078328 | 3300046461 | Bacteria | 1481 |
| 1141 | Ga0495641_0106583 | 3300046461 | Bacteria | 1250 |
| 1142 | Ga0495651_0000821 | 3300046462 | Bacteria | 24117 |
| 1143 | Ga0495651_0009095 | 3300046462 | Bacteria | 7624 |
| 1144 | Ga0495651_0036961 | 3300046462 | Bacteria | 3802 |
| 1145 | Ga0495651_0062573 | 3300046462 | Bacteria | 2847 |
| 1146 | Ga0495653_0002307 | 3300046463 | Bacteria | 15112 |
| 1147 | Ga0495653_0004970 | 3300046463 | Bacteria | 10793 |
| 1148 | Ga0495653_0010292 | 3300046463 | Bacteria | 7654 |
| 1149 | Ga0495653_0041256 | 3300046463 | Bacteria | 3603 |
| 1150 | Ga0495653_0053810 | 3300046463 | Bacteria | 3078 |
| 1151 | Ga0495653_0079954 | 3300046463 | Bacteria | 2420 |
| 1152 | Ga0495580_0004694 | 3300046472 | Bacteria | 11461 |
| 1153 | Ga0495580_0009608 | 3300046472 | Bacteria | 7596 |
| 1154 | Ga0495580_0040570 | 3300046472 | Bacteria | 3324 |
| 1155 | Ga0495582_0000251 | 3300046473 | Bacteria | 29816 |
| 1156 | Ga0495582_0009496 | 3300046473 | Bacteria | 5359 |
| 1157 | Ga0495582_0012182 | 3300046473 | Bacteria | 4737 |
| 1158 | Ga0495582_0045732 | 3300046473 | Bacteria | 2411 |
| 1159 | Ga0495582_0086417 | 3300046473 | Bacteria | 1745 |
| 1160 | Ga0495639_0000077 | 3300046475 | Bacteria | 46394 |
| 1161 | Ga0495639_0006383 | 3300046475 | Bacteria | 5069 |
| 1162 | Ga0495639_0032533 | 3300046475 | Bacteria | 2326 |
| 1163 | Ga0495662_0000826 | 3300046476 | Bacteria | 15060 |
| 1164 | Ga0495662_0014265 | 3300046476 | Bacteria | 3864 |
| 1165 | Ga0495664_0009436 | 3300046477 | Bacteria | 5459 |
| 1166 | Ga0495664_0024516 | 3300046477 | Bacteria | 3507 |
| 1167 | Ga0495664_0034171 | 3300046477 | Bacteria | 2990 |
| 1168 | Ga0495664_0111696 | 3300046477 | Bacteria | 1650 |
| 1169 | Ga0495584_0073949 | 3300046491 | Bacteria | 1713 |
| 1170 | Ga0495585_0094237 | 3300046492 | Bacteria | 1609 |
| 1171 | Ga0495585_0139672 | 3300046492 | Bacteria | 1269 |
| 1172 | Ga0495594_0000648 | 3300046499 | Bacteria | 17955 |
| 1173 | Ga0495594_0046269 | 3300046499 | Bacteria | 2389 |
| 1174 | Ga0495596_0063043 | 3300046500 | Bacteria | 1442 |
| 1175 | Ga0495583_0003990 | 3300046506 | Bacteria | 10891 |
| 1176 | Ga0495606_0008377 | 3300046507 | Bacteria | 8999 |
| 1177 | Ga0495606_0034264 | 3300046507 | Bacteria | 3487 |
| 1178 | Ga0495606_0085500 | 3300046507 | Bacteria | 1951 |
| 1179 | Ga0495608_0002352 | 3300046511 | Bacteria | 13621 |
| 1180 | Ga0495608_0004206 | 3300046511 | Bacteria | 10314 |
| 1181 | Ga0495610_0084361 | 3300046512 | Bacteria | 1452 |
| 1182 | Ga0495618_0004363 | 3300046514 | Bacteria | 8701 |
| 1183 | Ga0495618_0011914 | 3300046514 | Bacteria | 5277 |
| 1184 | Ga0495618_0050692 | 3300046514 | Bacteria | 2622 |
| 1185 | Ga0495620_0100369 | 3300046515 | Bacteria | 1154 |
| 1186 | Ga0495628_0007652 | 3300046516 | Bacteria | 9339 |
| 1187 | Ga0495628_0012115 | 3300046516 | Bacteria | 7269 |
| 1188 | Ga0495628_0015917 | 3300046516 | Bacteria | 6275 |
| 1189 | Ga0495628_0042818 | 3300046516 | Bacteria | 3609 |
| 1190 | Ga0495628_0085728 | 3300046516 | Bacteria | 2443 |
| 1191 | Ga0495628_0125348 | 3300046516 | Bacteria | 1968 |
| 1192 | Ga0495630_0001279 | 3300046517 | Bacteria | 17334 |
| 1193 | Ga0495630_0040014 | 3300046517 | Bacteria | 3503 |
| 1194 | Ga0495643_0055480 | 3300046522 | Bacteria | 2118 |
| 1195 | Ga0495666_0008087 | 3300046526 | Bacteria | 5272 |
| 1196 | Ga0495666_0027327 | 3300046526 | Bacteria | 2809 |
| 1197 | Ga0495666_0029598 | 3300046526 | Bacteria | 2694 |
| 1198 | Ga0495652_0009266 | 3300046529 | Bacteria | 8947 |
| 1199 | Ga0495652_0023802 | 3300046529 | Bacteria | 5426 |
| 1200 | Ga0495652_0069642 | 3300046529 | Bacteria | 2944 |
| 1201 | Ga0495652_0084854 | 3300046529 | Bacteria | 2603 |
| 1202 | Ga0495665_0005139 | 3300046531 | Bacteria | 7058 |
| 1203 | Ga0495640_0003320 | 3300046533 | Bacteria | 12954 |
| 1204 | Ga0495640_0004102 | 3300046533 | Bacteria | 11651 |
| 1205 | Ga0495640_0048507 | 3300046533 | Bacteria | 2934 |
| 1206 | Ga0495640_0055553 | 3300046533 | Bacteria | 2708 |
| 1207 | Ga0495640_0157445 | 3300046533 | Bacteria | 1457 |
| 1208 | Ga0495586_0002128 | 3300046535 | Bacteria | 10768 |
| 1209 | Ga0495587_0003095 | 3300046536 | Bacteria | 11115 |
| 1210 | Ga0495587_0011112 | 3300046536 | Bacteria | 5711 |
| 1211 | Ga0495587_0011231 | 3300046536 | Bacteria | 5677 |
| 1212 | Ga0495587_0013122 | 3300046536 | Bacteria | 5209 |
| 1213 | Ga0495621_0002390 | 3300046539 | Bacteria | 5053 |
| 1214 | Ga0495621_0015571 | 3300046539 | Bacteria | 2427 |
| 1215 | Ga0495645_0003434 | 3300046543 | Bacteria | 10742 |
| 1216 | Ga0495645_0010291 | 3300046543 | Bacteria | 6556 |
| 1217 | Ga0495645_0020403 | 3300046543 | Bacteria | 4779 |
| 1218 | Ga0495645_0063652 | 3300046543 | Bacteria | 2670 |
| 1219 | Ga0495633_0010291 | 3300046558 | Bacteria | 5114 |
| 1220 | Ga0495667_0001067 | 3300046559 | Bacteria | 17817 |
| 1221 | Ga0495667_0002892 | 3300046559 | Bacteria | 11514 |
| 1222 | Ga0495667_0011827 | 3300046559 | Bacteria | 5912 |
| 1223 | Ga0495667_0040012 | 3300046559 | Bacteria | 3114 |
| 1224 | Ga0495667_0050531 | 3300046559 | Bacteria | 2744 |
| 1225 | Ga0495656_0010707 | 3300046615 | Bacteria | 3341 |
| 1226 | Ga0495668_0014263 | 3300046616 | Bacteria | 4664 |
| 1227 | Ga0495668_0081063 | 3300046616 | Bacteria | 1781 |
| 1228 | Ga0495668_0130456 | 3300046616 | Bacteria | 1376 |
| 1229 | Ga0495634_0001976 | 3300046642 | Bacteria | 17475 |
| 1230 | Ga0495634_0015373 | 3300046642 | Bacteria | 5502 |
| 1231 | Ga0495634_0085415 | 3300046642 | Bacteria | 2056 |
| 1232 | Ga0495634_0127946 | 3300046642 | Bacteria | 1621 |
| 1233 | Ga0495625_0009866 | 3300046660 | Bacteria | 7942 |
| 1234 | Ga0495625_0243030 | 3300046660 | Bacteria | 1171 |
| 1235 | Ga0495635_0002471 | 3300046663 | Bacteria | 12619 |
| 1236 | Ga0495635_0004431 | 3300046663 | Bacteria | 9729 |
| 1237 | Ga0495635_0019246 | 3300046663 | Bacteria | 4761 |
| 1238 | Ga0495635_0021691 | 3300046663 | Bacteria | 4476 |
| 1239 | Ga0495635_0102187 | 3300046663 | Bacteria | 1959 |
| 1240 | Ga0495659_0002989 | 3300046664 | Bacteria | 5423 |
| 1241 | Ga0495588_0004422 | 3300046674 | Bacteria | 6213 |
| 1242 | Ga0495588_0004700 | 3300046674 | Bacteria | 6032 |
| 1243 | Ga0495588_0036562 | 3300046674 | Bacteria | 2492 |
| 1244 | Ga0495657_0007463 | 3300046675 | Bacteria | 8451 |
| 1245 | Ga0495657_0007949 | 3300046675 | Bacteria | 8132 |
| 1246 | Ga0495657_0025281 | 3300046675 | Bacteria | 4220 |
| 1247 | Ga0495657_0028310 | 3300046675 | Bacteria | 3943 |
| 1248 | Ga0495657_0028576 | 3300046675 | Bacteria | 3920 |
| 1249 | Ga0495599_0005682 | 3300046678 | Bacteria | 7482 |
| 1250 | Ga0495599_0006005 | 3300046678 | Bacteria | 7306 |
| 1251 | Ga0495599_0006827 | 3300046678 | Bacteria | 6900 |
| 1252 | Ga0495599_0028649 | 3300046678 | Bacteria | 3489 |
| 1253 | Ga0495623_0004291 | 3300046679 | Bacteria | 9385 |
| 1254 | Ga0495623_0006077 | 3300046679 | Bacteria | 7851 |
| 1255 | Ga0495623_0011175 | 3300046679 | Bacteria | 5808 |
| 1256 | Ga0495623_0107574 | 3300046679 | Bacteria | 1693 |
| 1257 | Ga0495646_0002070 | 3300046680 | Bacteria | 12167 |
| 1258 | Ga0495646_0006456 | 3300046680 | Bacteria | 7438 |
| 1259 | Ga0495646_0020774 | 3300046680 | Bacteria | 4152 |
| 1260 | Ga0495646_0087876 | 3300046680 | Bacteria | 1801 |
| 1261 | Ga0495647_0053033 | 3300046681 | Bacteria | 1580 |
| 1262 | Ga0495658_0001175 | 3300046683 | Bacteria | 13809 |
| 1263 | Ga0495658_0001615 | 3300046683 | Bacteria | 11744 |
| 1264 | Ga0495669_0006510 | 3300046684 | Bacteria | 4882 |
| 1265 | Ga0495613_0011644 | 3300046689 | Bacteria | 6538 |
| 1266 | Ga0495613_0012697 | 3300046689 | Bacteria | 6263 |
| 1267 | Ga0495613_0022371 | 3300046689 | Bacteria | 4711 |
| 1268 | Ga0495613_0170594 | 3300046689 | Bacteria | 1544 |
| 1269 | Ga0495624_0002021 | 3300046690 | Bacteria | 15445 |
| 1270 | Ga0495624_0062978 | 3300046690 | Bacteria | 2319 |
| 1271 | Ga0495600_0001546 | 3300046809 | Bacteria | 12799 |
| 1272 | Ga0495600_0004625 | 3300046809 | Bacteria | 8248 |
| 1273 | Ga0495600_0037714 | 3300046809 | Bacteria | 3143 |
| 1274 | Ga0495600_0039665 | 3300046809 | Bacteria | 3066 |
| 1275 | Ga0495581_0000503 | 3300047315 | Bacteria | 19983 |
| 1276 | Ga0495581_0033250 | 3300047315 | Bacteria | 2985 |
| 1277 | Ga0495581_0034285 | 3300047315 | Bacteria | 2937 |
| 1278 | Ga0495581_0061937 | 3300047315 | Bacteria | 2162 |
| 1279 | Ga0495604_0003694 | 3300047317 | Bacteria | 12194 |
| 1280 | Ga0495604_0011558 | 3300047317 | Bacteria | 7015 |
| 1281 | Ga0495604_0018158 | 3300047317 | Bacteria | 5631 |
| 1282 | Ga0495604_0023789 | 3300047317 | Bacteria | 4889 |
| 1283 | Ga0495604_0027799 | 3300047317 | Bacteria | 4498 |
| 1284 | Ga0495604_0094279 | 3300047317 | Bacteria | 2213 |
| 1285 | Ga0495674_0001342 | 3300047319 | Bacteria | 23999 |
| 1286 | Ga0495674_0026245 | 3300047319 | Bacteria | 5332 |
| 1287 | Ga0495674_0032084 | 3300047319 | Bacteria | 4767 |
| 1288 | Ga0495674_0044803 | 3300047319 | Bacteria | 3931 |
| 1289 | Ga0495674_0052198 | 3300047319 | Bacteria | 3599 |
| 1290 | Ga0495674_0117877 | 3300047319 | Bacteria | 2245 |
| 1291 | Ga0495672_0032635 | 3300047320 | Bacteria | 3236 |
| 1292 | Ga0495676_0021687 | 3300047321 | Bacteria | 5605 |
| 1293 | Ga0495676_0050478 | 3300047321 | Bacteria | 3336 |
| 1294 | Ga0495676_0142177 | 3300047321 | Bacteria | 1718 |
| 1295 | Ga0495680_0008204 | 3300047322 | Bacteria | 9519 |
| 1296 | Ga0495680_0012767 | 3300047322 | Bacteria | 7367 |
| 1297 | Ga0495680_0018195 | 3300047322 | Bacteria | 5974 |
| 1298 | Ga0495680_0022767 | 3300047322 | Bacteria | 5217 |
| 1299 | Ga0495680_0036916 | 3300047322 | Bacteria | 3918 |
| 1300 | Ga0495687_012474 | 3300047443 | Bacteria | 4490 |
| 1301 | Ga0495675_0001338 | 3300047444 | Bacteria | 14916 |
| 1302 | Ga0495675_0002401 | 3300047444 | Bacteria | 11186 |
| 1303 | Ga0495675_0004135 | 3300047444 | Bacteria | 8786 |
| 1304 | Ga0495675_0012731 | 3300047444 | Bacteria | 5297 |
| 1305 | Ga0495675_0039422 | 3300047444 | Bacteria | 3008 |
| 1306 | Ga0495673_0057791 | 3300047469 | Bacteria | 1674 |
| 1307 | Ga0495684_0002991 | 3300047471 | Bacteria | 13304 |
| 1308 | Ga0495684_0006000 | 3300047471 | Bacteria | 9439 |
| 1309 | Ga0495684_0050791 | 3300047471 | Bacteria | 3165 |
| 1310 | Ga0495684_0088193 | 3300047471 | Bacteria | 2351 |
| 1311 | Ga0495686_0005497 | 3300047472 | Bacteria | 9970 |
| 1312 | Ga0495593_0000192 | 3300047673 | Bacteria | 32140 |
| 1313 | Ga0495593_0001200 | 3300047673 | Bacteria | 15172 |
| 1314 | Ga0495593_0007939 | 3300047673 | Bacteria | 6183 |
| 1315 | Ga0495593_0009818 | 3300047673 | Bacteria | 5555 |
| 1316 | Ga0495593_0027391 | 3300047673 | Bacteria | 3138 |
| 1317 | Ga0495602_0002373 | 3300048088 | Bacteria | 19095 |
| 1318 | Ga0495602_0002392 | 3300048088 | Bacteria | 19051 |
| 1319 | Ga0495602_0007064 | 3300048088 | Bacteria | 11787 |
| 1320 | Ga0495602_0017778 | 3300048088 | Bacteria | 7118 |
| 1321 | Ga0495614_0062655 | 3300048089 | Bacteria | 1598 |
| 1322 | Ga0496100_0003962 | 3300048903 | Bacteria | 7781 |
| 1323 | Ga0496100_0004161 | 3300048903 | Bacteria | 7628 |
| 1324 | Ga0496100_0005504 | 3300048903 | Bacteria | 6830 |
| 1325 | Ga0496100_0023159 | 3300048903 | Bacteria | 3768 |
| 1326 | Ga0496100_0059662 | 3300048903 | Bacteria | 2508 |
| 1327 | Ga0496101_0001185 | 3300048904 | Bacteria | 15593 |
| 1328 | Ga0496101_0014484 | 3300048904 | Bacteria | 5301 |
| 1329 | Ga0496101_0052455 | 3300048904 | Bacteria | 2941 |
| 1330 | Ga0496101_0067099 | 3300048904 | Bacteria | 2618 |
| 1331 | Ga0496102_0001427 | 3300048905 | Bacteria | 21201 |
| 1332 | Ga0496102_0002571 | 3300048905 | Bacteria | 15468 |
| 1333 | Ga0496102_0010740 | 3300048905 | Bacteria | 7887 |
| 1334 | Ga0496102_0018426 | 3300048905 | Bacteria | 6136 |
| 1335 | Ga0496102_0021189 | 3300048905 | Bacteria | 5747 |
| 1336 | Ga0496102_0033644 | 3300048905 | Bacteria | 4607 |
| 1337 | Ga0496102_0053452 | 3300048905 | Bacteria | 3681 |
| 1338 | Ga0496103_0001145 | 3300048906 | Bacteria | 18320 |
| 1339 | Ga0496103_0011657 | 3300048906 | Bacteria | 5214 |
| 1340 | Ga0496103_0012446 | 3300048906 | Bacteria | 5046 |
| 1341 | Ga0496103_0028524 | 3300048906 | Bacteria | 3388 |
| 1342 | Ga0496103_0068689 | 3300048906 | Bacteria | 2214 |
| 1343 | Ga0496104_0000800 | 3300048907 | Bacteria | 27054 |
| 1344 | Ga0496104_0001608 | 3300048907 | Bacteria | 19461 |
| 1345 | Ga0496104_0004653 | 3300048907 | Bacteria | 11941 |
| 1346 | Ga0496104_0024050 | 3300048907 | Bacteria | 5605 |
| 1347 | Ga0496104_0034040 | 3300048907 | Bacteria | 4748 |
| 1348 | Ga0496104_0040661 | 3300048907 | Bacteria | 4359 |
| 1349 | Ga0496104_0080146 | 3300048907 | Bacteria | 3113 |
| 1350 | Ga0496105_0013595 | 3300048908 | Bacteria | 6464 |
| 1351 | Ga0496105_0014766 | 3300048908 | Bacteria | 6217 |
| 1352 | Ga0496105_0019467 | 3300048908 | Bacteria | 5474 |
| 1353 | Ga0496105_0061032 | 3300048908 | Bacteria | 3110 |
| 1354 | Ga0496105_0062915 | 3300048908 | Bacteria | 3062 |
| 1355 | Ga0496106_0000644 | 3300048909 | Bacteria | 24997 |
| 1356 | Ga0496106_0004195 | 3300048909 | Bacteria | 10741 |
| 1357 | Ga0496106_0015891 | 3300048909 | Bacteria | 5568 |
| 1358 | Ga0496106_0016692 | 3300048909 | Bacteria | 5432 |
| 1359 | Ga0496106_0038434 | 3300048909 | Bacteria | 3581 |
| 1360 | Ga0496106_0114552 | 3300048909 | Bacteria | 2102 |
| 1361 | Ga0496106_0194970 | 3300048909 | Bacteria | 1611 |
| 1362 | Ga0496107_0000844 | 3300048910 | Bacteria | 17921 |
| 1363 | Ga0496107_0002006 | 3300048910 | Bacteria | 12986 |
| 1364 | Ga0496107_0005355 | 3300048910 | Bacteria | 8778 |
| 1365 | Ga0496107_0009798 | 3300048910 | Bacteria | 6645 |
| 1366 | Ga0496107_0014142 | 3300048910 | Bacteria | 5587 |
| 1367 | Ga0496107_0031969 | 3300048910 | Bacteria | 3758 |
| 1368 | Ga0496107_0033348 | 3300048910 | Bacteria | 3683 |
| 1369 | Ga0496107_0132845 | 3300048910 | Bacteria | 1838 |
| 1370 | Ga0496107_0407875 | 3300048910 | Bacteria | 1011 |
| 1371 | Ga0496108_0002310 | 3300048911 | Bacteria | 15266 |
| 1372 | Ga0496108_0002624 | 3300048911 | Bacteria | 14402 |
| 1373 | Ga0496108_0057494 | 3300048911 | Bacteria | 3268 |
| 1374 | Ga0496108_0079607 | 3300048911 | Bacteria | 2774 |
| 1375 | Ga0496109_0002891 | 3300048912 | Bacteria | 14365 |
| 1376 | Ga0496109_0003011 | 3300048912 | Bacteria | 14061 |
| 1377 | Ga0496109_0011996 | 3300048912 | Bacteria | 7463 |
| 1378 | Ga0496109_0159657 | 3300048912 | Bacteria | 2112 |
| 1379 | Ga0496110_0002024 | 3300048913 | Bacteria | 15093 |
| 1380 | Ga0496110_0005701 | 3300048913 | Bacteria | 9777 |
| 1381 | Ga0496110_0006680 | 3300048913 | Bacteria | 9168 |
| 1382 | Ga0496110_0013610 | 3300048913 | Bacteria | 6734 |
| 1383 | Ga0496110_0063334 | 3300048913 | Bacteria | 3267 |
| 1384 | Ga0496110_0121716 | 3300048913 | Bacteria | 2351 |
| 1385 | Ga0496110_0329352 | 3300048913 | Bacteria | 1391 |
| 1386 | Ga0496111_0003300 | 3300048914 | Bacteria | 9978 |
| 1387 | Ga0496111_0016639 | 3300048914 | Bacteria | 5071 |
| 1388 | Ga0496111_0020931 | 3300048914 | Bacteria | 4560 |
| 1389 | Ga0496111_0025629 | 3300048914 | Bacteria | 4161 |
| 1390 | Ga0496111_0027351 | 3300048914 | Bacteria | 4034 |
| 1391 | Ga0496111_0029166 | 3300048914 | Bacteria | 3917 |
| 1392 | Ga0496111_0178753 | 3300048914 | Bacteria | 1577 |
| 1393 | Ga0496112_0000004 | 3300048915 | Bacteria | 553294 |
| 1394 | Ga0496112_0010399 | 3300048915 | Bacteria | 8437 |
| 1395 | Ga0496112_0013933 | 3300048915 | Bacteria | 7438 |
| 1396 | Ga0496112_0015385 | 3300048915 | Bacteria | 7138 |
| 1397 | Ga0496112_0031686 | 3300048915 | Bacteria | 5128 |
| 1398 | Ga0496112_0074323 | 3300048915 | Bacteria | 3360 |
| 1399 | Ga0496112_0202571 | 3300048915 | Bacteria | 1943 |
| 1400 | Ga0496112_0430124 | 3300048915 | Bacteria | 1258 |
| 1401 | Ga0496113_0006037 | 3300048916 | Bacteria | 7631 |
| 1402 | Ga0496113_0010146 | 3300048916 | Bacteria | 6216 |
| 1403 | Ga0496113_0022159 | 3300048916 | Bacteria | 4488 |
| 1404 | Ga0496113_0116201 | 3300048916 | Bacteria | 2087 |
| 1405 | Ga0496114_0010127 | 3300048917 | Bacteria | 7500 |
| 1406 | Ga0496114_0014349 | 3300048917 | Bacteria | 6355 |
| 1407 | Ga0496114_0068992 | 3300048917 | Bacteria | 2968 |
| 1408 | Ga0496114_0086065 | 3300048917 | Bacteria | 2663 |
| 1409 | Ga0496114_0298942 | 3300048917 | Bacteria | 1421 |
| 1410 | Ga0496115_0010097 | 3300048918 | Bacteria | 7040 |
| 1411 | Ga0496115_0016209 | 3300048918 | Bacteria | 5670 |
| 1412 | Ga0496115_0017600 | 3300048918 | Bacteria | 5469 |
| 1413 | Ga0496115_0021136 | 3300048918 | Bacteria | 5023 |
| 1414 | Ga0496115_0029351 | 3300048918 | Bacteria | 4319 |
| 1415 | Ga0496115_0030622 | 3300048918 | Bacteria | 4235 |
| 1416 | Ga0496115_0061514 | 3300048918 | Bacteria | 3027 |
| 1417 | Ga0496115_0115841 | 3300048918 | Bacteria | 2204 |
| 1418 | Ga0496115_0167310 | 3300048918 | Bacteria | 1818 |
| 1419 | Ga0496116_0033300 | 3300048919 | Bacteria | 3658 |
| 1420 | Ga0496117_0001113 | 3300048920 | Bacteria | 40547 |
| 1421 | Ga0496118_0002207 | 3300048921 | Bacteria | 27019 |
| 1422 | Ga0496118_0021354 | 3300048921 | Bacteria | 5701 |
| 1423 | Ga0496118_0022371 | 3300048921 | Bacteria | 5528 |
| 1424 | Ga0496118_0091952 | 3300048921 | Bacteria | 2084 |
| 1425 | Ga0496119_0003438 | 3300048922 | Bacteria | 16444 |
| 1426 | Ga0496119_0040194 | 3300048922 | Bacteria | 2995 |
| 1427 | Ga0496119_0114844 | 3300048922 | Bacteria | 1488 |
| 1428 | Ga0496120_0018689 | 3300048923 | Bacteria | 4457 |
| 1429 | Ga0496120_0029886 | 3300048923 | Bacteria | 3321 |
| 1430 | Ga0496121_0000458 | 3300048924 | Bacteria | 80207 |
| 1431 | Ga0496121_0000668 | 3300048924 | Bacteria | 64093 |
| 1432 | Ga0496121_0003282 | 3300048924 | Bacteria | 23219 |
| 1433 | Ga0496121_0015952 | 3300048924 | Bacteria | 7795 |
| 1434 | Ga0496121_0023452 | 3300048924 | Bacteria | 5942 |
| 1435 | Ga0496121_0046790 | 3300048924 | Bacteria | 3698 |
| 1436 | Ga0496121_0057763 | 3300048924 | Bacteria | 3213 |
| 1437 | Ga0496121_0058459 | 3300048924 | Bacteria | 3188 |
| 1438 | Ga0496121_0116311 | 3300048924 | Bacteria | 2028 |
| 1439 | Ga0496121_0138248 | 3300048924 | Bacteria | 1811 |
| 1440 | Ga0496122_0003250 | 3300048925 | Bacteria | 21566 |
| 1441 | Ga0496123_0002687 | 3300048926 | Bacteria | 21408 |
| 1442 | Ga0496124_0016929 | 3300048927 | Bacteria | 6905 |
| 1443 | Ga0496124_0018892 | 3300048927 | Bacteria | 6435 |
| 1444 | Ga0496124_0027613 | 3300048927 | Bacteria | 5091 |
| 1445 | Ga0496124_0030532 | 3300048927 | Bacteria | 4782 |
| 1446 | Ga0496125_0002993 | 3300048928 | Bacteria | 21169 |
| 1447 | Ga0496125_0037091 | 3300048928 | Bacteria | 4243 |
| 1448 | Ga0496125_0087127 | 3300048928 | Bacteria | 2359 |
| 1449 | Ga0496126_0004265 | 3300048929 | Bacteria | 17195 |
| 1450 | Ga0496126_0015822 | 3300048929 | Bacteria | 7575 |
| 1451 | Ga0496126_0021670 | 3300048929 | Bacteria | 6272 |
| 1452 | Ga0496126_0059053 | 3300048929 | Bacteria | 3455 |
| 1453 | Ga0496126_0075342 | 3300048929 | Bacteria | 2995 |
| 1454 | Ga0496126_0103663 | 3300048929 | Bacteria | 2486 |
| 1455 | Ga0496126_0121675 | 3300048929 | Bacteria | 2262 |
| 1456 | Ga0496126_0151971 | 3300048929 | Bacteria | 1983 |
| 1457 | Ga0501031_0026605 | 3300049568 | Bacteria | 3771 |
| 1458 | Ga0501031_0028491 | 3300049568 | Bacteria | 3641 |
| 1459 | Ga0501032_0000619 | 3300049569 | Bacteria | 28816 |
| 1460 | Ga0501032_0005134 | 3300049569 | Bacteria | 9765 |
| 1461 | Ga0501032_0017361 | 3300049569 | Bacteria | 5053 |
| 1462 | Ga0501033_0000108 | 3300049570 | Bacteria | 79903 |
| 1463 | Ga0501033_0008940 | 3300049570 | Bacteria | 7736 |
| 1464 | Ga0501033_0034418 | 3300049570 | Bacteria | 3800 |
| 1465 | Ga0501033_0101887 | 3300049570 | Bacteria | 2094 |
| 1466 | Ga0501034_0000100 | 3300049571 | Bacteria | 159536 |
| 1467 | Ga0501034_0001160 | 3300049571 | Bacteria | 36511 |
| 1468 | Ga0501034_0417808 | 3300049571 | Bacteria | 1262 |
| 1469 | Ga0501036_0003243 | 3300049572 | Bacteria | 12966 |
| 1470 | Ga0501036_0005602 | 3300049572 | Bacteria | 10187 |
| 1471 | Ga0501036_0046547 | 3300049572 | Bacteria | 3674 |
| 1472 | Ga0501037_0000153 | 3300049573 | Bacteria | 64239 |
| 1473 | Ga0501037_0002178 | 3300049573 | Bacteria | 14167 |
| 1474 | Ga0501037_0007559 | 3300049573 | Bacteria | 7956 |
| 1475 | Ga0501037_0024884 | 3300049573 | Bacteria | 4425 |
| 1476 | Ga0501037_0041443 | 3300049573 | Bacteria | 3386 |
| 1477 | Ga0501038_0000138 | 3300049574 | Bacteria | 62493 |
| 1478 | Ga0501038_0027593 | 3300049574 | Bacteria | 5050 |
| 1479 | Ga0501038_0044018 | 3300049574 | Bacteria | 3880 |
| 1480 | Ga0501038_0046396 | 3300049574 | Bacteria | 3767 |
| 1481 | Ga0501038_0135773 | 3300049574 | Bacteria | 2016 |
| 1482 | Ga0501039_0001334 | 3300049575 | Bacteria | 18048 |
| 1483 | Ga0501039_0005778 | 3300049575 | Bacteria | 9373 |
| 1484 | Ga0501039_0021206 | 3300049575 | Bacteria | 4984 |
| 1485 | Ga0501039_0151695 | 3300049575 | Bacteria | 1820 |
| 1486 | Ga0501042_0030014 | 3300049578 | Bacteria | 3838 |
| 1487 | Ga0501043_0000072 | 3300049579 | Bacteria | 89021 |
| 1488 | Ga0501043_0000085 | 3300049579 | Bacteria | 83544 |
| 1489 | Ga0501043_0000122 | 3300049579 | Bacteria | 71952 |
| 1490 | Ga0501043_0010595 | 3300049579 | Bacteria | 7218 |
| 1491 | Ga0501043_0059176 | 3300049579 | Bacteria | 3006 |
| 1492 | Ga0501046_0000112 | 3300049580 | Bacteria | 86313 |
| 1493 | Ga0501046_0001536 | 3300049580 | Bacteria | 22030 |
| 1494 | Ga0501046_0009020 | 3300049580 | Bacteria | 8649 |
| 1495 | Ga0501046_0016351 | 3300049580 | Bacteria | 6217 |
| 1496 | Ga0501046_0055778 | 3300049580 | Bacteria | 3103 |
| 1497 | Ga0501046_0056031 | 3300049580 | Bacteria | 3095 |
| 1498 | Ga0501047_0000138 | 3300049581 | Bacteria | 89028 |
| 1499 | Ga0501047_0000221 | 3300049581 | Bacteria | 68563 |
| 1500 | Ga0501047_0001508 | 3300049581 | Bacteria | 22710 |
| 1501 | Ga0501047_0010664 | 3300049581 | Bacteria | 8684 |
| 1502 | Ga0501047_0014013 | 3300049581 | Bacteria | 7619 |
| 1503 | Ga0501047_0150317 | 3300049581 | Bacteria | 2205 |
| 1504 | Ga0501048_0000151 | 3300049582 | Bacteria | 42561 |
| 1505 | Ga0501048_0016360 | 3300049582 | Bacteria | 5465 |
| 1506 | Ga0501048_0028911 | 3300049582 | Bacteria | 4023 |
| 1507 | Ga0501067_0003478 | 3300049583 | Bacteria | 8653 |
| 1508 | Ga0501067_0008205 | 3300049583 | Bacteria | 5799 |
| 1509 | Ga0501068_0000689 | 3300049584 | Bacteria | 17292 |
| 1510 | Ga0501068_0097161 | 3300049584 | Bacteria | 1822 |
| 1511 | Ga0501069_0009070 | 3300049585 | Bacteria | 5248 |
| 1512 | Ga0501069_0019871 | 3300049585 | Bacteria | 3634 |
| 1513 | Ga0501069_0027507 | 3300049585 | Bacteria | 3115 |
| 1514 | Ga0501069_0112356 | 3300049585 | Bacteria | 1552 |
| 1515 | Ga0501070_0005227 | 3300049586 | Bacteria | 11067 |
| 1516 | Ga0501070_0009879 | 3300049586 | Bacteria | 8067 |
| 1517 | Ga0501070_0014416 | 3300049586 | Bacteria | 6651 |
| 1518 | Ga0501070_0070401 | 3300049586 | Bacteria | 2896 |
| 1519 | Ga0501070_0124994 | 3300049586 | Bacteria | 2126 |
| 1520 | Ga0501071_0009224 | 3300049587 | Bacteria | 6561 |
| 1521 | Ga0501071_0093943 | 3300049587 | Bacteria | 2205 |
| 1522 | Ga0501072_0001591 | 3300049588 | Bacteria | 16965 |
| 1523 | Ga0501072_0097197 | 3300049588 | Bacteria | 2340 |
| 1524 | Ga0501072_0243898 | 3300049588 | Bacteria | 1431 |
| 1525 | Ga0501073_0000290 | 3300049589 | Bacteria | 33072 |
| 1526 | Ga0501073_0033251 | 3300049589 | Bacteria | 3672 |
| 1527 | Ga0501073_0047140 | 3300049589 | Bacteria | 3028 |
| 1528 | Ga0501073_0114295 | 3300049589 | Bacteria | 1871 |
| 1529 | Ga0501074_0000094 | 3300049590 | Bacteria | 42565 |
| 1530 | Ga0501074_0010639 | 3300049590 | Bacteria | 6679 |
| 1531 | Ga0501074_0018658 | 3300049590 | Bacteria | 5041 |
| 1532 | Ga0501074_0070101 | 3300049590 | Bacteria | 2520 |
| 1533 | Ga0501074_0135923 | 3300049590 | Bacteria | 1758 |
| 1534 | Ga0501075_0129638 | 3300049591 | Bacteria | 1921 |
| 1535 | Ga0501075_0319266 | 3300049591 | Bacteria | 1184 |
| 1536 | Ga0501076_0009771 | 3300049592 | Bacteria | 7087 |
| 1537 | Ga0501076_0009957 | 3300049592 | Bacteria | 7027 |
| 1538 | Ga0501076_0095072 | 3300049592 | Bacteria | 2400 |
| 1539 | Ga0501076_0103471 | 3300049592 | Bacteria | 2297 |
| 1540 | Ga0501077_0064401 | 3300049593 | Bacteria | 2326 |
| 1541 | Ga0501079_0011578 | 3300049741 | Bacteria | 6733 |
| 1542 | Ga0501079_0021362 | 3300049741 | Bacteria | 4951 |
| 1543 | Ga0501079_0045004 | 3300049741 | Bacteria | 3406 |
| 1544 | Ga0501080_0000104 | 3300049742 | Bacteria | 57865 |
| 1545 | Ga0501080_0000130 | 3300049742 | Bacteria | 53465 |
| 1546 | Ga0501080_0004806 | 3300049742 | Bacteria | 12047 |
| 1547 | Ga0501080_0037162 | 3300049742 | Bacteria | 4546 |
| 1548 | Ga0501080_0070845 | 3300049742 | Bacteria | 3242 |
| 1549 | Ga0501080_0080027 | 3300049742 | Bacteria | 3037 |
| 1550 | Ga0501081_0059062 | 3300049743 | Bacteria | 2654 |
| 1551 | Ga0501083_0000087 | 3300049744 | Bacteria | 62691 |
| 1552 | Ga0501083_0072468 | 3300049744 | Bacteria | 2290 |
| 1553 | Ga0501083_0102558 | 3300049744 | Bacteria | 1886 |
| 1554 | Ga0501083_0107677 | 3300049744 | Bacteria | 1834 |
| 1555 | Ga0501035_0000016 | 3300049822 | Bacteria | 243412 |
| 1556 | Ga0501035_0000127 | 3300049822 | Bacteria | 92397 |
| 1557 | Ga0501035_0000223 | 3300049822 | Bacteria | 67732 |
| 1558 | Ga0501035_0029522 | 3300049822 | Bacteria | 5001 |
| 1559 | Ga0501035_0037803 | 3300049822 | Bacteria | 4369 |
| 1560 | Ga0501035_0115008 | 3300049822 | Bacteria | 2355 |
| 1561 | Ga0501044_0000636 | 3300049823 | Bacteria | 42394 |
| 1562 | Ga0501044_0000970 | 3300049823 | Bacteria | 34530 |
| 1563 | Ga0501044_0035319 | 3300049823 | Bacteria | 5236 |
| 1564 | Ga0501044_0044641 | 3300049823 | Bacteria | 4598 |
| 1565 | Ga0501044_0072975 | 3300049823 | Bacteria | 3488 |
| 1566 | Ga0501044_0093247 | 3300049823 | Bacteria | 3036 |
| 1567 | Ga0501044_0129136 | 3300049823 | Bacteria | 2522 |
| 1568 | Ga0501044_0228567 | 3300049823 | Bacteria | 1809 |
| 1569 | Ga0501045_0024845 | 3300049824 | Bacteria | 4303 |
| 1570 | Ga0501045_0056865 | 3300049824 | Bacteria | 2862 |
| 1571 | nmdc:mga03n38_22876_c1 | 3300050490 | Bacteria | 2536 |
| 1572 | nmdc:mga03n38_4203_c1 | 3300050490 | Bacteria | 4738 |
| 1573 | nmdc:mga00v17_65912_c1 | 3300050491 | Bacteria | 2235 |
| 1574 | nmdc:mga0yw44_4056_c1 | 3300050492 | Bacteria | 6630 |
| 1575 | nmdc:mga0yw44_59988_c1 | 3300050492 | Bacteria | 2329 |
| 1576 | nmdc:mga0yw44_94336_c1 | 3300050492 | Bacteria | 1897 |
| 1577 | nmdc:mga0k408_4525_c1 | 3300050493 | Bacteria | 7382 |
| 1578 | nmdc:mga0k408_69181_c1 | 3300050493 | Bacteria | 2060 |
| 1579 | nmdc:mga0k408_70184_c1 | 3300050493 | Bacteria | 2045 |
| 1580 | nmdc:mga06z11_26425_c1 | 3300050494 | Bacteria | 2762 |
| 1581 | nmdc:mga06z11_5335_c1 | 3300050494 | Bacteria | 5149 |
| 1582 | nmdc:mga04h51_32831_c1 | 3300050495 | Bacteria | 1649 |
| 1583 | nmdc:mga04h51_54496_c1 | 3300050495 | Bacteria | 1352 |
| 1584 | nmdc:mga07m45_145268_c1 | 3300050496 | Bacteria | 1375 |
| 1585 | nmdc:mga07m45_5327_c1 | 3300050496 | Bacteria | 6397 |
| 1586 | nmdc:mga05p37_157565_c1 | 3300050507 | Bacteria | 2774 |
| 1587 | nmdc:mga05p37_3181_c1 | 3300050507 | Bacteria | 19102 |
| 1588 | nmdc:mga05p37_358703_c1 | 3300050507 | Bacteria | 1714 |
| 1589 | nmdc:mga05p37_4809_c1 | 3300050507 | Bacteria | 15796 |
| 1590 | nmdc:mga05p37_59973_c1 | 3300050507 | Bacteria | 4684 |
| 1591 | nmdc:mga05p37_63712_c1 | 3300050507 | Bacteria | 4537 |
| 1592 | nmdc:mga05p37_6528_c1 | 3300050507 | Bacteria | 10109 |
| 1593 | nmdc:mga05p37_9682_c1 | 3300050507 | Bacteria | 11423 |
| 1594 | nmdc:mga09592_2996_c1 | 3300050508 | Bacteria | 13695 |
| 1595 | nmdc:mga09592_327793_c1 | 3300050508 | Bacteria | 1326 |
| 1596 | nmdc:mga09592_3717_c1 | 3300050508 | Bacteria | 12298 |
| 1597 | nmdc:mga0qj67_3244_c1 | 3300050509 | Bacteria | 11709 |
| 1598 | nmdc:mga0qj67_64256_c1 | 3300050509 | Bacteria | 2919 |
| 1599 | nmdc:mga06r32_144049_c1 | 3300050510 | Bacteria | 2360 |
| 1600 | nmdc:mga06r32_208713_c1 | 3300050510 | Bacteria | 1941 |
| 1601 | nmdc:mga06r32_321926_c1 | 3300050510 | Bacteria | 1532 |
| 1602 | nmdc:mga06r32_3795_c1 | 3300050510 | Bacteria | 13525 |
| 1603 | nmdc:mga06r32_4964_c1 | 3300050510 | Bacteria | 11991 |
| 1604 | nmdc:mga06r32_5210_c1 | 3300050510 | Bacteria | 11684 |
| 1605 | nmdc:mga08y16_111162_c1 | 3300050511 | Bacteria | 2853 |
| 1606 | nmdc:mga08y16_194299_c1 | 3300050511 | Bacteria | 2104 |
| 1607 | nmdc:mga08y16_204_c3 | 3300050511 | Bacteria | 8325 |
| 1608 | nmdc:mga08y16_30352_c1 | 3300050511 | Bacteria | 5690 |
| 1609 | nmdc:mga08y16_4659_c1 | 3300050511 | Bacteria | 14281 |
| 1610 | nmdc:mga08y16_5147_c1 | 3300050511 | Bacteria | 13664 |
| 1611 | nmdc:mga08y16_60267_c1 | 3300050511 | Bacteria | 3965 |
| 1612 | nmdc:mga0n895_134904_c1 | 3300050512 | Bacteria | 2495 |
| 1613 | nmdc:mga0n895_1698_c1 | 3300050512 | Bacteria | 16639 |
| 1614 | nmdc:mga0n895_26906_c1 | 3300050512 | Bacteria | 5457 |
| 1615 | nmdc:mga0n895_324652_c1 | 3300050512 | Bacteria | 1560 |
| 1616 | nmdc:mga0n895_35962_c1 | 3300050512 | Bacteria | 4779 |
| 1617 | nmdc:mga0n895_75261_c1 | 3300050512 | Bacteria | 3356 |
| 1618 | nmdc:mga0rr50_157119_c1 | 3300050513 | Bacteria | 1843 |
| 1619 | nmdc:mga0rr50_196493_c1 | 3300050513 | Bacteria | 1656 |
| 1620 | nmdc:mga0rr50_28902_c1 | 3300050513 | Bacteria | 3293 |
| 1621 | nmdc:mga0rr50_289905_c1 | 3300050513 | Bacteria | 1367 |
| 1622 | nmdc:mga08x19_6_c1 | 3300050514 | Bacteria | 405679 |
| 1623 | nmdc:mga0a205_142570_c1 | 3300050515 | Bacteria | 2296 |
| 1624 | nmdc:mga0a205_184989_c1 | 3300050515 | Bacteria | 1976 |
| 1625 | nmdc:mga0a205_195722_c1 | 3300050515 | Bacteria | 1912 |
| 1626 | nmdc:mga0a205_39881_c2 | 3300050515 | Bacteria | 3323 |
| 1627 | nmdc:mga0a205_5270_c1 | 3300050515 | Bacteria | 11646 |
| 1628 | nmdc:mga0a205_66626_c1 | 3300050515 | Bacteria | 3479 |
| 1629 | nmdc:mga0sz30_6269_c1 | 3300050516 | Bacteria | 4411 |
| 1630 | Ga0495601_0000069 | 3300053077 | Bacteria | 56291 |
| 1631 | Ga0495601_0009894 | 3300053077 | Bacteria | 5647 |
| 1632 | Ga0495601_0011998 | 3300053077 | Bacteria | 5192 |
| 1633 | Ga0495601_0012835 | 3300053077 | Bacteria | 5028 |
| 1634 | Ga0495601_0028733 | 3300053077 | Bacteria | 3445 |
| 1635 | Ga0495601_0035833 | 3300053077 | Bacteria | 3098 |
| 1636 | Ga0495601_0089041 | 3300053077 | Bacteria | 1985 |
| 1637 | Ga0495612_0001538 | 3300053078 | Bacteria | 9512 |
| 1638 | Ga0495612_0016126 | 3300053078 | Bacteria | 2993 |
| 1639 | Ga0495612_0021353 | 3300053078 | Bacteria | 2597 |
| 1640 | Ga0500610_0071800 | 3300053079 | Bacteria | 1805 |
| 1641 | Ga0495595_0002192 | 3300053084 | Bacteria | 7589 |
| 1642 | Ga0495595_0003947 | 3300053084 | Bacteria | 5924 |
| 1643 | Ga0495595_0004944 | 3300053084 | Bacteria | 5373 |
| 1644 | Ga0495595_0009528 | 3300053084 | Bacteria | 4021 |
| 1645 | Ga0495595_0019399 | 3300053084 | Bacteria | 2949 |
| 1646 | Ga0495595_0022754 | 3300053084 | Bacteria | 2753 |
| 1647 | Ga0495595_0050933 | 3300053084 | Bacteria | 1918 |
| 1648 | Ga0495619_0000546 | 3300053085 | Bacteria | 24865 |
| 1649 | Ga0495619_0001245 | 3300053085 | Bacteria | 16673 |
| 1650 | Ga0495619_0005933 | 3300053085 | Bacteria | 7737 |
| 1651 | Ga0495619_0013779 | 3300053085 | Bacteria | 5101 |
| 1652 | Ga0495619_0018617 | 3300053085 | Bacteria | 4407 |
| 1653 | Ga0495619_0031858 | 3300053085 | Bacteria | 3417 |
| 1654 | Ga0495619_0037540 | 3300053085 | Bacteria | 3157 |
| 1655 | Ga0495619_0088326 | 3300053085 | Bacteria | 2097 |
| 1656 | Ga0500643_000035 | 3300053087 | Bacteria | 184794 |
| 1657 | Ga0500643_001421 | 3300053087 | Bacteria | 13818 |
| 1658 | Ga0500644_0004088 | 3300053088 | Bacteria | 3630 |
| 1659 | Ga0500647_0026741 | 3300053091 | Bacteria | 2723 |
| 1660 | Ga0500651_0000660 | 3300053093 | Bacteria | 17169 |
| 1661 | Ga0500651_0010557 | 3300053093 | Bacteria | 5540 |
| 1662 | Ga0500566_0000006 | 3300053094 | Bacteria | 153632 |
| 1663 | Ga0500566_0013976 | 3300053094 | Bacteria | 4719 |
| 1664 | Ga0500640_015397 | 3300053095 | Bacteria | 3202 |
| 1665 | Ga0500641_0002427 | 3300053096 | Bacteria | 6612 |
| 1666 | Ga0500641_0006784 | 3300053096 | Bacteria | 4074 |
| 1667 | Ga0500641_0042834 | 3300053096 | Bacteria | 1835 |
| 1668 | Ga0500557_000004 | 3300053105 | Bacteria | 202318 |
| 1669 | Ga0500593_052843 | 3300053117 | Bacteria | 1800 |
| 1670 | Ga0500595_000003 | 3300053119 | Bacteria | 419332 |
| 1671 | Ga0500595_000152 | 3300053119 | Bacteria | 45452 |
| 1672 | Ga0500595_006441 | 3300053119 | Bacteria | 4980 |
| 1673 | Ga0500595_009637 | 3300053119 | Bacteria | 3889 |
| 1674 | Ga0500608_011998 | 3300053122 | Bacteria | 3785 |
| 1675 | Ga0500614_001760 | 3300053123 | Bacteria | 5030 |
| 1676 | Ga0500642_0000133 | 3300053130 | Bacteria | 33202 |
| 1677 | Ga0500658_0078574 | 3300053134 | Bacteria | 1407 |
| 1678 | Ga0500559_0001576 | 3300053136 | Bacteria | 12756 |
| 1679 | Ga0500603_000352 | 3300053150 | Bacteria | 12039 |
| 1680 | Ga0500603_001602 | 3300053150 | Bacteria | 5114 |
| 1681 | Ga0500604_0000229 | 3300053151 | Bacteria | 15983 |
| 1682 | Ga0500604_0010123 | 3300053151 | Bacteria | 2519 |
| 1683 | Ga0500616_0000002 | 3300053153 | Bacteria | 1611257 |
| 1684 | Ga0500616_0000154 | 3300053153 | Bacteria | 115039 |
| 1685 | Ga0500616_0020018 | 3300053153 | Bacteria | 3763 |
| 1686 | Ga0500622_0009106 | 3300053156 | Bacteria | 5513 |
| 1687 | Ga0500627_0108538 | 3300053158 | Bacteria | 1249 |
| 1688 | Ga0500630_000571 | 3300053159 | Bacteria | 16714 |
| 1689 | Ga0500634_0000020 | 3300053161 | Bacteria | 106250 |
| 1690 | Ga0500639_000016 | 3300053163 | Bacteria | 118099 |
| 1691 | Ga0500636_0050949 | 3300053177 | Bacteria | 2433 |
| 1692 | Ga0500636_0101990 | 3300053177 | Bacteria | 1630 |
| 1693 | Ga0500637_0012256 | 3300053178 | Bacteria | 4462 |
| 1694 | Ga0500649_094977 | 3300053722 | Bacteria | 1189 |
| 1695 | Ga0500625_029782 | 3300053729 | Bacteria | 2592 |
| 1696 | Ga0500645_000226 | 3300053730 | Bacteria | 42982 |
| 1697 | Ga0500601_000607 | 3300053737 | Bacteria | 5085 |
| 1698 | Ga0501084_0079121 | 3300054114 | Bacteria | 2755 |
| 1699 | Ga0501084_0113611 | 3300054114 | Bacteria | 2276 |
| 1700 | Ga0501084_0289740 | 3300054114 | Bacteria | 1383 |
| 1701 | Ga0501084_0361105 | 3300054114 | Bacteria | 1227 |
| 1702 | Ga0501084_0426208 | 3300054114 | Bacteria | 1121 |
| 1703 | Ga0587085_008146 | 3300059506 | Bacteria | 1329 |
| 1704 | Ga0501082_0000266 | 3300060353 | Bacteria | 46186 |
| 1705 | Ga0501082_0007768 | 3300060353 | Bacteria | 9256 |
| 1706 | Ga0501082_0101382 | 3300060353 | Bacteria | 2490 |
| 1707 | Ga0466962_0029890 | 3300061719 | Bacteria | 2609 |
| 1708 | Ga0530510_0043777 | 3300061734 | Bacteria | 3234 |
| 1709 | Ga0530510_0256881 | 3300061734 | Bacteria | 1303 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046512 | Ga0495610_0084361 | Ga0495610_0084361_102_1055 | 305 |
| 2 | 3300035113 | Ga0373936_0050055 | Ga0373936_0050055_733_1659 | 308 |
| 3 | 3300035725 | Ga0373947_0099267 | Ga0373947_0099267_31_957 | 308 |
| 4 | 3300046674 | Ga0495588_0004700 | Ga0495588_0004700_34_960 | 308 |
| 5 | 3300048089 | Ga0495614_0062655 | Ga0495614_0062655_51_977 | 308 |
| 6 | 3300048910 | Ga0496107_0407875 | Ga0496107_0407875_14_940 | 308 |
| 7 | 3300005456 | Ga0070678_100105370 | Ga0070678_1001053702 | 324 |
| 8 | 3300005445 | Ga0070708_100170803 | Ga0070708_1001708032 | 327 |
| 9 | 3300005577 | Ga0068857_100277970 | Ga0068857_1002779701 | 327 |
| 10 | 3300025910 | Ga0207684_10002166 | Ga0207684_100021661 | 327 |
| 11 | 3300050494 | nmdc:mga06z11_26425_c1 | nmdc:mga06z11_26425_c1_263_1336 | 327 |
| 12 | 3300050496 | nmdc:mga07m45_145268_c1 | nmdc:mga07m45_145268_c1_144_1217 | 327 |
| 13 | 3300037312 | Ga0395899_0124850 | Ga0395899_0124850_580_1635 | 328 |
| 14 | 3300037466 | Ga0395898_0007511 | Ga0395898_0007511_10346_11401 | 328 |
| 15 | 3300038443 | Ga0395901_0011181 | Ga0395901_0011181_4441_5496 | 328 |
| 16 | 3300005985 | Ga0081539_10017410 | Ga0081539_100174103 | 332 |
| 17 | iso_pu_bacteria | 2643221618 | 2644104518 | 332 |
| 18 | iso_pu_bacteria | 2643221626 | 2644150118 | 332 |
| 19 | iso_pu_bacteria | 2643221655 | 2644307907 | 332 |
| 20 | iso_pu_bacteria | 2643221659 | 2644333634 | 332 |
| 21 | iso_pu_bacteria | 2643221698 | 2644544615 | 332 |
| 22 | iso_pu_bacteria | 2643221712 | 2644614062 | 332 |
| 23 | iso_pu_bacteria | 2844163670 | 2844167749 | 332 |
| 24 | iso_pu_bacteria | 2941499720 | 2941506154 | 332 |
| 25 | 3300037312 | Ga0395899_0124691 | Ga0395899_0124691_27_1037 | 335 |
| 26 | 3300046506 | Ga0495583_0003990 | Ga0495583_0003990_9747_10802 | 337 |
| 27 | 3300050513 | nmdc:mga0rr50_157119_c1 | nmdc:mga0rr50_157119_c1_29_1042 | 337 |
| 28 | 3300047315 | Ga0495581_0061937 | Ga0495581_0061937_12_1028 | 338 |
| 29 | 3300003187 | JGI25151J46595_10000600 | JGI25151J46595_1000060021 | 341 |
| 30 | 3300003215 | JGI25153J46596_10002895 | JGI25153J46596_100028958 | 341 |
| 31 | 3300003354 | JGI25160J50197_1000323 | JGI25160J50197_100032320 | 341 |
| 32 | 3300003374 | JGI25161J50226_1003863 | JGI25161J50226_10038631 | 341 |
| 33 | 3300003771 | Ga0055526_1002692 | Ga0055526_10026929 | 341 |
| 34 | 3300003775 | Ga0055524_1000709 | Ga0055524_10007098 | 341 |
| 35 | 3300003790 | Ga0055528_1001863 | Ga0055528_100186310 | 341 |
| 36 | 3300003792 | Ga0055540_1010264 | Ga0055540_10102642 | 341 |
| 37 | 3300004625 | Ga0055543_1000636 | Ga0055543_100063616 | 341 |
| 38 | 3300005262 | Ga0065165_1005992 | Ga0065165_10059924 | 341 |
| 39 | 3300006177 | Ga0075362_10000500 | Ga0075362_100005005 | 341 |
| 40 | 3300006178 | Ga0075367_10002117 | Ga0075367_100021178 | 341 |
| 41 | 3300006186 | Ga0075369_10003007 | Ga0075369_100030076 | 341 |
| 42 | 3300006195 | Ga0075366_10004256 | Ga0075366_100042565 | 341 |
| 43 | 3300006844 | Ga0075428_100019515 | Ga0075428_1000195155 | 341 |
| 44 | 3300006846 | Ga0075430_100030141 | Ga0075430_1000301411 | 341 |
| 45 | 3300006847 | Ga0075431_100000986 | Ga0075431_1000009869 | 341 |
| 46 | 3300009094 | Ga0111539_10004845 | Ga0111539_100048453 | 341 |
| 47 | 3300009147 | Ga0114129_10004791 | Ga0114129_1000479119 | 341 |
| 48 | 3300025245 | Ga0207425_1011256 | Ga0207425_10112562 | 341 |
| 49 | 3300025258 | Ga0209129_1000367 | Ga0209129_100036712 | 341 |
| 50 | 3300025273 | Ga0209673_1000872 | Ga0209673_100087216 | 341 |
| 51 | 3300025294 | Ga0209025_1000228 | Ga0209025_100022896 | 341 |
| 52 | 3300025295 | Ga0209564_1000763 | Ga0209564_100076337 | 341 |
| 53 | 3300025297 | Ga0209758_1000113 | Ga0209758_1000113134 | 341 |
| 54 | 3300025299 | Ga0209256_1001449 | Ga0209256_100144915 | 341 |
| 55 | 3300025302 | Ga0207426_1000307 | Ga0207426_100030770 | 341 |
| 56 | 3300027907 | Ga0207428_10061970 | Ga0207428_100619703 | 341 |
| 57 | 3300050493 | nmdc:mga0k408_4525_c1 | nmdc:mga0k408_4525_c1_4164_5225 | 341 |
| 58 | 3300050496 | nmdc:mga07m45_5327_c1 | nmdc:mga07m45_5327_c1_1556_2617 | 341 |
| 59 | 3300050507 | nmdc:mga05p37_3181_c1 | nmdc:mga05p37_3181_c1_1952_3019 | 341 |
| 60 | 3300050510 | nmdc:mga06r32_3795_c1 | nmdc:mga06r32_3795_c1_8175_9242 | 341 |
| 61 | 3300050511 | nmdc:mga08y16_204_c3 | nmdc:mga08y16_204_c3_1274_2341 | 341 |
| 62 | 3300025231 | Ga0207427_101277 | Ga0207427_1012775 | 342 |
| 63 | 3300049822 | Ga0501035_0037803 | Ga0501035_0037803_2362_3462 | 342 |
| 64 | iso_pu_bacteria | 2509276033 | 2509441518 | 342 |
| 65 | iso_pu_bacteria | 2513237103 | 2513710939 | 342 |
| 66 | iso_pu_bacteria | 2523231067 | 2523466473 | 342 |
| 67 | iso_pu_bacteria | 2529292951 | 2530649305 | 342 |
| 68 | iso_pu_bacteria | 2582581308 | 2585279908 | 342 |
| 69 | iso_pu_bacteria | 2582581315 | 2585326543 | 342 |
| 70 | iso_pu_bacteria | 2585427527 | 2585531688 | 342 |
| 71 | iso_pu_bacteria | 2585427528 | 2585541584 | 342 |
| 72 | iso_pu_bacteria | 2585427530 | 2585551365 | 342 |
| 73 | iso_pu_bacteria | 2585427593 | 2585840197 | 342 |
| 74 | iso_pu_bacteria | 2738541333 | 2739036198 | 342 |
| 75 | iso_pu_bacteria | 2738543031 | 2739351386 | 342 |
| 76 | iso_pu_bacteria | 2765235942 | 2766069279 | 342 |
| 77 | iso_pu_bacteria | 2791355259 | 2793317708 | 342 |
| 78 | iso_pu_bacteria | 2802429633 | 2806046301 | 342 |
| 79 | iso_pu_bacteria | 2802429634 | 2806053164 | 342 |
| 80 | iso_pu_bacteria | 2802429635 | 2806059628 | 342 |
| 81 | iso_pu_bacteria | 2802429636 | 2806068633 | 342 |
| 82 | iso_pu_bacteria | 2802429637 | 2806075055 | 342 |
| 83 | iso_pu_bacteria | 2818991453 | 2819638795 | 342 |
| 84 | iso_pu_bacteria | 2838042994 | 2838045322 | 342 |
| 85 | iso_pu_bacteria | 2842110456 | 2842111332 | 342 |
| 86 | iso_pu_bacteria | 2842217011 | 2842221443 | 342 |
| 87 | iso_pu_bacteria | 2857516855 | 2857518206 | 342 |
| 88 | iso_pu_bacteria | 2933586486 | 2933587886 | 342 |
| 89 | iso_pu_bacteria | 2936367885 | 2936374198 | 342 |
| 90 | iso_pu_bacteria | 2936375103 | 2936375290 | 342 |
| 91 | iso_pu_bacteria | 639633055 | 639645120 | 342 |
| 92 | iso_pu_bacteria | 8005376324 | 8005379994 | 342 |
| 93 | iso_pu_bacteria | 8005570704 | 8005572306 | 342 |
| 94 | iso_pu_bacteria | 8024479707 | 8024484869 | 342 |
| 95 | 3300049579 | Ga0501043_0000072 | Ga0501043_0000072_84955_86094 | 344 |
| 96 | 3300049580 | Ga0501046_0000112 | Ga0501046_0000112_82306_83445 | 344 |
| 97 | 3300049581 | Ga0501047_0000138 | Ga0501047_0000138_2928_4067 | 344 |
| 98 | 3300049582 | Ga0501048_0016360 | Ga0501048_0016360_1486_2625 | 344 |
| 99 | 3300049823 | Ga0501044_0228567 | Ga0501044_0228567_103_1242 | 344 |
| 100 | 3300049824 | Ga0501045_0024845 | Ga0501045_0024845_2900_4039 | 344 |
| 101 | iso_pu_bacteria | 2643221551 | 2643777953 | 344 |
| 102 | iso_pu_bacteria | 2643221555 | 2643796401 | 344 |
| 103 | 3300006844 | Ga0075428_100036724 | Ga0075428_1000367245 | 345 |
| 104 | 3300006846 | Ga0075430_100004728 | Ga0075430_10000472812 | 345 |
| 105 | 3300006852 | Ga0075433_10025950 | Ga0075433_100259503 | 345 |
| 106 | 3300006871 | Ga0075434_100016025 | Ga0075434_1000160254 | 345 |
| 107 | 3300006871 | Ga0075434_100080389 | Ga0075434_1000803893 | 345 |
| 108 | 3300009094 | Ga0111539_10010943 | Ga0111539_1001094311 | 345 |
| 109 | 3300009147 | Ga0114129_10014380 | Ga0114129_100143803 | 345 |
| 110 | 3300009147 | Ga0114129_10084982 | Ga0114129_100849824 | 345 |
| 111 | 3300027907 | Ga0207428_10005357 | Ga0207428_100053574 | 345 |
| 112 | 3300050507 | nmdc:mga05p37_358703_c1 | nmdc:mga05p37_358703_c1_301_1374 | 345 |
| 113 | 3300050507 | nmdc:mga05p37_9682_c1 | nmdc:mga05p37_9682_c1_690_1760 | 345 |
| 114 | 3300050508 | nmdc:mga09592_2996_c1 | nmdc:mga09592_2996_c1_11368_12438 | 345 |
| 115 | 3300050509 | nmdc:mga0qj67_3244_c1 | nmdc:mga0qj67_3244_c1_9636_10706 | 345 |
| 116 | 3300050510 | nmdc:mga06r32_4964_c1 | nmdc:mga06r32_4964_c1_1258_2328 | 345 |
| 117 | 3300050511 | nmdc:mga08y16_5147_c1 | nmdc:mga08y16_5147_c1_1226_2296 | 345 |
| 118 | 3300050512 | nmdc:mga0n895_35962_c1 | nmdc:mga0n895_35962_c1_2452_3522 | 345 |
| 119 | 3300050515 | nmdc:mga0a205_5270_c1 | nmdc:mga0a205_5270_c1_986_2056 | 345 |
| 120 | iso_pu_bacteria | 2643221595 | 2643989911 | 345 |
| 121 | iso_pu_bacteria | 2643221627 | 2644155217 | 345 |
| 122 | iso_pu_bacteria | 2854896431 | 2854900086 | 345 |
| 123 | 3300003215 | JGI25153J46596_10017972 | JGI25153J46596_100179722 | 346 |
| 124 | 3300003781 | Ga0055536_1002798 | Ga0055536_10027986 | 346 |
| 125 | 3300005548 | Ga0070665_100022442 | Ga0070665_1000224423 | 346 |
| 126 | 3300005563 | Ga0068855_100436312 | Ga0068855_1004363121 | 346 |
| 127 | 3300005834 | Ga0068851_10077448 | Ga0068851_100774482 | 346 |
| 128 | 3300009093 | Ga0105240_10000013 | Ga0105240_10000013248 | 346 |
| 129 | 3300009545 | Ga0105237_10007434 | Ga0105237_1000743410 | 346 |
| 130 | 3300010375 | Ga0105239_10014249 | Ga0105239_100142491 | 346 |
| 131 | 3300013104 | Ga0157370_10000548 | Ga0157370_1000054813 | 346 |
| 132 | 3300015262 | Ga0182007_10011275 | Ga0182007_100112753 | 346 |
| 133 | 3300015265 | Ga0182005_1002419 | Ga0182005_10024199 | 346 |
| 134 | 3300025253 | Ga0209677_105484 | Ga0209677_1054844 | 346 |
| 135 | 3300025261 | Ga0209233_1000358 | Ga0209233_10003584 | 346 |
| 136 | 3300025292 | Ga0209676_1005236 | Ga0209676_10052366 | 346 |
| 137 | 3300025297 | Ga0209758_1000684 | Ga0209758_100068411 | 346 |
| 138 | 3300025298 | Ga0209050_1027177 | Ga0209050_10271773 | 346 |
| 139 | 3300025321 | Ga0207656_10092070 | Ga0207656_100920701 | 346 |
| 140 | 3300025913 | Ga0207695_10000044 | Ga0207695_10000044206 | 346 |
| 141 | 3300025914 | Ga0207671_10006361 | Ga0207671_100063619 | 346 |
| 142 | 3300025949 | Ga0207667_10380115 | Ga0207667_103801151 | 346 |
| 143 | 3300028379 | Ga0268266_10048955 | Ga0268266_100489554 | 346 |
| 144 | 3300046492 | Ga0495585_0139672 | Ga0495585_0139672_178_1239 | 346 |
| 145 | 3300048903 | Ga0496100_0004161 | Ga0496100_0004161_6055_7125 | 346 |
| 146 | 3300048905 | Ga0496102_0002571 | Ga0496102_0002571_12773_13843 | 346 |
| 147 | 3300048906 | Ga0496103_0011657 | Ga0496103_0011657_2037_3107 | 346 |
| 148 | 3300048909 | Ga0496106_0194970 | Ga0496106_0194970_275_1345 | 346 |
| 149 | 3300048910 | Ga0496107_0132845 | Ga0496107_0132845_685_1755 | 346 |
| 150 | 3300048919 | Ga0496116_0033300 | Ga0496116_0033300_2383_3453 | 346 |
| 151 | 3300048920 | Ga0496117_0001113 | Ga0496117_0001113_39243_40313 | 346 |
| 152 | 3300048921 | Ga0496118_0002207 | Ga0496118_0002207_22464_23534 | 346 |
| 153 | 3300048922 | Ga0496119_0114844 | Ga0496119_0114844_235_1305 | 346 |
| 154 | 3300048923 | Ga0496120_0018689 | Ga0496120_0018689_3153_4223 | 346 |
| 155 | 3300048924 | Ga0496121_0003282 | Ga0496121_0003282_431_1501 | 346 |
| 156 | 3300048925 | Ga0496122_0003250 | Ga0496122_0003250_15131_16201 | 346 |
| 157 | 3300048926 | Ga0496123_0002687 | Ga0496123_0002687_7055_8125 | 346 |
| 158 | 3300048927 | Ga0496124_0016929 | Ga0496124_0016929_4298_5368 | 346 |
| 159 | 3300048928 | Ga0496125_0002993 | Ga0496125_0002993_15241_16311 | 346 |
| 160 | 3300048929 | Ga0496126_0151971 | Ga0496126_0151971_522_1592 | 346 |
| 161 | iso_pu_bacteria | 2510917026 | 2511169270 | 346 |
| 162 | iso_pu_bacteria | 2919171160 | 2919174071 | 346 |
| 163 | iso_pu_bacteria | 8054563764 | 8054566958 | 346 |
| 164 | 3300009553 | Ga0105249_10405042 | Ga0105249_104050421 | 347 |
| 165 | 3300013306 | Ga0163162_10006607 | Ga0163162_100066076 | 347 |
| 166 | 3300039093 | Ga0400489_28284 | Ga0400489_28284_1960_3099 | 347 |
| 167 | 3300050515 | nmdc:mga0a205_66626_c1 | nmdc:mga0a205_66626_c1_230_1276 | 347 |
| 168 | 3300053161 | Ga0500634_0000020 | Ga0500634_0000020_43904_44947 | 347 |
| 169 | iso_pu_bacteria | 2643221591 | 2643965462 | 347 |
| 170 | iso_pu_bacteria | 8019565922 | 8019569063 | 347 |
| 171 | 3300053153 | Ga0500616_0000154 | Ga0500616_0000154_22568_23635 | 348 |
| 172 | 3300053158 | Ga0500627_0108538 | Ga0500627_0108538_26_1093 | 348 |
| 173 | iso_pu_bacteria | 2852387548 | 2852394356 | 348 |
| 174 | iso_pu_bacteria | 8054563764 | 8054566968 | 348 |
| 175 | 3300028800 | Ga0265338_10000092 | Ga0265338_10000092130 | 349 |
| 176 | 3300031901 | Ga0307406_10118811 | Ga0307406_101188111 | 349 |
| 177 | 3300042876 | Ga0451577_0036995 | Ga0451577_0036995_1774_2826 | 349 |
| 178 | 3300046616 | Ga0495668_0130456 | Ga0495668_0130456_167_1225 | 349 |
| 179 | 3300046660 | Ga0495625_0009866 | Ga0495625_0009866_1678_2736 | 349 |
| 180 | 3300049586 | Ga0501070_0124994 | Ga0501070_0124994_119_1168 | 349 |
| 181 | 3300053151 | Ga0500604_0010123 | Ga0500604_0010123_1450_2508 | 349 |
| 182 | 3300054114 | Ga0501084_0289740 | Ga0501084_0289740_282_1334 | 349 |
| 183 | iso_pu_bacteria | 2503198000 | 2503199806 | 349 |
| 184 | iso_pu_bacteria | 2507262055 | 2507508304 | 349 |
| 185 | iso_pu_bacteria | 2508501009 | 2508542370 | 349 |
| 186 | iso_pu_bacteria | 2508501042 | 2508691875 | 349 |
| 187 | iso_pu_bacteria | 2508501128 | 2509151623 | 349 |
| 188 | iso_pu_bacteria | 2513237094 | 2513640614 | 349 |
| 189 | iso_pu_bacteria | 2515154112 | 2515627194 | 349 |
| 190 | iso_pu_bacteria | 2528768022 | 2528848586 | 349 |
| 191 | iso_pu_bacteria | 2791355197 | 2793068819 | 349 |
| 192 | iso_pu_bacteria | 2824600985 | 2824602450 | 349 |
| 193 | iso_pu_bacteria | 2824609381 | 2824610435 | 349 |
| 194 | iso_pu_bacteria | 2824653114 | 2824657387 | 349 |
| 195 | iso_pu_bacteria | 2824661429 | 2824661473 | 349 |
| 196 | iso_pu_bacteria | 2844315083 | 2844319328 | 349 |
| 197 | iso_pu_bacteria | 2874590934 | 2874598330 | 349 |
| 198 | iso_pu_bacteria | 2874628541 | 2874632161 | 349 |
| 199 | iso_pu_bacteria | 2874645413 | 2874652614 | 349 |
| 200 | iso_pu_bacteria | 2876761206 | 2876764860 | 349 |
| 201 | iso_pu_bacteria | 2876771140 | 2876778192 | 349 |
| 202 | iso_pu_bacteria | 2876818435 | 2876825939 | 349 |
| 203 | iso_pu_bacteria | 2879074833 | 2879081986 | 349 |
| 204 | iso_pu_bacteria | 2879099564 | 2879104577 | 349 |
| 205 | iso_pu_bacteria | 2879127579 | 2879135108 | 349 |
| 206 | iso_pu_bacteria | 2879142872 | 2879149792 | 349 |
| 207 | iso_pu_bacteria | 2885409591 | 2885410472 | 349 |
| 208 | iso_pu_bacteria | 2888388044 | 2888393536 | 349 |
| 209 | iso_pu_bacteria | 2888419890 | 2888424810 | 349 |
| 210 | iso_pu_bacteria | 2903727486 | 2903734269 | 349 |
| 211 | iso_pu_bacteria | 2906602504 | 2906605514 | 349 |
| 212 | iso_pu_bacteria | 2922368715 | 2922374745 | 349 |
| 213 | iso_pu_bacteria | 2929615660 | 2929621818 | 349 |
| 214 | iso_pu_bacteria | 2929624759 | 2929629875 | 349 |
| 215 | iso_pu_bacteria | 2932784394 | 2932788678 | 349 |
| 216 | iso_pu_bacteria | 2932794094 | 2932798079 | 349 |
| 217 | iso_pu_bacteria | 2932801729 | 2932807065 | 349 |
| 218 | iso_pu_bacteria | 2932809354 | 2932817381 | 349 |
| 219 | iso_pu_bacteria | 2932818245 | 2932826150 | 349 |
| 220 | iso_pu_bacteria | 2932828146 | 2932830326 | 349 |
| 221 | iso_pu_bacteria | 2933577622 | 2933583906 | 349 |
| 222 | iso_pu_bacteria | 2935608549 | 2935609211 | 349 |
| 223 | iso_pu_bacteria | 2935616580 | 2935616617 | 349 |
| 224 | iso_pu_bacteria | 2935638405 | 2935642053 | 349 |
| 225 | iso_pu_bacteria | 2935648319 | 2935650987 | 349 |
| 226 | iso_pu_bacteria | 2935656913 | 2935659168 | 349 |
| 227 | iso_pu_bacteria | 2935665750 | 2935672563 | 349 |
| 228 | iso_pu_bacteria | 2935675223 | 2935675966 | 349 |
| 229 | iso_pu_bacteria | 2935684952 | 2935685963 | 349 |
| 230 | iso_pu_bacteria | 2935694250 | 2935697792 | 349 |
| 231 | iso_pu_bacteria | 2935703347 | 2935705804 | 349 |
| 232 | iso_pu_bacteria | 2935713505 | 2935714515 | 349 |
| 233 | iso_pu_bacteria | 2935722832 | 2935725134 | 349 |
| 234 | iso_pu_bacteria | 2935732158 | 2935732506 | 349 |
| 235 | iso_pu_bacteria | 2935741537 | 2935741885 | 349 |
| 236 | iso_pu_bacteria | 2935750917 | 2935751928 | 349 |
| 237 | iso_pu_bacteria | 2935760218 | 2935765181 | 349 |
| 238 | iso_pu_bacteria | 2935769743 | 2935771777 | 349 |
| 239 | iso_pu_bacteria | 2935777560 | 2935778784 | 349 |
| 240 | iso_pu_bacteria | 2935785616 | 2935788828 | 349 |
| 241 | iso_pu_bacteria | 2935793552 | 2935795372 | 349 |
| 242 | iso_pu_bacteria | 2935801545 | 2935802801 | 349 |
| 243 | iso_pu_bacteria | 2935810662 | 2935813367 | 349 |
| 244 | iso_pu_bacteria | 2935819856 | 2935822371 | 349 |
| 245 | iso_pu_bacteria | 2935827899 | 2935830220 | 349 |
| 246 | iso_pu_bacteria | 2935837841 | 2935838117 | 349 |
| 247 | iso_pu_bacteria | 2935847175 | 2935847953 | 349 |
| 248 | iso_pu_bacteria | 2935855204 | 2935855241 | 349 |
| 249 | iso_pu_bacteria | 2935864058 | 2935867496 | 349 |
| 250 | iso_pu_bacteria | 2935873716 | 2935875666 | 349 |
| 251 | iso_pu_bacteria | 2935883170 | 2935886807 | 349 |
| 252 | iso_pu_bacteria | 2935908558 | 2935908827 | 349 |
| 253 | iso_pu_bacteria | 2935916978 | 2935919547 | 349 |
| 254 | iso_pu_bacteria | 2935926038 | 2935926599 | 349 |
| 255 | iso_pu_bacteria | 2935934488 | 2935935049 | 349 |
| 256 | iso_pu_bacteria | 2935942939 | 2935943499 | 349 |
| 257 | iso_pu_bacteria | 2935951376 | 2935951937 | 349 |
| 258 | iso_pu_bacteria | 2935959822 | 2935960695 | 349 |
| 259 | iso_pu_bacteria | 2935967501 | 2935968062 | 349 |
| 260 | iso_pu_bacteria | 2935975950 | 2935978688 | 349 |
| 261 | iso_pu_bacteria | 2935984226 | 2935987440 | 349 |
| 262 | iso_pu_bacteria | 2935992306 | 2935996349 | 349 |
| 263 | iso_pu_bacteria | 2936002035 | 2936003632 | 349 |
| 264 | iso_pu_bacteria | 2936011229 | 2936013583 | 349 |
| 265 | iso_pu_bacteria | 2936019824 | 2936022290 | 349 |
| 266 | iso_pu_bacteria | 2936028420 | 2936030736 | 349 |
| 267 | iso_pu_bacteria | 2936037263 | 2936042316 | 349 |
| 268 | iso_pu_bacteria | 2936046547 | 2936048549 | 349 |
| 269 | iso_pu_bacteria | 2936055302 | 2936058763 | 349 |
| 270 | iso_pu_bacteria | 2940556831 | 2940557269 | 349 |
| 271 | iso_pu_bacteria | 2941531003 | 2941533087 | 349 |
| 272 | iso_pu_bacteria | 2941538514 | 2941539216 | 349 |
| 273 | iso_pu_bacteria | 3005594810 | 3005599516 | 349 |
| 274 | iso_pu_bacteria | 3005710791 | 3005715187 | 349 |
| 275 | iso_pu_bacteria | 3005718088 | 3005722574 | 349 |
| 276 | iso_pu_bacteria | 8016511872 | 8016521978 | 349 |
| 277 | iso_pu_bacteria | 8016522445 | 8016529336 | 349 |
| 278 | iso_pu_bacteria | 8016530956 | 8016534551 | 349 |
| 279 | iso_pu_bacteria | 8016539877 | 8016547769 | 349 |
| 280 | iso_pu_bacteria | 8016548790 | 8016554367 | 349 |
| 281 | iso_pu_bacteria | 8016557553 | 8016562735 | 349 |
| 282 | iso_pu_bacteria | 8016575299 | 8016577052 | 349 |
| 283 | iso_pu_bacteria | 8016595262 | 8016600519 | 349 |
| 284 | iso_pu_bacteria | 8016603502 | 8016610227 | 349 |
| 285 | iso_pu_bacteria | 8016613128 | 8016614706 | 349 |
| 286 | iso_pu_bacteria | 8016622563 | 8016626284 | 349 |
| 287 | iso_pu_bacteria | 8016630954 | 8016640022 | 349 |
| 288 | iso_pu_bacteria | 8017057580 | 8017063687 | 349 |
| 289 | iso_pu_bacteria | 8019530166 | 8019534314 | 349 |
| 290 | iso_pu_bacteria | 8019538911 | 8019545146 | 349 |
| 291 | iso_pu_bacteria | 8019547302 | 8019553377 | 349 |
| 292 | iso_pu_bacteria | 8019576017 | 8019583017 | 349 |
| 293 | iso_pu_bacteria | 8019586578 | 8019590814 | 349 |
| 294 | iso_pu_bacteria | 8019597564 | 8019600535 | 349 |
| 295 | iso_pu_bacteria | 8019608314 | 8019618012 | 349 |
| 296 | iso_pu_bacteria | 8019619141 | 8019628489 | 349 |
| 297 | iso_pu_bacteria | 8019629233 | 8019634145 | 349 |
| 298 | iso_pu_bacteria | 8019659431 | 8019662024 | 349 |
| 299 | iso_pu_bacteria | 8019678201 | 8019684555 | 349 |
| 300 | iso_pu_bacteria | 8019687851 | 8019690364 | 349 |
| 301 | iso_pu_bacteria | 8055742211 | 8055746016 | 349 |
| 302 | iso_pu_bacteria | 8056967851 | 8056968304 | 349 |
| 303 | 3300003781 | Ga0055536_1003653 | Ga0055536_10036536 | 350 |
| 304 | 3300003792 | Ga0055540_1004229 | Ga0055540_10042292 | 350 |
| 305 | 3300003794 | Ga0055531_10002995 | Ga0055531_100029958 | 350 |
| 306 | 3300009093 | Ga0105240_10011470 | Ga0105240_100114705 | 350 |
| 307 | 3300010375 | Ga0105239_10031739 | Ga0105239_100317394 | 350 |
| 308 | 3300025292 | Ga0209676_1000580 | Ga0209676_100058048 | 350 |
| 309 | 3300025297 | Ga0209758_1001509 | Ga0209758_100150919 | 350 |
| 310 | 3300025298 | Ga0209050_1011385 | Ga0209050_10113853 | 350 |
| 311 | 3300025303 | Ga0209051_1004819 | Ga0209051_10048192 | 350 |
| 312 | 3300025304 | Ga0209257_1001372 | Ga0209257_100137222 | 350 |
| 313 | 3300044706 | Ga0466964_0026404 | Ga0466964_0026404_766_1818 | 350 |
| 314 | 3300048910 | Ga0496107_0014142 | Ga0496107_0014142_2736_3788 | 350 |
| 315 | 3300048913 | Ga0496110_0329352 | Ga0496110_0329352_67_1122 | 350 |
| 316 | 3300048921 | Ga0496118_0091952 | Ga0496118_0091952_795_1847 | 350 |
| 317 | 3300053153 | Ga0500616_0020018 | Ga0500616_0020018_2263_3315 | 350 |
| 318 | 3300053156 | Ga0500622_0009106 | Ga0500622_0009106_195_1247 | 350 |
| 319 | iso_pu_bacteria | 2513237160 | 2514008676 | 350 |
| 320 | iso_pu_bacteria | 2671180139 | 2671695655 | 350 |
| 321 | iso_pu_bacteria | 2928521798 | 2928522500 | 350 |
| 322 | iso_pu_bacteria | 2954011201 | 2954014104 | 350 |
| 323 | iso_pu_bacteria | 2960631154 | 2960633617 | 350 |
| 324 | iso_pu_bacteria | 2970122695 | 2970128005 | 350 |
| 325 | 3300006051 | Ga0075364_10004240 | Ga0075364_100042406 | 351 |
| 326 | 3300006844 | Ga0075428_100321987 | Ga0075428_1003219872 | 351 |
| 327 | 3300006847 | Ga0075431_100108731 | Ga0075431_1001087312 | 351 |
| 328 | 3300006880 | Ga0075429_100205242 | Ga0075429_1002052421 | 351 |
| 329 | 3300025901 | Ga0207688_10028561 | Ga0207688_100285611 | 351 |
| 330 | 3300025937 | Ga0207669_10177271 | Ga0207669_101772711 | 351 |
| 331 | 3300031995 | Ga0307409_100103111 | Ga0307409_1001031112 | 351 |
| 332 | 3300045051 | Ga0451576_0007753 | Ga0451576_0007753_5076_6137 | 351 |
| 333 | 3300046615 | Ga0495656_0010707 | Ga0495656_0010707_1305_2381 | 351 |
| 334 | 3300049574 | Ga0501038_0046396 | Ga0501038_0046396_389_1453 | 351 |
| 335 | 3300049592 | Ga0501076_0009957 | Ga0501076_0009957_2969_4033 | 351 |
| 336 | 3300050510 | nmdc:mga06r32_208713_c1 | nmdc:mga06r32_208713_c1_745_1830 | 351 |
| 337 | 3300061734 | Ga0530510_0256881 | Ga0530510_0256881_118_1182 | 351 |
| 338 | iso_pu_bacteria | 2513237092 | 2513622434 | 351 |
| 339 | iso_pu_bacteria | 2513237095 | 2513645541 | 351 |
| 340 | iso_pu_bacteria | 2513237096 | 2513657851 | 351 |
| 341 | iso_pu_bacteria | 2513237101 | 2513692864 | 351 |
| 342 | iso_pu_bacteria | 2513237102 | 2513702390 | 351 |
| 343 | iso_pu_bacteria | 2513237104 | 2513718473 | 351 |
| 344 | iso_pu_bacteria | 2513237137 | 2513855551 | 351 |
| 345 | iso_pu_bacteria | 2513237139 | 2513873052 | 351 |
| 346 | iso_pu_bacteria | 2513237145 | 2513920056 | 351 |
| 347 | iso_pu_bacteria | 2513237161 | 2514015650 | 351 |
| 348 | iso_pu_bacteria | 2517093001 | 2517102761 | 351 |
| 349 | iso_pu_bacteria | 2517572143 | 2517892096 | 351 |
| 350 | iso_pu_bacteria | 2524023205 | 2524437632 | 351 |
| 351 | iso_pu_bacteria | 2524023228 | 2524534180 | 351 |
| 352 | iso_pu_bacteria | 2617270735 | 2617347085 | 351 |
| 353 | iso_pu_bacteria | 2617270741 | 2617375480 | 351 |
| 354 | iso_pu_bacteria | 2643221547 | 2643758383 | 351 |
| 355 | iso_pu_bacteria | 2667528175 | 2671121866 | 351 |
| 356 | iso_pu_bacteria | 2721755755 | 2723844769 | 351 |
| 357 | iso_pu_bacteria | 2728368998 | 2728751100 | 351 |
| 358 | iso_pu_bacteria | 2744054633 | 2745079565 | 351 |
| 359 | iso_pu_bacteria | 2791355196 | 2793062685 | 351 |
| 360 | iso_pu_bacteria | 2791355199 | 2793079887 | 351 |
| 361 | iso_pu_bacteria | 2802429603 | 2805915049 | 351 |
| 362 | iso_pu_bacteria | 2816332527 | 2818238588 | 351 |
| 363 | iso_pu_bacteria | 2824617872 | 2824618012 | 351 |
| 364 | iso_pu_bacteria | 2824626560 | 2824626680 | 351 |
| 365 | iso_pu_bacteria | 2824635225 | 2824636685 | 351 |
| 366 | iso_pu_bacteria | 2824644064 | 2824648988 | 351 |
| 367 | iso_pu_bacteria | 2824671348 | 2824674905 | 351 |
| 368 | iso_pu_bacteria | 2824679649 | 2824685820 | 351 |
| 369 | iso_pu_bacteria | 2824687955 | 2824691330 | 351 |
| 370 | iso_pu_bacteria | 2824696289 | 2824699490 | 351 |
| 371 | iso_pu_bacteria | 2824704595 | 2824711558 | 351 |
| 372 | iso_pu_bacteria | 2824714736 | 2824719276 | 351 |
| 373 | iso_pu_bacteria | 2824723954 | 2824729681 | 351 |
| 374 | iso_pu_bacteria | 2824732956 | 2824733358 | 351 |
| 375 | iso_pu_bacteria | 2824746037 | 2824746515 | 351 |
| 376 | iso_pu_bacteria | 2824753945 | 2824754262 | 351 |
| 377 | iso_pu_bacteria | 2824763712 | 2824768999 | 351 |
| 378 | iso_pu_bacteria | 2824773399 | 2824775343 | 351 |
| 379 | iso_pu_bacteria | 2838122688 | 2838123441 | 351 |
| 380 | iso_pu_bacteria | 2841941048 | 2841947786 | 351 |
| 381 | iso_pu_bacteria | 2841949485 | 2841949543 | 351 |
| 382 | iso_pu_bacteria | 2841957949 | 2841964138 | 351 |
| 383 | iso_pu_bacteria | 2841966195 | 2841971950 | 351 |
| 384 | iso_pu_bacteria | 2841974524 | 2841974707 | 351 |
| 385 | iso_pu_bacteria | 2841983080 | 2841983735 | 351 |
| 386 | iso_pu_bacteria | 2842038055 | 2842040095 | 351 |
| 387 | iso_pu_bacteria | 2842045827 | 2842046960 | 351 |
| 388 | iso_pu_bacteria | 2847930680 | 2847936507 | 351 |
| 389 | iso_pu_bacteria | 2847939898 | 2847946853 | 351 |
| 390 | iso_pu_bacteria | 2849076700 | 2849079044 | 351 |
| 391 | iso_pu_bacteria | 2857509624 | 2857516706 | 351 |
| 392 | iso_pu_bacteria | 2874604998 | 2874605510 | 351 |
| 393 | iso_pu_bacteria | 2874612657 | 2874619465 | 351 |
| 394 | iso_pu_bacteria | 2874620515 | 2874627519 | 351 |
| 395 | iso_pu_bacteria | 2876808645 | 2876813056 | 351 |
| 396 | iso_pu_bacteria | 2879083081 | 2879089457 | 351 |
| 397 | iso_pu_bacteria | 2879110137 | 2879115830 | 351 |
| 398 | iso_pu_bacteria | 2881364244 | 2881368569 | 351 |
| 399 | iso_pu_bacteria | 2881665667 | 2881672616 | 351 |
| 400 | iso_pu_bacteria | 2885366525 | 2885369178 | 351 |
| 401 | iso_pu_bacteria | 2885374607 | 2885381711 | 351 |
| 402 | iso_pu_bacteria | 2888378607 | 2888384382 | 351 |
| 403 | iso_pu_bacteria | 2889033259 | 2889039468 | 351 |
| 404 | iso_pu_bacteria | 2903748898 | 2903753390 | 351 |
| 405 | iso_pu_bacteria | 2904666416 | 2904673161 | 351 |
| 406 | iso_pu_bacteria | 2904690495 | 2904694838 | 351 |
| 407 | iso_pu_bacteria | 2904699407 | 2904702218 | 351 |
| 408 | iso_pu_bacteria | 2904711408 | 2904714985 | 351 |
| 409 | iso_pu_bacteria | 2906610324 | 2906617227 | 351 |
| 410 | iso_pu_bacteria | 2906626472 | 2906633616 | 351 |
| 411 | iso_pu_bacteria | 2906635258 | 2906643384 | 351 |
| 412 | iso_pu_bacteria | 2906643746 | 2906651294 | 351 |
| 413 | iso_pu_bacteria | 2906660503 | 2906662485 | 351 |
| 414 | iso_pu_bacteria | 2908739725 | 2908742376 | 351 |
| 415 | iso_pu_bacteria | 2908756301 | 2908760058 | 351 |
| 416 | iso_pu_bacteria | 2908775508 | 2908780460 | 351 |
| 417 | iso_pu_bacteria | 2922361189 | 2922365646 | 351 |
| 418 | iso_pu_bacteria | 2922386360 | 2922391261 | 351 |
| 419 | iso_pu_bacteria | 2922393267 | 2922400515 | 351 |
| 420 | iso_pu_bacteria | 2922425934 | 2922430602 | 351 |
| 421 | iso_pu_bacteria | 2935630451 | 2935631233 | 351 |
| 422 | iso_pu_bacteria | 2941507105 | 2941509974 | 351 |
| 423 | iso_pu_bacteria | 2941515067 | 2941518939 | 351 |
| 424 | iso_pu_bacteria | 2941523033 | 2941525373 | 351 |
| 425 | iso_pu_bacteria | 3005474847 | 3005480512 | 351 |
| 426 | iso_pu_bacteria | 3005483717 | 3005484601 | 351 |
| 427 | iso_pu_bacteria | 3005506211 | 3005510599 | 351 |
| 428 | iso_pu_bacteria | 3005587118 | 3005587761 | 351 |
| 429 | iso_pu_bacteria | 8006926726 | 8006931535 | 351 |
| 430 | iso_pu_bacteria | 8006933436 | 8006940264 | 351 |
| 431 | iso_pu_bacteria | 8006964411 | 8006967021 | 351 |
| 432 | iso_pu_bacteria | 8006973647 | 8006980042 | 351 |
| 433 | iso_pu_bacteria | 8006984368 | 8006987975 | 351 |
| 434 | iso_pu_bacteria | 8006994254 | 8006995705 | 351 |
| 435 | iso_pu_bacteria | 8019555841 | 8019556247 | 351 |
| 436 | iso_pu_bacteria | 8019648815 | 8019658828 | 351 |
| 437 | iso_pu_bacteria | 8056673599 | 8056677661 | 351 |
| 438 | iso_pu_bacteria | 8056689827 | 8056694252 | 351 |
| 439 | 3300002987 | JGI25159J45721_1000210 | JGI25159J45721_100021011 | 352 |
| 440 | 3300003354 | JGI25160J50197_1000069 | JGI25160J50197_100006925 | 352 |
| 441 | 3300003374 | JGI25161J50226_1000049 | JGI25161J50226_100004995 | 352 |
| 442 | 3300004625 | Ga0055543_1000024 | Ga0055543_100002480 | 352 |
| 443 | 3300005262 | Ga0065165_1000202 | Ga0065165_100020260 | 352 |
| 444 | 3300005355 | Ga0070671_100007098 | Ga0070671_1000070983 | 352 |
| 445 | 3300006175 | Ga0070712_100211177 | Ga0070712_1002111771 | 352 |
| 446 | 3300009177 | Ga0105248_10000471 | Ga0105248_1000047125 | 352 |
| 447 | 3300013306 | Ga0163162_10035411 | Ga0163162_100354113 | 352 |
| 448 | 3300020070 | Ga0206356_10283358 | Ga0206356_102833581 | 352 |
| 449 | 3300020077 | Ga0206351_10620691 | Ga0206351_106206911 | 352 |
| 450 | 3300020080 | Ga0206350_10527760 | Ga0206350_105277602 | 352 |
| 451 | 3300020082 | Ga0206353_10224996 | Ga0206353_102249961 | 352 |
| 452 | 3300022467 | Ga0224712_10037983 | Ga0224712_100379831 | 352 |
| 453 | 3300025284 | Ga0209130_1000013 | Ga0209130_1000013132 | 352 |
| 454 | 3300025302 | Ga0207426_1000022 | Ga0207426_1000022250 | 352 |
| 455 | 3300025931 | Ga0207644_10014331 | Ga0207644_100143313 | 352 |
| 456 | 3300025941 | Ga0207711_10009143 | Ga0207711_1000914310 | 352 |
| 457 | 3300028794 | Ga0307515_10000950 | Ga0307515_1000095028 | 352 |
| 458 | 3300031730 | Ga0307516_10063808 | Ga0307516_100638083 | 352 |
| 459 | 3300031852 | Ga0307410_10027386 | Ga0307410_100273863 | 352 |
| 460 | 3300048922 | Ga0496119_0040194 | Ga0496119_0040194_279_1352 | 352 |
| 461 | 3300048924 | Ga0496121_0023452 | Ga0496121_0023452_2783_3856 | 352 |
| 462 | 3300048928 | Ga0496125_0087127 | Ga0496125_0087127_553_1611 | 352 |
| 463 | 3300049591 | Ga0501075_0319266 | Ga0501075_0319266_83_1150 | 352 |
| 464 | 3300053151 | Ga0500604_0000229 | Ga0500604_0000229_4416_5483 | 352 |
| 465 | 3300003752 | Ga0055539_1001746 | Ga0055539_10017462 | 353 |
| 466 | 3300004625 | Ga0055543_1021435 | Ga0055543_10214351 | 353 |
| 467 | 3300005262 | Ga0065165_1004658 | Ga0065165_10046582 | 353 |
| 468 | 3300005434 | Ga0070709_10015742 | Ga0070709_100157423 | 353 |
| 469 | 3300005435 | Ga0070714_100019885 | Ga0070714_1000198852 | 353 |
| 470 | 3300005435 | Ga0070714_100046922 | Ga0070714_1000469222 | 353 |
| 471 | 3300005435 | Ga0070714_100123907 | Ga0070714_1001239071 | 353 |
| 472 | 3300005436 | Ga0070713_100131027 | Ga0070713_1001310272 | 353 |
| 473 | 3300005437 | Ga0070710_10000567 | Ga0070710_1000056711 | 353 |
| 474 | 3300005439 | Ga0070711_100003646 | Ga0070711_1000036465 | 353 |
| 475 | 3300005455 | Ga0070663_100338757 | Ga0070663_1003387571 | 353 |
| 476 | 3300005458 | Ga0070681_10061567 | Ga0070681_100615672 | 353 |
| 477 | 3300005459 | Ga0068867_100214950 | Ga0068867_1002149501 | 353 |
| 478 | 3300005539 | Ga0068853_100074704 | Ga0068853_1000747042 | 353 |
| 479 | 3300005549 | Ga0070704_100265590 | Ga0070704_1002655901 | 353 |
| 480 | 3300005578 | Ga0068854_100335245 | Ga0068854_1003352452 | 353 |
| 481 | 3300005616 | Ga0068852_100002288 | Ga0068852_1000022883 | 353 |
| 482 | 3300005617 | Ga0068859_100135465 | Ga0068859_1001354652 | 353 |
| 483 | 3300005983 | Ga0081540_1005876 | Ga0081540_10058768 | 353 |
| 484 | 3300006038 | Ga0075365_10239829 | Ga0075365_102398292 | 353 |
| 485 | 3300006175 | Ga0070712_100032973 | Ga0070712_1000329732 | 353 |
| 486 | 3300006847 | Ga0075431_100060543 | Ga0075431_1000605433 | 353 |
| 487 | 3300006931 | Ga0097620_100135460 | Ga0097620_1001354602 | 353 |
| 488 | 3300009093 | Ga0105240_10011032 | Ga0105240_1001103210 | 353 |
| 489 | 3300009147 | Ga0114129_10039254 | Ga0114129_100392544 | 353 |
| 490 | 3300009174 | Ga0105241_10054453 | Ga0105241_100544532 | 353 |
| 491 | 3300009545 | Ga0105237_10009082 | Ga0105237_1000908210 | 353 |
| 492 | 3300010375 | Ga0105239_10068450 | Ga0105239_100684502 | 353 |
| 493 | 3300013104 | Ga0157370_10030134 | Ga0157370_100301343 | 353 |
| 494 | 3300013104 | Ga0157370_10103522 | Ga0157370_101035222 | 353 |
| 495 | 3300025230 | Ga0209563_102298 | Ga0209563_1022982 | 353 |
| 496 | 3300025253 | Ga0209677_101018 | Ga0209677_1010185 | 353 |
| 497 | 3300025253 | Ga0209677_101344 | Ga0209677_1013444 | 353 |
| 498 | 3300025254 | Ga0209148_1000475 | Ga0209148_100047524 | 353 |
| 499 | 3300025261 | Ga0209233_1002540 | Ga0209233_10025403 | 353 |
| 500 | 3300025261 | Ga0209233_1010781 | Ga0209233_10107812 | 353 |
| 501 | 3300025272 | Ga0209455_1001935 | Ga0209455_10019353 | 353 |
| 502 | 3300025297 | Ga0209758_1007908 | Ga0209758_10079083 | 353 |
| 503 | 3300025898 | Ga0207692_10009738 | Ga0207692_100097382 | 353 |
| 504 | 3300025911 | Ga0207654_10067398 | Ga0207654_100673981 | 353 |
| 505 | 3300025913 | Ga0207695_10000008 | Ga0207695_1000000857 | 353 |
| 506 | 3300025914 | Ga0207671_10010828 | Ga0207671_100108282 | 353 |
| 507 | 3300025915 | Ga0207693_10000581 | Ga0207693_1000058111 | 353 |
| 508 | 3300025916 | Ga0207663_10000084 | Ga0207663_1000008418 | 353 |
| 509 | 3300025916 | Ga0207663_10214559 | Ga0207663_102145592 | 353 |
| 510 | 3300025919 | Ga0207657_10018566 | Ga0207657_100185664 | 353 |
| 511 | 3300025928 | Ga0207700_10133971 | Ga0207700_101339712 | 353 |
| 512 | 3300025929 | Ga0207664_10024979 | Ga0207664_100249792 | 353 |
| 513 | 3300025929 | Ga0207664_10107250 | Ga0207664_101072502 | 353 |
| 514 | 3300025933 | Ga0207706_10102247 | Ga0207706_101022471 | 353 |
| 515 | 3300025939 | Ga0207665_10003511 | Ga0207665_100035117 | 353 |
| 516 | 3300026023 | Ga0207677_10043687 | Ga0207677_100436872 | 353 |
| 517 | 3300026067 | Ga0207678_10024738 | Ga0207678_100247382 | 353 |
| 518 | 3300026089 | Ga0207648_10050432 | Ga0207648_100504323 | 353 |
| 519 | 3300028379 | Ga0268266_10092365 | Ga0268266_100923651 | 353 |
| 520 | 3300028556 | Ga0265337_1002708 | Ga0265337_10027082 | 353 |
| 521 | 3300028558 | Ga0265326_10010670 | Ga0265326_100106702 | 353 |
| 522 | 3300028563 | Ga0265319_1004129 | Ga0265319_10041292 | 353 |
| 523 | 3300028573 | Ga0265334_10001756 | Ga0265334_100017563 | 353 |
| 524 | 3300028653 | Ga0265323_10001892 | Ga0265323_100018927 | 353 |
| 525 | 3300028666 | Ga0265336_10003392 | Ga0265336_100033922 | 353 |
| 526 | 3300028800 | Ga0265338_10000321 | Ga0265338_1000032112 | 353 |
| 527 | 3300029957 | Ga0265324_10019180 | Ga0265324_100191801 | 353 |
| 528 | 3300031241 | Ga0265325_10000675 | Ga0265325_1000067520 | 353 |
| 529 | 3300031241 | Ga0265325_10010821 | Ga0265325_100108213 | 353 |
| 530 | 3300031247 | Ga0265340_10005245 | Ga0265340_100052454 | 353 |
| 531 | 3300031250 | Ga0265331_10037975 | Ga0265331_100379752 | 353 |
| 532 | 3300031595 | Ga0265313_10020638 | Ga0265313_100206382 | 353 |
| 533 | 3300031616 | Ga0307508_10189556 | Ga0307508_101895561 | 353 |
| 534 | 3300031711 | Ga0265314_10009137 | Ga0265314_100091372 | 353 |
| 535 | 3300031711 | Ga0265314_10011261 | Ga0265314_100112615 | 353 |
| 536 | 3300031712 | Ga0265342_10017129 | Ga0265342_100171293 | 353 |
| 537 | 3300033180 | Ga0307510_10008141 | Ga0307510_100081419 | 353 |
| 538 | 3300035117 | Ga0373953_0012229 | Ga0373953_0012229_136_1197 | 353 |
| 539 | 3300035120 | Ga0373957_0010237 | Ga0373957_0010237_1097_2158 | 353 |
| 540 | 3300035172 | Ga0373955_0027657 | Ga0373955_0027657_1007_2068 | 353 |
| 541 | 3300035724 | Ga0373933_0187528 | Ga0373933_0187528_120_1181 | 353 |
| 542 | 3300036401 | Ga0373937_0027190 | Ga0373937_0027190_3858_4919 | 353 |
| 543 | 3300037466 | Ga0395898_0048176 | Ga0395898_0048176_444_1517 | 353 |
| 544 | 3300037466 | Ga0395898_0441700 | Ga0395898_0441700_45_1106 | 353 |
| 545 | 3300037471 | Ga0395905_0087304 | Ga0395905_0087304_1176_2237 | 353 |
| 546 | 3300038443 | Ga0395901_0364460 | Ga0395901_0364460_52_1125 | 353 |
| 547 | 3300039437 | Ga0436365_0771718 | Ga0436365_0771718_364_1425 | 353 |
| 548 | 3300039453 | Ga0436362_0716278 | Ga0436362_0716278_1819_2880 | 353 |
| 549 | 3300044684 | Ga0466966_0000065 | Ga0466966_0000065_2396_3457 | 353 |
| 550 | 3300044693 | Ga0466961_0000154 | Ga0466961_0000154_30264_31325 | 353 |
| 551 | 3300044694 | Ga0466963_0030858 | Ga0466963_0030858_153_1214 | 353 |
| 552 | 3300045049 | Ga0466959_0004864 | Ga0466959_0004864_5043_6104 | 353 |
| 553 | 3300045976 | Ga0466967_0007434 | Ga0466967_0007434_440_1501 | 353 |
| 554 | 3300045976 | Ga0466967_0062586 | Ga0466967_0062586_1566_2627 | 353 |
| 555 | 3300046455 | Ga0495603_0044614 | Ga0495603_0044614_1391_2452 | 353 |
| 556 | 3300046459 | Ga0495629_0015849 | Ga0495629_0015849_3022_4083 | 353 |
| 557 | 3300046459 | Ga0495629_0148235 | Ga0495629_0148235_430_1491 | 353 |
| 558 | 3300046460 | Ga0495638_0017268 | Ga0495638_0017268_2915_3976 | 353 |
| 559 | 3300046462 | Ga0495651_0000821 | Ga0495651_0000821_8345_9406 | 353 |
| 560 | 3300046462 | Ga0495651_0062573 | Ga0495651_0062573_1619_2680 | 353 |
| 561 | 3300046463 | Ga0495653_0053810 | Ga0495653_0053810_289_1350 | 353 |
| 562 | 3300046507 | Ga0495606_0008377 | Ga0495606_0008377_2591_3652 | 353 |
| 563 | 3300046516 | Ga0495628_0042818 | Ga0495628_0042818_1041_2102 | 353 |
| 564 | 3300046516 | Ga0495628_0125348 | Ga0495628_0125348_286_1347 | 353 |
| 565 | 3300046522 | Ga0495643_0055480 | Ga0495643_0055480_732_1793 | 353 |
| 566 | 3300046529 | Ga0495652_0084854 | Ga0495652_0084854_1503_2564 | 353 |
| 567 | 3300046533 | Ga0495640_0048507 | Ga0495640_0048507_1004_2065 | 353 |
| 568 | 3300046536 | Ga0495587_0011112 | Ga0495587_0011112_3886_4947 | 353 |
| 569 | 3300046536 | Ga0495587_0011231 | Ga0495587_0011231_1010_2071 | 353 |
| 570 | 3300046559 | Ga0495667_0050531 | Ga0495667_0050531_1664_2725 | 353 |
| 571 | 3300046663 | Ga0495635_0002471 | Ga0495635_0002471_7467_8528 | 353 |
| 572 | 3300046663 | Ga0495635_0102187 | Ga0495635_0102187_796_1857 | 353 |
| 573 | 3300046675 | Ga0495657_0025281 | Ga0495657_0025281_658_1719 | 353 |
| 574 | 3300046675 | Ga0495657_0028310 | Ga0495657_0028310_1753_2814 | 353 |
| 575 | 3300046678 | Ga0495599_0005682 | Ga0495599_0005682_4108_5169 | 353 |
| 576 | 3300046678 | Ga0495599_0006827 | Ga0495599_0006827_2774_3835 | 353 |
| 577 | 3300046679 | Ga0495623_0006077 | Ga0495623_0006077_2533_3594 | 353 |
| 578 | 3300046680 | Ga0495646_0087876 | Ga0495646_0087876_590_1651 | 353 |
| 579 | 3300046689 | Ga0495613_0170594 | Ga0495613_0170594_267_1328 | 353 |
| 580 | 3300046690 | Ga0495624_0062978 | Ga0495624_0062978_667_1728 | 353 |
| 581 | 3300046809 | Ga0495600_0039665 | Ga0495600_0039665_979_2040 | 353 |
| 582 | 3300047317 | Ga0495604_0018158 | Ga0495604_0018158_1349_2410 | 353 |
| 583 | 3300047322 | Ga0495680_0008204 | Ga0495680_0008204_6253_7314 | 353 |
| 584 | 3300047322 | Ga0495680_0022767 | Ga0495680_0022767_641_1702 | 353 |
| 585 | 3300047444 | Ga0495675_0012731 | Ga0495675_0012731_1906_2967 | 353 |
| 586 | 3300047444 | Ga0495675_0039422 | Ga0495675_0039422_1780_2841 | 353 |
| 587 | 3300048088 | Ga0495602_0002373 | Ga0495602_0002373_16448_17509 | 353 |
| 588 | 3300048907 | Ga0496104_0001608 | Ga0496104_0001608_7713_8774 | 353 |
| 589 | 3300048907 | Ga0496104_0040661 | Ga0496104_0040661_1637_2719 | 353 |
| 590 | 3300048908 | Ga0496105_0013595 | Ga0496105_0013595_250_1311 | 353 |
| 591 | 3300048909 | Ga0496106_0004195 | Ga0496106_0004195_6350_7411 | 353 |
| 592 | 3300048909 | Ga0496106_0114552 | Ga0496106_0114552_555_1616 | 353 |
| 593 | 3300048910 | Ga0496107_0005355 | Ga0496107_0005355_3947_5008 | 353 |
| 594 | 3300048912 | Ga0496109_0002891 | Ga0496109_0002891_5660_6721 | 353 |
| 595 | 3300048913 | Ga0496110_0006680 | Ga0496110_0006680_2601_3683 | 353 |
| 596 | 3300048914 | Ga0496111_0027351 | Ga0496111_0027351_1455_2537 | 353 |
| 597 | 3300048915 | Ga0496112_0015385 | Ga0496112_0015385_4826_5887 | 353 |
| 598 | 3300048917 | Ga0496114_0298942 | Ga0496114_0298942_310_1392 | 353 |
| 599 | 3300048918 | Ga0496115_0167310 | Ga0496115_0167310_736_1797 | 353 |
| 600 | 3300048921 | Ga0496118_0021354 | Ga0496118_0021354_1235_2299 | 353 |
| 601 | 3300048922 | Ga0496119_0003438 | Ga0496119_0003438_3103_4164 | 353 |
| 602 | 3300048923 | Ga0496120_0029886 | Ga0496120_0029886_1970_3031 | 353 |
| 603 | 3300048924 | Ga0496121_0015952 | Ga0496121_0015952_4314_5378 | 353 |
| 604 | 3300048924 | Ga0496121_0057763 | Ga0496121_0057763_624_1685 | 353 |
| 605 | 3300048924 | Ga0496121_0138248 | Ga0496121_0138248_428_1489 | 353 |
| 606 | 3300048927 | Ga0496124_0027613 | Ga0496124_0027613_3450_4511 | 353 |
| 607 | 3300048927 | Ga0496124_0030532 | Ga0496124_0030532_2327_3388 | 353 |
| 608 | 3300048928 | Ga0496125_0037091 | Ga0496125_0037091_3154_4215 | 353 |
| 609 | 3300048929 | Ga0496126_0004265 | Ga0496126_0004265_1441_2502 | 353 |
| 610 | 3300048929 | Ga0496126_0021670 | Ga0496126_0021670_2870_3931 | 353 |
| 611 | 3300048929 | Ga0496126_0059053 | Ga0496126_0059053_1033_2094 | 353 |
| 612 | 3300048929 | Ga0496126_0075342 | Ga0496126_0075342_334_1395 | 353 |
| 613 | 3300048929 | Ga0496126_0103663 | Ga0496126_0103663_1119_2186 | 353 |
| 614 | 3300049568 | Ga0501031_0026605 | Ga0501031_0026605_1437_2498 | 353 |
| 615 | 3300049569 | Ga0501032_0000619 | Ga0501032_0000619_13741_14802 | 353 |
| 616 | 3300049570 | Ga0501033_0000108 | Ga0501033_0000108_26041_27102 | 353 |
| 617 | 3300049570 | Ga0501033_0008940 | Ga0501033_0008940_3199_4287 | 353 |
| 618 | 3300049571 | Ga0501034_0000100 | Ga0501034_0000100_123108_124169 | 353 |
| 619 | 3300049572 | Ga0501036_0005602 | Ga0501036_0005602_4632_5720 | 353 |
| 620 | 3300049573 | Ga0501037_0000153 | Ga0501037_0000153_7271_8332 | 353 |
| 621 | 3300049573 | Ga0501037_0007559 | Ga0501037_0007559_5756_6844 | 353 |
| 622 | 3300049574 | Ga0501038_0000138 | Ga0501038_0000138_56142_57203 | 353 |
| 623 | 3300049575 | Ga0501039_0001334 | Ga0501039_0001334_10801_11862 | 353 |
| 624 | 3300049575 | Ga0501039_0021206 | Ga0501039_0021206_538_1626 | 353 |
| 625 | 3300049578 | Ga0501042_0030014 | Ga0501042_0030014_2174_3235 | 353 |
| 626 | 3300049579 | Ga0501043_0000085 | Ga0501043_0000085_52167_53228 | 353 |
| 627 | 3300049579 | Ga0501043_0000122 | Ga0501043_0000122_1678_2766 | 353 |
| 628 | 3300049580 | Ga0501046_0001536 | Ga0501046_0001536_20064_21152 | 353 |
| 629 | 3300049581 | Ga0501047_0000221 | Ga0501047_0000221_40307_41368 | 353 |
| 630 | 3300049582 | Ga0501048_0028911 | Ga0501048_0028911_468_1556 | 353 |
| 631 | 3300049583 | Ga0501067_0003478 | Ga0501067_0003478_847_1908 | 353 |
| 632 | 3300049584 | Ga0501068_0000689 | Ga0501068_0000689_14467_15528 | 353 |
| 633 | 3300049585 | Ga0501069_0009070 | Ga0501069_0009070_947_2008 | 353 |
| 634 | 3300049585 | Ga0501069_0019871 | Ga0501069_0019871_1591_2652 | 353 |
| 635 | 3300049585 | Ga0501069_0112356 | Ga0501069_0112356_312_1400 | 353 |
| 636 | 3300049586 | Ga0501070_0009879 | Ga0501070_0009879_4375_5463 | 353 |
| 637 | 3300049586 | Ga0501070_0070401 | Ga0501070_0070401_1318_2379 | 353 |
| 638 | 3300049587 | Ga0501071_0009224 | Ga0501071_0009224_1369_2430 | 353 |
| 639 | 3300049588 | Ga0501072_0001591 | Ga0501072_0001591_4306_5367 | 353 |
| 640 | 3300049588 | Ga0501072_0243898 | Ga0501072_0243898_223_1311 | 353 |
| 641 | 3300049589 | Ga0501073_0000290 | Ga0501073_0000290_16250_17311 | 353 |
| 642 | 3300049590 | Ga0501074_0000094 | Ga0501074_0000094_29895_30956 | 353 |
| 643 | 3300049741 | Ga0501079_0011578 | Ga0501079_0011578_4525_5586 | 353 |
| 644 | 3300049742 | Ga0501080_0000104 | Ga0501080_0000104_3416_4504 | 353 |
| 645 | 3300049742 | Ga0501080_0004806 | Ga0501080_0004806_7331_8392 | 353 |
| 646 | 3300049744 | Ga0501083_0000087 | Ga0501083_0000087_45548_46609 | 353 |
| 647 | 3300049822 | Ga0501035_0000016 | Ga0501035_0000016_237856_238944 | 353 |
| 648 | 3300049822 | Ga0501035_0000127 | Ga0501035_0000127_82017_83078 | 353 |
| 649 | 3300049822 | Ga0501035_0000223 | Ga0501035_0000223_46097_47158 | 353 |
| 650 | 3300049822 | Ga0501035_0029522 | Ga0501035_0029522_2977_4050 | 353 |
| 651 | 3300049823 | Ga0501044_0000970 | Ga0501044_0000970_1375_2436 | 353 |
| 652 | 3300049823 | Ga0501044_0093247 | Ga0501044_0093247_1099_2172 | 353 |
| 653 | 3300049824 | Ga0501045_0056865 | Ga0501045_0056865_645_1733 | 353 |
| 654 | 3300050507 | nmdc:mga05p37_157565_c1 | nmdc:mga05p37_157565_c1_1299_2378 | 353 |
| 655 | 3300050510 | nmdc:mga06r32_144049_c1 | nmdc:mga06r32_144049_c1_489_1550 | 353 |
| 656 | 3300053077 | Ga0495601_0009894 | Ga0495601_0009894_1409_2470 | 353 |
| 657 | 3300053078 | Ga0495612_0016126 | Ga0495612_0016126_1205_2266 | 353 |
| 658 | 3300053084 | Ga0495595_0022754 | Ga0495595_0022754_1653_2714 | 353 |
| 659 | 3300053087 | Ga0500643_000035 | Ga0500643_000035_83159_84220 | 353 |
| 660 | 3300053091 | Ga0500647_0026741 | Ga0500647_0026741_896_1957 | 353 |
| 661 | 3300053093 | Ga0500651_0000660 | Ga0500651_0000660_5712_6776 | 353 |
| 662 | 3300053094 | Ga0500566_0000006 | Ga0500566_0000006_82050_83111 | 353 |
| 663 | 3300053095 | Ga0500640_015397 | Ga0500640_015397_1419_2480 | 353 |
| 664 | 3300053096 | Ga0500641_0006784 | Ga0500641_0006784_2288_3349 | 353 |
| 665 | 3300053105 | Ga0500557_000004 | Ga0500557_000004_69572_70633 | 353 |
| 666 | 3300053119 | Ga0500595_006441 | Ga0500595_006441_3309_4373 | 353 |
| 667 | 3300053122 | Ga0500608_011998 | Ga0500608_011998_979_2040 | 353 |
| 668 | 3300053123 | Ga0500614_001760 | Ga0500614_001760_61_1122 | 353 |
| 669 | 3300053130 | Ga0500642_0000133 | Ga0500642_0000133_25071_26132 | 353 |
| 670 | 3300053136 | Ga0500559_0001576 | Ga0500559_0001576_2603_3664 | 353 |
| 671 | 3300053150 | Ga0500603_001602 | Ga0500603_001602_1467_2528 | 353 |
| 672 | 3300053159 | Ga0500630_000571 | Ga0500630_000571_13566_14627 | 353 |
| 673 | 3300053163 | Ga0500639_000016 | Ga0500639_000016_65640_66701 | 353 |
| 674 | 3300053177 | Ga0500636_0050949 | Ga0500636_0050949_465_1526 | 353 |
| 675 | 3300053177 | Ga0500636_0101990 | Ga0500636_0101990_351_1412 | 353 |
| 676 | 3300053722 | Ga0500649_094977 | Ga0500649_094977_17_1078 | 353 |
| 677 | 3300053729 | Ga0500625_029782 | Ga0500625_029782_286_1347 | 353 |
| 678 | 3300053737 | Ga0500601_000607 | Ga0500601_000607_1784_2845 | 353 |
| 679 | 3300054114 | Ga0501084_0079121 | Ga0501084_0079121_1582_2643 | 353 |
| 680 | 3300060353 | Ga0501082_0007768 | Ga0501082_0007768_4886_5947 | 353 |
| 681 | 3300061719 | Ga0466962_0029890 | Ga0466962_0029890_476_1537 | 353 |
| 682 | 3300003579 | Ga0007429J51699_1107255 | Ga0007429J51699_11072552 | 354 |
| 683 | 3300005331 | Ga0070670_100000403 | Ga0070670_10000040320 | 354 |
| 684 | 3300005331 | Ga0070670_100099778 | Ga0070670_1000997782 | 354 |
| 685 | 3300005338 | Ga0068868_100027002 | Ga0068868_1000270024 | 354 |
| 686 | 3300005364 | Ga0070673_100014070 | Ga0070673_1000140704 | 354 |
| 687 | 3300005459 | Ga0068867_100085008 | Ga0068867_1000850082 | 354 |
| 688 | 3300005548 | Ga0070665_100106738 | Ga0070665_1001067382 | 354 |
| 689 | 3300005564 | Ga0070664_100173668 | Ga0070664_1001736682 | 354 |
| 690 | 3300005618 | Ga0068864_100162047 | Ga0068864_1001620472 | 354 |
| 691 | 3300005840 | Ga0068870_10044340 | Ga0068870_100443402 | 354 |
| 692 | 3300009098 | Ga0105245_10045759 | Ga0105245_100457593 | 354 |
| 693 | 3300009101 | Ga0105247_10030643 | Ga0105247_100306432 | 354 |
| 694 | 3300009147 | Ga0114129_10081529 | Ga0114129_100815292 | 354 |
| 695 | 3300013308 | Ga0157375_10216761 | Ga0157375_102167612 | 354 |
| 696 | 3300022739 | Ga0228711_1013535 | Ga0228711_10135355 | 354 |
| 697 | 3300022740 | Ga0228710_1013900 | Ga0228710_10139005 | 354 |
| 698 | 3300025893 | Ga0207682_10001129 | Ga0207682_1000112910 | 354 |
| 699 | 3300025900 | Ga0207710_10032588 | Ga0207710_100325882 | 354 |
| 700 | 3300025925 | Ga0207650_10000408 | Ga0207650_1000040812 | 354 |
| 701 | 3300025926 | Ga0207659_10000256 | Ga0207659_1000025611 | 354 |
| 702 | 3300025927 | Ga0207687_10029353 | Ga0207687_100293532 | 354 |
| 703 | 3300025931 | Ga0207644_10015516 | Ga0207644_100155164 | 354 |
| 704 | 3300025940 | Ga0207691_10000360 | Ga0207691_1000036024 | 354 |
| 705 | 3300025960 | Ga0207651_10068414 | Ga0207651_100684143 | 354 |
| 706 | 3300026089 | Ga0207648_10023261 | Ga0207648_100232615 | 354 |
| 707 | 3300026095 | Ga0207676_10008222 | Ga0207676_100082222 | 354 |
| 708 | 3300026121 | Ga0207683_10003821 | Ga0207683_100038211 | 354 |
| 709 | 3300031548 | Ga0307408_100068810 | Ga0307408_1000688103 | 354 |
| 710 | 3300031727 | Ga0316576_10151946 | Ga0316576_101519462 | 354 |
| 711 | 3300031733 | Ga0316577_10005660 | Ga0316577_100056604 | 354 |
| 712 | 3300031733 | Ga0316577_10083912 | Ga0316577_100839122 | 354 |
| 713 | 3300031901 | Ga0307406_10004966 | Ga0307406_100049663 | 354 |
| 714 | 3300031911 | Ga0307412_10011920 | Ga0307412_100119204 | 354 |
| 715 | 3300031995 | Ga0307409_100067274 | Ga0307409_1000672743 | 354 |
| 716 | 3300032004 | Ga0307414_10014216 | Ga0307414_100142161 | 354 |
| 717 | 3300032005 | Ga0307411_10015181 | Ga0307411_100151814 | 354 |
| 718 | 3300032168 | Ga0316593_10032743 | Ga0316593_100327432 | 354 |
| 719 | 3300036647 | Ga0316582_0024005 | Ga0316582_0024005_1156_2259 | 354 |
| 720 | 3300036712 | Ga0316584_0194540 | Ga0316584_0194540_146_1249 | 354 |
| 721 | 3300042876 | Ga0451577_0013112 | Ga0451577_0013112_2859_3929 | 354 |
| 722 | 3300049581 | Ga0501047_0150317 | Ga0501047_0150317_1016_2080 | 354 |
| 723 | 3300050507 | nmdc:mga05p37_59973_c1 | nmdc:mga05p37_59973_c1_1747_2850 | 354 |
| 724 | 3300000042 | ARSoilYngRDRAFT_c00128 | ARSoilYngRDRAFT_0012818 | 355 |
| 725 | 3300000044 | ARSoilOldRDRAFT_c000297 | ARSoilOldRDRAFT_0002974 | 355 |
| 726 | 3300000652 | ARCol0yngRDRAFT_1000069 | ARCol0yngRDRAFT_100006928 | 355 |
| 727 | 3300001977 | JGI24746J21847_1000078 | JGI24746J21847_10000784 | 355 |
| 728 | 3300001979 | JGI24740J21852_10030484 | JGI24740J21852_100304841 | 355 |
| 729 | 3300001989 | JGI24739J22299_10002225 | JGI24739J22299_100022253 | 355 |
| 730 | 3300001990 | JGI24737J22298_10001972 | JGI24737J22298_100019723 | 355 |
| 731 | 3300002070 | JGI24750J21931_1000188 | JGI24750J21931_100018811 | 355 |
| 732 | 3300002073 | JGI24745J21846_1000126 | JGI24745J21846_10001261 | 355 |
| 733 | 3300002075 | JGI24738J21930_10000068 | JGI24738J21930_100000686 | 355 |
| 734 | 3300002076 | JGI24749J21850_1000122 | JGI24749J21850_10001223 | 355 |
| 735 | 3300002239 | JGI24034J26672_10000519 | JGI24034J26672_100005193 | 355 |
| 736 | 3300002244 | JGI24742J22300_10000082 | JGI24742J22300_100000822 | 355 |
| 737 | 3300003203 | JGI25406J46586_10000093 | JGI25406J46586_100000933 | 355 |
| 738 | 3300003203 | JGI25406J46586_10007700 | JGI25406J46586_100077003 | 355 |
| 739 | 3300003215 | JGI25153J46596_10000462 | JGI25153J46596_1000046211 | 355 |
| 740 | 3300005276 | Ga0065717_1000293 | Ga0065717_10002931 | 355 |
| 741 | 3300005293 | Ga0065715_10089172 | Ga0065715_100891724 | 355 |
| 742 | 3300005293 | Ga0065715_10193766 | Ga0065715_101937662 | 355 |
| 743 | 3300005327 | Ga0070658_10063326 | Ga0070658_100633261 | 355 |
| 744 | 3300005328 | Ga0070676_10000363 | Ga0070676_100003637 | 355 |
| 745 | 3300005328 | Ga0070676_10026577 | Ga0070676_100265773 | 355 |
| 746 | 3300005328 | Ga0070676_10110574 | Ga0070676_101105742 | 355 |
| 747 | 3300005328 | Ga0070676_10138318 | Ga0070676_101383182 | 355 |
| 748 | 3300005329 | Ga0070683_100004718 | Ga0070683_1000047183 | 355 |
| 749 | 3300005329 | Ga0070683_100020818 | Ga0070683_1000208185 | 355 |
| 750 | 3300005329 | Ga0070683_100049938 | Ga0070683_1000499384 | 355 |
| 751 | 3300005329 | Ga0070683_100078282 | Ga0070683_1000782822 | 355 |
| 752 | 3300005329 | Ga0070683_100163207 | Ga0070683_1001632072 | 355 |
| 753 | 3300005329 | Ga0070683_100244054 | Ga0070683_1002440542 | 355 |
| 754 | 3300005330 | Ga0070690_100001828 | Ga0070690_10000182811 | 355 |
| 755 | 3300005330 | Ga0070690_100015808 | Ga0070690_1000158084 | 355 |
| 756 | 3300005330 | Ga0070690_100044913 | Ga0070690_1000449132 | 355 |
| 757 | 3300005330 | Ga0070690_100106185 | Ga0070690_1001061852 | 355 |
| 758 | 3300005330 | Ga0070690_100110382 | Ga0070690_1001103822 | 355 |
| 759 | 3300005331 | Ga0070670_100001134 | Ga0070670_10000113411 | 355 |
| 760 | 3300005333 | Ga0070677_10000301 | Ga0070677_100003017 | 355 |
| 761 | 3300005333 | Ga0070677_10000815 | Ga0070677_100008156 | 355 |
| 762 | 3300005334 | Ga0068869_100006712 | Ga0068869_1000067123 | 355 |
| 763 | 3300005335 | Ga0070666_10039593 | Ga0070666_100395932 | 355 |
| 764 | 3300005336 | Ga0070680_100005574 | Ga0070680_1000055742 | 355 |
| 765 | 3300005336 | Ga0070680_100014945 | Ga0070680_1000149453 | 355 |
| 766 | 3300005336 | Ga0070680_100019341 | Ga0070680_1000193412 | 355 |
| 767 | 3300005336 | Ga0070680_100148433 | Ga0070680_1001484332 | 355 |
| 768 | 3300005337 | Ga0070682_100000719 | Ga0070682_10000071910 | 355 |
| 769 | 3300005337 | Ga0070682_100001130 | Ga0070682_10000113014 | 355 |
| 770 | 3300005337 | Ga0070682_100048011 | Ga0070682_1000480112 | 355 |
| 771 | 3300005337 | Ga0070682_100096655 | Ga0070682_1000966552 | 355 |
| 772 | 3300005338 | Ga0068868_100010138 | Ga0068868_1000101383 | 355 |
| 773 | 3300005338 | Ga0068868_100013587 | Ga0068868_1000135871 | 355 |
| 774 | 3300005338 | Ga0068868_100229841 | Ga0068868_1002298411 | 355 |
| 775 | 3300005339 | Ga0070660_100000730 | Ga0070660_10000073013 | 355 |
| 776 | 3300005339 | Ga0070660_100006450 | Ga0070660_1000064503 | 355 |
| 777 | 3300005339 | Ga0070660_100050497 | Ga0070660_1000504972 | 355 |
| 778 | 3300005339 | Ga0070660_100122390 | Ga0070660_1001223902 | 355 |
| 779 | 3300005340 | Ga0070689_100000601 | Ga0070689_10000060113 | 355 |
| 780 | 3300005340 | Ga0070689_100025910 | Ga0070689_1000259102 | 355 |
| 781 | 3300005340 | Ga0070689_100041110 | Ga0070689_1000411103 | 355 |
| 782 | 3300005340 | Ga0070689_100142846 | Ga0070689_1001428462 | 355 |
| 783 | 3300005341 | Ga0070691_10001015 | Ga0070691_100010154 | 355 |
| 784 | 3300005341 | Ga0070691_10017707 | Ga0070691_100177072 | 355 |
| 785 | 3300005341 | Ga0070691_10060361 | Ga0070691_100603612 | 355 |
| 786 | 3300005343 | Ga0070687_100000253 | Ga0070687_10000025311 | 355 |
| 787 | 3300005343 | Ga0070687_100045959 | Ga0070687_1000459592 | 355 |
| 788 | 3300005344 | Ga0070661_100003564 | Ga0070661_10000356410 | 355 |
| 789 | 3300005344 | Ga0070661_100197315 | Ga0070661_1001973152 | 355 |
| 790 | 3300005345 | Ga0070692_10000060 | Ga0070692_1000006012 | 355 |
| 791 | 3300005345 | Ga0070692_10005786 | Ga0070692_100057864 | 355 |
| 792 | 3300005345 | Ga0070692_10032255 | Ga0070692_100322552 | 355 |
| 793 | 3300005347 | Ga0070668_100001851 | Ga0070668_1000018517 | 355 |
| 794 | 3300005347 | Ga0070668_100132143 | Ga0070668_1001321431 | 355 |
| 795 | 3300005347 | Ga0070668_100246197 | Ga0070668_1002461971 | 355 |
| 796 | 3300005353 | Ga0070669_100000888 | Ga0070669_1000008887 | 355 |
| 797 | 3300005353 | Ga0070669_100042856 | Ga0070669_1000428563 | 355 |
| 798 | 3300005353 | Ga0070669_100065319 | Ga0070669_1000653192 | 355 |
| 799 | 3300005353 | Ga0070669_100068388 | Ga0070669_1000683882 | 355 |
| 800 | 3300005354 | Ga0070675_100000441 | Ga0070675_10000044119 | 355 |
| 801 | 3300005354 | Ga0070675_100039312 | Ga0070675_1000393122 | 355 |
| 802 | 3300005354 | Ga0070675_100192696 | Ga0070675_1001926962 | 355 |
| 803 | 3300005355 | Ga0070671_100001180 | Ga0070671_10000118010 | 355 |
| 804 | 3300005355 | Ga0070671_100015695 | Ga0070671_1000156952 | 355 |
| 805 | 3300005355 | Ga0070671_100019902 | Ga0070671_1000199022 | 355 |
| 806 | 3300005355 | Ga0070671_100042459 | Ga0070671_1000424592 | 355 |
| 807 | 3300005355 | Ga0070671_100044735 | Ga0070671_1000447351 | 355 |
| 808 | 3300005355 | Ga0070671_100075870 | Ga0070671_1000758702 | 355 |
| 809 | 3300005356 | Ga0070674_100000723 | Ga0070674_10000072311 | 355 |
| 810 | 3300005356 | Ga0070674_100051273 | Ga0070674_1000512732 | 355 |
| 811 | 3300005356 | Ga0070674_100052446 | Ga0070674_1000524462 | 355 |
| 812 | 3300005356 | Ga0070674_100084906 | Ga0070674_1000849062 | 355 |
| 813 | 3300005356 | Ga0070674_100108322 | Ga0070674_1001083222 | 355 |
| 814 | 3300005364 | Ga0070673_100000456 | Ga0070673_1000004567 | 355 |
| 815 | 3300005364 | Ga0070673_100038037 | Ga0070673_1000380373 | 355 |
| 816 | 3300005364 | Ga0070673_100150225 | Ga0070673_1001502252 | 355 |
| 817 | 3300005364 | Ga0070673_100343751 | Ga0070673_1003437511 | 355 |
| 818 | 3300005365 | Ga0070688_100000483 | Ga0070688_1000004837 | 355 |
| 819 | 3300005365 | Ga0070688_100010309 | Ga0070688_1000103094 | 355 |
| 820 | 3300005365 | Ga0070688_100027362 | Ga0070688_1000273621 | 355 |
| 821 | 3300005365 | Ga0070688_100046419 | Ga0070688_1000464192 | 355 |
| 822 | 3300005366 | Ga0070659_100001763 | Ga0070659_1000017637 | 355 |
| 823 | 3300005366 | Ga0070659_100047189 | Ga0070659_1000471893 | 355 |
| 824 | 3300005366 | Ga0070659_100124787 | Ga0070659_1001247872 | 355 |
| 825 | 3300005366 | Ga0070659_100162952 | Ga0070659_1001629522 | 355 |
| 826 | 3300005367 | Ga0070667_100004366 | Ga0070667_1000043663 | 355 |
| 827 | 3300005367 | Ga0070667_100029031 | Ga0070667_1000290312 | 355 |
| 828 | 3300005367 | Ga0070667_100035458 | Ga0070667_1000354582 | 355 |
| 829 | 3300005367 | Ga0070667_100046573 | Ga0070667_1000465733 | 355 |
| 830 | 3300005367 | Ga0070667_100114480 | Ga0070667_1001144802 | 355 |
| 831 | 3300005367 | Ga0070667_100152500 | Ga0070667_1001525002 | 355 |
| 832 | 3300005367 | Ga0070667_100357862 | Ga0070667_1003578621 | 355 |
| 833 | 3300005406 | Ga0070703_10002031 | Ga0070703_100020313 | 355 |
| 834 | 3300005406 | Ga0070703_10013855 | Ga0070703_100138551 | 355 |
| 835 | 3300005434 | Ga0070709_10079029 | Ga0070709_100790292 | 355 |
| 836 | 3300005434 | Ga0070709_10119364 | Ga0070709_101193642 | 355 |
| 837 | 3300005435 | Ga0070714_100045925 | Ga0070714_1000459252 | 355 |
| 838 | 3300005435 | Ga0070714_100089770 | Ga0070714_1000897702 | 355 |
| 839 | 3300005436 | Ga0070713_100022697 | Ga0070713_1000226973 | 355 |
| 840 | 3300005436 | Ga0070713_100052199 | Ga0070713_1000521992 | 355 |
| 841 | 3300005437 | Ga0070710_10001957 | Ga0070710_100019573 | 355 |
| 842 | 3300005437 | Ga0070710_10010719 | Ga0070710_100107194 | 355 |
| 843 | 3300005437 | Ga0070710_10026259 | Ga0070710_100262592 | 355 |
| 844 | 3300005437 | Ga0070710_10030961 | Ga0070710_100309611 | 355 |
| 845 | 3300005437 | Ga0070710_10064128 | Ga0070710_100641281 | 355 |
| 846 | 3300005438 | Ga0070701_10000150 | Ga0070701_100001507 | 355 |
| 847 | 3300005438 | Ga0070701_10029193 | Ga0070701_100291932 | 355 |
| 848 | 3300005439 | Ga0070711_100000801 | Ga0070711_10000080115 | 355 |
| 849 | 3300005439 | Ga0070711_100008716 | Ga0070711_1000087163 | 355 |
| 850 | 3300005439 | Ga0070711_100043909 | Ga0070711_1000439093 | 355 |
| 851 | 3300005439 | Ga0070711_100053717 | Ga0070711_1000537172 | 355 |
| 852 | 3300005439 | Ga0070711_100132478 | Ga0070711_1001324781 | 355 |
| 853 | 3300005439 | Ga0070711_100169817 | Ga0070711_1001698172 | 355 |
| 854 | 3300005440 | Ga0070705_100003099 | Ga0070705_1000030995 | 355 |
| 855 | 3300005440 | Ga0070705_100150225 | Ga0070705_1001502251 | 355 |
| 856 | 3300005441 | Ga0070700_100001083 | Ga0070700_1000010834 | 355 |
| 857 | 3300005441 | Ga0070700_100053677 | Ga0070700_1000536772 | 355 |
| 858 | 3300005444 | Ga0070694_100094512 | Ga0070694_1000945122 | 355 |
| 859 | 3300005445 | Ga0070708_100013928 | Ga0070708_1000139283 | 355 |
| 860 | 3300005445 | Ga0070708_100244001 | Ga0070708_1002440012 | 355 |
| 861 | 3300005445 | Ga0070708_100304044 | Ga0070708_1003040442 | 355 |
| 862 | 3300005455 | Ga0070663_100001801 | Ga0070663_1000018018 | 355 |
| 863 | 3300005455 | Ga0070663_100024121 | Ga0070663_1000241212 | 355 |
| 864 | 3300005455 | Ga0070663_100071433 | Ga0070663_1000714332 | 355 |
| 865 | 3300005455 | Ga0070663_100074832 | Ga0070663_1000748322 | 355 |
| 866 | 3300005455 | Ga0070663_100090820 | Ga0070663_1000908202 | 355 |
| 867 | 3300005455 | Ga0070663_100247118 | Ga0070663_1002471182 | 355 |
| 868 | 3300005456 | Ga0070678_100000199 | Ga0070678_10000019918 | 355 |
| 869 | 3300005456 | Ga0070678_100028678 | Ga0070678_1000286784 | 355 |
| 870 | 3300005456 | Ga0070678_100160175 | Ga0070678_1001601752 | 355 |
| 871 | 3300005457 | Ga0070662_100016138 | Ga0070662_1000161383 | 355 |
| 872 | 3300005457 | Ga0070662_100103150 | Ga0070662_1001031502 | 355 |
| 873 | 3300005457 | Ga0070662_100125536 | Ga0070662_1001255362 | 355 |
| 874 | 3300005458 | Ga0070681_10001398 | Ga0070681_1000139811 | 355 |
| 875 | 3300005458 | Ga0070681_10017437 | Ga0070681_100174375 | 355 |
| 876 | 3300005458 | Ga0070681_10195720 | Ga0070681_101957202 | 355 |
| 877 | 3300005459 | Ga0068867_100001623 | Ga0068867_1000016239 | 355 |
| 878 | 3300005459 | Ga0068867_100012724 | Ga0068867_1000127246 | 355 |
| 879 | 3300005466 | Ga0070685_10000782 | Ga0070685_100007827 | 355 |
| 880 | 3300005466 | Ga0070685_10007883 | Ga0070685_100078833 | 355 |
| 881 | 3300005466 | Ga0070685_10015377 | Ga0070685_100153773 | 355 |
| 882 | 3300005466 | Ga0070685_10045926 | Ga0070685_100459262 | 355 |
| 883 | 3300005467 | Ga0070706_100190434 | Ga0070706_1001904341 | 355 |
| 884 | 3300005530 | Ga0070679_100018692 | Ga0070679_1000186922 | 355 |
| 885 | 3300005530 | Ga0070679_100028756 | Ga0070679_1000287564 | 355 |
| 886 | 3300005530 | Ga0070679_100035744 | Ga0070679_1000357443 | 355 |
| 887 | 3300005530 | Ga0070679_100042533 | Ga0070679_1000425332 | 355 |
| 888 | 3300005530 | Ga0070679_100171156 | Ga0070679_1001711562 | 355 |
| 889 | 3300005530 | Ga0070679_100231671 | Ga0070679_1002316712 | 355 |
| 890 | 3300005535 | Ga0070684_100001802 | Ga0070684_1000018027 | 355 |
| 891 | 3300005535 | Ga0070684_100017238 | Ga0070684_1000172383 | 355 |
| 892 | 3300005535 | Ga0070684_100028452 | Ga0070684_1000284524 | 355 |
| 893 | 3300005535 | Ga0070684_100036280 | Ga0070684_1000362802 | 355 |
| 894 | 3300005535 | Ga0070684_100125269 | Ga0070684_1001252692 | 355 |
| 895 | 3300005536 | Ga0070697_100058284 | Ga0070697_1000582842 | 355 |
| 896 | 3300005539 | Ga0068853_100001448 | Ga0068853_1000014484 | 355 |
| 897 | 3300005539 | Ga0068853_100002281 | Ga0068853_1000022815 | 355 |
| 898 | 3300005539 | Ga0068853_100056883 | Ga0068853_1000568832 | 355 |
| 899 | 3300005539 | Ga0068853_100143530 | Ga0068853_1001435302 | 355 |
| 900 | 3300005539 | Ga0068853_100284496 | Ga0068853_1002844961 | 355 |
| 901 | 3300005543 | Ga0070672_100001622 | Ga0070672_1000016226 | 355 |
| 902 | 3300005543 | Ga0070672_100024941 | Ga0070672_1000249412 | 355 |
| 903 | 3300005544 | Ga0070686_100000746 | Ga0070686_1000007467 | 355 |
| 904 | 3300005544 | Ga0070686_100004148 | Ga0070686_1000041485 | 355 |
| 905 | 3300005544 | Ga0070686_100018778 | Ga0070686_1000187783 | 355 |
| 906 | 3300005544 | Ga0070686_100124308 | Ga0070686_1001243082 | 355 |
| 907 | 3300005545 | Ga0070695_100000553 | Ga0070695_10000055310 | 355 |
| 908 | 3300005545 | Ga0070695_100033941 | Ga0070695_1000339412 | 355 |
| 909 | 3300005546 | Ga0070696_100001299 | Ga0070696_1000012994 | 355 |
| 910 | 3300005546 | Ga0070696_100030835 | Ga0070696_1000308352 | 355 |
| 911 | 3300005546 | Ga0070696_100051897 | Ga0070696_1000518972 | 355 |
| 912 | 3300005546 | Ga0070696_100158942 | Ga0070696_1001589422 | 355 |
| 913 | 3300005547 | Ga0070693_100000613 | Ga0070693_1000006136 | 355 |
| 914 | 3300005547 | Ga0070693_100003449 | Ga0070693_1000034493 | 355 |
| 915 | 3300005547 | Ga0070693_100016956 | Ga0070693_1000169563 | 355 |
| 916 | 3300005548 | Ga0070665_100063622 | Ga0070665_1000636222 | 355 |
| 917 | 3300005548 | Ga0070665_100107687 | Ga0070665_1001076873 | 355 |
| 918 | 3300005549 | Ga0070704_100000423 | Ga0070704_1000004237 | 355 |
| 919 | 3300005563 | Ga0068855_100004415 | Ga0068855_1000044156 | 355 |
| 920 | 3300005563 | Ga0068855_100034249 | Ga0068855_1000342494 | 355 |
| 921 | 3300005563 | Ga0068855_100098794 | Ga0068855_1000987942 | 355 |
| 922 | 3300005563 | Ga0068855_100198832 | Ga0068855_1001988323 | 355 |
| 923 | 3300005564 | Ga0070664_100001312 | Ga0070664_1000013129 | 355 |
| 924 | 3300005564 | Ga0070664_100024128 | Ga0070664_1000241283 | 355 |
| 925 | 3300005564 | Ga0070664_100029501 | Ga0070664_1000295011 | 355 |
| 926 | 3300005564 | Ga0070664_100188915 | Ga0070664_1001889152 | 355 |
| 927 | 3300005577 | Ga0068857_100007906 | Ga0068857_1000079066 | 355 |
| 928 | 3300005577 | Ga0068857_100408846 | Ga0068857_1004088461 | 355 |
| 929 | 3300005578 | Ga0068854_100000827 | Ga0068854_1000008277 | 355 |
| 930 | 3300005578 | Ga0068854_100141681 | Ga0068854_1001416812 | 355 |
| 931 | 3300005578 | Ga0068854_100197451 | Ga0068854_1001974511 | 355 |
| 932 | 3300005614 | Ga0068856_100000020 | Ga0068856_10000002075 | 355 |
| 933 | 3300005614 | Ga0068856_100001340 | Ga0068856_10000134016 | 355 |
| 934 | 3300005616 | Ga0068852_100007064 | Ga0068852_1000070643 | 355 |
| 935 | 3300005616 | Ga0068852_100013291 | Ga0068852_1000132912 | 355 |
| 936 | 3300005616 | Ga0068852_100024490 | Ga0068852_1000244903 | 355 |
| 937 | 3300005616 | Ga0068852_100063539 | Ga0068852_1000635392 | 355 |
| 938 | 3300005617 | Ga0068859_100001767 | Ga0068859_10000176712 | 355 |
| 939 | 3300005617 | Ga0068859_100061270 | Ga0068859_1000612701 | 355 |
| 940 | 3300005617 | Ga0068859_100070871 | Ga0068859_1000708713 | 355 |
| 941 | 3300005617 | Ga0068859_100132349 | Ga0068859_1001323493 | 355 |
| 942 | 3300005617 | Ga0068859_100205452 | Ga0068859_1002054522 | 355 |
| 943 | 3300005618 | Ga0068864_100003544 | Ga0068864_1000035444 | 355 |
| 944 | 3300005618 | Ga0068864_100059172 | Ga0068864_1000591723 | 355 |
| 945 | 3300005718 | Ga0068866_10000372 | Ga0068866_1000037210 | 355 |
| 946 | 3300005718 | Ga0068866_10022582 | Ga0068866_100225822 | 355 |
| 947 | 3300005719 | Ga0068861_100001202 | Ga0068861_1000012024 | 355 |
| 948 | 3300005719 | Ga0068861_100003340 | Ga0068861_1000033408 | 355 |
| 949 | 3300005719 | Ga0068861_100024078 | Ga0068861_1000240783 | 355 |
| 950 | 3300005719 | Ga0068861_100093014 | Ga0068861_1000930142 | 355 |
| 951 | 3300005840 | Ga0068870_10000207 | Ga0068870_1000020710 | 355 |
| 952 | 3300005841 | Ga0068863_100003062 | Ga0068863_1000030624 | 355 |
| 953 | 3300005841 | Ga0068863_100020579 | Ga0068863_1000205791 | 355 |
| 954 | 3300005842 | Ga0068858_100004999 | Ga0068858_10000499916 | 355 |
| 955 | 3300005842 | Ga0068858_100087413 | Ga0068858_1000874133 | 355 |
| 956 | 3300005842 | Ga0068858_100307706 | Ga0068858_1003077061 | 355 |
| 957 | 3300005843 | Ga0068860_100007079 | Ga0068860_1000070793 | 355 |
| 958 | 3300005843 | Ga0068860_100008652 | Ga0068860_1000086523 | 355 |
| 959 | 3300005843 | Ga0068860_100042971 | Ga0068860_1000429711 | 355 |
| 960 | 3300005843 | Ga0068860_100050876 | Ga0068860_1000508762 | 355 |
| 961 | 3300005843 | Ga0068860_100064769 | Ga0068860_1000647694 | 355 |
| 962 | 3300005843 | Ga0068860_100474333 | Ga0068860_1004743332 | 355 |
| 963 | 3300005844 | Ga0068862_100002236 | Ga0068862_10000223610 | 355 |
| 964 | 3300005844 | Ga0068862_100032372 | Ga0068862_1000323725 | 355 |
| 965 | 3300005844 | Ga0068862_100163998 | Ga0068862_1001639981 | 355 |
| 966 | 3300005844 | Ga0068862_100383957 | Ga0068862_1003839571 | 355 |
| 967 | 3300005937 | Ga0081455_10005602 | Ga0081455_100056023 | 355 |
| 968 | 3300005937 | Ga0081455_10006534 | Ga0081455_100065348 | 355 |
| 969 | 3300005937 | Ga0081455_10006892 | Ga0081455_100068922 | 355 |
| 970 | 3300005937 | Ga0081455_10012847 | Ga0081455_100128476 | 355 |
| 971 | 3300005937 | Ga0081455_10035882 | Ga0081455_100358822 | 355 |
| 972 | 3300005937 | Ga0081455_10121166 | Ga0081455_101211661 | 355 |
| 973 | 3300005981 | Ga0081538_10055740 | Ga0081538_100557402 | 355 |
| 974 | 3300005983 | Ga0081540_1000933 | Ga0081540_100093314 | 355 |
| 975 | 3300005983 | Ga0081540_1002812 | Ga0081540_10028125 | 355 |
| 976 | 3300005983 | Ga0081540_1006330 | Ga0081540_10063305 | 355 |
| 977 | 3300005983 | Ga0081540_1016900 | Ga0081540_10169003 | 355 |
| 978 | 3300005983 | Ga0081540_1021448 | Ga0081540_10214483 | 355 |
| 979 | 3300005983 | Ga0081540_1029356 | Ga0081540_10293563 | 355 |
| 980 | 3300005985 | Ga0081539_10000140 | Ga0081539_1000014021 | 355 |
| 981 | 3300005985 | Ga0081539_10003950 | Ga0081539_100039507 | 355 |
| 982 | 3300005985 | Ga0081539_10026648 | Ga0081539_100266482 | 355 |
| 983 | 3300006028 | Ga0070717_10004566 | Ga0070717_100045668 | 355 |
| 984 | 3300006028 | Ga0070717_10047085 | Ga0070717_100470852 | 355 |
| 985 | 3300006028 | Ga0070717_10134551 | Ga0070717_101345511 | 355 |
| 986 | 3300006028 | Ga0070717_10292120 | Ga0070717_102921202 | 355 |
| 987 | 3300006028 | Ga0070717_10313860 | Ga0070717_103138602 | 355 |
| 988 | 3300006038 | Ga0075365_10008099 | Ga0075365_100080996 | 355 |
| 989 | 3300006038 | Ga0075365_10070687 | Ga0075365_100706872 | 355 |
| 990 | 3300006038 | Ga0075365_10076733 | Ga0075365_100767332 | 355 |
| 991 | 3300006042 | Ga0075368_10002671 | Ga0075368_100026716 | 355 |
| 992 | 3300006042 | Ga0075368_10012864 | Ga0075368_100128641 | 355 |
| 993 | 3300006048 | Ga0075363_100002429 | Ga0075363_1000024294 | 355 |
| 994 | 3300006048 | Ga0075363_100038616 | Ga0075363_1000386162 | 355 |
| 995 | 3300006051 | Ga0075364_10007885 | Ga0075364_100078856 | 355 |
| 996 | 3300006163 | Ga0070715_10070358 | Ga0070715_100703582 | 355 |
| 997 | 3300006173 | Ga0070716_100002662 | Ga0070716_1000026625 | 355 |
| 998 | 3300006175 | Ga0070712_100145116 | Ga0070712_1001451162 | 355 |
| 999 | 3300006175 | Ga0070712_100162464 | Ga0070712_1001624642 | 355 |
| 1000 | 3300006175 | Ga0070712_100214257 | Ga0070712_1002142572 | 355 |
| 1001 | 3300006177 | Ga0075362_10012691 | Ga0075362_100126912 | 355 |
| 1002 | 3300006178 | Ga0075367_10010400 | Ga0075367_100104003 | 355 |
| 1003 | 3300006178 | Ga0075367_10088217 | Ga0075367_100882171 | 355 |
| 1004 | 3300006178 | Ga0075367_10142445 | Ga0075367_101424451 | 355 |
| 1005 | 3300006186 | Ga0075369_10005033 | Ga0075369_100050331 | 355 |
| 1006 | 3300006195 | Ga0075366_10016935 | Ga0075366_100169351 | 355 |
| 1007 | 3300006195 | Ga0075366_10169765 | Ga0075366_101697651 | 355 |
| 1008 | 3300006237 | Ga0097621_100002408 | Ga0097621_1000024086 | 355 |
| 1009 | 3300006237 | Ga0097621_100035810 | Ga0097621_1000358102 | 355 |
| 1010 | 3300006237 | Ga0097621_100037422 | Ga0097621_1000374222 | 355 |
| 1011 | 3300006358 | Ga0068871_100002267 | Ga0068871_1000022676 | 355 |
| 1012 | 3300006358 | Ga0068871_100076440 | Ga0068871_1000764401 | 355 |
| 1013 | 3300006358 | Ga0068871_100129629 | Ga0068871_1001296292 | 355 |
| 1014 | 3300006844 | Ga0075428_100031362 | Ga0075428_1000313624 | 355 |
| 1015 | 3300006844 | Ga0075428_100067331 | Ga0075428_1000673312 | 355 |
| 1016 | 3300006847 | Ga0075431_100007073 | Ga0075431_10000707311 | 355 |
| 1017 | 3300006847 | Ga0075431_100371159 | Ga0075431_1003711591 | 355 |
| 1018 | 3300006852 | Ga0075433_10039549 | Ga0075433_100395493 | 355 |
| 1019 | 3300006871 | Ga0075434_100007264 | Ga0075434_1000072643 | 355 |
| 1020 | 3300006871 | Ga0075434_100029369 | Ga0075434_1000293692 | 355 |
| 1021 | 3300006871 | Ga0075434_100044598 | Ga0075434_1000445983 | 355 |
| 1022 | 3300006871 | Ga0075434_100274145 | Ga0075434_1002741452 | 355 |
| 1023 | 3300006871 | Ga0075434_100520669 | Ga0075434_1005206691 | 355 |
| 1024 | 3300006880 | Ga0075429_100258172 | Ga0075429_1002581722 | 355 |
| 1025 | 3300006881 | Ga0068865_100000537 | Ga0068865_1000005377 | 355 |
| 1026 | 3300006881 | Ga0068865_100003331 | Ga0068865_1000033319 | 355 |
| 1027 | 3300006881 | Ga0068865_100083233 | Ga0068865_1000832332 | 355 |
| 1028 | 3300006931 | Ga0097620_100001767 | Ga0097620_10000176712 | 355 |
| 1029 | 3300006931 | Ga0097620_100061272 | Ga0097620_1000612724 | 355 |
| 1030 | 3300006931 | Ga0097620_100070859 | Ga0097620_1000708591 | 355 |
| 1031 | 3300006931 | Ga0097620_100132356 | Ga0097620_1001323563 | 355 |
| 1032 | 3300006931 | Ga0097620_100205450 | Ga0097620_1002054502 | 355 |
| 1033 | 3300006942 | Ga0099824_1018476 | Ga0099824_10184765 | 355 |
| 1034 | 3300006943 | Ga0099822_1042608 | Ga0099822_10426082 | 355 |
| 1035 | 3300006944 | Ga0099823_1035886 | Ga0099823_10358862 | 355 |
| 1036 | 3300007076 | Ga0075435_100014461 | Ga0075435_1000144612 | 355 |
| 1037 | 3300007076 | Ga0075435_100024058 | Ga0075435_1000240582 | 355 |
| 1038 | 3300007076 | Ga0075435_100030713 | Ga0075435_1000307134 | 355 |
| 1039 | 3300007076 | Ga0075435_100085093 | Ga0075435_1000850932 | 355 |
| 1040 | 3300007076 | Ga0075435_100193375 | Ga0075435_1001933752 | 355 |
| 1041 | 3300007076 | Ga0075435_100218695 | Ga0075435_1002186952 | 355 |
| 1042 | 3300007076 | Ga0075435_100330204 | Ga0075435_1003302041 | 355 |
| 1043 | 3300007265 | Ga0099794_10054680 | Ga0099794_100546802 | 355 |
| 1044 | 3300007265 | Ga0099794_10054754 | Ga0099794_100547542 | 355 |
| 1045 | 3300009011 | Ga0105251_10037885 | Ga0105251_100378852 | 355 |
| 1046 | 3300009093 | Ga0105240_10222983 | Ga0105240_102229832 | 355 |
| 1047 | 3300009094 | Ga0111539_10004508 | Ga0111539_100045086 | 355 |
| 1048 | 3300009094 | Ga0111539_10008569 | Ga0111539_100085696 | 355 |
| 1049 | 3300009094 | Ga0111539_10011182 | Ga0111539_100111822 | 355 |
| 1050 | 3300009094 | Ga0111539_10017014 | Ga0111539_100170145 | 355 |
| 1051 | 3300009094 | Ga0111539_10136297 | Ga0111539_101362972 | 355 |
| 1052 | 3300009098 | Ga0105245_10000888 | Ga0105245_1000088821 | 355 |
| 1053 | 3300009098 | Ga0105245_10019909 | Ga0105245_100199094 | 355 |
| 1054 | 3300009098 | Ga0105245_10048198 | Ga0105245_100481982 | 355 |
| 1055 | 3300009098 | Ga0105245_10072768 | Ga0105245_100727682 | 355 |
| 1056 | 3300009098 | Ga0105245_10096894 | Ga0105245_100968942 | 355 |
| 1057 | 3300009101 | Ga0105247_10001292 | Ga0105247_100012928 | 355 |
| 1058 | 3300009101 | Ga0105247_10007990 | Ga0105247_100079902 | 355 |
| 1059 | 3300009101 | Ga0105247_10040354 | Ga0105247_100403541 | 355 |
| 1060 | 3300009147 | Ga0114129_10011980 | Ga0114129_100119803 | 355 |
| 1061 | 3300009147 | Ga0114129_10033315 | Ga0114129_100333157 | 355 |
| 1062 | 3300009148 | Ga0105243_10004521 | Ga0105243_100045216 | 355 |
| 1063 | 3300009148 | Ga0105243_10052213 | Ga0105243_100522133 | 355 |
| 1064 | 3300009148 | Ga0105243_10238346 | Ga0105243_102383462 | 355 |
| 1065 | 3300009174 | Ga0105241_10000662 | Ga0105241_1000066220 | 355 |
| 1066 | 3300009174 | Ga0105241_10016979 | Ga0105241_100169793 | 355 |
| 1067 | 3300009174 | Ga0105241_10062168 | Ga0105241_100621682 | 355 |
| 1068 | 3300009174 | Ga0105241_10179290 | Ga0105241_101792902 | 355 |
| 1069 | 3300009176 | Ga0105242_10001202 | Ga0105242_100012027 | 355 |
| 1070 | 3300009176 | Ga0105242_10033477 | Ga0105242_100334773 | 355 |
| 1071 | 3300009176 | Ga0105242_10053798 | Ga0105242_100537983 | 355 |
| 1072 | 3300009177 | Ga0105248_10002336 | Ga0105248_100023367 | 355 |
| 1073 | 3300009177 | Ga0105248_10063028 | Ga0105248_100630283 | 355 |
| 1074 | 3300009177 | Ga0105248_10072434 | Ga0105248_100724343 | 355 |
| 1075 | 3300009545 | Ga0105237_10010293 | Ga0105237_100102937 | 355 |
| 1076 | 3300009545 | Ga0105237_10020331 | Ga0105237_100203316 | 355 |
| 1077 | 3300009545 | Ga0105237_10053429 | Ga0105237_100534293 | 355 |
| 1078 | 3300009545 | Ga0105237_10138222 | Ga0105237_101382222 | 355 |
| 1079 | 3300009545 | Ga0105237_10142679 | Ga0105237_101426791 | 355 |
| 1080 | 3300009551 | Ga0105238_10035579 | Ga0105238_100355794 | 355 |
| 1081 | 3300009551 | Ga0105238_10044782 | Ga0105238_100447823 | 355 |
| 1082 | 3300009551 | Ga0105238_10232571 | Ga0105238_102325712 | 355 |
| 1083 | 3300009553 | Ga0105249_10001808 | Ga0105249_100018087 | 355 |
| 1084 | 3300010375 | Ga0105239_10018370 | Ga0105239_100183707 | 355 |
| 1085 | 3300010375 | Ga0105239_10050388 | Ga0105239_100503881 | 355 |
| 1086 | 3300010375 | Ga0105239_10056652 | Ga0105239_100566523 | 355 |
| 1087 | 3300010375 | Ga0105239_10060609 | Ga0105239_100606094 | 355 |
| 1088 | 3300010375 | Ga0105239_10103533 | Ga0105239_101035332 | 355 |
| 1089 | 3300010375 | Ga0105239_10133487 | Ga0105239_101334873 | 355 |
| 1090 | 3300010375 | Ga0105239_10170978 | Ga0105239_101709782 | 355 |
| 1091 | 3300011119 | Ga0105246_10004623 | Ga0105246_100046239 | 355 |
| 1092 | 3300011119 | Ga0105246_10013849 | Ga0105246_100138492 | 355 |
| 1093 | 3300011119 | Ga0105246_10240447 | Ga0105246_102404471 | 355 |
| 1094 | 3300012480 | Ga0157346_1000487 | Ga0157346_10004872 | 355 |
| 1095 | 3300012494 | Ga0157341_1000902 | Ga0157341_10009022 | 355 |
| 1096 | 3300012505 | Ga0157339_1001172 | Ga0157339_10011722 | 355 |
| 1097 | 3300013100 | Ga0157373_10011956 | Ga0157373_100119565 | 355 |
| 1098 | 3300013102 | Ga0157371_10027329 | Ga0157371_100273292 | 355 |
| 1099 | 3300013104 | Ga0157370_10004885 | Ga0157370_100048859 | 355 |
| 1100 | 3300013104 | Ga0157370_10101270 | Ga0157370_101012703 | 355 |
| 1101 | 3300013104 | Ga0157370_10209417 | Ga0157370_102094172 | 355 |
| 1102 | 3300013105 | Ga0157369_10016501 | Ga0157369_100165018 | 355 |
| 1103 | 3300013105 | Ga0157369_10066123 | Ga0157369_100661233 | 355 |
| 1104 | 3300013296 | Ga0157374_10002267 | Ga0157374_100022677 | 355 |
| 1105 | 3300013296 | Ga0157374_10005674 | Ga0157374_100056742 | 355 |
| 1106 | 3300013296 | Ga0157374_10030713 | Ga0157374_100307135 | 355 |
| 1107 | 3300013296 | Ga0157374_10050875 | Ga0157374_100508752 | 355 |
| 1108 | 3300013296 | Ga0157374_10066448 | Ga0157374_100664483 | 355 |
| 1109 | 3300013297 | Ga0157378_10100657 | Ga0157378_101006572 | 355 |
| 1110 | 3300013306 | Ga0163162_10009182 | Ga0163162_100091824 | 355 |
| 1111 | 3300013306 | Ga0163162_10015064 | Ga0163162_100150648 | 355 |
| 1112 | 3300013306 | Ga0163162_10284195 | Ga0163162_102841952 | 355 |
| 1113 | 3300013307 | Ga0157372_10005926 | Ga0157372_100059266 | 355 |
| 1114 | 3300013307 | Ga0157372_10011471 | Ga0157372_100114716 | 355 |
| 1115 | 3300013307 | Ga0157372_10277014 | Ga0157372_102770142 | 355 |
| 1116 | 3300013308 | Ga0157375_10001031 | Ga0157375_100010317 | 355 |
| 1117 | 3300013308 | Ga0157375_10019981 | Ga0157375_100199816 | 355 |
| 1118 | 3300013308 | Ga0157375_10052928 | Ga0157375_100529284 | 355 |
| 1119 | 3300013308 | Ga0157375_10184396 | Ga0157375_101843962 | 355 |
| 1120 | 3300013308 | Ga0157375_10189355 | Ga0157375_101893552 | 355 |
| 1121 | 3300013308 | Ga0157375_10204719 | Ga0157375_102047192 | 355 |
| 1122 | 3300014325 | Ga0163163_10003057 | Ga0163163_1000305713 | 355 |
| 1123 | 3300014325 | Ga0163163_10003323 | Ga0163163_1000332310 | 355 |
| 1124 | 3300014325 | Ga0163163_10038122 | Ga0163163_100381223 | 355 |
| 1125 | 3300014325 | Ga0163163_10113030 | Ga0163163_101130302 | 355 |
| 1126 | 3300014326 | Ga0157380_10000726 | Ga0157380_1000072610 | 355 |
| 1127 | 3300014326 | Ga0157380_10005881 | Ga0157380_100058813 | 355 |
| 1128 | 3300014326 | Ga0157380_10048489 | Ga0157380_100484891 | 355 |
| 1129 | 3300014745 | Ga0157377_10000324 | Ga0157377_1000032411 | 355 |
| 1130 | 3300014968 | Ga0157379_10001193 | Ga0157379_1000119310 | 355 |
| 1131 | 3300014968 | Ga0157379_10013061 | Ga0157379_100130613 | 355 |
| 1132 | 3300014968 | Ga0157379_10027074 | Ga0157379_100270744 | 355 |
| 1133 | 3300014969 | Ga0157376_10003383 | Ga0157376_100033834 | 355 |
| 1134 | 3300014969 | Ga0157376_10066060 | Ga0157376_100660602 | 355 |
| 1135 | 3300014969 | Ga0157376_10209517 | Ga0157376_102095172 | 355 |
| 1136 | 3300014969 | Ga0157376_10337305 | Ga0157376_103373051 | 355 |
| 1137 | 3300017792 | Ga0163161_10001040 | Ga0163161_100010407 | 355 |
| 1138 | 3300017792 | Ga0163161_10116279 | Ga0163161_101162792 | 355 |
| 1139 | 3300020069 | Ga0197907_10592444 | Ga0197907_105924443 | 355 |
| 1140 | 3300020070 | Ga0206356_11623307 | Ga0206356_116233071 | 355 |
| 1141 | 3300020076 | Ga0206355_1301277 | Ga0206355_13012771 | 355 |
| 1142 | 3300020080 | Ga0206350_11111889 | Ga0206350_111118893 | 355 |
| 1143 | 3300020082 | Ga0206353_11232580 | Ga0206353_112325801 | 355 |
| 1144 | 3300021320 | Ga0214544_1000002 | Ga0214544_1000002162 | 355 |
| 1145 | 3300021321 | Ga0214542_1000001 | Ga0214542_1000001512 | 355 |
| 1146 | 3300021324 | Ga0214545_1000001 | Ga0214545_1000001578 | 355 |
| 1147 | 3300021327 | Ga0214543_1000001 | Ga0214543_1000001618 | 355 |
| 1148 | 3300021384 | Ga0213876_10013313 | Ga0213876_100133132 | 355 |
| 1149 | 3300021388 | Ga0213875_10016415 | Ga0213875_100164153 | 355 |
| 1150 | 3300022467 | Ga0224712_10000671 | Ga0224712_100006713 | 355 |
| 1151 | 3300022467 | Ga0224712_10006030 | Ga0224712_100060303 | 355 |
| 1152 | 3300022467 | Ga0224712_10011398 | Ga0224712_100113983 | 355 |
| 1153 | 3300025261 | Ga0209233_1020784 | Ga0209233_10207841 | 355 |
| 1154 | 3300025271 | Ga0207666_1000034 | Ga0207666_10000347 | 355 |
| 1155 | 3300025290 | Ga0207673_1000073 | Ga0207673_10000736 | 355 |
| 1156 | 3300025295 | Ga0209564_1010443 | Ga0209564_10104433 | 355 |
| 1157 | 3300025297 | Ga0209758_1001768 | Ga0209758_100176818 | 355 |
| 1158 | 3300025297 | Ga0209758_1003468 | Ga0209758_100346811 | 355 |
| 1159 | 3300025297 | Ga0209758_1030049 | Ga0209758_10300492 | 355 |
| 1160 | 3300025299 | Ga0209256_1006564 | Ga0209256_10065643 | 355 |
| 1161 | 3300025302 | Ga0207426_1000855 | Ga0207426_100085521 | 355 |
| 1162 | 3300025302 | Ga0207426_1013721 | Ga0207426_10137212 | 355 |
| 1163 | 3300025304 | Ga0209257_1001932 | Ga0209257_100193222 | 355 |
| 1164 | 3300025315 | Ga0207697_10000280 | Ga0207697_100002807 | 355 |
| 1165 | 3300025321 | Ga0207656_10068821 | Ga0207656_100688211 | 355 |
| 1166 | 3300025885 | Ga0207653_10001427 | Ga0207653_100014273 | 355 |
| 1167 | 3300025893 | Ga0207682_10000134 | Ga0207682_1000013424 | 355 |
| 1168 | 3300025893 | Ga0207682_10002016 | Ga0207682_100020167 | 355 |
| 1169 | 3300025898 | Ga0207692_10002168 | Ga0207692_100021683 | 355 |
| 1170 | 3300025898 | Ga0207692_10002762 | Ga0207692_100027622 | 355 |
| 1171 | 3300025898 | Ga0207692_10142815 | Ga0207692_101428151 | 355 |
| 1172 | 3300025899 | Ga0207642_10008502 | Ga0207642_100085022 | 355 |
| 1173 | 3300025899 | Ga0207642_10083998 | Ga0207642_100839981 | 355 |
| 1174 | 3300025900 | Ga0207710_10001541 | Ga0207710_100015415 | 355 |
| 1175 | 3300025900 | Ga0207710_10006028 | Ga0207710_100060283 | 355 |
| 1176 | 3300025900 | Ga0207710_10027029 | Ga0207710_100270292 | 355 |
| 1177 | 3300025901 | Ga0207688_10000526 | Ga0207688_1000052610 | 355 |
| 1178 | 3300025901 | Ga0207688_10000663 | Ga0207688_100006633 | 355 |
| 1179 | 3300025901 | Ga0207688_10095742 | Ga0207688_100957421 | 355 |
| 1180 | 3300025901 | Ga0207688_10112576 | Ga0207688_101125761 | 355 |
| 1181 | 3300025903 | Ga0207680_10037146 | Ga0207680_100371463 | 355 |
| 1182 | 3300025904 | Ga0207647_10003350 | Ga0207647_100033506 | 355 |
| 1183 | 3300025904 | Ga0207647_10007263 | Ga0207647_100072633 | 355 |
| 1184 | 3300025904 | Ga0207647_10011872 | Ga0207647_100118723 | 355 |
| 1185 | 3300025905 | Ga0207685_10008122 | Ga0207685_100081222 | 355 |
| 1186 | 3300025906 | Ga0207699_10000508 | Ga0207699_1000050815 | 355 |
| 1187 | 3300025906 | Ga0207699_10024497 | Ga0207699_100244972 | 355 |
| 1188 | 3300025906 | Ga0207699_10025852 | Ga0207699_100258523 | 355 |
| 1189 | 3300025906 | Ga0207699_10049502 | Ga0207699_100495022 | 355 |
| 1190 | 3300025907 | Ga0207645_10001617 | Ga0207645_100016177 | 355 |
| 1191 | 3300025907 | Ga0207645_10023769 | Ga0207645_100237693 | 355 |
| 1192 | 3300025907 | Ga0207645_10030200 | Ga0207645_100302003 | 355 |
| 1193 | 3300025908 | Ga0207643_10000756 | Ga0207643_100007567 | 355 |
| 1194 | 3300025908 | Ga0207643_10000808 | Ga0207643_100008086 | 355 |
| 1195 | 3300025908 | Ga0207643_10072110 | Ga0207643_100721102 | 355 |
| 1196 | 3300025911 | Ga0207654_10011329 | Ga0207654_100113292 | 355 |
| 1197 | 3300025911 | Ga0207654_10061692 | Ga0207654_100616922 | 355 |
| 1198 | 3300025911 | Ga0207654_10068775 | Ga0207654_100687752 | 355 |
| 1199 | 3300025912 | Ga0207707_10000359 | Ga0207707_100003593 | 355 |
| 1200 | 3300025912 | Ga0207707_10001961 | Ga0207707_1000196117 | 355 |
| 1201 | 3300025912 | Ga0207707_10002112 | Ga0207707_100021127 | 355 |
| 1202 | 3300025912 | Ga0207707_10003260 | Ga0207707_1000326014 | 355 |
| 1203 | 3300025912 | Ga0207707_10003603 | Ga0207707_100036035 | 355 |
| 1204 | 3300025913 | Ga0207695_10113902 | Ga0207695_101139022 | 355 |
| 1205 | 3300025913 | Ga0207695_10126627 | Ga0207695_101266272 | 355 |
| 1206 | 3300025914 | Ga0207671_10030827 | Ga0207671_100308272 | 355 |
| 1207 | 3300025914 | Ga0207671_10031017 | Ga0207671_100310174 | 355 |
| 1208 | 3300025914 | Ga0207671_10036337 | Ga0207671_100363371 | 355 |
| 1209 | 3300025914 | Ga0207671_10084264 | Ga0207671_100842642 | 355 |
| 1210 | 3300025914 | Ga0207671_10092604 | Ga0207671_100926043 | 355 |
| 1211 | 3300025915 | Ga0207693_10002467 | Ga0207693_1000246712 | 355 |
| 1212 | 3300025915 | Ga0207693_10030563 | Ga0207693_100305632 | 355 |
| 1213 | 3300025915 | Ga0207693_10032713 | Ga0207693_100327133 | 355 |
| 1214 | 3300025915 | Ga0207693_10039890 | Ga0207693_100398903 | 355 |
| 1215 | 3300025915 | Ga0207693_10071283 | Ga0207693_100712832 | 355 |
| 1216 | 3300025915 | Ga0207693_10116468 | Ga0207693_101164681 | 355 |
| 1217 | 3300025916 | Ga0207663_10040483 | Ga0207663_100404833 | 355 |
| 1218 | 3300025916 | Ga0207663_10044561 | Ga0207663_100445612 | 355 |
| 1219 | 3300025916 | Ga0207663_10211677 | Ga0207663_102116772 | 355 |
| 1220 | 3300025917 | Ga0207660_10001335 | Ga0207660_1000133510 | 355 |
| 1221 | 3300025917 | Ga0207660_10008111 | Ga0207660_100081114 | 355 |
| 1222 | 3300025917 | Ga0207660_10013662 | Ga0207660_100136623 | 355 |
| 1223 | 3300025917 | Ga0207660_10044293 | Ga0207660_100442932 | 355 |
| 1224 | 3300025917 | Ga0207660_10047556 | Ga0207660_100475562 | 355 |
| 1225 | 3300025917 | Ga0207660_10078384 | Ga0207660_100783842 | 355 |
| 1226 | 3300025917 | Ga0207660_10242940 | Ga0207660_102429402 | 355 |
| 1227 | 3300025918 | Ga0207662_10000341 | Ga0207662_1000034110 | 355 |
| 1228 | 3300025918 | Ga0207662_10007966 | Ga0207662_100079662 | 355 |
| 1229 | 3300025918 | Ga0207662_10055341 | Ga0207662_100553412 | 355 |
| 1230 | 3300025919 | Ga0207657_10002888 | Ga0207657_100028888 | 355 |
| 1231 | 3300025919 | Ga0207657_10012009 | Ga0207657_100120099 | 355 |
| 1232 | 3300025919 | Ga0207657_10021585 | Ga0207657_100215852 | 355 |
| 1233 | 3300025919 | Ga0207657_10022947 | Ga0207657_100229474 | 355 |
| 1234 | 3300025919 | Ga0207657_10054672 | Ga0207657_100546723 | 355 |
| 1235 | 3300025920 | Ga0207649_10000271 | Ga0207649_100002717 | 355 |
| 1236 | 3300025920 | Ga0207649_10195265 | Ga0207649_101952651 | 355 |
| 1237 | 3300025920 | Ga0207649_10286747 | Ga0207649_102867471 | 355 |
| 1238 | 3300025921 | Ga0207652_10001830 | Ga0207652_100018307 | 355 |
| 1239 | 3300025921 | Ga0207652_10001857 | Ga0207652_1000185716 | 355 |
| 1240 | 3300025921 | Ga0207652_10019118 | Ga0207652_100191184 | 355 |
| 1241 | 3300025921 | Ga0207652_10034193 | Ga0207652_100341933 | 355 |
| 1242 | 3300025921 | Ga0207652_10047300 | Ga0207652_100473002 | 355 |
| 1243 | 3300025921 | Ga0207652_10064689 | Ga0207652_100646893 | 355 |
| 1244 | 3300025921 | Ga0207652_10085656 | Ga0207652_100856563 | 355 |
| 1245 | 3300025921 | Ga0207652_10134157 | Ga0207652_101341571 | 355 |
| 1246 | 3300025921 | Ga0207652_10141779 | Ga0207652_101417792 | 355 |
| 1247 | 3300025921 | Ga0207652_10198169 | Ga0207652_101981692 | 355 |
| 1248 | 3300025922 | Ga0207646_10140901 | Ga0207646_101409012 | 355 |
| 1249 | 3300025923 | Ga0207681_10000658 | Ga0207681_100006587 | 355 |
| 1250 | 3300025923 | Ga0207681_10067166 | Ga0207681_100671662 | 355 |
| 1251 | 3300025923 | Ga0207681_10212643 | Ga0207681_102126431 | 355 |
| 1252 | 3300025924 | Ga0207694_10019649 | Ga0207694_100196495 | 355 |
| 1253 | 3300025924 | Ga0207694_10065256 | Ga0207694_100652562 | 355 |
| 1254 | 3300025924 | Ga0207694_10077851 | Ga0207694_100778512 | 355 |
| 1255 | 3300025924 | Ga0207694_10208429 | Ga0207694_102084292 | 355 |
| 1256 | 3300025924 | Ga0207694_10309219 | Ga0207694_103092191 | 355 |
| 1257 | 3300025925 | Ga0207650_10296655 | Ga0207650_102966551 | 355 |
| 1258 | 3300025925 | Ga0207650_10301547 | Ga0207650_103015471 | 355 |
| 1259 | 3300025926 | Ga0207659_10000177 | Ga0207659_1000017717 | 355 |
| 1260 | 3300025926 | Ga0207659_10023619 | Ga0207659_100236193 | 355 |
| 1261 | 3300025927 | Ga0207687_10000495 | Ga0207687_100004957 | 355 |
| 1262 | 3300025927 | Ga0207687_10006623 | Ga0207687_100066232 | 355 |
| 1263 | 3300025927 | Ga0207687_10013921 | Ga0207687_100139212 | 355 |
| 1264 | 3300025927 | Ga0207687_10027876 | Ga0207687_100278763 | 355 |
| 1265 | 3300025927 | Ga0207687_10160216 | Ga0207687_101602162 | 355 |
| 1266 | 3300025927 | Ga0207687_10344897 | Ga0207687_103448971 | 355 |
| 1267 | 3300025928 | Ga0207700_10018872 | Ga0207700_100188724 | 355 |
| 1268 | 3300025928 | Ga0207700_10030543 | Ga0207700_100305432 | 355 |
| 1269 | 3300025928 | Ga0207700_10090460 | Ga0207700_100904602 | 355 |
| 1270 | 3300025928 | Ga0207700_10215152 | Ga0207700_102151522 | 355 |
| 1271 | 3300025929 | Ga0207664_10191702 | Ga0207664_101917022 | 355 |
| 1272 | 3300025931 | Ga0207644_10000279 | Ga0207644_100002796 | 355 |
| 1273 | 3300025931 | Ga0207644_10029940 | Ga0207644_100299403 | 355 |
| 1274 | 3300025931 | Ga0207644_10074660 | Ga0207644_100746602 | 355 |
| 1275 | 3300025931 | Ga0207644_10128507 | Ga0207644_101285072 | 355 |
| 1276 | 3300025931 | Ga0207644_10278256 | Ga0207644_102782561 | 355 |
| 1277 | 3300025932 | Ga0207690_10001557 | Ga0207690_100015577 | 355 |
| 1278 | 3300025932 | Ga0207690_10006785 | Ga0207690_100067852 | 355 |
| 1279 | 3300025932 | Ga0207690_10008986 | Ga0207690_100089862 | 355 |
| 1280 | 3300025933 | Ga0207706_10005939 | Ga0207706_1000593910 | 355 |
| 1281 | 3300025933 | Ga0207706_10007308 | Ga0207706_1000730810 | 355 |
| 1282 | 3300025933 | Ga0207706_10012772 | Ga0207706_100127727 | 355 |
| 1283 | 3300025933 | Ga0207706_10041280 | Ga0207706_100412802 | 355 |
| 1284 | 3300025933 | Ga0207706_10053602 | Ga0207706_100536022 | 355 |
| 1285 | 3300025933 | Ga0207706_10065929 | Ga0207706_100659293 | 355 |
| 1286 | 3300025933 | Ga0207706_10092877 | Ga0207706_100928774 | 355 |
| 1287 | 3300025934 | Ga0207686_10001383 | Ga0207686_100013839 | 355 |
| 1288 | 3300025934 | Ga0207686_10052401 | Ga0207686_100524012 | 355 |
| 1289 | 3300025934 | Ga0207686_10073324 | Ga0207686_100733241 | 355 |
| 1290 | 3300025935 | Ga0207709_10000952 | Ga0207709_100009527 | 355 |
| 1291 | 3300025936 | Ga0207670_10000491 | Ga0207670_100004917 | 355 |
| 1292 | 3300025936 | Ga0207670_10062155 | Ga0207670_100621552 | 355 |
| 1293 | 3300025936 | Ga0207670_10273891 | Ga0207670_102738912 | 355 |
| 1294 | 3300025937 | Ga0207669_10000649 | Ga0207669_100006496 | 355 |
| 1295 | 3300025937 | Ga0207669_10021526 | Ga0207669_100215263 | 355 |
| 1296 | 3300025937 | Ga0207669_10367063 | Ga0207669_103670631 | 355 |
| 1297 | 3300025938 | Ga0207704_10001342 | Ga0207704_100013424 | 355 |
| 1298 | 3300025938 | Ga0207704_10006681 | Ga0207704_100066812 | 355 |
| 1299 | 3300025939 | Ga0207665_10002422 | Ga0207665_100024228 | 355 |
| 1300 | 3300025939 | Ga0207665_10004210 | Ga0207665_100042104 | 355 |
| 1301 | 3300025939 | Ga0207665_10043152 | Ga0207665_100431522 | 355 |
| 1302 | 3300025940 | Ga0207691_10002815 | Ga0207691_100028156 | 355 |
| 1303 | 3300025940 | Ga0207691_10011566 | Ga0207691_100115666 | 355 |
| 1304 | 3300025940 | Ga0207691_10039366 | Ga0207691_100393662 | 355 |
| 1305 | 3300025940 | Ga0207691_10054159 | Ga0207691_100541594 | 355 |
| 1306 | 3300025941 | Ga0207711_10001570 | Ga0207711_100015707 | 355 |
| 1307 | 3300025941 | Ga0207711_10016743 | Ga0207711_100167433 | 355 |
| 1308 | 3300025941 | Ga0207711_10021793 | Ga0207711_100217933 | 355 |
| 1309 | 3300025941 | Ga0207711_10068152 | Ga0207711_100681522 | 355 |
| 1310 | 3300025942 | Ga0207689_10002449 | Ga0207689_100024497 | 355 |
| 1311 | 3300025942 | Ga0207689_10057982 | Ga0207689_100579822 | 355 |
| 1312 | 3300025944 | Ga0207661_10000642 | Ga0207661_1000064210 | 355 |
| 1313 | 3300025944 | Ga0207661_10003486 | Ga0207661_100034866 | 355 |
| 1314 | 3300025944 | Ga0207661_10012908 | Ga0207661_100129083 | 355 |
| 1315 | 3300025944 | Ga0207661_10017816 | Ga0207661_100178162 | 355 |
| 1316 | 3300025945 | Ga0207679_10000046 | Ga0207679_1000004615 | 355 |
| 1317 | 3300025945 | Ga0207679_10028026 | Ga0207679_100280263 | 355 |
| 1318 | 3300025945 | Ga0207679_10225010 | Ga0207679_102250102 | 355 |
| 1319 | 3300025949 | Ga0207667_10007962 | Ga0207667_100079624 | 355 |
| 1320 | 3300025949 | Ga0207667_10013915 | Ga0207667_100139153 | 355 |
| 1321 | 3300025949 | Ga0207667_10017447 | Ga0207667_100174475 | 355 |
| 1322 | 3300025949 | Ga0207667_10040700 | Ga0207667_100407004 | 355 |
| 1323 | 3300025949 | Ga0207667_10184243 | Ga0207667_101842432 | 355 |
| 1324 | 3300025960 | Ga0207651_10000214 | Ga0207651_100002147 | 355 |
| 1325 | 3300025960 | Ga0207651_10035381 | Ga0207651_100353812 | 355 |
| 1326 | 3300025960 | Ga0207651_10056778 | Ga0207651_100567783 | 355 |
| 1327 | 3300025960 | Ga0207651_10082135 | Ga0207651_100821352 | 355 |
| 1328 | 3300025961 | Ga0207712_10003297 | Ga0207712_100032973 | 355 |
| 1329 | 3300025961 | Ga0207712_10121130 | Ga0207712_101211302 | 355 |
| 1330 | 3300025961 | Ga0207712_10171984 | Ga0207712_101719842 | 355 |
| 1331 | 3300025961 | Ga0207712_10176649 | Ga0207712_101766492 | 355 |
| 1332 | 3300025972 | Ga0207668_10000537 | Ga0207668_100005377 | 355 |
| 1333 | 3300025972 | Ga0207668_10026242 | Ga0207668_100262422 | 355 |
| 1334 | 3300025972 | Ga0207668_10064228 | Ga0207668_100642282 | 355 |
| 1335 | 3300025981 | Ga0207640_10000765 | Ga0207640_100007657 | 355 |
| 1336 | 3300025981 | Ga0207640_10073819 | Ga0207640_100738192 | 355 |
| 1337 | 3300025986 | Ga0207658_10001147 | Ga0207658_1000114711 | 355 |
| 1338 | 3300025986 | Ga0207658_10114269 | Ga0207658_101142692 | 355 |
| 1339 | 3300026023 | Ga0207677_10003377 | Ga0207677_100033778 | 355 |
| 1340 | 3300026023 | Ga0207677_10023214 | Ga0207677_100232142 | 355 |
| 1341 | 3300026023 | Ga0207677_10165636 | Ga0207677_101656362 | 355 |
| 1342 | 3300026035 | Ga0207703_10000940 | Ga0207703_1000094019 | 355 |
| 1343 | 3300026035 | Ga0207703_10104329 | Ga0207703_101043292 | 355 |
| 1344 | 3300026035 | Ga0207703_10128879 | Ga0207703_101288792 | 355 |
| 1345 | 3300026035 | Ga0207703_10178802 | Ga0207703_101788022 | 355 |
| 1346 | 3300026041 | Ga0207639_10000852 | Ga0207639_100008527 | 355 |
| 1347 | 3300026041 | Ga0207639_10038053 | Ga0207639_100380532 | 355 |
| 1348 | 3300026041 | Ga0207639_10105528 | Ga0207639_101055282 | 355 |
| 1349 | 3300026041 | Ga0207639_10136104 | Ga0207639_101361042 | 355 |
| 1350 | 3300026041 | Ga0207639_10343701 | Ga0207639_103437011 | 355 |
| 1351 | 3300026067 | Ga0207678_10002525 | Ga0207678_100025257 | 355 |
| 1352 | 3300026067 | Ga0207678_10011036 | Ga0207678_100110363 | 355 |
| 1353 | 3300026067 | Ga0207678_10021682 | Ga0207678_100216822 | 355 |
| 1354 | 3300026067 | Ga0207678_10105768 | Ga0207678_101057681 | 355 |
| 1355 | 3300026067 | Ga0207678_10154890 | Ga0207678_101548902 | 355 |
| 1356 | 3300026075 | Ga0207708_10001006 | Ga0207708_1000100610 | 355 |
| 1357 | 3300026075 | Ga0207708_10005549 | Ga0207708_100055493 | 355 |
| 1358 | 3300026075 | Ga0207708_10017098 | Ga0207708_100170983 | 355 |
| 1359 | 3300026078 | Ga0207702_10000126 | Ga0207702_1000012673 | 355 |
| 1360 | 3300026078 | Ga0207702_10002642 | Ga0207702_1000264217 | 355 |
| 1361 | 3300026088 | Ga0207641_10001370 | Ga0207641_100013707 | 355 |
| 1362 | 3300026088 | Ga0207641_10139531 | Ga0207641_101395312 | 355 |
| 1363 | 3300026088 | Ga0207641_10149185 | Ga0207641_101491852 | 355 |
| 1364 | 3300026089 | Ga0207648_10002036 | Ga0207648_100020367 | 355 |
| 1365 | 3300026089 | Ga0207648_10002249 | Ga0207648_1000224915 | 355 |
| 1366 | 3300026089 | Ga0207648_10013101 | Ga0207648_100131012 | 355 |
| 1367 | 3300026089 | Ga0207648_10016754 | Ga0207648_100167543 | 355 |
| 1368 | 3300026089 | Ga0207648_10021939 | Ga0207648_100219393 | 355 |
| 1369 | 3300026095 | Ga0207676_10004314 | Ga0207676_100043144 | 355 |
| 1370 | 3300026095 | Ga0207676_10024360 | Ga0207676_100243603 | 355 |
| 1371 | 3300026095 | Ga0207676_10104391 | Ga0207676_101043912 | 355 |
| 1372 | 3300026116 | Ga0207674_10002956 | Ga0207674_100029567 | 355 |
| 1373 | 3300026116 | Ga0207674_10037457 | Ga0207674_100374573 | 355 |
| 1374 | 3300026116 | Ga0207674_10045708 | Ga0207674_100457082 | 355 |
| 1375 | 3300026116 | Ga0207674_10147506 | Ga0207674_101475062 | 355 |
| 1376 | 3300026118 | Ga0207675_100006209 | Ga0207675_10000620910 | 355 |
| 1377 | 3300026118 | Ga0207675_100019635 | Ga0207675_1000196352 | 355 |
| 1378 | 3300026118 | Ga0207675_100020315 | Ga0207675_1000203155 | 355 |
| 1379 | 3300026118 | Ga0207675_100034484 | Ga0207675_1000344842 | 355 |
| 1380 | 3300026121 | Ga0207683_10001099 | Ga0207683_1000109925 | 355 |
| 1381 | 3300026121 | Ga0207683_10001904 | Ga0207683_100019048 | 355 |
| 1382 | 3300026121 | Ga0207683_10002624 | Ga0207683_1000262413 | 355 |
| 1383 | 3300026121 | Ga0207683_10004971 | Ga0207683_100049719 | 355 |
| 1384 | 3300026121 | Ga0207683_10014537 | Ga0207683_100145373 | 355 |
| 1385 | 3300026121 | Ga0207683_10250912 | Ga0207683_102509121 | 355 |
| 1386 | 3300026121 | Ga0207683_10270064 | Ga0207683_102700641 | 355 |
| 1387 | 3300026142 | Ga0207698_10001980 | Ga0207698_100019805 | 355 |
| 1388 | 3300026142 | Ga0207698_10014902 | Ga0207698_100149022 | 355 |
| 1389 | 3300027296 | Ga0209389_1000040 | Ga0209389_100004057 | 355 |
| 1390 | 3300027296 | Ga0209389_1000123 | Ga0209389_100012344 | 355 |
| 1391 | 3300027357 | Ga0209589_1000001 | Ga0209589_1000001215 | 355 |
| 1392 | 3300027357 | Ga0209589_1000036 | Ga0209589_100003644 | 355 |
| 1393 | 3300027361 | Ga0209489_100001 | Ga0209489_100001215 | 355 |
| 1394 | 3300027361 | Ga0209489_100006 | Ga0209489_100006372 | 355 |
| 1395 | 3300027361 | Ga0209489_111662 | Ga0209489_1116625 | 355 |
| 1396 | 3300027363 | Ga0209700_100001 | Ga0209700_100001215 | 355 |
| 1397 | 3300027363 | Ga0209700_100005 | Ga0209700_100005242 | 355 |
| 1398 | 3300027543 | Ga0209999_1020773 | Ga0209999_10207731 | 355 |
| 1399 | 3300027665 | Ga0209983_1006861 | Ga0209983_10068612 | 355 |
| 1400 | 3300027671 | Ga0209588_1014733 | Ga0209588_10147332 | 355 |
| 1401 | 3300027876 | Ga0209974_10000502 | Ga0209974_100005026 | 355 |
| 1402 | 3300027876 | Ga0209974_10036492 | Ga0209974_100364922 | 355 |
| 1403 | 3300027907 | Ga0207428_10002104 | Ga0207428_100021047 | 355 |
| 1404 | 3300027907 | Ga0207428_10002830 | Ga0207428_1000283015 | 355 |
| 1405 | 3300027907 | Ga0207428_10002977 | Ga0207428_100029776 | 355 |
| 1406 | 3300027907 | Ga0207428_10027000 | Ga0207428_100270004 | 355 |
| 1407 | 3300027907 | Ga0207428_10182071 | Ga0207428_101820711 | 355 |
| 1408 | 3300028379 | Ga0268266_10019214 | Ga0268266_100192143 | 355 |
| 1409 | 3300028379 | Ga0268266_10020054 | Ga0268266_100200542 | 355 |
| 1410 | 3300028379 | Ga0268266_10038195 | Ga0268266_100381951 | 355 |
| 1411 | 3300028379 | Ga0268266_10042402 | Ga0268266_100424023 | 355 |
| 1412 | 3300028379 | Ga0268266_10132847 | Ga0268266_101328472 | 355 |
| 1413 | 3300028380 | Ga0268265_10000817 | Ga0268265_1000081719 | 355 |
| 1414 | 3300028380 | Ga0268265_10009900 | Ga0268265_100099004 | 355 |
| 1415 | 3300028380 | Ga0268265_10079471 | Ga0268265_100794712 | 355 |
| 1416 | 3300028380 | Ga0268265_10120271 | Ga0268265_101202712 | 355 |
| 1417 | 3300028381 | Ga0268264_10000065 | Ga0268264_10000065230 | 355 |
| 1418 | 3300028381 | Ga0268264_10001227 | Ga0268264_100012277 | 355 |
| 1419 | 3300028381 | Ga0268264_10024308 | Ga0268264_100243083 | 355 |
| 1420 | 3300028573 | Ga0265334_10042944 | Ga0265334_100429442 | 355 |
| 1421 | 3300028577 | Ga0265318_10040378 | Ga0265318_100403782 | 355 |
| 1422 | 3300028786 | Ga0307517_10000008 | Ga0307517_100000089 | 355 |
| 1423 | 3300028794 | Ga0307515_10026041 | Ga0307515_100260419 | 355 |
| 1424 | 3300031235 | Ga0265330_10037973 | Ga0265330_100379731 | 355 |
| 1425 | 3300031241 | Ga0265325_10030264 | Ga0265325_100302642 | 355 |
| 1426 | 3300031241 | Ga0265325_10042198 | Ga0265325_100421982 | 355 |
| 1427 | 3300031241 | Ga0265325_10044311 | Ga0265325_100443112 | 355 |
| 1428 | 3300031242 | Ga0265329_10018732 | Ga0265329_100187322 | 355 |
| 1429 | 3300031247 | Ga0265340_10008853 | Ga0265340_100088532 | 355 |
| 1430 | 3300031249 | Ga0265339_10030325 | Ga0265339_100303252 | 355 |
| 1431 | 3300031250 | Ga0265331_10023016 | Ga0265331_100230163 | 355 |
| 1432 | 3300031250 | Ga0265331_10075329 | Ga0265331_100753292 | 355 |
| 1433 | 3300031344 | Ga0265316_10015085 | Ga0265316_100150856 | 355 |
| 1434 | 3300031344 | Ga0265316_10032664 | Ga0265316_100326643 | 355 |
| 1435 | 3300031344 | Ga0265316_10116788 | Ga0265316_101167881 | 355 |
| 1436 | 3300031456 | Ga0307513_10070981 | Ga0307513_100709812 | 355 |
| 1437 | 3300031595 | Ga0265313_10030488 | Ga0265313_100304882 | 355 |
| 1438 | 3300031595 | Ga0265313_10039966 | Ga0265313_100399662 | 355 |
| 1439 | 3300031616 | Ga0307508_10000018 | Ga0307508_10000018114 | 355 |
| 1440 | 3300031616 | Ga0307508_10021377 | Ga0307508_100213773 | 355 |
| 1441 | 3300031616 | Ga0307508_10212892 | Ga0307508_102128922 | 355 |
| 1442 | 3300031711 | Ga0265314_10004715 | Ga0265314_100047152 | 355 |
| 1443 | 3300031711 | Ga0265314_10021648 | Ga0265314_100216484 | 355 |
| 1444 | 3300031712 | Ga0265342_10011538 | Ga0265342_100115386 | 355 |
| 1445 | 3300031712 | Ga0265342_10075603 | Ga0265342_100756032 | 355 |
| 1446 | 3300031730 | Ga0307516_10014561 | Ga0307516_100145611 | 355 |
| 1447 | 3300031730 | Ga0307516_10068079 | Ga0307516_100680791 | 355 |
| 1448 | 3300031731 | Ga0307405_10058956 | Ga0307405_100589562 | 355 |
| 1449 | 3300031911 | Ga0307412_10055365 | Ga0307412_100553652 | 355 |
| 1450 | 3300031995 | Ga0307409_100159904 | Ga0307409_1001599042 | 355 |
| 1451 | 3300032002 | Ga0307416_100040802 | Ga0307416_1000408022 | 355 |
| 1452 | 3300032002 | Ga0307416_100449178 | Ga0307416_1004491781 | 355 |
| 1453 | 3300033180 | Ga0307510_10026470 | Ga0307510_100264703 | 355 |
| 1454 | 3300033442 | Ga0315911_1000006 | Ga0315911_1000006321 | 355 |
| 1455 | 3300034816 | Ga0373930_0000266 | Ga0373930_0000266_362_1429 | 355 |
| 1456 | 3300034816 | Ga0373930_0001442 | Ga0373930_0001442_1676_2743 | 355 |
| 1457 | 3300034817 | Ga0373948_0000471 | Ga0373948_0000471_3735_4802 | 355 |
| 1458 | 3300034818 | Ga0373950_0000324 | Ga0373950_0000324_3045_4112 | 355 |
| 1459 | 3300034819 | Ga0373958_0000451 | Ga0373958_0000451_1627_2694 | 355 |
| 1460 | 3300034820 | Ga0373959_0000553 | Ga0373959_0000553_823_1890 | 355 |
| 1461 | 3300034957 | Ga0373938_0000348 | Ga0373938_0000348_849_1916 | 355 |
| 1462 | 3300034957 | Ga0373938_0006862 | Ga0373938_0006862_521_1588 | 355 |
| 1463 | 3300035083 | Ga0373926_0002868 | Ga0373926_0002868_3067_4134 | 355 |
| 1464 | 3300035084 | Ga0373928_0001853 | Ga0373928_0001853_1656_2723 | 355 |
| 1465 | 3300035085 | Ga0373929_0000456 | Ga0373929_0000456_800_1867 | 355 |
| 1466 | 3300035085 | Ga0373929_0004977 | Ga0373929_0004977_858_1925 | 355 |
| 1467 | 3300035088 | Ga0373940_0001082 | Ga0373940_0001082_2889_3956 | 355 |
| 1468 | 3300035088 | Ga0373940_0003271 | Ga0373940_0003271_623_1690 | 355 |
| 1469 | 3300035089 | Ga0373944_0017321 | Ga0373944_0017321_496_1563 | 355 |
| 1470 | 3300035090 | Ga0373949_0002643 | Ga0373949_0002643_3172_4239 | 355 |
| 1471 | 3300035090 | Ga0373949_0004203 | Ga0373949_0004203_1740_2807 | 355 |
| 1472 | 3300035090 | Ga0373949_0005479 | Ga0373949_0005479_977_2044 | 355 |
| 1473 | 3300035091 | Ga0373951_0001125 | Ga0373951_0001125_2326_3393 | 355 |
| 1474 | 3300035091 | Ga0373951_0001619 | Ga0373951_0001619_578_1645 | 355 |
| 1475 | 3300035091 | Ga0373951_0023787 | Ga0373951_0023787_110_1177 | 355 |
| 1476 | 3300035092 | Ga0373952_0000133 | Ga0373952_0000133_4917_5984 | 355 |
| 1477 | 3300035111 | Ga0373923_0029874 | Ga0373923_0029874_236_1303 | 355 |
| 1478 | 3300035111 | Ga0373923_0031183 | Ga0373923_0031183_154_1221 | 355 |
| 1479 | 3300035111 | Ga0373923_0047617 | Ga0373923_0047617_525_1592 | 355 |
| 1480 | 3300035112 | Ga0373932_0000703 | Ga0373932_0000703_662_1729 | 355 |
| 1481 | 3300035112 | Ga0373932_0001964 | Ga0373932_0001964_4006_5073 | 355 |
| 1482 | 3300035112 | Ga0373932_0056793 | Ga0373932_0056793_43_1110 | 355 |
| 1483 | 3300035113 | Ga0373936_0007505 | Ga0373936_0007505_1852_2919 | 355 |
| 1484 | 3300035113 | Ga0373936_0028149 | Ga0373936_0028149_57_1124 | 355 |
| 1485 | 3300035113 | Ga0373936_0028822 | Ga0373936_0028822_797_1864 | 355 |
| 1486 | 3300035113 | Ga0373936_0048196 | Ga0373936_0048196_327_1394 | 355 |
| 1487 | 3300035114 | Ga0373939_0000343 | Ga0373939_0000343_2765_3832 | 355 |
| 1488 | 3300035114 | Ga0373939_0005408 | Ga0373939_0005408_849_1916 | 355 |
| 1489 | 3300035115 | Ga0373941_0001154 | Ga0373941_0001154_3248_4315 | 355 |
| 1490 | 3300035115 | Ga0373941_0002185 | Ga0373941_0002185_2996_4063 | 355 |
| 1491 | 3300035115 | Ga0373941_0003006 | Ga0373941_0003006_287_1357 | 355 |
| 1492 | 3300035116 | Ga0373945_0004512 | Ga0373945_0004512_2046_3113 | 355 |
| 1493 | 3300035118 | Ga0373954_0002285 | Ga0373954_0002285_4362_5429 | 355 |
| 1494 | 3300035118 | Ga0373954_0003393 | Ga0373954_0003393_5479_6546 | 355 |
| 1495 | 3300035118 | Ga0373954_0005654 | Ga0373954_0005654_3682_4749 | 355 |
| 1496 | 3300035118 | Ga0373954_0022517 | Ga0373954_0022517_423_1490 | 355 |
| 1497 | 3300035119 | Ga0373956_0002225 | Ga0373956_0002225_4914_5981 | 355 |
| 1498 | 3300035119 | Ga0373956_0021669 | Ga0373956_0021669_395_1462 | 355 |
| 1499 | 3300035119 | Ga0373956_0072905 | Ga0373956_0072905_163_1230 | 355 |
| 1500 | 3300035120 | Ga0373957_0002536 | Ga0373957_0002536_2567_3634 | 355 |
| 1501 | 3300035120 | Ga0373957_0009639 | Ga0373957_0009639_695_1762 | 355 |
| 1502 | 3300035121 | Ga0373960_0002057 | Ga0373960_0002057_530_1597 | 355 |
| 1503 | 3300035121 | Ga0373960_0002646 | Ga0373960_0002646_2633_3700 | 355 |
| 1504 | 3300035170 | Ga0373943_0002714 | Ga0373943_0002714_4724_5791 | 355 |
| 1505 | 3300035170 | Ga0373943_0005039 | Ga0373943_0005039_2746_3813 | 355 |
| 1506 | 3300035170 | Ga0373943_0008492 | Ga0373943_0008492_3338_4405 | 355 |
| 1507 | 3300035170 | Ga0373943_0016526 | Ga0373943_0016526_574_1641 | 355 |
| 1508 | 3300035171 | Ga0373946_0041554 | Ga0373946_0041554_59_1126 | 355 |
| 1509 | 3300035172 | Ga0373955_0001765 | Ga0373955_0001765_3322_4389 | 355 |
| 1510 | 3300035172 | Ga0373955_0027293 | Ga0373955_0027293_896_1963 | 355 |
| 1511 | 3300035172 | Ga0373955_0069280 | Ga0373955_0069280_581_1648 | 355 |
| 1512 | 3300035207 | Ga0373942_0001912 | Ga0373942_0001912_374_1441 | 355 |
| 1513 | 3300035207 | Ga0373942_0005068 | Ga0373942_0005068_1628_2695 | 355 |
| 1514 | 3300035241 | Ga0373961_0004534 | Ga0373961_0004534_307_1374 | 355 |
| 1515 | 3300035241 | Ga0373961_0026679 | Ga0373961_0026679_446_1513 | 355 |
| 1516 | 3300035242 | Ga0373962_0000253 | Ga0373962_0000253_5762_6829 | 355 |
| 1517 | 3300035410 | Ga0373924_0005148 | Ga0373924_0005148_1104_2171 | 355 |
| 1518 | 3300035410 | Ga0373924_0007383 | Ga0373924_0007383_2580_3647 | 355 |
| 1519 | 3300035691 | Ga0373931_0000714 | Ga0373931_0000714_9478_10545 | 355 |
| 1520 | 3300035691 | Ga0373931_0001610 | Ga0373931_0001610_4482_5549 | 355 |
| 1521 | 3300035691 | Ga0373931_0025062 | Ga0373931_0025062_1599_2666 | 355 |
| 1522 | 3300035691 | Ga0373931_0032400 | Ga0373931_0032400_852_1919 | 355 |
| 1523 | 3300035692 | Ga0373935_0000382 | Ga0373935_0000382_9315_10382 | 355 |
| 1524 | 3300035692 | Ga0373935_0004984 | Ga0373935_0004984_1276_2343 | 355 |
| 1525 | 3300035692 | Ga0373935_0060881 | Ga0373935_0060881_557_1624 | 355 |
| 1526 | 3300035692 | Ga0373935_0110312 | Ga0373935_0110312_726_1793 | 355 |
| 1527 | 3300035692 | Ga0373935_0113950 | Ga0373935_0113950_240_1307 | 355 |
| 1528 | 3300035692 | Ga0373935_0189356 | Ga0373935_0189356_132_1199 | 355 |
| 1529 | 3300035695 | Ga0373927_0002885 | Ga0373927_0002885_1285_2352 | 355 |
| 1530 | 3300035695 | Ga0373927_0003772 | Ga0373927_0003772_7694_8761 | 355 |
| 1531 | 3300035695 | Ga0373927_0008081 | Ga0373927_0008081_3217_4284 | 355 |
| 1532 | 3300035695 | Ga0373927_0009027 | Ga0373927_0009027_2261_3328 | 355 |
| 1533 | 3300035695 | Ga0373927_0009357 | Ga0373927_0009357_4543_5610 | 355 |
| 1534 | 3300035695 | Ga0373927_0035894 | Ga0373927_0035894_68_1135 | 355 |
| 1535 | 3300035724 | Ga0373933_0000110 | Ga0373933_0000110_9243_10310 | 355 |
| 1536 | 3300035724 | Ga0373933_0001224 | Ga0373933_0001224_10860_11927 | 355 |
| 1537 | 3300035724 | Ga0373933_0002094 | Ga0373933_0002094_3036_4103 | 355 |
| 1538 | 3300035724 | Ga0373933_0144907 | Ga0373933_0144907_171_1238 | 355 |
| 1539 | 3300035725 | Ga0373947_0001850 | Ga0373947_0001850_2103_3170 | 355 |
| 1540 | 3300035725 | Ga0373947_0005699 | Ga0373947_0005699_2536_3603 | 355 |
| 1541 | 3300035725 | Ga0373947_0015499 | Ga0373947_0015499_2303_3370 | 355 |
| 1542 | 3300035725 | Ga0373947_0034544 | Ga0373947_0034544_1628_2695 | 355 |
| 1543 | 3300035725 | Ga0373947_0036519 | Ga0373947_0036519_1334_2401 | 355 |
| 1544 | 3300035725 | Ga0373947_0080640 | Ga0373947_0080640_319_1386 | 355 |
| 1545 | 3300035725 | Ga0373947_0119783 | Ga0373947_0119783_210_1277 | 355 |
| 1546 | 3300036401 | Ga0373937_0000849 | Ga0373937_0000849_178_1245 | 355 |
| 1547 | 3300036401 | Ga0373937_0005174 | Ga0373937_0005174_3070_4137 | 355 |
| 1548 | 3300036401 | Ga0373937_0030627 | Ga0373937_0030627_2006_3073 | 355 |
| 1549 | 3300036401 | Ga0373937_0040820 | Ga0373937_0040820_1780_2847 | 355 |
| 1550 | 3300036401 | Ga0373937_0194250 | Ga0373937_0194250_64_1131 | 355 |
| 1551 | 3300037068 | Ga0373925_0007329 | Ga0373925_0007329_744_1811 | 355 |
| 1552 | 3300037068 | Ga0373925_0009418 | Ga0373925_0009418_4668_5735 | 355 |
| 1553 | 3300037068 | Ga0373925_0013981 | Ga0373925_0013981_2616_3683 | 355 |
| 1554 | 3300037068 | Ga0373925_0020372 | Ga0373925_0020372_2346_3413 | 355 |
| 1555 | 3300037068 | Ga0373925_0022711 | Ga0373925_0022711_505_1572 | 355 |
| 1556 | 3300037068 | Ga0373925_0029279 | Ga0373925_0029279_443_1510 | 355 |
| 1557 | 3300037068 | Ga0373925_0030911 | Ga0373925_0030911_922_1989 | 355 |
| 1558 | 3300037068 | Ga0373925_0037118 | Ga0373925_0037118_2342_3409 | 355 |
| 1559 | 3300037068 | Ga0373925_0065256 | Ga0373925_0065256_753_1820 | 355 |
| 1560 | 3300037312 | Ga0395899_0008367 | Ga0395899_0008367_4099_5166 | 355 |
| 1561 | 3300037418 | Ga0395900_0000940 | Ga0395900_0000940_10881_11948 | 355 |
| 1562 | 3300037418 | Ga0395900_0018516 | Ga0395900_0018516_566_1636 | 355 |
| 1563 | 3300037418 | Ga0395900_0042832 | Ga0395900_0042832_1949_3016 | 355 |
| 1564 | 3300037466 | Ga0395898_0006219 | Ga0395898_0006219_8948_10015 | 355 |
| 1565 | 3300037466 | Ga0395898_0066370 | Ga0395898_0066370_366_1433 | 355 |
| 1566 | 3300037466 | Ga0395898_0116297 | Ga0395898_0116297_747_1814 | 355 |
| 1567 | 3300037471 | Ga0395905_0001756 | Ga0395905_0001756_23860_24927 | 355 |
| 1568 | 3300037471 | Ga0395905_0004739 | Ga0395905_0004739_8574_9644 | 355 |
| 1569 | 3300037853 | Ga0436364_0351617 | Ga0436364_0351617_945_2012 | 355 |
| 1570 | 3300038443 | Ga0395901_0020828 | Ga0395901_0020828_5011_6078 | 355 |
| 1571 | 3300038443 | Ga0395901_0080714 | Ga0395901_0080714_481_1551 | 355 |
| 1572 | 3300038735 | Ga0400485_12741 | Ga0400485_12741_21522_22640 | 355 |
| 1573 | 3300038742 | Ga0400486_20716 | Ga0400486_20716_994_2148 | 355 |
| 1574 | 3300039110 | Ga0400487_27495 | Ga0400487_27495_1104_2222 | 355 |
| 1575 | 3300039437 | Ga0436365_0225834 | Ga0436365_0225834_2030_3097 | 355 |
| 1576 | 3300039437 | Ga0436365_0684140 | Ga0436365_0684140_28_1095 | 355 |
| 1577 | 3300039437 | Ga0436365_1077710 | Ga0436365_1077710_1284_2351 | 355 |
| 1578 | 3300039437 | Ga0436365_1332159 | Ga0436365_1332159_13719_14786 | 355 |
| 1579 | 3300039450 | Ga0436363_1328249 | Ga0436363_1328249_1720_2787 | 355 |
| 1580 | 3300039453 | Ga0436362_0123159 | Ga0436362_0123159_68_1135 | 355 |
| 1581 | 3300042005 | Ga0439448_0037983 | Ga0439448_0037983_407_1474 | 355 |
| 1582 | 3300042436 | Ga0439435_0041066 | Ga0439435_0041066_182_1249 | 355 |
| 1583 | 3300044658 | Ga0466972_0001455 | Ga0466972_0001455_7813_8880 | 355 |
| 1584 | 3300044658 | Ga0466972_0004207 | Ga0466972_0004207_2432_3499 | 355 |
| 1585 | 3300044673 | Ga0453683_0016653 | Ga0453683_0016653_2492_3583 | 355 |
| 1586 | 3300044683 | Ga0466965_0050746 | Ga0466965_0050746_911_1978 | 355 |
| 1587 | 3300044735 | Ga0466968_0034723 | Ga0466968_0034723_923_1990 | 355 |
| 1588 | 3300044901 | Ga0466960_0010379 | Ga0466960_0010379_2513_3580 | 355 |
| 1589 | 3300044901 | Ga0466960_0047808 | Ga0466960_0047808_93_1160 | 355 |
| 1590 | 3300045049 | Ga0466959_0028283 | Ga0466959_0028283_2708_3775 | 355 |
| 1591 | 3300045051 | Ga0451576_0004860 | Ga0451576_0004860_14961_16052 | 355 |
| 1592 | 3300045976 | Ga0466967_0001722 | Ga0466967_0001722_1256_2323 | 355 |
| 1593 | 3300045976 | Ga0466967_0062148 | Ga0466967_0062148_913_1980 | 355 |
| 1594 | 3300046452 | Ga0495617_051367 | Ga0495617_051367_145_1212 | 355 |
| 1595 | 3300046454 | Ga0495592_0003334 | Ga0495592_0003334_4151_5218 | 355 |
| 1596 | 3300046454 | Ga0495592_0008695 | Ga0495592_0008695_3339_4406 | 355 |
| 1597 | 3300046454 | Ga0495592_0026610 | Ga0495592_0026610_248_1315 | 355 |
| 1598 | 3300046454 | Ga0495592_0047700 | Ga0495592_0047700_1543_2610 | 355 |
| 1599 | 3300046454 | Ga0495592_0048320 | Ga0495592_0048320_746_1813 | 355 |
| 1600 | 3300046454 | Ga0495592_0132609 | Ga0495592_0132609_305_1372 | 355 |
| 1601 | 3300046455 | Ga0495603_0000191 | Ga0495603_0000191_26677_27744 | 355 |
| 1602 | 3300046455 | Ga0495603_0007025 | Ga0495603_0007025_1081_2148 | 355 |
| 1603 | 3300046455 | Ga0495603_0012838 | Ga0495603_0012838_3424_4491 | 355 |
| 1604 | 3300046459 | Ga0495629_0000500 | Ga0495629_0000500_5790_6857 | 355 |
| 1605 | 3300046459 | Ga0495629_0001281 | Ga0495629_0001281_7794_8861 | 355 |
| 1606 | 3300046459 | Ga0495629_0002009 | Ga0495629_0002009_9881_10948 | 355 |
| 1607 | 3300046459 | Ga0495629_0065989 | Ga0495629_0065989_57_1124 | 355 |
| 1608 | 3300046459 | Ga0495629_0115401 | Ga0495629_0115401_768_1835 | 355 |
| 1609 | 3300046459 | Ga0495629_0141597 | Ga0495629_0141597_237_1304 | 355 |
| 1610 | 3300046460 | Ga0495638_0032724 | Ga0495638_0032724_1443_2510 | 355 |
| 1611 | 3300046460 | Ga0495638_0125884 | Ga0495638_0125884_392_1459 | 355 |
| 1612 | 3300046461 | Ga0495641_0001436 | Ga0495641_0001436_13852_14919 | 355 |
| 1613 | 3300046461 | Ga0495641_0078328 | Ga0495641_0078328_178_1245 | 355 |
| 1614 | 3300046461 | Ga0495641_0106583 | Ga0495641_0106583_83_1150 | 355 |
| 1615 | 3300046462 | Ga0495651_0009095 | Ga0495651_0009095_1598_2665 | 355 |
| 1616 | 3300046462 | Ga0495651_0036961 | Ga0495651_0036961_866_1933 | 355 |
| 1617 | 3300046463 | Ga0495653_0002307 | Ga0495653_0002307_6278_7345 | 355 |
| 1618 | 3300046463 | Ga0495653_0004970 | Ga0495653_0004970_7546_8613 | 355 |
| 1619 | 3300046463 | Ga0495653_0010292 | Ga0495653_0010292_1511_2578 | 355 |
| 1620 | 3300046463 | Ga0495653_0041256 | Ga0495653_0041256_1213_2280 | 355 |
| 1621 | 3300046463 | Ga0495653_0079954 | Ga0495653_0079954_285_1352 | 355 |
| 1622 | 3300046472 | Ga0495580_0004694 | Ga0495580_0004694_3858_4925 | 355 |
| 1623 | 3300046472 | Ga0495580_0009608 | Ga0495580_0009608_3972_5039 | 355 |
| 1624 | 3300046472 | Ga0495580_0040570 | Ga0495580_0040570_158_1225 | 355 |
| 1625 | 3300046473 | Ga0495582_0000251 | Ga0495582_0000251_6739_7806 | 355 |
| 1626 | 3300046473 | Ga0495582_0009496 | Ga0495582_0009496_3217_4284 | 355 |
| 1627 | 3300046473 | Ga0495582_0012182 | Ga0495582_0012182_2715_3782 | 355 |
| 1628 | 3300046473 | Ga0495582_0045732 | Ga0495582_0045732_778_1845 | 355 |
| 1629 | 3300046473 | Ga0495582_0086417 | Ga0495582_0086417_505_1572 | 355 |
| 1630 | 3300046475 | Ga0495639_0000077 | Ga0495639_0000077_26954_28021 | 355 |
| 1631 | 3300046475 | Ga0495639_0006383 | Ga0495639_0006383_71_1138 | 355 |
| 1632 | 3300046475 | Ga0495639_0032533 | Ga0495639_0032533_238_1365 | 355 |
| 1633 | 3300046476 | Ga0495662_0000826 | Ga0495662_0000826_1525_2592 | 355 |
| 1634 | 3300046476 | Ga0495662_0014265 | Ga0495662_0014265_1761_2828 | 355 |
| 1635 | 3300046477 | Ga0495664_0009436 | Ga0495664_0009436_998_2065 | 355 |
| 1636 | 3300046477 | Ga0495664_0024516 | Ga0495664_0024516_319_1386 | 355 |
| 1637 | 3300046477 | Ga0495664_0034171 | Ga0495664_0034171_993_2060 | 355 |
| 1638 | 3300046477 | Ga0495664_0111696 | Ga0495664_0111696_387_1454 | 355 |
| 1639 | 3300046491 | Ga0495584_0073949 | Ga0495584_0073949_211_1278 | 355 |
| 1640 | 3300046492 | Ga0495585_0094237 | Ga0495585_0094237_338_1405 | 355 |
| 1641 | 3300046499 | Ga0495594_0000648 | Ga0495594_0000648_5471_6538 | 355 |
| 1642 | 3300046499 | Ga0495594_0046269 | Ga0495594_0046269_33_1100 | 355 |
| 1643 | 3300046500 | Ga0495596_0063043 | Ga0495596_0063043_336_1403 | 355 |
| 1644 | 3300046507 | Ga0495606_0034264 | Ga0495606_0034264_275_1342 | 355 |
| 1645 | 3300046507 | Ga0495606_0085500 | Ga0495606_0085500_445_1512 | 355 |
| 1646 | 3300046511 | Ga0495608_0002352 | Ga0495608_0002352_9334_10401 | 355 |
| 1647 | 3300046511 | Ga0495608_0004206 | Ga0495608_0004206_7146_8213 | 355 |
| 1648 | 3300046514 | Ga0495618_0004363 | Ga0495618_0004363_3356_4423 | 355 |
| 1649 | 3300046514 | Ga0495618_0011914 | Ga0495618_0011914_2529_3596 | 355 |
| 1650 | 3300046514 | Ga0495618_0050692 | Ga0495618_0050692_1524_2591 | 355 |
| 1651 | 3300046515 | Ga0495620_0100369 | Ga0495620_0100369_63_1130 | 355 |
| 1652 | 3300046516 | Ga0495628_0007652 | Ga0495628_0007652_3945_5012 | 355 |
| 1653 | 3300046516 | Ga0495628_0012115 | Ga0495628_0012115_1371_2438 | 355 |
| 1654 | 3300046516 | Ga0495628_0015917 | Ga0495628_0015917_1497_2564 | 355 |
| 1655 | 3300046516 | Ga0495628_0085728 | Ga0495628_0085728_382_1449 | 355 |
| 1656 | 3300046517 | Ga0495630_0001279 | Ga0495630_0001279_6493_7560 | 355 |
| 1657 | 3300046517 | Ga0495630_0040014 | Ga0495630_0040014_2376_3443 | 355 |
| 1658 | 3300046526 | Ga0495666_0008087 | Ga0495666_0008087_714_1781 | 355 |
| 1659 | 3300046526 | Ga0495666_0027327 | Ga0495666_0027327_1688_2755 | 355 |
| 1660 | 3300046526 | Ga0495666_0029598 | Ga0495666_0029598_354_1421 | 355 |
| 1661 | 3300046529 | Ga0495652_0009266 | Ga0495652_0009266_3602_4669 | 355 |
| 1662 | 3300046529 | Ga0495652_0023802 | Ga0495652_0023802_191_1258 | 355 |
| 1663 | 3300046529 | Ga0495652_0069642 | Ga0495652_0069642_645_1712 | 355 |
| 1664 | 3300046531 | Ga0495665_0005139 | Ga0495665_0005139_4649_5716 | 355 |
| 1665 | 3300046533 | Ga0495640_0003320 | Ga0495640_0003320_8689_9756 | 355 |
| 1666 | 3300046533 | Ga0495640_0004102 | Ga0495640_0004102_5359_6426 | 355 |
| 1667 | 3300046533 | Ga0495640_0055553 | Ga0495640_0055553_1571_2638 | 355 |
| 1668 | 3300046533 | Ga0495640_0157445 | Ga0495640_0157445_204_1271 | 355 |
| 1669 | 3300046535 | Ga0495586_0002128 | Ga0495586_0002128_9042_10109 | 355 |
| 1670 | 3300046536 | Ga0495587_0003095 | Ga0495587_0003095_3059_4126 | 355 |
| 1671 | 3300046536 | Ga0495587_0013122 | Ga0495587_0013122_1598_2665 | 355 |
| 1672 | 3300046539 | Ga0495621_0002390 | Ga0495621_0002390_1581_2648 | 355 |
| 1673 | 3300046539 | Ga0495621_0015571 | Ga0495621_0015571_796_1863 | 355 |
| 1674 | 3300046543 | Ga0495645_0003434 | Ga0495645_0003434_5972_7039 | 355 |
| 1675 | 3300046543 | Ga0495645_0010291 | Ga0495645_0010291_3559_4626 | 355 |
| 1676 | 3300046543 | Ga0495645_0020403 | Ga0495645_0020403_2328_3395 | 355 |
| 1677 | 3300046543 | Ga0495645_0063652 | Ga0495645_0063652_893_1960 | 355 |
| 1678 | 3300046558 | Ga0495633_0010291 | Ga0495633_0010291_2900_3967 | 355 |
| 1679 | 3300046559 | Ga0495667_0001067 | Ga0495667_0001067_3270_4337 | 355 |
| 1680 | 3300046559 | Ga0495667_0002892 | Ga0495667_0002892_6279_7346 | 355 |
| 1681 | 3300046559 | Ga0495667_0011827 | Ga0495667_0011827_3452_4519 | 355 |
| 1682 | 3300046559 | Ga0495667_0040012 | Ga0495667_0040012_1358_2425 | 355 |
| 1683 | 3300046616 | Ga0495668_0014263 | Ga0495668_0014263_850_1917 | 355 |
| 1684 | 3300046616 | Ga0495668_0081063 | Ga0495668_0081063_313_1380 | 355 |
| 1685 | 3300046642 | Ga0495634_0001976 | Ga0495634_0001976_12381_13448 | 355 |
| 1686 | 3300046642 | Ga0495634_0015373 | Ga0495634_0015373_2530_3597 | 355 |
| 1687 | 3300046642 | Ga0495634_0085415 | Ga0495634_0085415_576_1643 | 355 |
| 1688 | 3300046642 | Ga0495634_0127946 | Ga0495634_0127946_391_1458 | 355 |
| 1689 | 3300046660 | Ga0495625_0243030 | Ga0495625_0243030_65_1132 | 355 |
| 1690 | 3300046663 | Ga0495635_0004431 | Ga0495635_0004431_3994_5061 | 355 |
| 1691 | 3300046663 | Ga0495635_0019246 | Ga0495635_0019246_2958_4025 | 355 |
| 1692 | 3300046663 | Ga0495635_0021691 | Ga0495635_0021691_1237_2304 | 355 |
| 1693 | 3300046664 | Ga0495659_0002989 | Ga0495659_0002989_2892_3959 | 355 |
| 1694 | 3300046674 | Ga0495588_0004422 | Ga0495588_0004422_4235_5302 | 355 |
| 1695 | 3300046674 | Ga0495588_0036562 | Ga0495588_0036562_190_1257 | 355 |
| 1696 | 3300046675 | Ga0495657_0007463 | Ga0495657_0007463_1186_2253 | 355 |
| 1697 | 3300046675 | Ga0495657_0007949 | Ga0495657_0007949_4862_5929 | 355 |
| 1698 | 3300046675 | Ga0495657_0028576 | Ga0495657_0028576_2154_3221 | 355 |
| 1699 | 3300046678 | Ga0495599_0006005 | Ga0495599_0006005_2072_3139 | 355 |
| 1700 | 3300046678 | Ga0495599_0028649 | Ga0495599_0028649_192_1259 | 355 |
| 1701 | 3300046679 | Ga0495623_0004291 | Ga0495623_0004291_6577_7644 | 355 |
| 1702 | 3300046679 | Ga0495623_0011175 | Ga0495623_0011175_3144_4211 | 355 |
| 1703 | 3300046679 | Ga0495623_0107574 | Ga0495623_0107574_548_1615 | 355 |
| 1704 | 3300046680 | Ga0495646_0002070 | Ga0495646_0002070_3042_4109 | 355 |
| 1705 | 3300046680 | Ga0495646_0006456 | Ga0495646_0006456_3474_4541 | 355 |
| 1706 | 3300046680 | Ga0495646_0020774 | Ga0495646_0020774_1267_2334 | 355 |
| 1707 | 3300046681 | Ga0495647_0053033 | Ga0495647_0053033_496_1563 | 355 |
| 1708 | 3300046683 | Ga0495658_0001175 | Ga0495658_0001175_3226_4293 | 355 |
| 1709 | 3300046683 | Ga0495658_0001615 | Ga0495658_0001615_8978_10045 | 355 |
| 1710 | 3300046684 | Ga0495669_0006510 | Ga0495669_0006510_1935_3002 | 355 |
| 1711 | 3300046689 | Ga0495613_0011644 | Ga0495613_0011644_1127_2194 | 355 |
| 1712 | 3300046689 | Ga0495613_0012697 | Ga0495613_0012697_2288_3355 | 355 |
| 1713 | 3300046689 | Ga0495613_0022371 | Ga0495613_0022371_127_1194 | 355 |
| 1714 | 3300046690 | Ga0495624_0002021 | Ga0495624_0002021_12347_13414 | 355 |
| 1715 | 3300046809 | Ga0495600_0001546 | Ga0495600_0001546_4454_5521 | 355 |
| 1716 | 3300046809 | Ga0495600_0004625 | Ga0495600_0004625_4123_5190 | 355 |
| 1717 | 3300046809 | Ga0495600_0037714 | Ga0495600_0037714_1610_2677 | 355 |
| 1718 | 3300047315 | Ga0495581_0000503 | Ga0495581_0000503_6555_7622 | 355 |
| 1719 | 3300047315 | Ga0495581_0033250 | Ga0495581_0033250_1290_2357 | 355 |
| 1720 | 3300047315 | Ga0495581_0034285 | Ga0495581_0034285_367_1434 | 355 |
| 1721 | 3300047317 | Ga0495604_0003694 | Ga0495604_0003694_8058_9125 | 355 |
| 1722 | 3300047317 | Ga0495604_0011558 | Ga0495604_0011558_1598_2665 | 355 |
| 1723 | 3300047317 | Ga0495604_0023789 | Ga0495604_0023789_3361_4428 | 355 |
| 1724 | 3300047317 | Ga0495604_0027799 | Ga0495604_0027799_2835_3902 | 355 |
| 1725 | 3300047317 | Ga0495604_0094279 | Ga0495604_0094279_822_1889 | 355 |
| 1726 | 3300047319 | Ga0495674_0001342 | Ga0495674_0001342_21025_22092 | 355 |
| 1727 | 3300047319 | Ga0495674_0026245 | Ga0495674_0026245_3891_4958 | 355 |
| 1728 | 3300047319 | Ga0495674_0032084 | Ga0495674_0032084_3054_4121 | 355 |
| 1729 | 3300047319 | Ga0495674_0044803 | Ga0495674_0044803_957_2024 | 355 |
| 1730 | 3300047319 | Ga0495674_0052198 | Ga0495674_0052198_524_1591 | 355 |
| 1731 | 3300047319 | Ga0495674_0117877 | Ga0495674_0117877_518_1585 | 355 |
| 1732 | 3300047320 | Ga0495672_0032635 | Ga0495672_0032635_1985_3052 | 355 |
| 1733 | 3300047321 | Ga0495676_0021687 | Ga0495676_0021687_681_1748 | 355 |
| 1734 | 3300047321 | Ga0495676_0050478 | Ga0495676_0050478_494_1561 | 355 |
| 1735 | 3300047321 | Ga0495676_0142177 | Ga0495676_0142177_33_1100 | 355 |
| 1736 | 3300047322 | Ga0495680_0012767 | Ga0495680_0012767_4060_5127 | 355 |
| 1737 | 3300047322 | Ga0495680_0018195 | Ga0495680_0018195_3267_4334 | 355 |
| 1738 | 3300047322 | Ga0495680_0036916 | Ga0495680_0036916_1485_2552 | 355 |
| 1739 | 3300047443 | Ga0495687_012474 | Ga0495687_012474_752_1819 | 355 |
| 1740 | 3300047444 | Ga0495675_0001338 | Ga0495675_0001338_3062_4129 | 355 |
| 1741 | 3300047444 | Ga0495675_0002401 | Ga0495675_0002401_6950_8017 | 355 |
| 1742 | 3300047444 | Ga0495675_0004135 | Ga0495675_0004135_7111_8178 | 355 |
| 1743 | 3300047469 | Ga0495673_0057791 | Ga0495673_0057791_377_1444 | 355 |
| 1744 | 3300047471 | Ga0495684_0002991 | Ga0495684_0002991_4960_6027 | 355 |
| 1745 | 3300047471 | Ga0495684_0006000 | Ga0495684_0006000_6953_8020 | 355 |
| 1746 | 3300047471 | Ga0495684_0050791 | Ga0495684_0050791_751_1818 | 355 |
| 1747 | 3300047471 | Ga0495684_0088193 | Ga0495684_0088193_138_1205 | 355 |
| 1748 | 3300047472 | Ga0495686_0005497 | Ga0495686_0005497_7858_8937 | 355 |
| 1749 | 3300047673 | Ga0495593_0000192 | Ga0495593_0000192_4169_5236 | 355 |
| 1750 | 3300047673 | Ga0495593_0001200 | Ga0495593_0001200_7934_9001 | 355 |
| 1751 | 3300047673 | Ga0495593_0007939 | Ga0495593_0007939_2408_3475 | 355 |
| 1752 | 3300047673 | Ga0495593_0009818 | Ga0495593_0009818_3094_4161 | 355 |
| 1753 | 3300047673 | Ga0495593_0027391 | Ga0495593_0027391_1862_2929 | 355 |
| 1754 | 3300048088 | Ga0495602_0002392 | Ga0495602_0002392_14915_15982 | 355 |
| 1755 | 3300048088 | Ga0495602_0007064 | Ga0495602_0007064_1379_2446 | 355 |
| 1756 | 3300048088 | Ga0495602_0017778 | Ga0495602_0017778_4454_5521 | 355 |
| 1757 | 3300048903 | Ga0496100_0003962 | Ga0496100_0003962_6118_7185 | 355 |
| 1758 | 3300048903 | Ga0496100_0005504 | Ga0496100_0005504_1622_2689 | 355 |
| 1759 | 3300048903 | Ga0496100_0023159 | Ga0496100_0023159_751_1818 | 355 |
| 1760 | 3300048903 | Ga0496100_0059662 | Ga0496100_0059662_446_1513 | 355 |
| 1761 | 3300048904 | Ga0496101_0001185 | Ga0496101_0001185_12347_13414 | 355 |
| 1762 | 3300048904 | Ga0496101_0014484 | Ga0496101_0014484_864_1931 | 355 |
| 1763 | 3300048904 | Ga0496101_0052455 | Ga0496101_0052455_1009_2076 | 355 |
| 1764 | 3300048904 | Ga0496101_0067099 | Ga0496101_0067099_22_1089 | 355 |
| 1765 | 3300048905 | Ga0496102_0001427 | Ga0496102_0001427_7730_8797 | 355 |
| 1766 | 3300048905 | Ga0496102_0010740 | Ga0496102_0010740_894_1961 | 355 |
| 1767 | 3300048905 | Ga0496102_0018426 | Ga0496102_0018426_2406_3473 | 355 |
| 1768 | 3300048905 | Ga0496102_0021189 | Ga0496102_0021189_727_1794 | 355 |
| 1769 | 3300048905 | Ga0496102_0033644 | Ga0496102_0033644_1923_2990 | 355 |
| 1770 | 3300048905 | Ga0496102_0053452 | Ga0496102_0053452_1521_2588 | 355 |
| 1771 | 3300048906 | Ga0496103_0001145 | Ga0496103_0001145_4078_5145 | 355 |
| 1772 | 3300048906 | Ga0496103_0012446 | Ga0496103_0012446_1232_2299 | 355 |
| 1773 | 3300048906 | Ga0496103_0028524 | Ga0496103_0028524_933_2000 | 355 |
| 1774 | 3300048906 | Ga0496103_0068689 | Ga0496103_0068689_484_1551 | 355 |
| 1775 | 3300048907 | Ga0496104_0000800 | Ga0496104_0000800_10902_11969 | 355 |
| 1776 | 3300048907 | Ga0496104_0004653 | Ga0496104_0004653_4985_6052 | 355 |
| 1777 | 3300048907 | Ga0496104_0024050 | Ga0496104_0024050_3451_4518 | 355 |
| 1778 | 3300048907 | Ga0496104_0034040 | Ga0496104_0034040_1866_2933 | 355 |
| 1779 | 3300048907 | Ga0496104_0080146 | Ga0496104_0080146_527_1594 | 355 |
| 1780 | 3300048908 | Ga0496105_0014766 | Ga0496105_0014766_894_1961 | 355 |
| 1781 | 3300048908 | Ga0496105_0019467 | Ga0496105_0019467_2879_3946 | 355 |
| 1782 | 3300048908 | Ga0496105_0061032 | Ga0496105_0061032_405_1472 | 355 |
| 1783 | 3300048908 | Ga0496105_0062915 | Ga0496105_0062915_799_1866 | 355 |
| 1784 | 3300048909 | Ga0496106_0000644 | Ga0496106_0000644_12431_13498 | 355 |
| 1785 | 3300048909 | Ga0496106_0015891 | Ga0496106_0015891_793_1860 | 355 |
| 1786 | 3300048909 | Ga0496106_0016692 | Ga0496106_0016692_2933_4000 | 355 |
| 1787 | 3300048909 | Ga0496106_0038434 | Ga0496106_0038434_1137_2204 | 355 |
| 1788 | 3300048910 | Ga0496107_0000844 | Ga0496107_0000844_9801_10868 | 355 |
| 1789 | 3300048910 | Ga0496107_0002006 | Ga0496107_0002006_6551_7618 | 355 |
| 1790 | 3300048910 | Ga0496107_0009798 | Ga0496107_0009798_2984_4051 | 355 |
| 1791 | 3300048910 | Ga0496107_0031969 | Ga0496107_0031969_1795_2862 | 355 |
| 1792 | 3300048910 | Ga0496107_0033348 | Ga0496107_0033348_1055_2122 | 355 |
| 1793 | 3300048911 | Ga0496108_0002310 | Ga0496108_0002310_427_1494 | 355 |
| 1794 | 3300048911 | Ga0496108_0002624 | Ga0496108_0002624_4861_5928 | 355 |
| 1795 | 3300048911 | Ga0496108_0057494 | Ga0496108_0057494_822_1889 | 355 |
| 1796 | 3300048911 | Ga0496108_0079607 | Ga0496108_0079607_207_1274 | 355 |
| 1797 | 3300048912 | Ga0496109_0003011 | Ga0496109_0003011_10503_11570 | 355 |
| 1798 | 3300048912 | Ga0496109_0011996 | Ga0496109_0011996_3322_4389 | 355 |
| 1799 | 3300048912 | Ga0496109_0159657 | Ga0496109_0159657_114_1181 | 355 |
| 1800 | 3300048913 | Ga0496110_0002024 | Ga0496110_0002024_8281_9348 | 355 |
| 1801 | 3300048913 | Ga0496110_0005701 | Ga0496110_0005701_2885_3952 | 355 |
| 1802 | 3300048913 | Ga0496110_0013610 | Ga0496110_0013610_3244_4311 | 355 |
| 1803 | 3300048913 | Ga0496110_0063334 | Ga0496110_0063334_555_1622 | 355 |
| 1804 | 3300048913 | Ga0496110_0121716 | Ga0496110_0121716_1010_2077 | 355 |
| 1805 | 3300048914 | Ga0496111_0003300 | Ga0496111_0003300_8416_9483 | 355 |
| 1806 | 3300048914 | Ga0496111_0016639 | Ga0496111_0016639_3730_4797 | 355 |
| 1807 | 3300048914 | Ga0496111_0020931 | Ga0496111_0020931_2706_3773 | 355 |
| 1808 | 3300048914 | Ga0496111_0025629 | Ga0496111_0025629_3039_4106 | 355 |
| 1809 | 3300048914 | Ga0496111_0029166 | Ga0496111_0029166_1161_2228 | 355 |
| 1810 | 3300048914 | Ga0496111_0178753 | Ga0496111_0178753_14_1081 | 355 |
| 1811 | 3300048915 | Ga0496112_0000004 | Ga0496112_0000004_318810_319877 | 355 |
| 1812 | 3300048915 | Ga0496112_0010399 | Ga0496112_0010399_6752_7819 | 355 |
| 1813 | 3300048915 | Ga0496112_0013933 | Ga0496112_0013933_832_1899 | 355 |
| 1814 | 3300048915 | Ga0496112_0031686 | Ga0496112_0031686_2824_3891 | 355 |
| 1815 | 3300048915 | Ga0496112_0074323 | Ga0496112_0074323_1296_2363 | 355 |
| 1816 | 3300048915 | Ga0496112_0202571 | Ga0496112_0202571_163_1230 | 355 |
| 1817 | 3300048915 | Ga0496112_0430124 | Ga0496112_0430124_147_1214 | 355 |
| 1818 | 3300048916 | Ga0496113_0006037 | Ga0496113_0006037_851_1918 | 355 |
| 1819 | 3300048916 | Ga0496113_0010146 | Ga0496113_0010146_719_1786 | 355 |
| 1820 | 3300048916 | Ga0496113_0022159 | Ga0496113_0022159_783_1850 | 355 |
| 1821 | 3300048916 | Ga0496113_0116201 | Ga0496113_0116201_31_1098 | 355 |
| 1822 | 3300048917 | Ga0496114_0010127 | Ga0496114_0010127_2190_3257 | 355 |
| 1823 | 3300048917 | Ga0496114_0014349 | Ga0496114_0014349_3957_5024 | 355 |
| 1824 | 3300048917 | Ga0496114_0068992 | Ga0496114_0068992_1461_2528 | 355 |
| 1825 | 3300048917 | Ga0496114_0086065 | Ga0496114_0086065_1316_2383 | 355 |
| 1826 | 3300048918 | Ga0496115_0010097 | Ga0496115_0010097_3675_4742 | 355 |
| 1827 | 3300048918 | Ga0496115_0016209 | Ga0496115_0016209_1943_3010 | 355 |
| 1828 | 3300048918 | Ga0496115_0017600 | Ga0496115_0017600_414_1481 | 355 |
| 1829 | 3300048918 | Ga0496115_0021136 | Ga0496115_0021136_3037_4104 | 355 |
| 1830 | 3300048918 | Ga0496115_0029351 | Ga0496115_0029351_50_1117 | 355 |
| 1831 | 3300048918 | Ga0496115_0030622 | Ga0496115_0030622_1648_2715 | 355 |
| 1832 | 3300048918 | Ga0496115_0061514 | Ga0496115_0061514_1353_2420 | 355 |
| 1833 | 3300048918 | Ga0496115_0115841 | Ga0496115_0115841_839_1906 | 355 |
| 1834 | 3300048921 | Ga0496118_0022371 | Ga0496118_0022371_2156_3223 | 355 |
| 1835 | 3300048924 | Ga0496121_0000458 | Ga0496121_0000458_78200_79267 | 355 |
| 1836 | 3300048924 | Ga0496121_0000668 | Ga0496121_0000668_38490_39557 | 355 |
| 1837 | 3300048924 | Ga0496121_0046790 | Ga0496121_0046790_1102_2169 | 355 |
| 1838 | 3300048924 | Ga0496121_0058459 | Ga0496121_0058459_1807_2874 | 355 |
| 1839 | 3300048924 | Ga0496121_0116311 | Ga0496121_0116311_695_1762 | 355 |
| 1840 | 3300048927 | Ga0496124_0018892 | Ga0496124_0018892_3690_4757 | 355 |
| 1841 | 3300048929 | Ga0496126_0015822 | Ga0496126_0015822_572_1639 | 355 |
| 1842 | 3300048929 | Ga0496126_0121675 | Ga0496126_0121675_156_1223 | 355 |
| 1843 | 3300049568 | Ga0501031_0028491 | Ga0501031_0028491_195_1262 | 355 |
| 1844 | 3300049569 | Ga0501032_0005134 | Ga0501032_0005134_6286_7356 | 355 |
| 1845 | 3300049569 | Ga0501032_0017361 | Ga0501032_0017361_3587_4657 | 355 |
| 1846 | 3300049570 | Ga0501033_0034418 | Ga0501033_0034418_1774_2844 | 355 |
| 1847 | 3300049570 | Ga0501033_0101887 | Ga0501033_0101887_295_1365 | 355 |
| 1848 | 3300049571 | Ga0501034_0001160 | Ga0501034_0001160_31060_32130 | 355 |
| 1849 | 3300049571 | Ga0501034_0417808 | Ga0501034_0417808_134_1204 | 355 |
| 1850 | 3300049572 | Ga0501036_0003243 | Ga0501036_0003243_6284_7354 | 355 |
| 1851 | 3300049572 | Ga0501036_0046547 | Ga0501036_0046547_691_1758 | 355 |
| 1852 | 3300049573 | Ga0501037_0002178 | Ga0501037_0002178_2363_3433 | 355 |
| 1853 | 3300049573 | Ga0501037_0024884 | Ga0501037_0024884_1857_2927 | 355 |
| 1854 | 3300049573 | Ga0501037_0041443 | Ga0501037_0041443_776_1846 | 355 |
| 1855 | 3300049574 | Ga0501038_0027593 | Ga0501038_0027593_2761_3831 | 355 |
| 1856 | 3300049574 | Ga0501038_0044018 | Ga0501038_0044018_1652_2719 | 355 |
| 1857 | 3300049574 | Ga0501038_0135773 | Ga0501038_0135773_810_1901 | 355 |
| 1858 | 3300049575 | Ga0501039_0005778 | Ga0501039_0005778_3927_4997 | 355 |
| 1859 | 3300049575 | Ga0501039_0151695 | Ga0501039_0151695_373_1443 | 355 |
| 1860 | 3300049579 | Ga0501043_0010595 | Ga0501043_0010595_6083_7153 | 355 |
| 1861 | 3300049579 | Ga0501043_0059176 | Ga0501043_0059176_623_1693 | 355 |
| 1862 | 3300049580 | Ga0501046_0009020 | Ga0501046_0009020_6529_7599 | 355 |
| 1863 | 3300049580 | Ga0501046_0016351 | Ga0501046_0016351_2224_3291 | 355 |
| 1864 | 3300049580 | Ga0501046_0055778 | Ga0501046_0055778_1407_2477 | 355 |
| 1865 | 3300049580 | Ga0501046_0056031 | Ga0501046_0056031_831_1901 | 355 |
| 1866 | 3300049581 | Ga0501047_0001508 | Ga0501047_0001508_17526_18596 | 355 |
| 1867 | 3300049581 | Ga0501047_0010664 | Ga0501047_0010664_4543_5610 | 355 |
| 1868 | 3300049581 | Ga0501047_0014013 | Ga0501047_0014013_1674_2744 | 355 |
| 1869 | 3300049582 | Ga0501048_0000151 | Ga0501048_0000151_32483_33553 | 355 |
| 1870 | 3300049583 | Ga0501067_0008205 | Ga0501067_0008205_2570_3637 | 355 |
| 1871 | 3300049584 | Ga0501068_0097161 | Ga0501068_0097161_568_1638 | 355 |
| 1872 | 3300049585 | Ga0501069_0027507 | Ga0501069_0027507_1952_3022 | 355 |
| 1873 | 3300049586 | Ga0501070_0005227 | Ga0501070_0005227_252_1322 | 355 |
| 1874 | 3300049586 | Ga0501070_0014416 | Ga0501070_0014416_2080_3147 | 355 |
| 1875 | 3300049587 | Ga0501071_0093943 | Ga0501071_0093943_94_1164 | 355 |
| 1876 | 3300049588 | Ga0501072_0097197 | Ga0501072_0097197_912_1982 | 355 |
| 1877 | 3300049589 | Ga0501073_0033251 | Ga0501073_0033251_1937_3004 | 355 |
| 1878 | 3300049589 | Ga0501073_0047140 | Ga0501073_0047140_1085_2155 | 355 |
| 1879 | 3300049589 | Ga0501073_0114295 | Ga0501073_0114295_708_1778 | 355 |
| 1880 | 3300049590 | Ga0501074_0010639 | Ga0501074_0010639_3808_4875 | 355 |
| 1881 | 3300049590 | Ga0501074_0018658 | Ga0501074_0018658_1372_2442 | 355 |
| 1882 | 3300049590 | Ga0501074_0070101 | Ga0501074_0070101_377_1447 | 355 |
| 1883 | 3300049590 | Ga0501074_0135923 | Ga0501074_0135923_313_1383 | 355 |
| 1884 | 3300049591 | Ga0501075_0129638 | Ga0501075_0129638_694_1761 | 355 |
| 1885 | 3300049592 | Ga0501076_0009771 | Ga0501076_0009771_5510_6577 | 355 |
| 1886 | 3300049592 | Ga0501076_0095072 | Ga0501076_0095072_926_1993 | 355 |
| 1887 | 3300049592 | Ga0501076_0103471 | Ga0501076_0103471_612_1682 | 355 |
| 1888 | 3300049593 | Ga0501077_0064401 | Ga0501077_0064401_906_1973 | 355 |
| 1889 | 3300049741 | Ga0501079_0021362 | Ga0501079_0021362_3559_4626 | 355 |
| 1890 | 3300049741 | Ga0501079_0045004 | Ga0501079_0045004_1116_2186 | 355 |
| 1891 | 3300049742 | Ga0501080_0000130 | Ga0501080_0000130_30483_31553 | 355 |
| 1892 | 3300049742 | Ga0501080_0037162 | Ga0501080_0037162_240_1307 | 355 |
| 1893 | 3300049742 | Ga0501080_0070845 | Ga0501080_0070845_962_2032 | 355 |
| 1894 | 3300049742 | Ga0501080_0080027 | Ga0501080_0080027_17_1084 | 355 |
| 1895 | 3300049743 | Ga0501081_0059062 | Ga0501081_0059062_1359_2426 | 355 |
| 1896 | 3300049744 | Ga0501083_0072468 | Ga0501083_0072468_497_1564 | 355 |
| 1897 | 3300049744 | Ga0501083_0102558 | Ga0501083_0102558_350_1417 | 355 |
| 1898 | 3300049744 | Ga0501083_0107677 | Ga0501083_0107677_429_1496 | 355 |
| 1899 | 3300049822 | Ga0501035_0115008 | Ga0501035_0115008_1105_2175 | 355 |
| 1900 | 3300049823 | Ga0501044_0000636 | Ga0501044_0000636_32511_33581 | 355 |
| 1901 | 3300049823 | Ga0501044_0035319 | Ga0501044_0035319_832_1899 | 355 |
| 1902 | 3300049823 | Ga0501044_0044641 | Ga0501044_0044641_2695_3762 | 355 |
| 1903 | 3300049823 | Ga0501044_0072975 | Ga0501044_0072975_1208_2278 | 355 |
| 1904 | 3300049823 | Ga0501044_0129136 | Ga0501044_0129136_496_1566 | 355 |
| 1905 | 3300050490 | nmdc:mga03n38_22876_c1 | nmdc:mga03n38_22876_c1_1374_2441 | 355 |
| 1906 | 3300050490 | nmdc:mga03n38_4203_c1 | nmdc:mga03n38_4203_c1_3204_4271 | 355 |
| 1907 | 3300050491 | nmdc:mga00v17_65912_c1 | nmdc:mga00v17_65912_c1_884_1951 | 355 |
| 1908 | 3300050492 | nmdc:mga0yw44_4056_c1 | nmdc:mga0yw44_4056_c1_4422_5489 | 355 |
| 1909 | 3300050492 | nmdc:mga0yw44_59988_c1 | nmdc:mga0yw44_59988_c1_1225_2292 | 355 |
| 1910 | 3300050492 | nmdc:mga0yw44_94336_c1 | nmdc:mga0yw44_94336_c1_656_1723 | 355 |
| 1911 | 3300050493 | nmdc:mga0k408_69181_c1 | nmdc:mga0k408_69181_c1_849_1916 | 355 |
| 1912 | 3300050493 | nmdc:mga0k408_70184_c1 | nmdc:mga0k408_70184_c1_930_1997 | 355 |
| 1913 | 3300050494 | nmdc:mga06z11_5335_c1 | nmdc:mga06z11_5335_c1_1787_2854 | 355 |
| 1914 | 3300050495 | nmdc:mga04h51_32831_c1 | nmdc:mga04h51_32831_c1_316_1383 | 355 |
| 1915 | 3300050495 | nmdc:mga04h51_54496_c1 | nmdc:mga04h51_54496_c1_79_1146 | 355 |
| 1916 | 3300050507 | nmdc:mga05p37_4809_c1 | nmdc:mga05p37_4809_c1_13118_14188 | 355 |
| 1917 | 3300050507 | nmdc:mga05p37_63712_c1 | nmdc:mga05p37_63712_c1_1717_2784 | 355 |
| 1918 | 3300050507 | nmdc:mga05p37_6528_c1 | nmdc:mga05p37_6528_c1_4912_5982 | 355 |
| 1919 | 3300050508 | nmdc:mga09592_327793_c1 | nmdc:mga09592_327793_c1_223_1290 | 355 |
| 1920 | 3300050508 | nmdc:mga09592_3717_c1 | nmdc:mga09592_3717_c1_9970_11040 | 355 |
| 1921 | 3300050509 | nmdc:mga0qj67_64256_c1 | nmdc:mga0qj67_64256_c1_99_1169 | 355 |
| 1922 | 3300050510 | nmdc:mga06r32_321926_c1 | nmdc:mga06r32_321926_c1_150_1217 | 355 |
| 1923 | 3300050510 | nmdc:mga06r32_5210_c1 | nmdc:mga06r32_5210_c1_9356_10426 | 355 |
| 1924 | 3300050511 | nmdc:mga08y16_111162_c1 | nmdc:mga08y16_111162_c1_1774_2841 | 355 |
| 1925 | 3300050511 | nmdc:mga08y16_194299_c1 | nmdc:mga08y16_194299_c1_374_1441 | 355 |
| 1926 | 3300050511 | nmdc:mga08y16_30352_c1 | nmdc:mga08y16_30352_c1_3197_4264 | 355 |
| 1927 | 3300050511 | nmdc:mga08y16_4659_c1 | nmdc:mga08y16_4659_c1_11061_12131 | 355 |
| 1928 | 3300050511 | nmdc:mga08y16_60267_c1 | nmdc:mga08y16_60267_c1_2180_3247 | 355 |
| 1929 | 3300050512 | nmdc:mga0n895_134904_c1 | nmdc:mga0n895_134904_c1_962_2032 | 355 |
| 1930 | 3300050512 | nmdc:mga0n895_1698_c1 | nmdc:mga0n895_1698_c1_7461_8528 | 355 |
| 1931 | 3300050512 | nmdc:mga0n895_26906_c1 | nmdc:mga0n895_26906_c1_957_2024 | 355 |
| 1932 | 3300050512 | nmdc:mga0n895_324652_c1 | nmdc:mga0n895_324652_c1_36_1103 | 355 |
| 1933 | 3300050512 | nmdc:mga0n895_75261_c1 | nmdc:mga0n895_75261_c1_1084_2154 | 355 |
| 1934 | 3300050513 | nmdc:mga0rr50_196493_c1 | nmdc:mga0rr50_196493_c1_30_1100 | 355 |
| 1935 | 3300050513 | nmdc:mga0rr50_28902_c1 | nmdc:mga0rr50_28902_c1_376_1443 | 355 |
| 1936 | 3300050513 | nmdc:mga0rr50_289905_c1 | nmdc:mga0rr50_289905_c1_137_1204 | 355 |
| 1937 | 3300050514 | nmdc:mga08x19_6_c1 | nmdc:mga08x19_6_c1_319988_321055 | 355 |
| 1938 | 3300050515 | nmdc:mga0a205_142570_c1 | nmdc:mga0a205_142570_c1_311_1378 | 355 |
| 1939 | 3300050515 | nmdc:mga0a205_184989_c1 | nmdc:mga0a205_184989_c1_179_1246 | 355 |
| 1940 | 3300050515 | nmdc:mga0a205_195722_c1 | nmdc:mga0a205_195722_c1_703_1770 | 355 |
| 1941 | 3300050515 | nmdc:mga0a205_39881_c2 | nmdc:mga0a205_39881_c2_531_1598 | 355 |
| 1942 | 3300050516 | nmdc:mga0sz30_6269_c1 | nmdc:mga0sz30_6269_c1_2357_3424 | 355 |
| 1943 | 3300053077 | Ga0495601_0000069 | Ga0495601_0000069_5011_6078 | 355 |
| 1944 | 3300053077 | Ga0495601_0011998 | Ga0495601_0011998_3351_4418 | 355 |
| 1945 | 3300053077 | Ga0495601_0012835 | Ga0495601_0012835_857_1924 | 355 |
| 1946 | 3300053077 | Ga0495601_0028733 | Ga0495601_0028733_882_1949 | 355 |
| 1947 | 3300053077 | Ga0495601_0035833 | Ga0495601_0035833_1873_2940 | 355 |
| 1948 | 3300053077 | Ga0495601_0089041 | Ga0495601_0089041_38_1105 | 355 |
| 1949 | 3300053078 | Ga0495612_0001538 | Ga0495612_0001538_3523_4590 | 355 |
| 1950 | 3300053078 | Ga0495612_0021353 | Ga0495612_0021353_120_1187 | 355 |
| 1951 | 3300053079 | Ga0500610_0071800 | Ga0500610_0071800_222_1289 | 355 |
| 1952 | 3300053084 | Ga0495595_0002192 | Ga0495595_0002192_3049_4116 | 355 |
| 1953 | 3300053084 | Ga0495595_0003947 | Ga0495595_0003947_1821_2888 | 355 |
| 1954 | 3300053084 | Ga0495595_0004944 | Ga0495595_0004944_3018_4085 | 355 |
| 1955 | 3300053084 | Ga0495595_0009528 | Ga0495595_0009528_1367_2434 | 355 |
| 1956 | 3300053084 | Ga0495595_0019399 | Ga0495595_0019399_503_1570 | 355 |
| 1957 | 3300053084 | Ga0495595_0050933 | Ga0495595_0050933_10_1077 | 355 |
| 1958 | 3300053085 | Ga0495619_0000546 | Ga0495619_0000546_7999_9066 | 355 |
| 1959 | 3300053085 | Ga0495619_0001245 | Ga0495619_0001245_10745_11812 | 355 |
| 1960 | 3300053085 | Ga0495619_0005933 | Ga0495619_0005933_1374_2441 | 355 |
| 1961 | 3300053085 | Ga0495619_0013779 | Ga0495619_0013779_1023_2090 | 355 |
| 1962 | 3300053085 | Ga0495619_0018617 | Ga0495619_0018617_217_1284 | 355 |
| 1963 | 3300053085 | Ga0495619_0031858 | Ga0495619_0031858_2231_3298 | 355 |
| 1964 | 3300053085 | Ga0495619_0037540 | Ga0495619_0037540_71_1138 | 355 |
| 1965 | 3300053085 | Ga0495619_0088326 | Ga0495619_0088326_159_1226 | 355 |
| 1966 | 3300053087 | Ga0500643_001421 | Ga0500643_001421_1089_2156 | 355 |
| 1967 | 3300053088 | Ga0500644_0004088 | Ga0500644_0004088_1366_2433 | 355 |
| 1968 | 3300053093 | Ga0500651_0010557 | Ga0500651_0010557_206_1273 | 355 |
| 1969 | 3300053094 | Ga0500566_0013976 | Ga0500566_0013976_3511_4578 | 355 |
| 1970 | 3300053096 | Ga0500641_0002427 | Ga0500641_0002427_1728_2795 | 355 |
| 1971 | 3300053096 | Ga0500641_0042834 | Ga0500641_0042834_490_1557 | 355 |
| 1972 | 3300053117 | Ga0500593_052843 | Ga0500593_052843_380_1447 | 355 |
| 1973 | 3300053119 | Ga0500595_000003 | Ga0500595_000003_391089_392156 | 355 |
| 1974 | 3300053119 | Ga0500595_000152 | Ga0500595_000152_19627_20694 | 355 |
| 1975 | 3300053119 | Ga0500595_009637 | Ga0500595_009637_2667_3734 | 355 |
| 1976 | 3300053134 | Ga0500658_0078574 | Ga0500658_0078574_11_1078 | 355 |
| 1977 | 3300053150 | Ga0500603_000352 | Ga0500603_000352_7422_8489 | 355 |
| 1978 | 3300053153 | Ga0500616_0000002 | Ga0500616_0000002_1577706_1578773 | 355 |
| 1979 | 3300053178 | Ga0500637_0012256 | Ga0500637_0012256_2425_3492 | 355 |
| 1980 | 3300053730 | Ga0500645_000226 | Ga0500645_000226_33785_34852 | 355 |
| 1981 | 3300054114 | Ga0501084_0113611 | Ga0501084_0113611_912_1982 | 355 |
| 1982 | 3300054114 | Ga0501084_0361105 | Ga0501084_0361105_73_1140 | 355 |
| 1983 | 3300054114 | Ga0501084_0426208 | Ga0501084_0426208_18_1085 | 355 |
| 1984 | 3300059506 | Ga0587085_008146 | Ga0587085_008146_186_1253 | 355 |
| 1985 | 3300060353 | Ga0501082_0000266 | Ga0501082_0000266_33387_34454 | 355 |
| 1986 | 3300060353 | Ga0501082_0101382 | Ga0501082_0101382_142_1209 | 355 |
| 1987 | 3300061734 | Ga0530510_0043777 | Ga0530510_0043777_132_1199 | 355 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7x0q-assembly1.cif.gz_A | crystal structure of atpase clo1313_2554 from clostridium thermocellum | 0.962 | 4 | 354 |
| 4tqu-assembly1.cif.gz_T | crystal structure of a bacterial abc transporter involved in the import of the acidic polysaccharide alginate | 0.9555 | 2 | 352 |
| 4khz-assembly1.cif.gz_B | crystal structure of the maltose-binding protein/maltose transporter complex in an pre-translocation conformation bound to maltoheptaose | 0.9513 | 3 | 352 |
| 2xiw-assembly1.cif.gz_B-2 | crystal structure of the sac7d-derived igg1-binder c3-c24s | 0.95 | 295 | 321 |
| 7x0q-assembly1.cif.gz_A | crystal structure of atpase clo1313_2554 from clostridium thermocellum | 0.9488 | 4 | 354 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2awoD01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9881 | 3 | 216 | 3.40.50.300 |
| af_P77795_1_218_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9777 | 1 | 217 | 3.40.50.300 |
| 2awnC01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9754 | 3 | 238 | 3.40.50.300 |
| 2awoD01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9745 | 3 | 216 | 3.40.50.300 |
| af_P77795_1_218_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9689 | 1 | 217 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7J9YE84-F1-model_v4 | ATP-binding cassette domain-containing protein | 0.9879 | 1 | 221 |
GO:0005524
GO:0016887 GO:0055052 |
| AF-A0A382V5S9-F1-model_v4 | ABC transporter domain-containing protein | 0.9879 | 48 | 191 |
GO:0005524
GO:0016887 GO:0055052 |
| AF-A0A0D6JVA7-F1-model_v4 | Molybdate/tungstate import ATP-binding protein WtpC (EC 7.3.2.6) | 0.9826 | 1 | 235 |
GO:0005524
GO:0016887 |
| AF-A0A382V5S9-F1-model_v4 | ABC transporter domain-containing protein | 0.9811 | 48 | 191 |
GO:0005524
GO:0016887 GO:0055052 |
| AF-A0A379D261-F1-model_v4 | deleted | 0.9801 | 1 | 225 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar