F496172

General Info

Members Datasets Scaffolds Average Seq Length
1969 744 3938 359

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2917554339|2917554979
Length 357
Sequence LVLGLETSCDETAAAVVARDADGRGRILSNVVLSQVEAHAAFGGVVPEVAARAHVEAIDGVVRAALTEAGVALSAVDAVAATAGPGLIGGVLVGLTTAKALAFAAGKPLVAVNHLEGHALTARLTDGVAFPYLLLLVSGGHTQIVRVDGVGRYRRLGTTIDDALGEAFDKTAKLLGLGYPGGPAVERAAAAGDPSRFALPRPMTGRKAPDFSFSGLKTAVRLEAEAAAPLGPKDVADLCAAFQAAVGDVVADRVGIALRAFRADAADVQPVLVVAGGVAANRSIAARLRGLADREGARLIVPPLALCTDNGAMIAWAGAERLALGLHDDLAAPARARWPLDGDTAPVVGHGRLGAKV

Samples

Sample ID Description Type Environment
1 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
2 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
3 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
4 3300000045 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere Metagenome Rhizosphere
5 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
6 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
7 3300001430 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 Metagenome Rhizosphere
8 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
9 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
10 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
11 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
12 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
13 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
14 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
15 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
16 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
17 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
18 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
19 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
20 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
21 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
22 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
23 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
24 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
25 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
26 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
27 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
28 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
29 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
30 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
31 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
32 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
33 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
34 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
35 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
36 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
37 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
38 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
39 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
40 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
41 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
42 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
43 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
44 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
45 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
46 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
47 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
48 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
49 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
50 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
51 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
52 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
53 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
54 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
55 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
56 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
57 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
58 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
59 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
60 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
61 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
62 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
63 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
64 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
65 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
66 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
67 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
68 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
69 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
70 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
71 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
72 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
73 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
74 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
75 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
76 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
77 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
78 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
79 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
80 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
81 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
82 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
83 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
84 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
85 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
86 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
87 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
88 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
89 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
90 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
91 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
92 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
93 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
94 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
95 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
96 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
97 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
98 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
99 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
100 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
101 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
102 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
103 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
104 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
105 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
106 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
107 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
108 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
109 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
110 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
111 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
112 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
113 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
114 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
115 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
116 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
117 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
118 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
119 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
120 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
121 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
122 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
123 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
124 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
125 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
126 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
127 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
128 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
129 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
130 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
131 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
132 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
133 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
134 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
135 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
136 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
137 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
138 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
139 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
140 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
141 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
142 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
143 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
144 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
145 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
146 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
147 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
148 3300012481 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610 Metagenome Rhizosphere
149 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
150 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
151 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
152 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
153 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
154 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
155 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
156 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
157 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
158 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
159 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
160 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
161 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
162 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
163 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
164 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
165 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
166 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
167 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
168 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
169 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
170 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
171 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
172 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
173 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
174 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
175 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
176 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
177 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
178 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
180 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
181 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
182 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
183 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
184 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
239 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
240 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
241 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
244 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
245 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
246 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
247 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
248 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
249 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
250 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
251 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
252 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
253 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
254 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
255 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
256 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
257 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
258 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
259 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
260 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
261 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
262 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
263 3300028023 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 Metagenome Rhizosphere
264 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
265 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
266 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
267 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
268 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
269 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
270 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
271 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
272 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
273 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
274 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
275 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
276 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
277 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
278 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
279 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
280 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
281 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
282 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
283 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
284 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
285 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
286 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
287 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
288 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
289 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
290 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
291 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
292 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
293 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
294 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
295 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
296 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
297 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
298 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
299 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
300 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
301 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
302 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
303 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
304 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
305 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
306 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
307 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
308 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
309 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
310 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
311 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
312 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
313 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
314 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
315 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
316 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
317 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
318 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
319 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
320 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
321 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
322 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
323 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
324 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
325 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
326 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
327 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
328 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
329 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
330 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
331 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
332 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
333 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
334 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
335 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
336 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
337 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
338 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
339 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
340 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
341 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
342 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
343 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
344 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
345 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
346 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
347 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
348 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
349 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
350 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
351 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
352 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
353 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
354 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
355 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
356 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
357 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
358 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
359 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
360 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
361 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
362 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
363 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
364 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
365 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
366 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
367 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
368 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
369 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
370 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
371 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
372 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
373 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
374 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
375 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
376 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
377 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
378 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
379 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
380 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
381 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
382 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
383 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
384 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
385 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
386 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
387 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
388 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
389 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
390 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
391 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
392 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
393 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
394 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
395 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
396 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
397 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
398 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
399 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
400 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
401 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
402 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
403 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
404 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
405 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
406 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
407 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
408 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
409 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
410 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
411 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
412 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
413 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
414 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
415 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
416 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
417 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
418 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
419 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
420 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
421 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
422 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
423 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
424 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
425 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
426 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
427 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
428 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
429 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
430 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
431 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
432 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
433 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
434 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
435 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
436 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
437 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
438 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
439 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
440 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
441 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
442 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
443 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
444 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
445 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
446 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
447 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
448 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
449 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
450 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
451 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
452 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
453 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
454 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
455 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
456 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
457 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
458 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
459 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
460 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
461 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
462 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
463 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
464 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
465 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
466 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
467 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
468 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
469 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
470 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
471 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
472 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
473 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
474 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
475 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
476 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
477 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
478 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
479 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
480 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
481 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
482 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
483 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
484 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
485 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
486 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
487 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
488 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
489 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
490 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
491 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
492 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
493 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
494 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
495 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
496 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
497 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
498 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
499 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
500 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
501 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
502 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
503 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
504 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
505 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
506 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
507 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
508 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
509 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
510 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
511 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
512 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
513 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
514 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
515 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
516 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
517 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
518 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
519 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
520 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
521 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
522 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
523 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
524 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
525 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
526 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
527 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
528 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
529 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
530 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
531 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
532 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
533 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
534 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
535 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
536 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
537 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
538 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
539 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
540 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
541 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
542 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
543 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
544 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
545 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
546 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
547 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
548 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
549 2917554339 Chthonobacter rhizosphaerae yh7-1 Isolate Rhizosphere
550 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
551 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
552 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
553 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
554 2513237087 Azorhizobium doebereinerae UFLA1-100 Isolate Nodule
555 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
556 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
557 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
558 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
559 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
560 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
561 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
562 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
563 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
564 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
565 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
566 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
567 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
568 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
569 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
570 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
571 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
572 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
573 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
574 2643221651 Afipia sp. Root123D2 Isolate Unclassified
575 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
576 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
577 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
578 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
579 2791355199
580 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
581 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
582 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
583 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
584 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
585 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
586 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
587 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
588 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
589 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
590 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
591 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
592 2828305725 Xanthobacter tagetidis DSM 11105 Isolate Unclassified
593 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
594 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
595 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
596 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
597 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
598 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
599 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
600 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
601 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
602 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
603 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
604 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
605 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
606 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
607 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
608 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
609 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
610 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
611 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
612 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
613 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
614 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
615 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
616 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
617 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
618 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
619 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
620 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
621 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
622 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
623 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
624 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
625 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
626 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
627 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
628 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
629 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
630 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
631 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
632 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
633 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
634 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
635 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
636 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
637 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
638 2906610324
639 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
640 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
641 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
642 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
643 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
644 2919450847 Ancylobacter sp. 3268 Isolate Rhizosphere
645 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
646 2922368715
647 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
648 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
649 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
650 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
651 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
652 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
653 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
654 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
655 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
656 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
657 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
658 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
659 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
660 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
661 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
662 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
663 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
664 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
665 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
666 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
667 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
668 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
669 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
670 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
671 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
672 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
673 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
674 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
675 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
676 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
677 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
678 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
679 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
680 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
681 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
682 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
683 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
684 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
685 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
686 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
687 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
688 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
689 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
690 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
691 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
692 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
693 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
694 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
695 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
696 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
697 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
698 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
699 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
700 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
701 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
702 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
703 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
704 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
705 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
706 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
707 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
708 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
709 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
710 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
711 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
712 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
713 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
714 8001845381 Ancylobacter sonchi VKM B-3145 Isolate Unclassified
715 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
716 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
717 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
718 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
719 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
720 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
721 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
722 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
723 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
724 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
725 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
726 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
727 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
728 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
729 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
730 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
731 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
732 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
733 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
734 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
735 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
736 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
737 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
738 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
739 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
740 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
741 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
742 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
743 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
744 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 89.98
Metatranscriptomes 0.2
Isolates 9.82

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.21
Nodule 7.87
Rhizoplane 6.96
Rhizosphere 72.02
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 2214911852 2209111006 Bacteria 7073
2 ARSoilYngRDRAFT_c00080 3300000042 Bacteria 16083
3 ARcpr5yngRDRAFT_c000055 3300000043 Bacteria 18216
4 ARCol0oldRDRAFT_c00230 3300000045 Bacteria 5194
5 LJQas_1007647 3300000549 Bacteria 1326
6 ARCol0yngRDRAFT_1000007 3300000652 Bacteria 46089
7 JGI24032J14994_100153 3300001430 Bacteria 3352
8 JGI24752J21851_1003516 3300001976 Bacteria 2064
9 JGI24737J22298_10000509 3300001990 Bacteria 13587
10 JGI24750J21931_1001269 3300002070 Bacteria 3185
11 JGI24738J21930_10000120 3300002075 Bacteria 18716
12 JGI24035J26624_1000291 3300002126 Bacteria 4658
13 JGI24033J26618_1000558 3300002155 Bacteria 3589
14 JGI24034J26672_10000187 3300002239 Bacteria 8364
15 JGI24742J22300_10000029 3300002244 Bacteria 23366
16 JGI25406J46586_10006206 3300003203 Bacteria 5518
17 JGI25406J46586_10011555 3300003203 Bacteria 3870
18 JGI25153J46596_10001726 3300003215 Bacteria 12962
19 JGI25153J46596_10001794 3300003215 Bacteria 12730
20 JGI25153J46596_10007254 3300003215 Bacteria 5483
21 JGI25153J46596_10009299 3300003215 Bacteria 4589
22 JGI25160J50197_1000637 3300003354 Bacteria 19539
23 JGI25160J50197_1002896 3300003354 Bacteria 7854
24 Ga0055531_10003548 3300003794 Bacteria 9902
25 Ga0065165_1001452 3300005262 Bacteria 25650
26 Ga0065165_1006072 3300005262 Bacteria 6478
27 Ga0065165_1015074 3300005262 Bacteria 2964
28 Ga0065165_1017160 3300005262 Bacteria 2679
29 Ga0065704_10096592 3300005289 Bacteria 2434
30 Ga0065712_10000690 3300005290 Bacteria 10070
31 Ga0065712_10001626 3300005290 Bacteria 6725
32 Ga0065715_10001262 3300005293 Bacteria 15576
33 Ga0065715_10008806 3300005293 Bacteria 2738
34 Ga0070658_10015046 3300005327 Bacteria 6193
35 Ga0070658_10019709 3300005327 Bacteria 5401
36 Ga0070658_10034887 3300005327 Bacteria 4049
37 Ga0070676_10003502 3300005328 Bacteria 8194
38 Ga0070676_10074001 3300005328 Bacteria 2051
39 Ga0070676_10102198 3300005328 Bacteria 1773
40 Ga0070683_100000116 3300005329 Bacteria 51956
41 Ga0070683_100031209 3300005329 Bacteria 4843
42 Ga0070683_100113145 3300005329 Bacteria 2561
43 Ga0070683_100138935 3300005329 Bacteria 2301
44 Ga0070690_100005618 3300005330 Bacteria 7057
45 Ga0070690_100014607 3300005330 Bacteria 4660
46 Ga0070690_100210064 3300005330 Bacteria 1358
47 Ga0070670_100006964 3300005331 Bacteria 9582
48 Ga0070670_100017200 3300005331 Bacteria 6203
49 Ga0070670_100125130 3300005331 Bacteria 2219
50 Ga0070670_100163497 3300005331 Bacteria 1929
51 Ga0070670_100184120 3300005331 Bacteria 1813
52 Ga0070670_100185074 3300005331 Bacteria 1808
53 Ga0070677_10000097 3300005333 Bacteria 28703
54 Ga0068869_100002566 3300005334 Bacteria 10965
55 Ga0068869_100129609 3300005334 Bacteria 1937
56 Ga0068869_100146062 3300005334 Bacteria 1830
57 Ga0068869_100188240 3300005334 Bacteria 1622
58 Ga0070666_10003937 3300005335 Bacteria 9018
59 Ga0070666_10050475 3300005335 Bacteria 2798
60 Ga0070666_10183415 3300005335 Bacteria 1469
61 Ga0070680_100013619 3300005336 Bacteria 6338
62 Ga0070680_100022146 3300005336 Bacteria 5055
63 Ga0070680_100041923 3300005336 Bacteria 3712
64 Ga0070680_100047006 3300005336 Bacteria 3513
65 Ga0070680_100066975 3300005336 Bacteria 2945
66 Ga0070680_100151413 3300005336 Bacteria 1947
67 Ga0070680_100218103 3300005336 Bacteria 1610
68 Ga0070682_100001635 3300005337 Bacteria 12449
69 Ga0068868_100028104 3300005338 Bacteria 4297
70 Ga0068868_100035020 3300005338 Bacteria 3879
71 Ga0068868_100064549 3300005338 Bacteria 2907
72 Ga0070660_100009547 3300005339 Bacteria 6832
73 Ga0070660_100021366 3300005339 Bacteria 4772
74 Ga0070660_100031050 3300005339 Bacteria 4010
75 Ga0070660_100247606 3300005339 Bacteria 1453
76 Ga0070689_100000461 3300005340 Bacteria 24086
77 Ga0070691_10000048 3300005341 Bacteria 33217
78 Ga0070687_100002383 3300005343 Bacteria 7019
79 Ga0070687_100091231 3300005343 Bacteria 1686
80 Ga0070661_100000228 3300005344 Bacteria 46622
81 Ga0070661_100059239 3300005344 Bacteria 2807
82 Ga0070692_10000050 3300005345 Bacteria 22340
83 Ga0070668_100010524 3300005347 Bacteria 6877
84 Ga0070668_100022397 3300005347 Bacteria 4775
85 Ga0070668_100108131 3300005347 Bacteria 2211
86 Ga0070668_100110742 3300005347 Bacteria 2185
87 Ga0070669_100031291 3300005353 Bacteria 3844
88 Ga0070669_100047132 3300005353 Bacteria 3144
89 Ga0070669_100065519 3300005353 Bacteria 2676
90 Ga0070669_100091246 3300005353 Bacteria 2284
91 Ga0070669_100251401 3300005353 Bacteria 1407
92 Ga0070675_100000503 3300005354 Bacteria 26846
93 Ga0070675_100104609 3300005354 Bacteria 2388
94 Ga0070671_100000720 3300005355 Bacteria 23686
95 Ga0070671_100056367 3300005355 Bacteria 3269
96 Ga0070671_100124906 3300005355 Bacteria 2166
97 Ga0070671_100170681 3300005355 Bacteria 1839
98 Ga0070674_100000570 3300005356 Bacteria 18571
99 Ga0070674_100093821 3300005356 Bacteria 2172
100 Ga0070673_100000045 3300005364 Bacteria 50756
101 Ga0070673_100003240 3300005364 Bacteria 10097
102 Ga0070688_100000308 3300005365 Bacteria 24884
103 Ga0070688_100039274 3300005365 Bacteria 2896
104 Ga0070688_100086423 3300005365 Bacteria 2040
105 Ga0070688_100102450 3300005365 Bacteria 1890
106 Ga0070688_100231664 3300005365 Bacteria 1307
107 Ga0070659_100000183 3300005366 Bacteria 47789
108 Ga0070659_100009946 3300005366 Bacteria 6996
109 Ga0070659_100047796 3300005366 Bacteria 3359
110 Ga0070659_100059804 3300005366 Bacteria 3009
111 Ga0070659_100110299 3300005366 Bacteria 2221
112 Ga0070667_100003874 3300005367 Bacteria 12703
113 Ga0070667_100055839 3300005367 Bacteria 3334
114 Ga0070667_100068432 3300005367 Bacteria 3021
115 Ga0070709_10003045 3300005434 Bacteria 8994
116 Ga0070709_10074808 3300005434 Bacteria 2196
117 Ga0070709_10076543 3300005434 Bacteria 2173
118 Ga0070709_10126515 3300005434 Bacteria 1739
119 Ga0070709_10207040 3300005434 Bacteria 1392
120 Ga0070714_100006355 3300005435 Bacteria 9113
121 Ga0070714_100020893 3300005435 Bacteria 5352
122 Ga0070714_100021163 3300005435 Bacteria 5318
123 Ga0070714_100032110 3300005435 Bacteria 4383
124 Ga0070714_100056532 3300005435 Bacteria 3356
125 Ga0070714_100062909 3300005435 Bacteria 3190
126 Ga0070714_100271604 3300005435 Bacteria 1572
127 Ga0070713_100007601 3300005436 Bacteria 7624
128 Ga0070713_100009557 3300005436 Bacteria 6952
129 Ga0070713_100016407 3300005436 Bacteria 5568
130 Ga0070713_100074482 3300005436 Bacteria 2876
131 Ga0070713_100218875 3300005436 Bacteria 1727
132 Ga0070713_100261749 3300005436 Bacteria 1581
133 Ga0070710_10002948 3300005437 Bacteria 8080
134 Ga0070710_10005418 3300005437 Bacteria 6059
135 Ga0070710_10006006 3300005437 Bacteria 5800
136 Ga0070710_10033282 3300005437 Bacteria 2798
137 Ga0070710_10039227 3300005437 Bacteria 2605
138 Ga0070701_10002546 3300005438 Bacteria 7056
139 Ga0070701_10020704 3300005438 Bacteria 3126
140 Ga0070701_10123381 3300005438 Bacteria 1463
141 Ga0070711_100000599 3300005439 Bacteria 18773
142 Ga0070711_100014115 3300005439 Bacteria 5028
143 Ga0070711_100016274 3300005439 Bacteria 4721
144 Ga0070711_100017625 3300005439 Bacteria 4549
145 Ga0070711_100022586 3300005439 Bacteria 4079
146 Ga0070711_100049014 3300005439 Bacteria 2891
147 Ga0070711_100217366 3300005439 Bacteria 1483
148 Ga0070705_100001770 3300005440 Bacteria 11188
149 Ga0070700_100000239 3300005441 Bacteria 30133
150 Ga0070694_100003730 3300005444 Bacteria 9088
151 Ga0070694_100164114 3300005444 Bacteria 1632
152 Ga0070708_100182315 3300005445 Bacteria 1963
153 Ga0070663_100000328 3300005455 Bacteria 24676
154 Ga0070663_100000390 3300005455 Bacteria 23042
155 Ga0070663_100024158 3300005455 Bacteria 4085
156 Ga0070663_100073835 3300005455 Bacteria 2489
157 Ga0070663_100137505 3300005455 Bacteria 1861
158 Ga0070663_100188839 3300005455 Bacteria 1603
159 Ga0070678_100000576 3300005456 Bacteria 17985
160 Ga0070678_100043325 3300005456 Bacteria 3205
161 Ga0070678_100086322 3300005456 Bacteria 2393
162 Ga0070681_10000933 3300005458 Bacteria 24595
163 Ga0070681_10015684 3300005458 Bacteria 7549
164 Ga0070681_10036877 3300005458 Bacteria 4908
165 Ga0070681_10078407 3300005458 Bacteria 3260
166 Ga0070681_10102279 3300005458 Bacteria 2810
167 Ga0068867_100147962 3300005459 Bacteria 1842
168 Ga0070685_10003069 3300005466 Bacteria 8508
169 Ga0070685_10013737 3300005466 Bacteria 4277
170 Ga0070685_10019816 3300005466 Bacteria 3634
171 Ga0070685_10125147 3300005466 Bacteria 1600
172 Ga0070685_10142471 3300005466 Bacteria 1511
173 Ga0070685_10257511 3300005466 Bacteria 1159
174 Ga0070707_100047831 3300005468 Bacteria 4096
175 Ga0070707_100314659 3300005468 Bacteria 1521
176 Ga0070698_100039216 3300005471 Bacteria 4876
177 Ga0070699_100004245 3300005518 Bacteria 12669
178 Ga0070679_100005744 3300005530 Bacteria 11509
179 Ga0070679_100016653 3300005530 Bacteria 7100
180 Ga0070679_100058275 3300005530 Bacteria 3848
181 Ga0070679_100073903 3300005530 Bacteria 3400
182 Ga0070679_100113836 3300005530 Bacteria 2690
183 Ga0070679_100135947 3300005530 Bacteria 2439
184 Ga0070679_100191906 3300005530 Bacteria 2011
185 Ga0070679_100390868 3300005530 Bacteria 1337
186 Ga0070684_100000352 3300005535 Bacteria 31642
187 Ga0070684_100006584 3300005535 Bacteria 8997
188 Ga0070684_100020670 3300005535 Bacteria 5460
189 Ga0070684_100038063 3300005535 Bacteria 4130
190 Ga0070684_100145709 3300005535 Bacteria 2143
191 Ga0068853_100000902 3300005539 Bacteria 20677
192 Ga0068853_100026207 3300005539 Bacteria 4894
193 Ga0068853_100087721 3300005539 Bacteria 2730
194 Ga0068853_100164786 3300005539 Bacteria 2002
195 Ga0068853_100285634 3300005539 Bacteria 1522
196 Ga0070672_100000016 3300005543 Bacteria 71848
197 Ga0070686_100005714 3300005544 Bacteria 6892
198 Ga0070686_100017851 3300005544 Bacteria 4153
199 Ga0070686_100121576 3300005544 Bacteria 1793
200 Ga0070695_100001458 3300005545 Bacteria 13124
201 Ga0070695_100004098 3300005545 Bacteria 8517
202 Ga0070696_100006179 3300005546 Bacteria 8004
203 Ga0070696_100202216 3300005546 Bacteria 1483
204 Ga0070693_100037529 3300005547 Bacteria 2702
205 Ga0070665_100014898 3300005548 Bacteria 7804
206 Ga0070665_100024748 3300005548 Bacteria 6048
207 Ga0070665_100025556 3300005548 Bacteria 5949
208 Ga0070665_100070182 3300005548 Bacteria 3510
209 Ga0070665_100072923 3300005548 Bacteria 3441
210 Ga0070665_100095421 3300005548 Bacteria 2979
211 Ga0070665_100098599 3300005548 Bacteria 2927
212 Ga0070665_100099991 3300005548 Bacteria 2904
213 Ga0070665_100145785 3300005548 Bacteria 2370
214 Ga0070704_100004902 3300005549 Bacteria 7767
215 Ga0070704_100014046 3300005549 Bacteria 4991
216 Ga0068855_100003504 3300005563 Bacteria 19223
217 Ga0068855_100019804 3300005563 Bacteria 8084
218 Ga0068855_100020035 3300005563 Bacteria 8031
219 Ga0068855_100071356 3300005563 Bacteria 4039
220 Ga0068855_100076667 3300005563 Bacteria 3879
221 Ga0068855_100123814 3300005563 Bacteria 2957
222 Ga0068855_100232988 3300005563 Bacteria 2061
223 Ga0068855_100271037 3300005563 Bacteria 1887
224 Ga0070664_100000067 3300005564 Bacteria 65201
225 Ga0070664_100179259 3300005564 Bacteria 1882
226 Ga0070664_100248730 3300005564 Bacteria 1598
227 Ga0068857_100003331 3300005577 Bacteria 13366
228 Ga0068857_100022002 3300005577 Bacteria 5611
229 Ga0068854_100062790 3300005578 Bacteria 2695
230 Ga0068854_100098345 3300005578 Bacteria 2190
231 Ga0068854_100118938 3300005578 Bacteria 2003
232 Ga0068856_100002341 3300005614 Bacteria 19506
233 Ga0068856_100042629 3300005614 Bacteria 4464
234 Ga0068856_100053053 3300005614 Bacteria 3999
235 Ga0068856_100070685 3300005614 Bacteria 3453
236 Ga0070702_100001107 3300005615 Bacteria 10796
237 Ga0068852_100014075 3300005616 Bacteria 6140
238 Ga0068852_100015623 3300005616 Bacteria 5896
239 Ga0068852_100091383 3300005616 Bacteria 2724
240 Ga0068852_100193773 3300005616 Bacteria 1919
241 Ga0068852_100214060 3300005616 Bacteria 1829
242 Ga0068859_100077162 3300005617 Bacteria 3373
243 Ga0068859_100295653 3300005617 Bacteria 1712
244 Ga0068864_100000234 3300005618 Bacteria 49663
245 Ga0068864_100059635 3300005618 Bacteria 3302
246 Ga0068864_100158116 3300005618 Bacteria 2058
247 Ga0068866_10016142 3300005718 Bacteria 3332
248 Ga0068861_100000241 3300005719 Bacteria 30096
249 Ga0068861_100015670 3300005719 Bacteria 5348
250 Ga0068861_100137862 3300005719 Bacteria 1988
251 Ga0068861_100139783 3300005719 Bacteria 1975
252 Ga0068851_10013343 3300005834 Bacteria 3890
253 Ga0068851_10069059 3300005834 Bacteria 1825
254 Ga0068851_10145527 3300005834 Bacteria 1292
255 Ga0068870_10000009 3300005840 Bacteria 70353
256 Ga0068870_10055073 3300005840 Bacteria 2118
257 Ga0068863_100003248 3300005841 Bacteria 16072
258 Ga0068863_100098163 3300005841 Bacteria 2782
259 Ga0068863_100175337 3300005841 Bacteria 2057
260 Ga0068863_100191047 3300005841 Bacteria 1968
261 Ga0068858_100001548 3300005842 Bacteria 23613
262 Ga0068860_100000508 3300005843 Bacteria 48302
263 Ga0068860_100001050 3300005843 Bacteria 30441
264 Ga0068860_100034650 3300005843 Bacteria 4843
265 Ga0068860_100107472 3300005843 Bacteria 2666
266 Ga0068860_100156416 3300005843 Bacteria 2197
267 Ga0068862_100001143 3300005844 Bacteria 25122
268 Ga0068862_100200451 3300005844 Bacteria 1799
269 Ga0081455_10000002 3300005937 Bacteria 460472
270 Ga0081455_10004068 3300005937 Bacteria 16566
271 Ga0081455_10008760 3300005937 Bacteria 10474
272 Ga0081455_10021942 3300005937 Bacteria 5980
273 Ga0081455_10022833 3300005937 Bacteria 5834
274 Ga0081455_10125580 3300005937 Bacteria 2014
275 Ga0081455_10204121 3300005937 Bacteria 1478
276 Ga0081540_1002394 3300005983 Bacteria 15299
277 Ga0081540_1003646 3300005983 Bacteria 12081
278 Ga0081540_1004307 3300005983 Bacteria 10902
279 Ga0081540_1005999 3300005983 Bacteria 8950
280 Ga0081540_1008954 3300005983 Bacteria 6930
281 Ga0081540_1009843 3300005983 Bacteria 6538
282 Ga0081540_1012693 3300005983 Bacteria 5526
283 Ga0081540_1015357 3300005983 Bacteria 4851
284 Ga0081540_1016330 3300005983 Bacteria 4651
285 Ga0081540_1044846 3300005983 Bacteria 2252
286 Ga0081539_10000265 3300005985 Bacteria 120457
287 Ga0081539_10000966 3300005985 Bacteria 53690
288 Ga0081539_10015864 3300005985 Bacteria 5434
289 Ga0081539_10049888 3300005985 Bacteria 2371
290 Ga0070717_10029553 3300006028 Bacteria 4397
291 Ga0070717_10044938 3300006028 Bacteria 3609
292 Ga0070717_10167557 3300006028 Bacteria 1909
293 Ga0075365_10013341 3300006038 Bacteria 4910
294 Ga0075365_10049882 3300006038 Bacteria 2759
295 Ga0075365_10051135 3300006038 Bacteria 2728
296 Ga0075368_10014896 3300006042 Bacteria 2878
297 Ga0075363_100001175 3300006048 Bacteria 9625
298 Ga0075363_100021411 3300006048 Bacteria 3256
299 Ga0075363_100048774 3300006048 Bacteria 2253
300 Ga0075363_100086490 3300006048 Bacteria 1721
301 Ga0075364_10021970 3300006051 Bacteria 4025
302 Ga0075364_10037508 3300006051 Bacteria 3139
303 Ga0075364_10067636 3300006051 Bacteria 2349
304 Ga0075364_10087356 3300006051 Bacteria 2066
305 Ga0075432_10001464 3300006058 Bacteria 7696
306 Ga0070715_10027530 3300006163 Bacteria 2272
307 Ga0070716_100003613 3300006173 Bacteria 7309
308 Ga0070716_100003799 3300006173 Bacteria 7162
309 Ga0070716_100015416 3300006173 Bacteria 3926
310 Ga0070712_100017531 3300006175 Bacteria 4637
311 Ga0070712_100019139 3300006175 Bacteria 4459
312 Ga0070712_100150895 3300006175 Bacteria 1784
313 Ga0070712_100171105 3300006175 Bacteria 1685
314 Ga0070712_100221306 3300006175 Bacteria 1499
315 Ga0075362_10002382 3300006177 Bacteria 6298
316 Ga0075362_10057222 3300006177 Bacteria 1757
317 Ga0075367_10009497 3300006178 Bacteria 5088
318 Ga0075367_10013375 3300006178 Bacteria 4410
319 Ga0075367_10018489 3300006178 Bacteria 3846
320 Ga0075367_10051257 3300006178 Bacteria 2439
321 Ga0075369_10052055 3300006186 Bacteria 1774
322 Ga0075427_10003015 3300006194 Bacteria 2295
323 Ga0075366_10007698 3300006195 Bacteria 5965
324 Ga0075366_10018053 3300006195 Bacteria 4072
325 Ga0097621_100000569 3300006237 Bacteria 25928
326 Ga0097621_100034909 3300006237 Bacteria 4014
327 Ga0097621_100093302 3300006237 Bacteria 2522
328 Ga0075370_10040354 3300006353 Bacteria 2632
329 Ga0075370_10164691 3300006353 Bacteria 1302
330 Ga0068871_100000012 3300006358 Bacteria 105267
331 Ga0068871_100017133 3300006358 Bacteria 5475
332 Ga0068871_100230754 3300006358 Bacteria 1606
333 Ga0075428_100000797 3300006844 Bacteria 32864
334 Ga0075428_100202612 3300006844 Bacteria 2145
335 Ga0075430_100000045 3300006846 Bacteria 64983
336 Ga0075430_100000509 3300006846 Bacteria 29219
337 Ga0075430_100061183 3300006846 Bacteria 3164
338 Ga0075431_100022535 3300006847 Bacteria 6440
339 Ga0075431_100272852 3300006847 Bacteria 1713
340 Ga0075431_100474964 3300006847 Bacteria 1244
341 Ga0075433_10002970 3300006852 Bacteria 13023
342 Ga0075433_10009693 3300006852 Bacteria 7712
343 Ga0075433_10200207 3300006852 Bacteria 1776
344 Ga0075434_100001007 3300006871 Bacteria 22897
345 Ga0075434_100003473 3300006871 Bacteria 14090
346 Ga0075434_100034517 3300006871 Bacteria 4995
347 Ga0075434_100047837 3300006871 Bacteria 4244
348 Ga0075434_100065389 3300006871 Bacteria 3622
349 Ga0075434_100074246 3300006871 Bacteria 3394
350 Ga0075434_100395196 3300006871 Bacteria 1403
351 Ga0075429_100000214 3300006880 Bacteria 38983
352 Ga0068865_100000209 3300006881 Bacteria 32559
353 Ga0068865_100147074 3300006881 Bacteria 1783
354 Ga0075436_100155156 3300006914 Bacteria 1612
355 Ga0097620_100077157 3300006931 Bacteria 3373
356 Ga0097620_100295636 3300006931 Bacteria 1712
357 Ga0099824_1004485 3300006942 Bacteria 20097
358 Ga0099824_1005993 3300006942 Bacteria 16885
359 Ga0099822_1056885 3300006943 Bacteria 1409
360 Ga0099823_1036201 3300006944 Bacteria 3805
361 Ga0075435_100003730 3300007076 Bacteria 10380
362 Ga0075435_100029012 3300007076 Bacteria 4342
363 Ga0075435_100130294 3300007076 Bacteria 2104
364 Ga0075435_100171867 3300007076 Bacteria 1828
365 Ga0075435_100179585 3300007076 Bacteria 1789
366 Ga0075435_100222601 3300007076 Bacteria 1602
367 Ga0099794_10020050 3300007265 Bacteria 3022
368 Ga0099795_10017879 3300007788 Bacteria 2267
369 Ga0105251_10064373 3300009011 Bacteria 1719
370 Ga0105244_10013466 3300009036 Bacteria 4780
371 Ga0105250_10087777 3300009092 Bacteria 1263
372 Ga0105240_10019597 3300009093 Bacteria 9035
373 Ga0105240_10366977 3300009093 Bacteria 1629
374 Ga0111539_10000693 3300009094 Bacteria 43665
375 Ga0111539_10000941 3300009094 Bacteria 38137
376 Ga0111539_10001081 3300009094 Bacteria 36017
377 Ga0111539_10154547 3300009094 Bacteria 2685
378 Ga0105245_10001284 3300009098 Bacteria 22645
379 Ga0105245_10145013 3300009098 Bacteria 2240
380 Ga0105245_10419824 3300009098 Bacteria 1341
381 Ga0105247_10003522 3300009101 Bacteria 10175
382 Ga0105247_10015712 3300009101 Bacteria 4532
383 Ga0114129_10009653 3300009147 Bacteria 13772
384 Ga0114129_10010881 3300009147 Bacteria 12959
385 Ga0114129_10064508 3300009147 Bacteria 5112
386 Ga0114129_10190930 3300009147 Bacteria 2781
387 Ga0114129_10229703 3300009147 Bacteria 2499
388 Ga0114129_10431643 3300009147 Bacteria 1731
389 Ga0114129_10436172 3300009147 Bacteria 1720
390 Ga0105243_10003373 3300009148 Bacteria 12960
391 Ga0105243_10217864 3300009148 Bacteria 1685
392 Ga0105241_10000053 3300009174 Bacteria 94578
393 Ga0105241_10123177 3300009174 Bacteria 2091
394 Ga0105242_10000492 3300009176 Bacteria 31218
395 Ga0105242_10078474 3300009176 Bacteria 2757
396 Ga0105248_10000934 3300009177 Bacteria 32542
397 Ga0105248_10031696 3300009177 Bacteria 5906
398 Ga0105248_10038013 3300009177 Bacteria 5385
399 Ga0105248_10041758 3300009177 Bacteria 5143
400 Ga0105248_10097830 3300009177 Bacteria 3306
401 Ga0105248_10110014 3300009177 Bacteria 3107
402 Ga0105237_10003661 3300009545 Bacteria 18122
403 Ga0105237_10082006 3300009545 Bacteria 3216
404 Ga0105237_10196605 3300009545 Bacteria 2016
405 Ga0105238_10005232 3300009551 Bacteria 12822
406 Ga0105238_10322524 3300009551 Bacteria 1531
407 Ga0105249_10003582 3300009553 Bacteria 13439
408 Ga0105249_10033319 3300009553 Bacteria 4664
409 Ga0105249_10356389 3300009553 Bacteria 1483
410 Ga0099796_10029818 3300010159 Bacteria 1764
411 Ga0105239_10016523 3300010375 Bacteria 8160
412 Ga0105239_10065271 3300010375 Bacteria 3997
413 Ga0105239_10074495 3300010375 Bacteria 3732
414 Ga0105239_10182570 3300010375 Bacteria 2347
415 Ga0105246_10000055 3300011119 Bacteria 45431
416 Ga0105246_10003672 3300011119 Bacteria 9292
417 Ga0105246_10201643 3300011119 Bacteria 1547
418 Ga0157320_1000638 3300012481 Bacteria 1511
419 Ga0157373_10064543 3300013100 Bacteria 2592
420 Ga0157371_10043951 3300013102 Bacteria 3182
421 Ga0157370_10034537 3300013104 Bacteria 4921
422 Ga0157370_10041817 3300013104 Bacteria 4418
423 Ga0157370_10114858 3300013104 Bacteria 2515
424 Ga0157370_10178554 3300013104 Bacteria 1973
425 Ga0157370_10255425 3300013104 Bacteria 1621
426 Ga0157369_10016644 3300013105 Bacteria 8267
427 Ga0157369_10041997 3300013105 Bacteria 4990
428 Ga0157369_10157244 3300013105 Bacteria 2400
429 Ga0157374_10001308 3300013296 Bacteria 21203
430 Ga0157374_10025888 3300013296 Bacteria 5274
431 Ga0157374_10041871 3300013296 Bacteria 4223
432 Ga0157374_10045186 3300013296 Bacteria 4076
433 Ga0157374_10047928 3300013296 Bacteria 3963
434 Ga0157378_10000986 3300013297 Bacteria 26065
435 Ga0157378_10142354 3300013297 Bacteria 2228
436 Ga0157378_10182480 3300013297 Bacteria 1975
437 Ga0163162_10002432 3300013306 Bacteria 17549
438 Ga0163162_10075871 3300013306 Bacteria 3423
439 Ga0163162_10275342 3300013306 Bacteria 1815
440 Ga0163162_10487935 3300013306 Bacteria 1363
441 Ga0157372_10031748 3300013307 Bacteria 5786
442 Ga0157372_10036245 3300013307 Bacteria 5436
443 Ga0157372_10346278 3300013307 Bacteria 1731
444 Ga0157372_10502847 3300013307 Bacteria 1413
445 Ga0157375_10000933 3300013308 Bacteria 25341
446 Ga0157375_10029408 3300013308 Bacteria 5167
447 Ga0157375_10030809 3300013308 Bacteria 5063
448 Ga0157375_10041036 3300013308 Bacteria 4466
449 Ga0157375_10170070 3300013308 Bacteria 2326
450 Ga0157375_10221031 3300013308 Bacteria 2052
451 Ga0157375_10272322 3300013308 Bacteria 1855
452 Ga0157375_10307118 3300013308 Bacteria 1750
453 Ga0163163_10009027 3300014325 Bacteria 8883
454 Ga0163163_10029817 3300014325 Bacteria 5250
455 Ga0163163_10090954 3300014325 Bacteria 3065
456 Ga0163163_10116963 3300014325 Bacteria 2698
457 Ga0157380_10000821 3300014326 Bacteria 19478
458 Ga0157380_10083969 3300014326 Bacteria 2610
459 Ga0157380_10137302 3300014326 Bacteria 2095
460 Ga0157380_10317590 3300014326 Bacteria 1443
461 Ga0157377_10002329 3300014745 Bacteria 8365
462 Ga0157379_10000679 3300014968 Bacteria 27606
463 Ga0157379_10056130 3300014968 Bacteria 3519
464 Ga0157379_10065272 3300014968 Bacteria 3254
465 Ga0157379_10216790 3300014968 Bacteria 1734
466 Ga0157376_10000527 3300014969 Bacteria 24607
467 Ga0157376_10038272 3300014969 Bacteria 3901
468 Ga0157376_10049122 3300014969 Bacteria 3493
469 Ga0163161_10000770 3300017792 Bacteria 25240
470 Ga0163161_10337736 3300017792 Bacteria 1194
471 Ga0197907_11009316 3300020069 Bacteria 1331
472 Ga0206356_11354353 3300020070 Bacteria 2542
473 Ga0214544_1000016 3300021320 Bacteria 204278
474 Ga0214542_1000016 3300021321 Bacteria 210332
475 Ga0214545_1000008 3300021324 Bacteria 215190
476 Ga0214543_1000043 3300021327 Bacteria 160517
477 Ga0213876_10018008 3300021384 Bacteria 3727
478 Ga0213875_10012959 3300021388 Bacteria 4105
479 Ga0224712_10055462 3300022467 Bacteria 1559
480 Ga0228598_1008246 3300024227 Bacteria 2109
481 Ga0209563_101466 3300025230 Bacteria 6222
482 Ga0209677_100936 3300025253 Bacteria 14294
483 Ga0209148_1000504 3300025254 Bacteria 39653
484 Ga0209233_1003870 3300025261 Bacteria 5205
485 Ga0207666_1000026 3300025271 Bacteria 33873
486 Ga0207666_1001597 3300025271 Bacteria 2680
487 Ga0209455_1000957 3300025272 Bacteria 14712
488 Ga0209758_1000069 3300025297 Bacteria 286161
489 Ga0209758_1000253 3300025297 Bacteria 107937
490 Ga0209758_1000351 3300025297 Bacteria 83626
491 Ga0209758_1000990 3300025297 Bacteria 38049
492 Ga0209758_1005097 3300025297 Bacteria 10401
493 Ga0209758_1009810 3300025297 Bacteria 5863
494 Ga0209758_1033376 3300025297 Bacteria 2069
495 Ga0209256_1008686 3300025299 Bacteria 4644
496 Ga0207426_1000420 3300025302 Bacteria 69895
497 Ga0207426_1001001 3300025302 Bacteria 27520
498 Ga0207426_1002779 3300025302 Bacteria 10534
499 Ga0207426_1018465 3300025302 Bacteria 2456
500 Ga0209257_1000564 3300025304 Bacteria 62815
501 Ga0207697_10000245 3300025315 Bacteria 29793
502 Ga0207697_10011834 3300025315 Bacteria 3679
503 Ga0207656_10001442 3300025321 Bacteria 7887
504 Ga0207656_10034259 3300025321 Bacteria 2120
505 Ga0207682_10000029 3300025893 Bacteria 57930
506 Ga0207682_10014795 3300025893 Bacteria 3039
507 Ga0207692_10000218 3300025898 Bacteria 19284
508 Ga0207692_10012824 3300025898 Bacteria 3614
509 Ga0207692_10031373 3300025898 Bacteria 2545
510 Ga0207642_10015391 3300025899 Bacteria 2849
511 Ga0207642_10022067 3300025899 Bacteria 2518
512 Ga0207710_10000676 3300025900 Bacteria 19190
513 Ga0207710_10027072 3300025900 Bacteria 2481
514 Ga0207688_10000084 3300025901 Bacteria 35752
515 Ga0207688_10008498 3300025901 Bacteria 5588
516 Ga0207680_10001429 3300025903 Bacteria 11322
517 Ga0207647_10003716 3300025904 Bacteria 11411
518 Ga0207647_10009100 3300025904 Bacteria 7070
519 Ga0207647_10018094 3300025904 Bacteria 4776
520 Ga0207647_10038424 3300025904 Bacteria 3027
521 Ga0207685_10030478 3300025905 Bacteria 1920
522 Ga0207685_10039930 3300025905 Bacteria 1746
523 Ga0207699_10000145 3300025906 Bacteria 46647
524 Ga0207699_10001859 3300025906 Bacteria 9947
525 Ga0207699_10002344 3300025906 Bacteria 8946
526 Ga0207699_10004700 3300025906 Bacteria 6524
527 Ga0207699_10081951 3300025906 Bacteria 2003
528 Ga0207699_10096259 3300025906 Bacteria 1869
529 Ga0207699_10133912 3300025906 Bacteria 1620
530 Ga0207699_10232911 3300025906 Bacteria 1262
531 Ga0207645_10000090 3300025907 Bacteria 65569
532 Ga0207645_10029552 3300025907 Bacteria 3532
533 Ga0207645_10085115 3300025907 Bacteria 2030
534 Ga0207643_10000044 3300025908 Bacteria 82217
535 Ga0207643_10003440 3300025908 Bacteria 8518
536 Ga0207643_10034241 3300025908 Bacteria 2846
537 Ga0207705_10011060 3300025909 Bacteria 6542
538 Ga0207705_10023489 3300025909 Bacteria 4398
539 Ga0207705_10126273 3300025909 Bacteria 1902
540 Ga0207705_10204922 3300025909 Bacteria 1495
541 Ga0207684_10007412 3300025910 Bacteria 9880
542 Ga0207654_10000143 3300025911 Bacteria 45654
543 Ga0207654_10060218 3300025911 Bacteria 2217
544 Ga0207707_10000580 3300025912 Bacteria 37172
545 Ga0207707_10001318 3300025912 Bacteria 23068
546 Ga0207707_10001462 3300025912 Bacteria 21837
547 Ga0207707_10012685 3300025912 Bacteria 7324
548 Ga0207707_10028941 3300025912 Bacteria 4842
549 Ga0207707_10163134 3300025912 Bacteria 1948
550 Ga0207707_10329992 3300025912 Bacteria 1316
551 Ga0207707_10334625 3300025912 Bacteria 1306
552 Ga0207695_10000148 3300025913 Bacteria 208344
553 Ga0207695_10073547 3300025913 Bacteria 3482
554 Ga0207695_10260447 3300025913 Bacteria 1632
555 Ga0207671_10014374 3300025914 Bacteria 6260
556 Ga0207671_10051753 3300025914 Bacteria 3043
557 Ga0207693_10001456 3300025915 Bacteria 20941
558 Ga0207693_10008645 3300025915 Bacteria 8331
559 Ga0207693_10014519 3300025915 Bacteria 6330
560 Ga0207693_10022611 3300025915 Bacteria 4995
561 Ga0207693_10068117 3300025915 Bacteria 2786
562 Ga0207693_10072991 3300025915 Bacteria 2686
563 Ga0207693_10112390 3300025915 Bacteria 2136
564 Ga0207663_10001778 3300025916 Bacteria 10168
565 Ga0207663_10005840 3300025916 Bacteria 6240
566 Ga0207663_10053706 3300025916 Bacteria 2519
567 Ga0207660_10000653 3300025917 Bacteria 23385
568 Ga0207660_10006180 3300025917 Bacteria 7780
569 Ga0207660_10022078 3300025917 Bacteria 4285
570 Ga0207660_10034613 3300025917 Bacteria 3502
571 Ga0207660_10129792 3300025917 Bacteria 1917
572 Ga0207660_10175813 3300025917 Bacteria 1660
573 Ga0207662_10000104 3300025918 Bacteria 40365
574 Ga0207662_10012668 3300025918 Bacteria 4699
575 Ga0207662_10055424 3300025918 Bacteria 2366
576 Ga0207662_10072216 3300025918 Bacteria 2091
577 Ga0207662_10102891 3300025918 Bacteria 1772
578 Ga0207662_10228246 3300025918 Bacteria 1215
579 Ga0207657_10001095 3300025919 Bacteria 28754
580 Ga0207657_10011813 3300025919 Bacteria 8646
581 Ga0207657_10027567 3300025919 Bacteria 5201
582 Ga0207649_10000057 3300025920 Bacteria 102314
583 Ga0207649_10214061 3300025920 Bacteria 1369
584 Ga0207652_10001436 3300025921 Bacteria 21120
585 Ga0207652_10006195 3300025921 Bacteria 9661
586 Ga0207652_10009939 3300025921 Bacteria 7659
587 Ga0207652_10021448 3300025921 Bacteria 5331
588 Ga0207652_10082063 3300025921 Bacteria 2821
589 Ga0207652_10103257 3300025921 Bacteria 2520
590 Ga0207652_10116157 3300025921 Bacteria 2377
591 Ga0207652_10128330 3300025921 Bacteria 2260
592 Ga0207652_10259545 3300025921 Bacteria 1567
593 Ga0207646_10044687 3300025922 Bacteria 3976
594 Ga0207681_10000154 3300025923 Bacteria 57555
595 Ga0207681_10041806 3300025923 Bacteria 3058
596 Ga0207681_10061535 3300025923 Bacteria 2581
597 Ga0207681_10110822 3300025923 Bacteria 1996
598 Ga0207694_10013631 3300025924 Bacteria 6128
599 Ga0207694_10171615 3300025924 Bacteria 1756
600 Ga0207650_10001069 3300025925 Bacteria 20358
601 Ga0207650_10029876 3300025925 Bacteria 3921
602 Ga0207650_10038377 3300025925 Bacteria 3497
603 Ga0207650_10059701 3300025925 Bacteria 2844
604 Ga0207659_10000028 3300025926 Bacteria 130804
605 Ga0207659_10064129 3300025926 Bacteria 2658
606 Ga0207659_10164353 3300025926 Bacteria 1746
607 Ga0207687_10000249 3300025927 Bacteria 36556
608 Ga0207687_10015275 3300025927 Bacteria 5031
609 Ga0207687_10284289 3300025927 Bacteria 1327
610 Ga0207700_10007100 3300025928 Bacteria 6820
611 Ga0207700_10018744 3300025928 Bacteria 4659
612 Ga0207700_10036980 3300025928 Bacteria 3531
613 Ga0207700_10072688 3300025928 Bacteria 2653
614 Ga0207700_10151033 3300025928 Bacteria 1919
615 Ga0207700_10151669 3300025928 Bacteria 1916
616 Ga0207664_10014021 3300025929 Bacteria 5777
617 Ga0207664_10027440 3300025929 Bacteria 4316
618 Ga0207644_10000776 3300025931 Bacteria 20251
619 Ga0207644_10002109 3300025931 Bacteria 12894
620 Ga0207644_10015442 3300025931 Bacteria 5126
621 Ga0207644_10020295 3300025931 Bacteria 4517
622 Ga0207644_10190573 3300025931 Bacteria 1612
623 Ga0207690_10000225 3300025932 Bacteria 42706
624 Ga0207690_10093886 3300025932 Bacteria 2127
625 Ga0207690_10109743 3300025932 Bacteria 1985
626 Ga0207706_10001675 3300025933 Bacteria 21873
627 Ga0207706_10042501 3300025933 Bacteria 4028
628 Ga0207706_10070446 3300025933 Bacteria 3076
629 Ga0207706_10103738 3300025933 Bacteria 2502
630 Ga0207686_10001701 3300025934 Bacteria 12258
631 Ga0207686_10029111 3300025934 Bacteria 3255
632 Ga0207709_10000291 3300025935 Bacteria 56621
633 Ga0207670_10000463 3300025936 Bacteria 22617
634 Ga0207670_10007249 3300025936 Bacteria 6178
635 Ga0207670_10011845 3300025936 Bacteria 5078
636 Ga0207670_10079765 3300025936 Bacteria 2286
637 Ga0207669_10000019 3300025937 Bacteria 111630
638 Ga0207704_10000230 3300025938 Bacteria 27729
639 Ga0207704_10039730 3300025938 Bacteria 2743
640 Ga0207704_10061285 3300025938 Bacteria 2333
641 Ga0207704_10201241 3300025938 Bacteria 1458
642 Ga0207665_10005663 3300025939 Bacteria 8322
643 Ga0207665_10010796 3300025939 Bacteria 5997
644 Ga0207665_10029367 3300025939 Bacteria 3634
645 Ga0207665_10143824 3300025939 Bacteria 1703
646 Ga0207665_10213294 3300025939 Bacteria 1411
647 Ga0207691_10000882 3300025940 Bacteria 29793
648 Ga0207691_10007777 3300025940 Bacteria 10322
649 Ga0207691_10069856 3300025940 Bacteria 3172
650 Ga0207691_10254055 3300025940 Bacteria 1517
651 Ga0207691_10275295 3300025940 Bacteria 1449
652 Ga0207711_10001381 3300025941 Bacteria 22842
653 Ga0207711_10011217 3300025941 Bacteria 7446
654 Ga0207711_10072837 3300025941 Bacteria 2985
655 Ga0207711_10367605 3300025941 Bacteria 1333
656 Ga0207689_10000228 3300025942 Bacteria 50020
657 Ga0207689_10009830 3300025942 Bacteria 8245
658 Ga0207689_10050716 3300025942 Bacteria 3421
659 Ga0207661_10000107 3300025944 Bacteria 52429
660 Ga0207661_10017315 3300025944 Bacteria 5328
661 Ga0207661_10166725 3300025944 Bacteria 1915
662 Ga0207679_10000026 3300025945 Bacteria 200073
663 Ga0207679_10064593 3300025945 Bacteria 2736
664 Ga0207667_10007642 3300025949 Bacteria 12950
665 Ga0207667_10017783 3300025949 Bacteria 7994
666 Ga0207667_10021717 3300025949 Bacteria 7111
667 Ga0207667_10038306 3300025949 Bacteria 5122
668 Ga0207667_10056568 3300025949 Bacteria 4120
669 Ga0207667_10185843 3300025949 Bacteria 2133
670 Ga0207651_10000069 3300025960 Bacteria 46408
671 Ga0207651_10038302 3300025960 Bacteria 3150
672 Ga0207651_10076837 3300025960 Bacteria 2388
673 Ga0207712_10000242 3300025961 Bacteria 53794
674 Ga0207712_10267673 3300025961 Bacteria 1389
675 Ga0207668_10000049 3300025972 Bacteria 99391
676 Ga0207668_10059373 3300025972 Bacteria 2679
677 Ga0207668_10168639 3300025972 Bacteria 1714
678 Ga0207640_10000301 3300025981 Bacteria 32802
679 Ga0207640_10029527 3300025981 Bacteria 3367
680 Ga0207640_10074211 3300025981 Bacteria 2301
681 Ga0207640_10189847 3300025981 Bacteria 1548
682 Ga0207658_10077114 3300025986 Bacteria 2542
683 Ga0207658_10175261 3300025986 Bacteria 1770
684 Ga0207677_10072040 3300026023 Bacteria 2441
685 Ga0207677_10219393 3300026023 Bacteria 1524
686 Ga0207677_10295039 3300026023 Bacteria 1337
687 Ga0207703_10098502 3300026035 Bacteria 2473
688 Ga0207703_10318466 3300026035 Bacteria 1424
689 Ga0207639_10000413 3300026041 Bacteria 29583
690 Ga0207639_10011576 3300026041 Bacteria 6129
691 Ga0207639_10066094 3300026041 Bacteria 2809
692 Ga0207639_10075818 3300026041 Bacteria 2646
693 Ga0207678_10000920 3300026067 Bacteria 26941
694 Ga0207678_10007714 3300026067 Bacteria 9507
695 Ga0207678_10010132 3300026067 Bacteria 8270
696 Ga0207678_10018124 3300026067 Bacteria 6184
697 Ga0207678_10030856 3300026067 Bacteria 4679
698 Ga0207678_10035645 3300026067 Bacteria 4331
699 Ga0207678_10041352 3300026067 Bacteria 3997
700 Ga0207678_10120737 3300026067 Bacteria 2237
701 Ga0207708_10002680 3300026075 Bacteria 13080
702 Ga0207708_10002682 3300026075 Bacteria 13078
703 Ga0207708_10029309 3300026075 Bacteria 4171
704 Ga0207708_10137658 3300026075 Bacteria 1913
705 Ga0207702_10001310 3300026078 Bacteria 24935
706 Ga0207702_10002075 3300026078 Bacteria 19368
707 Ga0207641_10000542 3300026088 Bacteria 42352
708 Ga0207648_10002093 3300026089 Bacteria 21739
709 Ga0207648_10011369 3300026089 Bacteria 8390
710 Ga0207676_10000511 3300026095 Bacteria 32689
711 Ga0207676_10034980 3300026095 Bacteria 3808
712 Ga0207676_10055650 3300026095 Bacteria 3107
713 Ga0207676_10066499 3300026095 Bacteria 2875
714 Ga0207676_10308686 3300026095 Bacteria 1447
715 Ga0207674_10000882 3300026116 Bacteria 39274
716 Ga0207674_10008675 3300026116 Bacteria 11703
717 Ga0207674_10029762 3300026116 Bacteria 5745
718 Ga0207674_10074468 3300026116 Bacteria 3407
719 Ga0207674_10122257 3300026116 Bacteria 2569
720 Ga0207674_10207300 3300026116 Bacteria 1909
721 Ga0207675_100001599 3300026118 Bacteria 22695
722 Ga0207675_100032506 3300026118 Bacteria 4859
723 Ga0207675_100032967 3300026118 Bacteria 4826
724 Ga0207675_100056412 3300026118 Bacteria 3664
725 Ga0207675_100181195 3300026118 Bacteria 2017
726 Ga0207675_100333112 3300026118 Bacteria 1484
727 Ga0207683_10000653 3300026121 Bacteria 31779
728 Ga0207683_10005584 3300026121 Bacteria 10781
729 Ga0207683_10032212 3300026121 Bacteria 4553
730 Ga0207683_10034787 3300026121 Bacteria 4380
731 Ga0207683_10058314 3300026121 Bacteria 3390
732 Ga0207683_10126366 3300026121 Bacteria 2298
733 Ga0207683_10320810 3300026121 Bacteria 1419
734 Ga0207698_10003176 3300026142 Bacteria 9855
735 Ga0207698_10015074 3300026142 Bacteria 5165
736 Ga0207698_10031914 3300026142 Bacteria 3809
737 Ga0207698_10141417 3300026142 Bacteria 2074
738 Ga0207698_10184510 3300026142 Bacteria 1852
739 Ga0207698_10213466 3300026142 Bacteria 1738
740 Ga0207698_10241296 3300026142 Bacteria 1647
741 Ga0209389_1000033 3300027296 Bacteria 131516
742 Ga0209389_1000071 3300027296 Bacteria 97411
743 Ga0209589_1000040 3300027357 Bacteria 126550
744 Ga0209489_100045 3300027361 Bacteria 158225
745 Ga0209489_101361 3300027361 Bacteria 50193
746 Ga0209700_100011 3300027363 Bacteria 362159
747 Ga0209967_1004267 3300027364 Bacteria 1894
748 Ga0209179_1004156 3300027512 Bacteria 2161
749 Ga0210002_1005285 3300027617 Bacteria 1938
750 Ga0209588_1021319 3300027671 Bacteria 2034
751 Ga0209966_1009837 3300027695 Bacteria 1714
752 Ga0209998_10000855 3300027717 Bacteria 7842
753 Ga0209998_10000913 3300027717 Bacteria 7554
754 Ga0209974_10001240 3300027876 Bacteria 9154
755 Ga0207428_10000130 3300027907 Bacteria 104457
756 Ga0207428_10000180 3300027907 Bacteria 88557
757 Ga0207428_10000286 3300027907 Bacteria 68250
758 Ga0265357_1000126 3300028023 Bacteria 3187
759 Ga0268266_10000680 3300028379 Bacteria 45937
760 Ga0268266_10001248 3300028379 Bacteria 31070
761 Ga0268266_10011598 3300028379 Bacteria 7650
762 Ga0268266_10013545 3300028379 Bacteria 7022
763 Ga0268266_10019092 3300028379 Bacteria 5838
764 Ga0268266_10047378 3300028379 Bacteria 3682
765 Ga0268266_10061027 3300028379 Bacteria 3251
766 Ga0268266_10084876 3300028379 Bacteria 2766
767 Ga0268266_10146772 3300028379 Bacteria 2122
768 Ga0268266_10192534 3300028379 Bacteria 1862
769 Ga0268265_10000410 3300028380 Bacteria 45939
770 Ga0268265_10109383 3300028380 Bacteria 2252
771 Ga0268265_10136371 3300028380 Bacteria 2048
772 Ga0268265_10243594 3300028380 Bacteria 1588
773 Ga0268265_10346640 3300028380 Bacteria 1354
774 Ga0268264_10001172 3300028381 Bacteria 25487
775 Ga0265337_1000803 3300028556 Bacteria 16537
776 Ga0307517_10000175 3300028786 Bacteria 105567
777 Ga0307515_10010288 3300028794 Bacteria 17962
778 Ga0265338_10082594 3300028800 Bacteria 2689
779 Ga0265763_1000550 3300030763 Bacteria 2334
780 Ga0265330_10013168 3300031235 Bacteria 3858
781 Ga0265330_10017853 3300031235 Bacteria 3264
782 Ga0265328_10005186 3300031239 Bacteria 5604
783 Ga0265328_10012310 3300031239 Bacteria 3407
784 Ga0265325_10000011 3300031241 Bacteria 150631
785 Ga0265325_10000031 3300031241 Bacteria 102905
786 Ga0265325_10009845 3300031241 Bacteria 5565
787 Ga0265325_10010725 3300031241 Bacteria 5287
788 Ga0265325_10043236 3300031241 Bacteria 2351
789 Ga0265325_10060508 3300031241 Bacteria 1923
790 Ga0265340_10000988 3300031247 Bacteria 16244
791 Ga0265340_10002668 3300031247 Bacteria 10139
792 Ga0265340_10015328 3300031247 Bacteria 3983
793 Ga0265340_10016275 3300031247 Bacteria 3853
794 Ga0265340_10019075 3300031247 Bacteria 3532
795 Ga0265339_10000420 3300031249 Bacteria 33598
796 Ga0265339_10023140 3300031249 Bacteria 3594
797 Ga0265339_10029285 3300031249 Bacteria 3124
798 Ga0265339_10033487 3300031249 Bacteria 2892
799 Ga0265339_10081739 3300031249 Bacteria 1707
800 Ga0265331_10065751 3300031250 Bacteria 1704
801 Ga0265316_10012332 3300031344 Bacteria 7672
802 Ga0265316_10031368 3300031344 Bacteria 4346
803 Ga0265316_10156012 3300031344 Bacteria 1708
804 Ga0307513_10079139 3300031456 Bacteria 3397
805 Ga0265313_10000008 3300031595 Bacteria 173405
806 Ga0265313_10000637 3300031595 Bacteria 36099
807 Ga0265313_10004833 3300031595 Bacteria 10135
808 Ga0265313_10007230 3300031595 Bacteria 7639
809 Ga0265313_10008768 3300031595 Bacteria 6673
810 Ga0265313_10020749 3300031595 Bacteria 3616
811 Ga0265313_10023060 3300031595 Bacteria 3360
812 Ga0265313_10023600 3300031595 Bacteria 3310
813 Ga0265313_10025145 3300031595 Bacteria 3163
814 Ga0307508_10000108 3300031616 Bacteria 97443
815 Ga0307508_10044567 3300031616 Bacteria 3967
816 Ga0307508_10109344 3300031616 Bacteria 2364
817 Ga0316575_10005603 3300031665 Bacteria 4481
818 Ga0316575_10013015 3300031665 Bacteria 3105
819 Ga0316579_10006101 3300031691 Bacteria 4895
820 Ga0265314_10002983 3300031711 Bacteria 16763
821 Ga0265314_10011076 3300031711 Bacteria 7474
822 Ga0265314_10072325 3300031711 Bacteria 2304
823 Ga0265342_10004075 3300031712 Bacteria 11653
824 Ga0265342_10008760 3300031712 Bacteria 7216
825 Ga0265342_10034408 3300031712 Bacteria 3108
826 Ga0265342_10051976 3300031712 Bacteria 2443
827 Ga0265342_10053102 3300031712 Bacteria 2413
828 Ga0265342_10118905 3300031712 Bacteria 1490
829 Ga0307516_10275542 3300031730 Bacteria 1366
830 Ga0307516_10287203 3300031730 Bacteria 1325
831 Ga0307405_10039377 3300031731 Bacteria 2856
832 Ga0307412_10131376 3300031911 Bacteria 1819
833 Ga0316583_10000432 3300032133 Bacteria 12280
834 Ga0307510_10172898 3300033180 Bacteria 1736
835 Ga0373930_0002135 3300034816 Bacteria 3031
836 Ga0373930_0004672 3300034816 Bacteria 2242
837 Ga0373930_0006152 3300034816 Bacteria 2019
838 Ga0373948_0019053 3300034817 Bacteria 1294
839 Ga0373950_0004459 3300034818 Bacteria 2052
840 Ga0373950_0009843 3300034818 Bacteria 1534
841 Ga0373958_0001550 3300034819 Bacteria 3108
842 Ga0373959_0000740 3300034820 Bacteria 5585
843 Ga0373959_0002603 3300034820 Bacteria 2862
844 Ga0373938_0000260 3300034957 Bacteria 8284
845 Ga0373938_0001185 3300034957 Bacteria 4200
846 Ga0373926_0045645 3300035083 Bacteria 1571
847 Ga0373928_0000813 3300035084 Bacteria 6085
848 Ga0373928_0008582 3300035084 Bacteria 1986
849 Ga0373928_0011485 3300035084 Bacteria 1753
850 Ga0373929_0001725 3300035085 Bacteria 4109
851 Ga0373929_0005692 3300035085 Bacteria 2249
852 Ga0373934_0052433 3300035086 Bacteria 1618
853 Ga0373940_0000718 3300035088 Bacteria 5376
854 Ga0373944_0007059 3300035089 Bacteria 3002
855 Ga0373949_0000547 3300035090 Bacteria 12392
856 Ga0373949_0011258 3300035090 Bacteria 1969
857 Ga0373951_0001164 3300035091 Bacteria 6957
858 Ga0373951_0002297 3300035091 Bacteria 4858
859 Ga0373952_0000516 3300035092 Bacteria 6773
860 Ga0373952_0000760 3300035092 Bacteria 5799
861 Ga0373923_0010424 3300035111 Bacteria 3379
862 Ga0373932_0000908 3300035112 Bacteria 8652
863 Ga0373936_0106013 3300035113 Bacteria 1190
864 Ga0373939_0000911 3300035114 Bacteria 7343
865 Ga0373939_0014272 3300035114 Bacteria 2059
866 Ga0373939_0024389 3300035114 Bacteria 1684
867 Ga0373941_0000037 3300035115 Bacteria 19599
868 Ga0373941_0001686 3300035115 Bacteria 4731
869 Ga0373941_0017520 3300035115 Bacteria 1964
870 Ga0373945_0004426 3300035116 Bacteria 4463
871 Ga0373945_0008144 3300035116 Bacteria 3407
872 Ga0373945_0023371 3300035116 Bacteria 2135
873 Ga0373945_0026758 3300035116 Bacteria 2010
874 Ga0373953_0001233 3300035117 Bacteria 7299
875 Ga0373953_0018745 3300035117 Bacteria 2565
876 Ga0373953_0022802 3300035117 Bacteria 2365
877 Ga0373954_0000514 3300035118 Bacteria 14516
878 Ga0373954_0003303 3300035118 Bacteria 6814
879 Ga0373954_0024791 3300035118 Bacteria 2737
880 Ga0373954_0100960 3300035118 Bacteria 1392
881 Ga0373956_0003634 3300035119 Bacteria 6226
882 Ga0373956_0005363 3300035119 Bacteria 5133
883 Ga0373956_0007961 3300035119 Bacteria 4281
884 Ga0373956_0015060 3300035119 Bacteria 3234
885 Ga0373957_0001007 3300035120 Bacteria 7408
886 Ga0373957_0006379 3300035120 Bacteria 3713
887 Ga0373957_0011003 3300035120 Bacteria 3008
888 Ga0373957_0019840 3300035120 Bacteria 2370
889 Ga0373957_0024024 3300035120 Bacteria 2185
890 Ga0373960_0000805 3300035121 Bacteria 6600
891 Ga0373960_0001073 3300035121 Bacteria 5899
892 Ga0373943_0000699 3300035170 Bacteria 14633
893 Ga0373943_0004297 3300035170 Bacteria 6466
894 Ga0373943_0007096 3300035170 Bacteria 5027
895 Ga0373943_0010381 3300035170 Bacteria 4174
896 Ga0373943_0010931 3300035170 Bacteria 4079
897 Ga0373943_0030320 3300035170 Bacteria 2558
898 Ga0373943_0136083 3300035170 Bacteria 1319
899 Ga0373946_0004806 3300035171 Bacteria 4863
900 Ga0373946_0009235 3300035171 Bacteria 3628
901 Ga0373946_0014570 3300035171 Bacteria 2966
902 Ga0373946_0032937 3300035171 Bacteria 2083
903 Ga0373955_0000723 3300035172 Bacteria 14148
904 Ga0373955_0001851 3300035172 Bacteria 9104
905 Ga0373955_0007716 3300035172 Bacteria 4956
906 Ga0373955_0014090 3300035172 Bacteria 3882
907 Ga0373955_0019345 3300035172 Bacteria 3401
908 Ga0373955_0030955 3300035172 Bacteria 2799
909 Ga0373955_0103027 3300035172 Bacteria 1641
910 Ga0373942_0000388 3300035207 Bacteria 12155
911 Ga0373942_0010244 3300035207 Bacteria 2203
912 Ga0373961_0000658 3300035241 Bacteria 12233
913 Ga0373961_0010035 3300035241 Bacteria 2328
914 Ga0373961_0024994 3300035241 Bacteria 1620
915 Ga0373962_0004022 3300035242 Bacteria 3540
916 Ga0373962_0005442 3300035242 Bacteria 3082
917 Ga0373962_0008725 3300035242 Bacteria 2501
918 Ga0373924_0003551 3300035410 Bacteria 5372
919 Ga0373924_0005950 3300035410 Bacteria 4348
920 Ga0373924_0014945 3300035410 Bacteria 2940
921 Ga0373924_0033471 3300035410 Bacteria 2075
922 Ga0373924_0082998 3300035410 Bacteria 1364
923 Ga0373931_0001169 3300035691 Bacteria 11182
924 Ga0373931_0002000 3300035691 Bacteria 8971
925 Ga0373931_0021214 3300035691 Bacteria 3258
926 Ga0373931_0024262 3300035691 Bacteria 3070
927 Ga0373931_0041537 3300035691 Bacteria 2416
928 Ga0373935_0000777 3300035692 Bacteria 16996
929 Ga0373935_0015808 3300035692 Bacteria 4566
930 Ga0373935_0016204 3300035692 Bacteria 4510
931 Ga0373927_0000337 3300035695 Bacteria 36861
932 Ga0373927_0000920 3300035695 Bacteria 22344
933 Ga0373927_0007511 3300035695 Bacteria 7373
934 Ga0373927_0063703 3300035695 Bacteria 2385
935 Ga0373927_0070036 3300035695 Bacteria 2270
936 Ga0373933_0000749 3300035724 Bacteria 19837
937 Ga0373933_0008828 3300035724 Bacteria 5495
938 Ga0373933_0016195 3300035724 Bacteria 4166
939 Ga0373933_0020951 3300035724 Bacteria 3708
940 Ga0373933_0097439 3300035724 Bacteria 1821
941 Ga0373933_0177752 3300035724 Bacteria 1356
942 Ga0373947_0001483 3300035725 Bacteria 14409
943 Ga0373947_0001596 3300035725 Bacteria 13905
944 Ga0373947_0004710 3300035725 Bacteria 7993
945 Ga0373947_0004829 3300035725 Bacteria 7879
946 Ga0373947_0010845 3300035725 Bacteria 5228
947 Ga0373947_0011454 3300035725 Bacteria 5087
948 Ga0373947_0012687 3300035725 Bacteria 4832
949 Ga0373947_0035521 3300035725 Bacteria 2951
950 Ga0373947_0037785 3300035725 Bacteria 2866
951 Ga0373947_0098051 3300035725 Bacteria 1838
952 Ga0373937_0001087 3300036401 Bacteria 22920
953 Ga0373937_0004268 3300036401 Bacteria 12113
954 Ga0373937_0012013 3300036401 Bacteria 7601
955 Ga0373937_0020739 3300036401 Bacteria 5894
956 Ga0373937_0027462 3300036401 Bacteria 5147
957 Ga0373937_0034586 3300036401 Bacteria 4596
958 Ga0373937_0040316 3300036401 Bacteria 4256
959 Ga0373937_0059594 3300036401 Bacteria 3508
960 Ga0373937_0129696 3300036401 Bacteria 2355
961 Ga0373937_0327232 3300036401 Bacteria 1450
962 Ga0373937_0331331 3300036401 Bacteria 1441
963 Ga0373925_0000712 3300037068 Bacteria 31050
964 Ga0373925_0002178 3300037068 Bacteria 15945
965 Ga0373925_0012757 3300037068 Bacteria 6088
966 Ga0373925_0070890 3300037068 Bacteria 2635
967 Ga0373925_0071831 3300037068 Bacteria 2618
968 Ga0373925_0074899 3300037068 Bacteria 2564
969 Ga0373925_0167688 3300037068 Bacteria 1732
970 Ga0373925_0179167 3300037068 Bacteria 1676
971 Ga0373925_0242286 3300037068 Bacteria 1444
972 Ga0395899_0013101 3300037312 Bacteria 6342
973 Ga0395899_0072062 3300037312 Bacteria 2528
974 Ga0395900_0002974 3300037418 Bacteria 18448
975 Ga0395900_0010116 3300037418 Bacteria 9647
976 Ga0395900_0101559 3300037418 Bacteria 2954
977 Ga0395898_0005741 3300037466 Bacteria 13364
978 Ga0395898_0011608 3300037466 Bacteria 9143
979 Ga0395898_0014047 3300037466 Bacteria 8229
980 Ga0395898_0113141 3300037466 Bacteria 2601
981 Ga0395905_0009536 3300037471 Bacteria 9483
982 Ga0395905_0023356 3300037471 Bacteria 5845
983 Ga0436364_0091611 3300037853 Bacteria 8138
984 Ga0395901_0003628 3300038443 Bacteria 15574
985 Ga0395901_0012308 3300038443 Bacteria 8683
986 Ga0395901_0092810 3300038443 Bacteria 3160
987 Ga0436365_0113731 3300039437 Bacteria 1517
988 Ga0436365_0254353 3300039437 Bacteria 4466
989 Ga0436365_0270990 3300039437 Bacteria 1951
990 Ga0436365_0671434 3300039437 Bacteria 2715
991 Ga0436365_1550909 3300039437 Bacteria 12274
992 Ga0436365_1927338 3300039437 Bacteria 1636
993 Ga0436361_0438836 3300039447 Bacteria 1625
994 Ga0436361_0676992 3300039447 Bacteria 1904
995 Ga0436361_0764602 3300039447 Bacteria 1327
996 Ga0436361_0842459 3300039447 Bacteria 1417
997 Ga0436361_0869536 3300039447 Bacteria 4068
998 Ga0436363_1655093 3300039450 Bacteria 1861
999 Ga0436362_0320095 3300039453 Bacteria 2860
1000 Ga0439453_0001745 3300041408 Bacteria 2865
1001 Ga0439453_0015656 3300041408 Bacteria 1314
1002 Ga0439465_0015093 3300041413 Bacteria 2411
1003 Ga0439441_010110 3300042001 Bacteria 1576
1004 Ga0439455_0016975 3300042012 Bacteria 1690
1005 Ga0466969_0031199 3300044656 Bacteria 2714
1006 Ga0466972_0000107 3300044658 Bacteria 71873
1007 Ga0466965_0006278 3300044683 Bacteria 5381
1008 Ga0466966_0000429 3300044684 Bacteria 27002
1009 Ga0466966_0048482 3300044684 Bacteria 2706
1010 Ga0466966_0074503 3300044684 Bacteria 2122
1011 Ga0466961_0000074 3300044693 Bacteria 61968
1012 Ga0466963_0004354 3300044694 Bacteria 8220
1013 Ga0466963_0004518 3300044694 Bacteria 8099
1014 Ga0466963_0004913 3300044694 Bacteria 7794
1015 Ga0466963_0030079 3300044694 Bacteria 3501
1016 Ga0466963_0056684 3300044694 Bacteria 2608
1017 Ga0466968_0003762 3300044735 Bacteria 5620
1018 Ga0466957_0004324 3300044842 Bacteria 7887
1019 Ga0466957_0028192 3300044842 Bacteria 3342
1020 Ga0466960_0008577 3300044901 Bacteria 4189
1021 Ga0466960_0028229 3300044901 Bacteria 2567
1022 Ga0466959_0001671 3300045049 Bacteria 13739
1023 Ga0466959_0030925 3300045049 Bacteria 3964
1024 Ga0466959_0093715 3300045049 Bacteria 2155
1025 Ga0451576_0164471 3300045051 Bacteria 2315
1026 Ga0451576_0442507 3300045051 Bacteria 1364
1027 Ga0466958_0026534 3300045836 Bacteria 3424
1028 Ga0466967_0004481 3300045976 Bacteria 9428
1029 Ga0466967_0372979 3300045976 Bacteria 1384
1030 Ga0466967_0416113 3300045976 Bacteria 1309
1031 Ga0495592_0003132 3300046454 Bacteria 11819
1032 Ga0495592_0011587 3300046454 Bacteria 6678
1033 Ga0495592_0048616 3300046454 Bacteria 3155
1034 Ga0495592_0058912 3300046454 Bacteria 2830
1035 Ga0495592_0193907 3300046454 Bacteria 1375
1036 Ga0495603_0007593 3300046455 Bacteria 6525
1037 Ga0495603_0012985 3300046455 Bacteria 5035
1038 Ga0495603_0053315 3300046455 Bacteria 2399
1039 Ga0495603_0122267 3300046455 Bacteria 1516
1040 Ga0495629_0000124 3300046459 Bacteria 68796
1041 Ga0495629_0001397 3300046459 Bacteria 19021
1042 Ga0495629_0001747 3300046459 Bacteria 17032
1043 Ga0495629_0002750 3300046459 Bacteria 13453
1044 Ga0495629_0004000 3300046459 Bacteria 11075
1045 Ga0495629_0136391 3300046459 Bacteria 1708
1046 Ga0495638_0003214 3300046460 Bacteria 12926
1047 Ga0495638_0035809 3300046460 Bacteria 3163
1048 Ga0495638_0045581 3300046460 Bacteria 2758
1049 Ga0495638_0121170 3300046460 Bacteria 1546
1050 Ga0495651_0000828 3300046462 Bacteria 24059
1051 Ga0495651_0000848 3300046462 Bacteria 23752
1052 Ga0495651_0010521 3300046462 Bacteria 7109
1053 Ga0495651_0013380 3300046462 Bacteria 6347
1054 Ga0495651_0034381 3300046462 Bacteria 3950
1055 Ga0495651_0139182 3300046462 Bacteria 1762
1056 Ga0495653_0003214 3300046463 Bacteria 13088
1057 Ga0495653_0009388 3300046463 Bacteria 8005
1058 Ga0495653_0014317 3300046463 Bacteria 6468
1059 Ga0495653_0059128 3300046463 Bacteria 2911
1060 Ga0495580_0084249 3300046472 Bacteria 2214
1061 Ga0495580_0243244 3300046472 Bacteria 1233
1062 Ga0495582_0000494 3300046473 Bacteria 21572
1063 Ga0495582_0000612 3300046473 Bacteria 19623
1064 Ga0495582_0029848 3300046473 Bacteria 2993
1065 Ga0495605_0070490 3300046474 Bacteria 1653
1066 Ga0495639_0018656 3300046475 Bacteria 3022
1067 Ga0495639_0022341 3300046475 Bacteria 2774
1068 Ga0495662_0001524 3300046476 Bacteria 11502
1069 Ga0495664_0003608 3300046477 Bacteria 8436
1070 Ga0495664_0004132 3300046477 Bacteria 7926
1071 Ga0495664_0007442 3300046477 Bacteria 6082
1072 Ga0495664_0024956 3300046477 Bacteria 3476
1073 Ga0495664_0052403 3300046477 Bacteria 2425
1074 Ga0495584_0007686 3300046491 Bacteria 5613
1075 Ga0495584_0098033 3300046491 Bacteria 1481
1076 Ga0495585_0031324 3300046492 Bacteria 3019
1077 Ga0495594_0005394 3300046499 Bacteria 6572
1078 Ga0495583_0060554 3300046506 Bacteria 1692
1079 Ga0495606_0001875 3300046507 Bacteria 26343
1080 Ga0495606_0029132 3300046507 Bacteria 3881
1081 Ga0495606_0081523 3300046507 Bacteria 2011
1082 Ga0495606_0083098 3300046507 Bacteria 1986
1083 Ga0495606_0112941 3300046507 Bacteria 1636
1084 Ga0495608_0000289 3300046511 Bacteria 35308
1085 Ga0495608_0006800 3300046511 Bacteria 8107
1086 Ga0495608_0016797 3300046511 Bacteria 5064
1087 Ga0495608_0026000 3300046511 Bacteria 3994
1088 Ga0495608_0029737 3300046511 Bacteria 3703
1089 Ga0495608_0051514 3300046511 Bacteria 2728
1090 Ga0495610_0057783 3300046512 Bacteria 1859
1091 Ga0495616_0013598 3300046513 Bacteria 4586
1092 Ga0495616_0072093 3300046513 Bacteria 1668
1093 Ga0495616_0111407 3300046513 Bacteria 1271
1094 Ga0495618_0002332 3300046514 Bacteria 12272
1095 Ga0495618_0005683 3300046514 Bacteria 7578
1096 Ga0495618_0005818 3300046514 Bacteria 7498
1097 Ga0495618_0021212 3300046514 Bacteria 4005
1098 Ga0495620_0008453 3300046515 Bacteria 5526
1099 Ga0495628_0002019 3300046516 Bacteria 18395
1100 Ga0495628_0005743 3300046516 Bacteria 10869
1101 Ga0495628_0063328 3300046516 Bacteria 2898
1102 Ga0495628_0070770 3300046516 Bacteria 2719
1103 Ga0495628_0099426 3300046516 Bacteria 2247
1104 Ga0495628_0109037 3300046516 Bacteria 2131
1105 Ga0495630_0004265 3300046517 Bacteria 10023
1106 Ga0495630_0010648 3300046517 Bacteria 6638
1107 Ga0495630_0010684 3300046517 Bacteria 6628
1108 Ga0495632_0025333 3300046519 Bacteria 3139
1109 Ga0495648_0044784 3300046524 Bacteria 2759
1110 Ga0495648_0087688 3300046524 Bacteria 1751
1111 Ga0495666_0067927 3300046526 Bacteria 1698
1112 Ga0495652_0004566 3300046529 Bacteria 13203
1113 Ga0495652_0007469 3300046529 Bacteria 10075
1114 Ga0495652_0015031 3300046529 Bacteria 6934
1115 Ga0495652_0045490 3300046529 Bacteria 3772
1116 Ga0495652_0081641 3300046529 Bacteria 2666
1117 Ga0495652_0167720 3300046529 Bacteria 1697
1118 Ga0495652_0239116 3300046529 Bacteria 1353
1119 Ga0495654_0121070 3300046530 Bacteria 1184
1120 Ga0495665_0007626 3300046531 Bacteria 5862
1121 Ga0495665_0016023 3300046531 Bacteria 4038
1122 Ga0495665_0018434 3300046531 Bacteria 3751
1123 Ga0495640_0002278 3300046533 Bacteria 15391
1124 Ga0495640_0009218 3300046533 Bacteria 7699
1125 Ga0495640_0010515 3300046533 Bacteria 7143
1126 Ga0495640_0011275 3300046533 Bacteria 6881
1127 Ga0495640_0030298 3300046533 Bacteria 3875
1128 Ga0495640_0037763 3300046533 Bacteria 3403
1129 Ga0495640_0126222 3300046533 Bacteria 1659
1130 Ga0495640_0142826 3300046533 Bacteria 1542
1131 Ga0495586_0075916 3300046535 Bacteria 1840
1132 Ga0495587_0001579 3300046536 Bacteria 15169
1133 Ga0495587_0002055 3300046536 Bacteria 13439
1134 Ga0495587_0075738 3300046536 Bacteria 1954
1135 Ga0495598_0010358 3300046537 Bacteria 2232
1136 Ga0495609_0041186 3300046538 Bacteria 2077
1137 Ga0495621_0012445 3300046539 Bacteria 2652
1138 Ga0495645_0015600 3300046543 Bacteria 5404
1139 Ga0495645_0017012 3300046543 Bacteria 5205
1140 Ga0495645_0064816 3300046543 Bacteria 2643
1141 Ga0495622_0008280 3300046557 Bacteria 4816
1142 Ga0495622_0047417 3300046557 Bacteria 1996
1143 Ga0495622_0049876 3300046557 Bacteria 1943
1144 Ga0495667_0000745 3300046559 Bacteria 20880
1145 Ga0495667_0003972 3300046559 Bacteria 9929
1146 Ga0495667_0004942 3300046559 Bacteria 9014
1147 Ga0495667_0007291 3300046559 Bacteria 7502
1148 Ga0495667_0017408 3300046559 Bacteria 4853
1149 Ga0495667_0029968 3300046559 Bacteria 3658
1150 Ga0495667_0036611 3300046559 Bacteria 3274
1151 Ga0495656_0026478 3300046615 Bacteria 2309
1152 Ga0495668_0024098 3300046616 Bacteria 3463
1153 Ga0495634_0000886 3300046642 Bacteria 28754
1154 Ga0495634_0010854 3300046642 Bacteria 6655
1155 Ga0495634_0035418 3300046642 Bacteria 3419
1156 Ga0495634_0059475 3300046642 Bacteria 2545
1157 Ga0495634_0108579 3300046642 Bacteria 1786
1158 Ga0495635_0000288 3300046663 Bacteria 32286
1159 Ga0495635_0000628 3300046663 Bacteria 22744
1160 Ga0495635_0007880 3300046663 Bacteria 7439
1161 Ga0495635_0010659 3300046663 Bacteria 6436
1162 Ga0495635_0019422 3300046663 Bacteria 4736
1163 Ga0495635_0030423 3300046663 Bacteria 3752
1164 Ga0495635_0115167 3300046663 Bacteria 1835
1165 Ga0495635_0127602 3300046663 Bacteria 1734
1166 Ga0495659_0004621 3300046664 Bacteria 4334
1167 Ga0495661_0111970 3300046665 Bacteria 1520
1168 Ga0495588_0006045 3300046674 Bacteria 5430
1169 Ga0495588_0049532 3300046674 Bacteria 2160
1170 Ga0495657_0000869 3300046675 Bacteria 26665
1171 Ga0495657_0001357 3300046675 Bacteria 21264
1172 Ga0495657_0009320 3300046675 Bacteria 7450
1173 Ga0495657_0023590 3300046675 Bacteria 4394
1174 Ga0495657_0134114 3300046675 Bacteria 1548
1175 Ga0495599_0002342 3300046678 Bacteria 11001
1176 Ga0495599_0012613 3300046678 Bacteria 5211
1177 Ga0495599_0019939 3300046678 Bacteria 4176
1178 Ga0495599_0032432 3300046678 Bacteria 3279
1179 Ga0495623_0002014 3300046679 Bacteria 13644
1180 Ga0495623_0002560 3300046679 Bacteria 12022
1181 Ga0495623_0004925 3300046679 Bacteria 8751
1182 Ga0495623_0011972 3300046679 Bacteria 5620
1183 Ga0495623_0119677 3300046679 Bacteria 1586
1184 Ga0495646_0001350 3300046680 Bacteria 14492
1185 Ga0495646_0003278 3300046680 Bacteria 10075
1186 Ga0495646_0080599 3300046680 Bacteria 1898
1187 Ga0495647_0010897 3300046681 Bacteria 3105
1188 Ga0495647_0028792 3300046681 Bacteria 2050
1189 Ga0495658_0005405 3300046683 Bacteria 6278
1190 Ga0495658_0007867 3300046683 Bacteria 5279
1191 Ga0495658_0061430 3300046683 Bacteria 2157
1192 Ga0495669_0023835 3300046684 Bacteria 2666
1193 Ga0495669_0113690 3300046684 Bacteria 1265
1194 Ga0495613_0002256 3300046689 Bacteria 14570
1195 Ga0495613_0030094 3300046689 Bacteria 4033
1196 Ga0495613_0092460 3300046689 Bacteria 2190
1197 Ga0495613_0104223 3300046689 Bacteria 2048
1198 Ga0495613_0148608 3300046689 Bacteria 1672
1199 Ga0495613_0160595 3300046689 Bacteria 1599
1200 Ga0495613_0241365 3300046689 Bacteria 1263
1201 Ga0495624_0000867 3300046690 Bacteria 24012
1202 Ga0495624_0070358 3300046690 Bacteria 2178
1203 Ga0495670_0008005 3300046691 Bacteria 5195
1204 Ga0495670_0059673 3300046691 Bacteria 1915
1205 Ga0495671_0031480 3300046692 Bacteria 2712
1206 Ga0495649_0006343 3300046694 Bacteria 7362
1207 Ga0495600_0001518 3300046809 Bacteria 12888
1208 Ga0495600_0020307 3300046809 Bacteria 4249
1209 Ga0495600_0040052 3300046809 Bacteria 3051
1210 Ga0495600_0058682 3300046809 Bacteria 2514
1211 Ga0495600_0123335 3300046809 Bacteria 1685
1212 Ga0495581_0116575 3300047315 Bacteria 1553
1213 Ga0495604_0000613 3300047317 Bacteria 30609
1214 Ga0495604_0002473 3300047317 Bacteria 14751
1215 Ga0495604_0005447 3300047317 Bacteria 10093
1216 Ga0495604_0033969 3300047317 Bacteria 4036
1217 Ga0495604_0062471 3300047317 Bacteria 2844
1218 Ga0495604_0101529 3300047317 Bacteria 2113
1219 Ga0495604_0199296 3300047317 Bacteria 1390
1220 Ga0495636_0021260 3300047318 Bacteria 2620
1221 Ga0495674_0005148 3300047319 Bacteria 12558
1222 Ga0495674_0009345 3300047319 Bacteria 9321
1223 Ga0495674_0016916 3300047319 Bacteria 6799
1224 Ga0495674_0022408 3300047319 Bacteria 5826
1225 Ga0495674_0034750 3300047319 Bacteria 4555
1226 Ga0495674_0040150 3300047319 Bacteria 4188
1227 Ga0495674_0203789 3300047319 Bacteria 1640
1228 Ga0495672_0087515 3300047320 Bacteria 1720
1229 Ga0495676_0021648 3300047321 Bacteria 5609
1230 Ga0495676_0035932 3300047321 Bacteria 4142
1231 Ga0495680_0000791 3300047322 Bacteria 35389
1232 Ga0495680_0000871 3300047322 Bacteria 33528
1233 Ga0495680_0003706 3300047322 Bacteria 14923
1234 Ga0495680_0008347 3300047322 Bacteria 9419
1235 Ga0495680_0056497 3300047322 Bacteria 3039
1236 Ga0495680_0082360 3300047322 Bacteria 2428
1237 Ga0495683_0008398 3300047323 Bacteria 5529
1238 Ga0495683_0093686 3300047323 Bacteria 1452
1239 Ga0495687_008699 3300047443 Bacteria 5772
1240 Ga0495675_0000231 3300047444 Bacteria 40288
1241 Ga0495675_0004959 3300047444 Bacteria 8105
1242 Ga0495675_0006519 3300047444 Bacteria 7145
1243 Ga0495675_0046490 3300047444 Bacteria 2763
1244 Ga0495675_0136897 3300047444 Bacteria 1520
1245 Ga0495673_0064366 3300047469 Bacteria 1560
1246 Ga0495684_0000169 3300047471 Bacteria 49164
1247 Ga0495684_0006577 3300047471 Bacteria 9011
1248 Ga0495684_0017615 3300047471 Bacteria 5501
1249 Ga0495684_0024653 3300047471 Bacteria 4629
1250 Ga0495684_0033293 3300047471 Bacteria 3954
1251 Ga0495684_0040178 3300047471 Bacteria 3586
1252 Ga0495684_0048445 3300047471 Bacteria 3249
1253 Ga0495684_0061181 3300047471 Bacteria 2865
1254 Ga0495684_0076092 3300047471 Bacteria 2549
1255 Ga0495684_0111667 3300047471 Bacteria 2062
1256 Ga0495684_0176189 3300047471 Bacteria 1587
1257 Ga0495686_0069066 3300047472 Bacteria 2179
1258 Ga0495686_0084342 3300047472 Bacteria 1936
1259 Ga0495686_0124031 3300047472 Bacteria 1537
1260 Ga0495593_0006499 3300047673 Bacteria 6850
1261 Ga0495593_0015076 3300047673 Bacteria 4390
1262 Ga0495602_0006526 3300048088 Bacteria 12232
1263 Ga0495602_0007532 3300048088 Bacteria 11388
1264 Ga0495602_0008023 3300048088 Bacteria 11038
1265 Ga0495602_0109171 3300048088 Bacteria 2251
1266 Ga0495626_0019874 3300048091 Bacteria 3352
1267 Ga0496100_0001568 3300048903 Bacteria 11248
1268 Ga0496100_0015384 3300048903 Bacteria 4468
1269 Ga0496100_0029669 3300048903 Bacteria 3385
1270 Ga0496100_0039950 3300048903 Bacteria 2982
1271 Ga0496100_0056464 3300048903 Bacteria 2568
1272 Ga0496101_0000171 3300048904 Bacteria 53757
1273 Ga0496101_0001461 3300048904 Bacteria 14113
1274 Ga0496101_0002295 3300048904 Bacteria 11691
1275 Ga0496101_0061278 3300048904 Bacteria 2732
1276 Ga0496101_0094070 3300048904 Bacteria 2233
1277 Ga0496101_0264407 3300048904 Bacteria 1342
1278 Ga0496102_0001453 3300048905 Bacteria 20988
1279 Ga0496102_0004724 3300048905 Bacteria 11533
1280 Ga0496102_0024848 3300048905 Bacteria 5328
1281 Ga0496102_0132235 3300048905 Bacteria 2336
1282 Ga0496102_0170684 3300048905 Bacteria 2048
1283 Ga0496102_0221645 3300048905 Bacteria 1783
1284 Ga0496103_0005627 3300048906 Bacteria 7489
1285 Ga0496103_0005987 3300048906 Bacteria 7274
1286 Ga0496103_0017226 3300048906 Bacteria 4321
1287 Ga0496103_0216405 3300048906 Bacteria 1232
1288 Ga0496104_0000067 3300048907 Bacteria 108556
1289 Ga0496104_0003147 3300048907 Bacteria 14223
1290 Ga0496104_0012278 3300048907 Bacteria 7699
1291 Ga0496104_0037074 3300048907 Bacteria 4559
1292 Ga0496104_0064446 3300048907 Bacteria 3475
1293 Ga0496104_0081709 3300048907 Bacteria 3082
1294 Ga0496104_0089362 3300048907 Bacteria 2943
1295 Ga0496104_0138768 3300048907 Bacteria 2336
1296 Ga0496104_0176828 3300048907 Bacteria 2044
1297 Ga0496105_0000130 3300048908 Bacteria 50576
1298 Ga0496105_0004705 3300048908 Bacteria 10292
1299 Ga0496105_0011328 3300048908 Bacteria 7042
1300 Ga0496105_0050772 3300048908 Bacteria 3426
1301 Ga0496105_0054949 3300048908 Bacteria 3287
1302 Ga0496105_0108449 3300048908 Bacteria 2292
1303 Ga0496105_0189447 3300048908 Bacteria 1682
1304 Ga0496105_0192646 3300048908 Bacteria 1666
1305 Ga0496105_0218260 3300048908 Bacteria 1553
1306 Ga0496106_0002116 3300048909 Bacteria 14844
1307 Ga0496106_0005992 3300048909 Bacteria 8988
1308 Ga0496106_0013472 3300048909 Bacteria 6037
1309 Ga0496106_0013768 3300048909 Bacteria 5975
1310 Ga0496106_0019258 3300048909 Bacteria 5061
1311 Ga0496106_0035425 3300048909 Bacteria 3732
1312 Ga0496106_0053430 3300048909 Bacteria 3051
1313 Ga0496106_0063140 3300048909 Bacteria 2814
1314 Ga0496106_0139292 3300048909 Bacteria 1908
1315 Ga0496106_0177492 3300048909 Bacteria 1690
1316 Ga0496107_0002489 3300048910 Bacteria 11968
1317 Ga0496107_0003392 3300048910 Bacteria 10660
1318 Ga0496107_0005829 3300048910 Bacteria 8433
1319 Ga0496107_0009248 3300048910 Bacteria 6831
1320 Ga0496107_0010662 3300048910 Bacteria 6390
1321 Ga0496107_0036330 3300048910 Bacteria 3534
1322 Ga0496107_0103925 3300048910 Bacteria 2084
1323 Ga0496107_0120514 3300048910 Bacteria 1933
1324 Ga0496107_0280096 3300048910 Bacteria 1241
1325 Ga0496108_0003417 3300048911 Bacteria 12751
1326 Ga0496108_0005206 3300048911 Bacteria 10513
1327 Ga0496108_0006501 3300048911 Bacteria 9482
1328 Ga0496108_0025147 3300048911 Bacteria 4905
1329 Ga0496108_0025606 3300048911 Bacteria 4863
1330 Ga0496108_0039052 3300048911 Bacteria 3956
1331 Ga0496108_0047350 3300048911 Bacteria 3594
1332 Ga0496108_0064251 3300048911 Bacteria 3092
1333 Ga0496108_0132273 3300048911 Bacteria 2144
1334 Ga0496109_0000606 3300048912 Bacteria 29948
1335 Ga0496109_0000714 3300048912 Bacteria 27676
1336 Ga0496109_0004345 3300048912 Bacteria 11842
1337 Ga0496109_0004713 3300048912 Bacteria 11387
1338 Ga0496109_0024520 3300048912 Bacteria 5363
1339 Ga0496109_0030825 3300048912 Bacteria 4807
1340 Ga0496109_0084083 3300048912 Bacteria 2935
1341 Ga0496109_0084980 3300048912 Bacteria 2920
1342 Ga0496109_0122011 3300048912 Bacteria 2428
1343 Ga0496109_0125037 3300048912 Bacteria 2397
1344 Ga0496109_0151615 3300048912 Bacteria 2170
1345 Ga0496109_0210528 3300048912 Bacteria 1828
1346 Ga0496109_0218652 3300048912 Bacteria 1792
1347 Ga0496110_0011093 3300048913 Bacteria 7361
1348 Ga0496110_0031167 3300048913 Bacteria 4599
1349 Ga0496110_0073759 3300048913 Bacteria 3029
1350 Ga0496110_0080773 3300048913 Bacteria 2898
1351 Ga0496110_0083757 3300048913 Bacteria 2845
1352 Ga0496110_0149039 3300048913 Bacteria 2117
1353 Ga0496110_0407516 3300048913 Bacteria 1239
1354 Ga0496110_0453028 3300048913 Bacteria 1169
1355 Ga0496111_0038001 3300048914 Bacteria 3447
1356 Ga0496111_0039188 3300048914 Bacteria 3396
1357 Ga0496111_0111178 3300048914 Bacteria 2018
1358 Ga0496111_0141650 3300048914 Bacteria 1781
1359 Ga0496111_0160448 3300048914 Bacteria 1669
1360 Ga0496111_0172079 3300048914 Bacteria 1609
1361 Ga0496111_0172431 3300048914 Bacteria 1607
1362 Ga0496112_0002085 3300048915 Bacteria 15849
1363 Ga0496112_0003993 3300048915 Bacteria 12365
1364 Ga0496112_0007660 3300048915 Bacteria 9604
1365 Ga0496112_0018292 3300048915 Bacteria 6596
1366 Ga0496112_0090589 3300048915 Bacteria 3027
1367 Ga0496112_0091411 3300048915 Bacteria 3012
1368 Ga0496112_0130032 3300048915 Bacteria 2489
1369 Ga0496112_0154841 3300048915 Bacteria 2259
1370 Ga0496112_0156781 3300048915 Bacteria 2243
1371 Ga0496112_0204664 3300048915 Bacteria 1932
1372 Ga0496112_0250203 3300048915 Bacteria 1723
1373 Ga0496112_0309730 3300048915 Bacteria 1524
1374 Ga0496113_0000399 3300048916 Bacteria 20918
1375 Ga0496113_0002831 3300048916 Bacteria 10199
1376 Ga0496113_0034822 3300048916 Bacteria 3677
1377 Ga0496113_0035652 3300048916 Bacteria 3639
1378 Ga0496113_0042451 3300048916 Bacteria 3361
1379 Ga0496113_0067886 3300048916 Bacteria 2705
1380 Ga0496113_0092424 3300048916 Bacteria 2333
1381 Ga0496114_0008317 3300048917 Bacteria 8221
1382 Ga0496114_0028520 3300048917 Bacteria 4581
1383 Ga0496114_0029718 3300048917 Bacteria 4493
1384 Ga0496114_0041803 3300048917 Bacteria 3798
1385 Ga0496114_0096651 3300048917 Bacteria 2515
1386 Ga0496114_0174186 3300048917 Bacteria 1876
1387 Ga0496114_0178178 3300048917 Bacteria 1855
1388 Ga0496114_0216719 3300048917 Bacteria 1680
1389 Ga0496114_0225839 3300048917 Bacteria 1644
1390 Ga0496114_0238726 3300048917 Bacteria 1598
1391 Ga0496114_0267825 3300048917 Bacteria 1505
1392 Ga0496115_0001189 3300048918 Bacteria 18669
1393 Ga0496115_0006380 3300048918 Bacteria 8641
1394 Ga0496115_0085724 3300048918 Bacteria 2569
1395 Ga0496115_0100555 3300048918 Bacteria 2370
1396 Ga0496115_0101360 3300048918 Bacteria 2361
1397 Ga0496115_0105381 3300048918 Bacteria 2314
1398 Ga0496115_0116269 3300048918 Bacteria 2200
1399 Ga0496115_0130782 3300048918 Bacteria 2069
1400 Ga0496115_0189688 3300048918 Bacteria 1698
1401 Ga0496115_0207959 3300048918 Bacteria 1616
1402 Ga0496115_0280027 3300048918 Bacteria 1369
1403 Ga0496116_0003460 3300048919 Bacteria 15569
1404 Ga0496116_0097457 3300048919 Bacteria 1768
1405 Ga0496117_0027790 3300048920 Bacteria 4396
1406 Ga0496117_0030958 3300048920 Bacteria 4094
1407 Ga0496117_0037619 3300048920 Bacteria 3603
1408 Ga0496118_0015666 3300048921 Bacteria 7003
1409 Ga0496118_0016153 3300048921 Bacteria 6865
1410 Ga0496118_0037789 3300048921 Bacteria 3880
1411 Ga0496118_0047600 3300048921 Bacteria 3321
1412 Ga0496118_0074444 3300048921 Bacteria 2427
1413 Ga0496118_0167974 3300048921 Bacteria 1345
1414 Ga0496119_0025737 3300048922 Bacteria 4101
1415 Ga0496119_0042676 3300048922 Bacteria 2874
1416 Ga0496119_0045738 3300048922 Bacteria 2741
1417 Ga0496119_0048007 3300048922 Bacteria 2651
1418 Ga0496120_0024841 3300048923 Bacteria 3729
1419 Ga0496121_0010952 3300048924 Bacteria 10129
1420 Ga0496121_0012201 3300048924 Bacteria 9417
1421 Ga0496121_0017146 3300048924 Bacteria 7418
1422 Ga0496121_0022980 3300048924 Bacteria 6024
1423 Ga0496121_0023489 3300048924 Bacteria 5936
1424 Ga0496121_0025833 3300048924 Bacteria 5557
1425 Ga0496121_0043880 3300048924 Bacteria 3866
1426 Ga0496121_0085681 3300048924 Bacteria 2479
1427 Ga0496121_0229765 3300048924 Bacteria 1300
1428 Ga0496122_0002797 3300048925 Bacteria 23973
1429 Ga0496122_0016307 3300048925 Bacteria 7045
1430 Ga0496122_0050808 3300048925 Bacteria 3157
1431 Ga0496123_0001238 3300048926 Bacteria 37104
1432 Ga0496123_0033846 3300048926 Bacteria 3670
1433 Ga0496123_0109376 3300048926 Bacteria 1584
1434 Ga0496124_0038924 3300048927 Bacteria 4125
1435 Ga0496125_0006390 3300048928 Bacteria 12771
1436 Ga0496125_0016099 3300048928 Bacteria 7197
1437 Ga0496125_0039975 3300048928 Bacteria 4030
1438 Ga0496125_0064054 3300048928 Bacteria 2925
1439 Ga0496125_0208572 3300048928 Bacteria 1271
1440 Ga0496126_0015873 3300048929 Bacteria 7562
1441 Ga0496126_0032674 3300048929 Bacteria 4901
1442 Ga0496126_0038151 3300048929 Bacteria 4472
1443 Ga0496126_0042128 3300048929 Bacteria 4218
1444 Ga0496126_0042747 3300048929 Bacteria 4184
1445 Ga0496126_0050585 3300048929 Bacteria 3785
1446 Ga0496126_0072076 3300048929 Bacteria 3073
1447 Ga0496126_0072748 3300048929 Bacteria 3057
1448 Ga0496126_0228588 3300048929 Bacteria 1559
1449 Ga0496126_0266403 3300048929 Bacteria 1423
1450 Ga0496126_0297037 3300048929 Bacteria 1334
1451 Ga0501032_0006146 3300049569 Bacteria 8839
1452 Ga0501032_0011555 3300049569 Bacteria 6336
1453 Ga0501032_0041414 3300049569 Bacteria 3128
1454 Ga0501032_0042184 3300049569 Bacteria 3095
1455 Ga0501032_0181234 3300049569 Bacteria 1379
1456 Ga0501033_0008505 3300049570 Bacteria 7943
1457 Ga0501033_0027308 3300049570 Bacteria 4291
1458 Ga0501033_0052754 3300049570 Bacteria 3014
1459 Ga0501033_0062434 3300049570 Bacteria 2743
1460 Ga0501033_0138088 3300049570 Bacteria 1763
1461 Ga0501034_0000374 3300049571 Bacteria 76280
1462 Ga0501034_0001727 3300049571 Bacteria 28118
1463 Ga0501034_0009449 3300049571 Bacteria 10204
1464 Ga0501034_0011524 3300049571 Bacteria 9161
1465 Ga0501034_0015758 3300049571 Bacteria 7762
1466 Ga0501034_0060482 3300049571 Bacteria 3804
1467 Ga0501034_0064804 3300049571 Bacteria 3667
1468 Ga0501034_0084794 3300049571 Bacteria 3169
1469 Ga0501034_0088636 3300049571 Bacteria 3092
1470 Ga0501034_0102221 3300049571 Bacteria 2859
1471 Ga0501034_0116629 3300049571 Bacteria 2658
1472 Ga0501034_0198434 3300049571 Bacteria 1965
1473 Ga0501034_0252815 3300049571 Bacteria 1706
1474 Ga0501034_0274474 3300049571 Bacteria 1626
1475 Ga0501036_0000123 3300049572 Bacteria 48776
1476 Ga0501036_0018169 3300049572 Bacteria 5889
1477 Ga0501036_0030032 3300049572 Bacteria 4592
1478 Ga0501036_0130862 3300049572 Bacteria 2119
1479 Ga0501036_0167670 3300049572 Bacteria 1850
1480 Ga0501036_0404633 3300049572 Bacteria 1138
1481 Ga0501037_0019490 3300049573 Bacteria 5004
1482 Ga0501037_0055241 3300049573 Bacteria 2903
1483 Ga0501037_0074458 3300049573 Bacteria 2467
1484 Ga0501037_0169336 3300049573 Bacteria 1553
1485 Ga0501037_0185034 3300049573 Bacteria 1477
1486 Ga0501037_0263644 3300049573 Bacteria 1203
1487 Ga0501038_0004971 3300049574 Bacteria 12354
1488 Ga0501038_0023342 3300049574 Bacteria 5531
1489 Ga0501038_0034764 3300049574 Bacteria 4428
1490 Ga0501038_0054112 3300049574 Bacteria 3452
1491 Ga0501038_0101697 3300049574 Bacteria 2392
1492 Ga0501038_0116515 3300049574 Bacteria 2208
1493 Ga0501039_0027874 3300049575 Bacteria 4344
1494 Ga0501039_0051218 3300049575 Bacteria 3195
1495 Ga0501039_0125510 3300049575 Bacteria 2013
1496 Ga0501039_0256922 3300049575 Bacteria 1373
1497 Ga0501039_0308719 3300049575 Bacteria 1243
1498 Ga0501039_0353512 3300049575 Bacteria 1154
1499 Ga0501040_0154134 3300049576 Bacteria 1622
1500 Ga0501043_0016075 3300049579 Bacteria 5869
1501 Ga0501043_0027703 3300049579 Bacteria 4448
1502 Ga0501043_0139039 3300049579 Bacteria 1902
1503 Ga0501043_0181334 3300049579 Bacteria 1640
1504 Ga0501043_0182719 3300049579 Bacteria 1634
1505 Ga0501043_0188076 3300049579 Bacteria 1607
1506 Ga0501046_0028653 3300049580 Bacteria 4534
1507 Ga0501046_0060697 3300049580 Bacteria 2958
1508 Ga0501046_0125307 3300049580 Bacteria 1952
1509 Ga0501046_0168359 3300049580 Bacteria 1645
1510 Ga0501047_0000234 3300049581 Bacteria 65759
1511 Ga0501047_0014755 3300049581 Bacteria 7434
1512 Ga0501047_0020561 3300049581 Bacteria 6338
1513 Ga0501047_0024694 3300049581 Bacteria 5771
1514 Ga0501047_0059180 3300049581 Bacteria 3699
1515 Ga0501047_0069949 3300049581 Bacteria 3379
1516 Ga0501047_0107349 3300049581 Bacteria 2673
1517 Ga0501047_0322777 3300049581 Bacteria 1383
1518 Ga0501047_0399451 3300049581 Bacteria 1207
1519 Ga0501048_0000051 3300049582 Bacteria 57320
1520 Ga0501067_0014452 3300049583 Bacteria 4371
1521 Ga0501067_0017895 3300049583 Bacteria 3923
1522 Ga0501067_0035608 3300049583 Bacteria 2764
1523 Ga0501068_0055285 3300049584 Bacteria 2405
1524 Ga0501068_0057599 3300049584 Bacteria 2356
1525 Ga0501068_0166882 3300049584 Bacteria 1389
1526 Ga0501068_0167124 3300049584 Bacteria 1387
1527 Ga0501069_0077136 3300049585 Bacteria 1874
1528 Ga0501069_0102353 3300049585 Bacteria 1626
1529 Ga0501070_0000886 3300049586 Bacteria 27179
1530 Ga0501070_0003306 3300049586 Bacteria 13999
1531 Ga0501070_0014454 3300049586 Bacteria 6643
1532 Ga0501070_0019784 3300049586 Bacteria 5646
1533 Ga0501070_0035784 3300049586 Bacteria 4146
1534 Ga0501070_0039056 3300049586 Bacteria 3961
1535 Ga0501070_0049732 3300049586 Bacteria 3481
1536 Ga0501070_0057621 3300049586 Bacteria 3221
1537 Ga0501070_0075239 3300049586 Bacteria 2795
1538 Ga0501070_0141871 3300049586 Bacteria 1983
1539 Ga0501070_0227283 3300049586 Bacteria 1529
1540 Ga0501071_0044011 3300049587 Bacteria 3202
1541 Ga0501071_0047958 3300049587 Bacteria 3070
1542 Ga0501071_0176720 3300049587 Bacteria 1599
1543 Ga0501072_0064463 3300049588 Bacteria 2889
1544 Ga0501072_0073920 3300049588 Bacteria 2695
1545 Ga0501072_0088730 3300049588 Bacteria 2454
1546 Ga0501072_0229559 3300049588 Bacteria 1479
1547 Ga0501073_0005359 3300049589 Bacteria 9616
1548 Ga0501073_0012550 3300049589 Bacteria 6184
1549 Ga0501073_0029845 3300049589 Bacteria 3896
1550 Ga0501073_0039990 3300049589 Bacteria 3321
1551 Ga0501073_0056536 3300049589 Bacteria 2744
1552 Ga0501073_0068530 3300049589 Bacteria 2472
1553 Ga0501073_0071925 3300049589 Bacteria 2409
1554 Ga0501074_0061808 3300049590 Bacteria 2698
1555 Ga0501074_0062480 3300049590 Bacteria 2682
1556 Ga0501074_0083248 3300049590 Bacteria 2293
1557 Ga0501074_0083519 3300049590 Bacteria 2290
1558 Ga0501074_0090261 3300049590 Bacteria 2194
1559 Ga0501074_0098863 3300049590 Bacteria 2089
1560 Ga0501074_0108317 3300049590 Bacteria 1988
1561 Ga0501075_0052437 3300049591 Bacteria 3067
1562 Ga0501076_0004635 3300049592 Bacteria 9795
1563 Ga0501076_0244478 3300049592 Bacteria 1468
1564 Ga0501077_0004508 3300049593 Bacteria 8465
1565 Ga0501077_0056520 3300049593 Bacteria 2491
1566 Ga0501079_0024017 3300049741 Bacteria 4676
1567 Ga0501079_0125840 3300049741 Bacteria 1994
1568 Ga0501079_0179179 3300049741 Bacteria 1653
1569 Ga0501080_0000528 3300049742 Bacteria 30043
1570 Ga0501080_0011183 3300049742 Bacteria 8214
1571 Ga0501080_0015520 3300049742 Bacteria 7024
1572 Ga0501080_0087545 3300049742 Bacteria 2893
1573 Ga0501080_0100490 3300049742 Bacteria 2683
1574 Ga0501080_0174595 3300049742 Bacteria 1980
1575 Ga0501080_0218127 3300049742 Bacteria 1746
1576 Ga0501080_0291167 3300049742 Bacteria 1482
1577 Ga0501080_0327262 3300049742 Bacteria 1386
1578 Ga0501081_0000718 3300049743 Bacteria 19248
1579 Ga0501083_0008673 3300049744 Bacteria 7171
1580 Ga0501083_0035017 3300049744 Bacteria 3431
1581 Ga0501083_0082630 3300049744 Bacteria 2128
1582 Ga0501083_0112684 3300049744 Bacteria 1787
1583 Ga0501083_0189704 3300049744 Bacteria 1341
1584 Ga0501035_0000366 3300049822 Bacteria 52132
1585 Ga0501035_0019199 3300049822 Bacteria 6294
1586 Ga0501035_0028768 3300049822 Bacteria 5071
1587 Ga0501035_0062570 3300049822 Bacteria 3311
1588 Ga0501035_0072916 3300049822 Bacteria 3038
1589 Ga0501035_0120311 3300049822 Bacteria 2296
1590 Ga0501035_0129680 3300049822 Bacteria 2199
1591 Ga0501035_0141264 3300049822 Bacteria 2093
1592 Ga0501035_0283915 3300049822 Bacteria 1398
1593 Ga0501035_0315516 3300049822 Bacteria 1314
1594 Ga0501044_0000122 3300049823 Bacteria 93246
1595 Ga0501044_0001683 3300049823 Bacteria 25978
1596 Ga0501044_0024050 3300049823 Bacteria 6472
1597 Ga0501044_0027004 3300049823 Bacteria 6073
1598 Ga0501044_0032759 3300049823 Bacteria 5462
1599 Ga0501044_0042684 3300049823 Bacteria 4715
1600 Ga0501044_0047844 3300049823 Bacteria 4422
1601 Ga0501044_0052709 3300049823 Bacteria 4190
1602 Ga0501044_0056059 3300049823 Bacteria 4046
1603 Ga0501044_0077803 3300049823 Bacteria 3363
1604 Ga0501044_0118929 3300049823 Bacteria 2644
1605 Ga0501044_0198312 3300049823 Bacteria 1966
1606 Ga0501044_0221720 3300049823 Bacteria 1841
1607 Ga0501044_0390894 3300049823 Bacteria 1305
1608 Ga0501045_0142865 3300049824 Bacteria 1780
1609 nmdc:mga03683_12219_c1 3300050489 Bacteria 3131
1610 nmdc:mga03n38_2270_c1 3300050490 Bacteria 5886
1611 nmdc:mga03n38_85112_c1 3300050490 Bacteria 1494
1612 nmdc:mga03n38_97343_c1 3300050490 Bacteria 1413
1613 nmdc:mga00v17_126688_c1 3300050491 Bacteria 1629
1614 nmdc:mga00v17_13149_c2 3300050491 Bacteria 3469
1615 nmdc:mga00v17_48336_c1 3300050491 Bacteria 2578
1616 nmdc:mga0yw44_19588_c2 3300050492 Bacteria 2125
1617 nmdc:mga0yw44_21048_c1 3300050492 Bacteria 3632
1618 nmdc:mga0yw44_52774_c1 3300050492 Bacteria 2466
1619 nmdc:mga0yw44_7314_c1 3300050492 Bacteria 5421
1620 nmdc:mga0yw44_94778_c1 3300050492 Bacteria 1892
1621 nmdc:mga0yw44_98163_c1 3300050492 Bacteria 1862
1622 nmdc:mga0k408_11019_c1 3300050493 Bacteria 4909
1623 nmdc:mga0k408_172928_c1 3300050493 Bacteria 1288
1624 nmdc:mga0k408_24659_c1 3300050493 Bacteria 3401
1625 nmdc:mga06z11_21831_c1 3300050494 Bacteria 2980
1626 nmdc:mga06z11_6887_c1 3300050494 Bacteria 4650
1627 nmdc:mga06z11_7520_c1 3300050494 Bacteria 4222
1628 nmdc:mga06z11_88854_c1 3300050494 Bacteria 1674
1629 nmdc:mga07m45_175977_c1 3300050496 Bacteria 1244
1630 nmdc:mga07m45_3560_c1 3300050496 Bacteria 7524
1631 nmdc:mga07m45_83115_c1 3300050496 Bacteria 1829
1632 nmdc:mga05p37_290_c1 3300050507 Bacteria 52425
1633 nmdc:mga05p37_357878_c1 3300050507 Bacteria 1717
1634 nmdc:mga05p37_46125_c1 3300050507 Bacteria 5359
1635 nmdc:mga05p37_58061_c1 3300050507 Bacteria 4766
1636 nmdc:mga09592_154530_c1 3300050508 Bacteria 1980
1637 nmdc:mga09592_2994_c1 3300050508 Bacteria 13696
1638 nmdc:mga0qj67_16217_c1 3300050509 Bacteria 5646
1639 nmdc:mga0qj67_2739_c1 3300050509 Bacteria 12638
1640 nmdc:mga0qj67_412_c1 3300050509 Bacteria 29289
1641 nmdc:mga06r32_2029_c1 3300050510 Bacteria 18097
1642 nmdc:mga06r32_475583_c1 3300050510 Bacteria 1228
1643 nmdc:mga08y16_126862_c1 3300050511 Bacteria 2654
1644 nmdc:mga08y16_1898_c1 3300050511 Bacteria 21299
1645 nmdc:mga08y16_2825_c1 3300050511 Bacteria 17843
1646 nmdc:mga08y16_844_c1 3300050511 Bacteria 29426
1647 nmdc:mga0n895_1061_c1 3300050512 Bacteria 20040
1648 nmdc:mga0n895_113418_c1 3300050512 Bacteria 2728
1649 nmdc:mga0n895_134613_c1 3300050512 Bacteria 2497
1650 nmdc:mga0n895_20783_c1 3300050512 Bacteria 6130
1651 nmdc:mga0n895_22046_c1 3300050512 Bacteria 5968
1652 nmdc:mga0n895_22082_c1 3300050512 Bacteria 5964
1653 nmdc:mga0n895_62410_c1 3300050512 Bacteria 3683
1654 nmdc:mga0rr50_276383_c1 3300050513 Bacteria 1401
1655 nmdc:mga0rr50_3611_c1 3300050513 Bacteria 8942
1656 nmdc:mga0rr50_6009_c1 3300050513 Bacteria 7328
1657 nmdc:mga08x19_80718_c1 3300050514 Bacteria 2135
1658 nmdc:mga0a205_3382_c1 3300050515 Bacteria 14218
1659 nmdc:mga0a205_8902_c1 3300050515 Bacteria 9148
1660 nmdc:mga0a205_9541_c1 3300050515 Bacteria 8880
1661 nmdc:mga0sz30_12054_c1 3300050516 Bacteria 3355
1662 nmdc:mga0sz30_18686_c1 3300050516 Bacteria 1905
1663 nmdc:mga0sz30_39804_c1 3300050516 Bacteria 1974
1664 Ga0495601_0001939 3300053077 Bacteria 11573
1665 Ga0495601_0002428 3300053077 Bacteria 10581
1666 Ga0495601_0004177 3300053077 Bacteria 8330
1667 Ga0495601_0074964 3300053077 Bacteria 2165
1668 Ga0495601_0150692 3300053077 Bacteria 1518
1669 Ga0495601_0229984 3300053077 Bacteria 1211
1670 Ga0495612_0003279 3300053078 Bacteria 6711
1671 Ga0495612_0003991 3300053078 Bacteria 6117
1672 Ga0495612_0008348 3300053078 Bacteria 4202
1673 Ga0495612_0014886 3300053078 Bacteria 3121
1674 Ga0495612_0027096 3300053078 Bacteria 2304
1675 Ga0495655_0005062 3300053083 Bacteria 2301
1676 Ga0495595_0000430 3300053084 Bacteria 15913
1677 Ga0495595_0002807 3300053084 Bacteria 6852
1678 Ga0495595_0003742 3300053084 Bacteria 6050
1679 Ga0495595_0011462 3300053084 Bacteria 3707
1680 Ga0495595_0011494 3300053084 Bacteria 3702
1681 Ga0495595_0028290 3300053084 Bacteria 2503
1682 Ga0495595_0028986 3300053084 Bacteria 2474
1683 Ga0495595_0029997 3300053084 Bacteria 2437
1684 Ga0495619_0000259 3300053085 Bacteria 38593
1685 Ga0495619_0000719 3300053085 Bacteria 21645
1686 Ga0495619_0006574 3300053085 Bacteria 7353
1687 Ga0495619_0007799 3300053085 Bacteria 6775
1688 Ga0495619_0007804 3300053085 Bacteria 6773
1689 Ga0495619_0009420 3300053085 Bacteria 6160
1690 Ga0495619_0022954 3300053085 Bacteria 3994
1691 Ga0495619_0047265 3300053085 Bacteria 2833
1692 Ga0495619_0048438 3300053085 Bacteria 2800
1693 Ga0495619_0073760 3300053085 Bacteria 2287
1694 Ga0500643_000076 3300053087 Bacteria 106911
1695 Ga0500643_002781 3300053087 Bacteria 8748
1696 Ga0500646_0011073 3300053090 Bacteria 2317
1697 Ga0500583_0014448 3300053092 Bacteria 3092
1698 Ga0500651_0011112 3300053093 Bacteria 5419
1699 Ga0500651_0152144 3300053093 Bacteria 1389
1700 Ga0500566_0000314 3300053094 Bacteria 26180
1701 Ga0500566_0002194 3300053094 Bacteria 11509
1702 Ga0500566_0085944 3300053094 Bacteria 1744
1703 Ga0500641_0018283 3300053096 Bacteria 2634
1704 Ga0500641_0019444 3300053096 Bacteria 2568
1705 Ga0500641_0038156 3300053096 Bacteria 1929
1706 Ga0500641_0042427 3300053096 Bacteria 1843
1707 Ga0500554_000886 3300053102 Bacteria 5866
1708 Ga0500555_020392 3300053103 Bacteria 1909
1709 Ga0500556_0000006 3300053104 Bacteria 453982
1710 Ga0500556_0000601 3300053104 Bacteria 23232
1711 Ga0500557_000059 3300053105 Bacteria 45905
1712 Ga0500562_005330 3300053108 Bacteria 3229
1713 Ga0500595_000001 3300053119 Bacteria 1088438
1714 Ga0500595_000506 3300053119 Bacteria 23559
1715 Ga0500595_001968 3300053119 Bacteria 10552
1716 Ga0500595_008320 3300053119 Bacteria 4245
1717 Ga0500642_0000004 3300053130 Bacteria 433122
1718 Ga0500642_0000226 3300053130 Bacteria 22146
1719 Ga0500642_0011908 3300053130 Bacteria 3133
1720 Ga0500642_0084177 3300053130 Bacteria 1464
1721 Ga0500652_000033 3300053131 Bacteria 80332
1722 Ga0500652_009006 3300053131 Bacteria 3355
1723 Ga0500655_016310 3300053133 Bacteria 1368
1724 Ga0500658_0028460 3300053134 Bacteria 2168
1725 Ga0500559_0003127 3300053136 Bacteria 8230
1726 Ga0500559_0031663 3300053136 Bacteria 2269
1727 Ga0500568_0002010 3300053139 Bacteria 12384
1728 Ga0500568_0026877 3300053139 Bacteria 2411
1729 Ga0500568_0053198 3300053139 Bacteria 1588
1730 Ga0500577_0009852 3300053142 Bacteria 2789
1731 Ga0500590_047066 3300053148 Bacteria 2203
1732 Ga0500590_141494 3300053148 Bacteria 1099
1733 Ga0500604_0007979 3300053151 Bacteria 2808
1734 Ga0500616_0000001 3300053153 Bacteria 1986011
1735 Ga0500616_0000022 3300053153 Bacteria 460463
1736 Ga0500616_0009597 3300053153 Bacteria 5872
1737 Ga0500616_0046260 3300053153 Bacteria 2314
1738 Ga0500616_0060370 3300053153 Bacteria 1966
1739 Ga0500619_049698 3300053154 Bacteria 1354
1740 Ga0500622_0001425 3300053156 Bacteria 19200
1741 Ga0500638_020622 3300053162 Bacteria 3105
1742 Ga0500638_072191 3300053162 Bacteria 1649
1743 Ga0500636_0000309 3300053177 Bacteria 26814
1744 Ga0500636_0017136 3300053177 Bacteria 4273
1745 Ga0500636_0024605 3300053177 Bacteria 3561
1746 Ga0500637_0000542 3300053178 Bacteria 14772
1747 Ga0500637_0053050 3300053178 Bacteria 2314
1748 Ga0500567_027363 3300053723 Bacteria 2713
1749 Ga0500625_009898 3300053729 Bacteria 4269
1750 Ga0500645_000189 3300053730 Bacteria 47865
1751 Ga0500645_003077 3300053730 Bacteria 6994
1752 Ga0500645_024562 3300053730 Bacteria 1842
1753 Ga0500609_001592 3300053731 Bacteria 3312
1754 Ga0500599_004040 3300053736 Bacteria 1804
1755 Ga0500601_000066 3300053737 Bacteria 21867
1756 Ga0501084_0021239 3300054114 Bacteria 5413
1757 Ga0501084_0050807 3300054114 Bacteria 3469
1758 Ga0501084_0064310 3300054114 Bacteria 3070
1759 Ga0501084_0114426 3300054114 Bacteria 2268
1760 Ga0501084_0162878 3300054114 Bacteria 1882
1761 Ga0501084_0170223 3300054114 Bacteria 1839
1762 Ga0500661_000578 3300055283 Bacteria 6841
1763 Ga0500661_013556 3300055283 Bacteria 1469
1764 Ga0501082_0027087 3300060353 Bacteria 4939
1765 Ga0501082_0034241 3300060353 Bacteria 4380
1766 Ga0501082_0046452 3300060353 Bacteria 3743
1767 Ga0501082_0055319 3300060353 Bacteria 3419
1768 Ga0501082_0059259 3300060353 Bacteria 3300
1769 Ga0501082_0086528 3300060353 Bacteria 2703
1770 Ga0501082_0105184 3300060353 Bacteria 2442
1771 Ga0501082_0308790 3300060353 Bacteria 1377
1772 Ga0501082_0372016 3300060353 Bacteria 1246
1773 Ga0530510_0048974 3300061734 Bacteria 3054
1774 2917554979 2917554339 Bacteria 4987857
1775 2507505334 2507262055 Bacteria 8048963
1776 2508539223 2508501009 Bacteria 7784016
1777 2508695544 2508501042 Bacteria 8719808
1778 2511401171 2511231028 Bacteria 8046582
1779 2513591209 2513237087 Bacteria 5817514
1780 2513625402 2513237092 Bacteria 8341956
1781 2513642080 2513237094 Bacteria 8789602
1782 2513651454 2513237095 Bacteria 8976980
1783 2513675077 2513237098 Bacteria 9902361
1784 2513695163 2513237101 Bacteria 7952346
1785 2513699919 2513237102 Bacteria 7703324
1786 2513718120 2513237104 Bacteria 10034502
1787 2513873469 2513237139 Bacteria 8737671
1788 2513888834 2513237141 Bacteria 8496279
1789 2514012547 2513237161 Bacteria 8871253
1790 2515627502 2515154112 Bacteria 8294334
1791 2517107168 2517093001 Bacteria 9002274
1792 2524440827 2524023205 Bacteria 8918781
1793 2524469524 2524023210 Bacteria 9029266
1794 2528854047 2528768022 Bacteria 10457665
1795 2603858579 2602042107 Bacteria 6226103
1796 2617352455 2617270735 Bacteria 9163226
1797 2617373819 2617270741 Bacteria 8201522
1798 2643758153 2643221547 Bacteria 4740017
1799 2644290986 2643221651 Bacteria 4798932
1800 2723841691 2721755755 Bacteria 8322773
1801 2745081753 2744054633 Bacteria 8678936
1802 2793062109 2791355196 Bacteria 7323613
1803 2793073615 2791355197 Bacteria 8420563
1804 2793080874
1805 2805915551 2802429603 Bacteria 8777136
1806 2818237712 2816332527 Bacteria 8933356
1807 2824604522 2824600985 Bacteria 8488197
1808 2824616682 2824609381 Bacteria 8672835
1809 2824631657 2824626560 Bacteria 8813858
1810 2824671217 2824661429 Bacteria 9877870
1811 2824695939 2824687955 Bacteria 8360029
1812 2824732503 2824723954 Bacteria 8758240
1813 2824748638 2824746037 Bacteria 7911610
1814 2824763571 2824753945 Bacteria 9787441
1815 2824772698 2824763712 Bacteria 9792355
1816 2824779831 2824773399 Bacteria 8360218
1817 2828309374 2828305725 Bacteria 4916900
1818 2841945264 2841941048 Bacteria 8688029
1819 2841952045 2841949485 Bacteria 8680857
1820 2841965562 2841957949 Bacteria 8652217
1821 2841970561 2841966195 Bacteria 8673214
1822 2841981810 2841974524 Bacteria 8931498
1823 2841985088 2841983080 Bacteria 8395090
1824 2842043445 2842038055 Bacteria 8002051
1825 2842052565 2842045827 Bacteria 8006841
1826 2844315400 2844315083 Bacteria 8138177
1827 2847931136 2847930680 Bacteria 9342022
1828 2847942217 2847939898 Bacteria 8606328
1829 2849083090 2849076700 Bacteria 7039503
1830 2857511988 2857509624 Bacteria 7472071
1831 2857526297 2857524615 Bacteria 6615449
1832 2874594506 2874590934 Bacteria 8299676
1833 2874624852 2874620515 Bacteria 8290088
1834 2874628725 2874628541 Bacteria 8630250
1835 2874649878 2874645413 Bacteria 8214782
1836 2876770964 2876761206 Bacteria 10111113
1837 2876773998 2876771140 Bacteria 8287509
1838 2876809950 2876808645 Bacteria 8824342
1839 2876821878 2876818435 Bacteria 8274608
1840 2879078278 2879074833 Bacteria 8279565
1841 2879085971 2879083081 Bacteria 8587928
1842 2879105962 2879099564 Bacteria 10442239
1843 2879112226 2879110137 Bacteria 8907982
1844 2879130538 2879127579 Bacteria 8294491
1845 2879147186 2879142872 Bacteria 8267021
1846 2881365261 2881364244 Bacteria 7710352
1847 2881668125 2881665667 Bacteria 8175609
1848 2885370965 2885366525 Bacteria 8326213
1849 2885392677 2885383462 Bacteria 9473874
1850 2885415729 2885409591 Bacteria 9235467
1851 2888379524 2888378607 Bacteria 9652610
1852 2888390623 2888388044 Bacteria 7304136
1853 2888420244 2888419890 Bacteria 7857137
1854 2889793289 2889790730 Bacteria 5689708
1855 2893067431 2893066018 Bacteria 6158120
1856 2903732260 2903727486 Bacteria 8281579
1857 2903754693 2903748898 Bacteria 9972761
1858 2903777734 2903768456 Bacteria 9749579
1859 2904670193 2904666416 Bacteria 8226587
1860 2904691132 2904690495 Bacteria 9412302
1861 2904713247 2904711408 Bacteria 9771557
1862 2906604338 2906602504 Bacteria 8295279
1863 2906613940
1864 2906628501 2906626472 Bacteria 8826946
1865 2906652108 2906643746 Bacteria 8722424
1866 2908756526 2908756301 Bacteria 8864324
1867 2908776336 2908775508 Bacteria 8092255
1868 2919073851 2919073203 Bacteria 6531949
1869 2919452221 2919450847 Bacteria 5631160
1870 2922363947 2922361189 Bacteria 7436256
1871 2922369515
1872 2922392526 2922386360 Bacteria 7017218
1873 2922394298 2922393267 Bacteria 8285685
1874 2929618663 2929615660 Bacteria 9193770
1875 2929628652 2929624759 Bacteria 9339455
1876 2932790841 2932784394 Bacteria 9704911
1877 2932794254 2932794094 Bacteria 7915132
1878 2932808152 2932801729 Bacteria 7987968
1879 2932812106 2932809354 Bacteria 9135765
1880 2932823096 2932818245 Bacteria 9955613
1881 2932833528 2932828146 Bacteria 9745859
1882 2933580626 2933577622 Bacteria 9116884
1883 2935615666 2935608549 Bacteria 8203142
1884 2935623084 2935616580 Bacteria 9032984
1885 2935644159 2935638405 Bacteria 10015038
1886 2935653556 2935648319 Bacteria 8801166
1887 2935662305 2935656913 Bacteria 8965014
1888 2935672259 2935665750 Bacteria 9571747
1889 2935679218 2935675223 Bacteria 9928132
1890 2935686462 2935684952 Bacteria 9590419
1891 2935700242 2935694250 Bacteria 9291695
1892 2935710191 2935703347 Bacteria 10242284
1893 2935716150 2935713505 Bacteria 9608509
1894 2935723726 2935722832 Bacteria 9608746
1895 2935735281 2935732158 Bacteria 9706831
1896 2935743928 2935741537 Bacteria 9707219
1897 2935752428 2935750917 Bacteria 9590372
1898 2935763476 2935760218 Bacteria 9817913
1899 2935772980 2935769743 Bacteria 7878163
1900 2935783231 2935777560 Bacteria 8077691
1901 2935788032 2935785616 Bacteria 7962367
1902 2935808183 2935801545 Bacteria 9301974
1903 2935816204 2935810662 Bacteria 9401221
1904 2935825535 2935819856 Bacteria 8261050
1905 2935833597 2935827899 Bacteria 10038562
1906 2935844550 2935837841 Bacteria 9454360
1907 2935853324 2935847175 Bacteria 8228321
1908 2935861332 2935855204 Bacteria 9035059
1909 2935869451 2935864058 Bacteria 9784707
1910 2935879780 2935873716 Bacteria 9632195
1911 2935890031 2935883170 Bacteria 7964738
1912 2935914797 2935908558 Bacteria 8568796
1913 2935918773 2935916978 Bacteria 9113783
1914 2935931510 2935926038 Bacteria 8601059
1915 2935940107 2935934488 Bacteria 8602579
1916 2935947546 2935942939 Bacteria 8599779
1917 2935956318 2935951376 Bacteria 8602333
1918 2935962699 2935959822 Bacteria 7869783
1919 2935973111 2935967501 Bacteria 8603075
1920 2935980644 2935975950 Bacteria 8347125
1921 2935985205 2935984226 Bacteria 8302647
1922 2935997997 2935992306 Bacteria 9802711
1923 2936008737 2936002035 Bacteria 9362176
1924 2936016607 2936011229 Bacteria 8801034
1925 2936025240 2936019824 Bacteria 8804134
1926 2936034082 2936028420 Bacteria 8965941
1927 2936041209 2936037263 Bacteria 9446081
1928 2936052139 2936046547 Bacteria 8903709
1929 2936056377 2936055302 Bacteria 8785755
1930 2940558341 2940556831 Bacteria 9590747
1931 2941535453 2941531003 Bacteria 7653939
1932 2941543265 2941538514 Bacteria 9402094
1933 3005489008 3005483717 Bacteria 7877331
1934 3005509102 3005506211 Bacteria 6943378
1935 3005591579 3005587118 Bacteria 7794411
1936 3005595118 3005594810 Bacteria 8716512
1937 3005711057 3005710791 Bacteria 7622528
1938 3005718365 3005718088 Bacteria 8283608
1939 8001845898 8001845381 Bacteria 5804942
1940 8006967510 8006964411 Bacteria 8966052
1941 8006990975 8006984368 Bacteria 9651211
1942 8007000310 8006994254 Bacteria 8309700
1943 8016518120 8016511872 Bacteria 9921665
1944 8016544130 8016539877 Bacteria 8155419
1945 8016549179 8016548790 Bacteria 8155074
1946 8016557604 8016557553 Bacteria 8154380
1947 8016569533 8016566248 Bacteria 8158151
1948 8016582143 8016575299 Bacteria 8154085
1949 8016586298 8016583857 Bacteria 10421953
1950 8016606492 8016603502 Bacteria 8731218
1951 8016618393 8016613128 Bacteria 8794220
1952 8016623040 8016622563 Bacteria 7999408
1953 8017058524 8017057580 Bacteria 10023680
1954 8019531103 8019530166 Bacteria 8155624
1955 8019540452 8019538911 Bacteria 7872763
1956 8019550043 8019547302 Bacteria 7996444
1957 8019577167 8019576017 Bacteria 10049540
1958 8019595241 8019586578 Bacteria 10212056
1959 8019612012 8019608314 Bacteria 10042931
1960 8019623034 8019619141 Bacteria 9218857
1961 8019630065 8019629233 Bacteria 8687553
1962 8019640544 8019638758 Bacteria 9062356
1963 8019652403 8019648815 Bacteria 10014479
1964 8019676661 8019668869 Bacteria 8791617
1965 8019679332 8019678201 Bacteria 8863603
1966 8019696177 8019687851 Bacteria 8712826
1967 8055742513 8055742211 Bacteria 9226248
1968 8056691016 8056689827 Bacteria 6712655
1969 8056971351 8056967851 Bacteria 9038162
1970 2214911852
1971 ARSoilYngRDRAFT_c00080
1972 ARcpr5yngRDRAFT_c000055
1973 ARCol0oldRDRAFT_c00230
1974 LJQas_1007647
1975 ARCol0yngRDRAFT_1000007
1976 JGI24032J14994_100153
1977 JGI24752J21851_1003516
1978 JGI24737J22298_10000509
1979 JGI24750J21931_1001269
1980 JGI24738J21930_10000120
1981 JGI24035J26624_1000291
1982 JGI24033J26618_1000558
1983 JGI24034J26672_10000187
1984 JGI24742J22300_10000029
1985 JGI25406J46586_10006206
1986 JGI25406J46586_10011555
1987 JGI25153J46596_10001726
1988 JGI25153J46596_10001794
1989 JGI25153J46596_10007254
1990 JGI25153J46596_10009299
1991 JGI25160J50197_1000637
1992 JGI25160J50197_1002896
1993 Ga0055531_10003548
1994 Ga0065165_1001452
1995 Ga0065165_1006072
1996 Ga0065165_1015074
1997 Ga0065165_1017160
1998 Ga0065704_10096592
1999 Ga0065712_10000690
2000 Ga0065712_10001626
2001 Ga0065715_10001262
2002 Ga0065715_10008806
2003 Ga0070658_10015046
2004 Ga0070658_10019709
2005 Ga0070658_10034887
2006 Ga0070676_10003502
2007 Ga0070676_10074001
2008 Ga0070676_10102198
2009 Ga0070683_100000116
2010 Ga0070683_100031209
2011 Ga0070683_100113145
2012 Ga0070683_100138935
2013 Ga0070690_100005618
2014 Ga0070690_100014607
2015 Ga0070690_100210064
2016 Ga0070670_100006964
2017 Ga0070670_100017200
2018 Ga0070670_100125130
2019 Ga0070670_100163497
2020 Ga0070670_100184120
2021 Ga0070670_100185074
2022 Ga0070677_10000097
2023 Ga0068869_100002566
2024 Ga0068869_100129609
2025 Ga0068869_100146062
2026 Ga0068869_100188240
2027 Ga0070666_10003937
2028 Ga0070666_10050475
2029 Ga0070666_10183415
2030 Ga0070680_100013619
2031 Ga0070680_100022146
2032 Ga0070680_100041923
2033 Ga0070680_100047006
2034 Ga0070680_100066975
2035 Ga0070680_100151413
2036 Ga0070680_100218103
2037 Ga0070682_100001635
2038 Ga0068868_100028104
2039 Ga0068868_100035020
2040 Ga0068868_100064549
2041 Ga0070660_100009547
2042 Ga0070660_100021366
2043 Ga0070660_100031050
2044 Ga0070660_100247606
2045 Ga0070689_100000461
2046 Ga0070691_10000048
2047 Ga0070687_100002383
2048 Ga0070687_100091231
2049 Ga0070661_100000228
2050 Ga0070661_100059239
2051 Ga0070692_10000050
2052 Ga0070668_100010524
2053 Ga0070668_100022397
2054 Ga0070668_100108131
2055 Ga0070668_100110742
2056 Ga0070669_100031291
2057 Ga0070669_100047132
2058 Ga0070669_100065519
2059 Ga0070669_100091246
2060 Ga0070669_100251401
2061 Ga0070675_100000503
2062 Ga0070675_100104609
2063 Ga0070671_100000720
2064 Ga0070671_100056367
2065 Ga0070671_100124906
2066 Ga0070671_100170681
2067 Ga0070674_100000570
2068 Ga0070674_100093821
2069 Ga0070673_100000045
2070 Ga0070673_100003240
2071 Ga0070688_100000308
2072 Ga0070688_100039274
2073 Ga0070688_100086423
2074 Ga0070688_100102450
2075 Ga0070688_100231664
2076 Ga0070659_100000183
2077 Ga0070659_100009946
2078 Ga0070659_100047796
2079 Ga0070659_100059804
2080 Ga0070659_100110299
2081 Ga0070667_100003874
2082 Ga0070667_100055839
2083 Ga0070667_100068432
2084 Ga0070709_10003045
2085 Ga0070709_10074808
2086 Ga0070709_10076543
2087 Ga0070709_10126515
2088 Ga0070709_10207040
2089 Ga0070714_100006355
2090 Ga0070714_100020893
2091 Ga0070714_100021163
2092 Ga0070714_100032110
2093 Ga0070714_100056532
2094 Ga0070714_100062909
2095 Ga0070714_100271604
2096 Ga0070713_100007601
2097 Ga0070713_100009557
2098 Ga0070713_100016407
2099 Ga0070713_100074482
2100 Ga0070713_100218875
2101 Ga0070713_100261749
2102 Ga0070710_10002948
2103 Ga0070710_10005418
2104 Ga0070710_10006006
2105 Ga0070710_10033282
2106 Ga0070710_10039227
2107 Ga0070701_10002546
2108 Ga0070701_10020704
2109 Ga0070701_10123381
2110 Ga0070711_100000599
2111 Ga0070711_100014115
2112 Ga0070711_100016274
2113 Ga0070711_100017625
2114 Ga0070711_100022586
2115 Ga0070711_100049014
2116 Ga0070711_100217366
2117 Ga0070705_100001770
2118 Ga0070700_100000239
2119 Ga0070694_100003730
2120 Ga0070694_100164114
2121 Ga0070708_100182315
2122 Ga0070663_100000328
2123 Ga0070663_100000390
2124 Ga0070663_100024158
2125 Ga0070663_100073835
2126 Ga0070663_100137505
2127 Ga0070663_100188839
2128 Ga0070678_100000576
2129 Ga0070678_100043325
2130 Ga0070678_100086322
2131 Ga0070681_10000933
2132 Ga0070681_10015684
2133 Ga0070681_10036877
2134 Ga0070681_10078407
2135 Ga0070681_10102279
2136 Ga0068867_100147962
2137 Ga0070685_10003069
2138 Ga0070685_10013737
2139 Ga0070685_10019816
2140 Ga0070685_10125147
2141 Ga0070685_10142471
2142 Ga0070685_10257511
2143 Ga0070707_100047831
2144 Ga0070707_100314659
2145 Ga0070698_100039216
2146 Ga0070699_100004245
2147 Ga0070679_100005744
2148 Ga0070679_100016653
2149 Ga0070679_100058275
2150 Ga0070679_100073903
2151 Ga0070679_100113836
2152 Ga0070679_100135947
2153 Ga0070679_100191906
2154 Ga0070679_100390868
2155 Ga0070684_100000352
2156 Ga0070684_100006584
2157 Ga0070684_100020670
2158 Ga0070684_100038063
2159 Ga0070684_100145709
2160 Ga0068853_100000902
2161 Ga0068853_100026207
2162 Ga0068853_100087721
2163 Ga0068853_100164786
2164 Ga0068853_100285634
2165 Ga0070672_100000016
2166 Ga0070686_100005714
2167 Ga0070686_100017851
2168 Ga0070686_100121576
2169 Ga0070695_100001458
2170 Ga0070695_100004098
2171 Ga0070696_100006179
2172 Ga0070696_100202216
2173 Ga0070693_100037529
2174 Ga0070665_100014898
2175 Ga0070665_100024748
2176 Ga0070665_100025556
2177 Ga0070665_100070182
2178 Ga0070665_100072923
2179 Ga0070665_100095421
2180 Ga0070665_100098599
2181 Ga0070665_100099991
2182 Ga0070665_100145785
2183 Ga0070704_100004902
2184 Ga0070704_100014046
2185 Ga0068855_100003504
2186 Ga0068855_100019804
2187 Ga0068855_100020035
2188 Ga0068855_100071356
2189 Ga0068855_100076667
2190 Ga0068855_100123814
2191 Ga0068855_100232988
2192 Ga0068855_100271037
2193 Ga0070664_100000067
2194 Ga0070664_100179259
2195 Ga0070664_100248730
2196 Ga0068857_100003331
2197 Ga0068857_100022002
2198 Ga0068854_100062790
2199 Ga0068854_100098345
2200 Ga0068854_100118938
2201 Ga0068856_100002341
2202 Ga0068856_100042629
2203 Ga0068856_100053053
2204 Ga0068856_100070685
2205 Ga0070702_100001107
2206 Ga0068852_100014075
2207 Ga0068852_100015623
2208 Ga0068852_100091383
2209 Ga0068852_100193773
2210 Ga0068852_100214060
2211 Ga0068859_100077162
2212 Ga0068859_100295653
2213 Ga0068864_100000234
2214 Ga0068864_100059635
2215 Ga0068864_100158116
2216 Ga0068866_10016142
2217 Ga0068861_100000241
2218 Ga0068861_100015670
2219 Ga0068861_100137862
2220 Ga0068861_100139783
2221 Ga0068851_10013343
2222 Ga0068851_10069059
2223 Ga0068851_10145527
2224 Ga0068870_10000009
2225 Ga0068870_10055073
2226 Ga0068863_100003248
2227 Ga0068863_100098163
2228 Ga0068863_100175337
2229 Ga0068863_100191047
2230 Ga0068858_100001548
2231 Ga0068860_100000508
2232 Ga0068860_100001050
2233 Ga0068860_100034650
2234 Ga0068860_100107472
2235 Ga0068860_100156416
2236 Ga0068862_100001143
2237 Ga0068862_100200451
2238 Ga0081455_10000002
2239 Ga0081455_10004068
2240 Ga0081455_10008760
2241 Ga0081455_10021942
2242 Ga0081455_10022833
2243 Ga0081455_10125580
2244 Ga0081455_10204121
2245 Ga0081540_1002394
2246 Ga0081540_1003646
2247 Ga0081540_1004307
2248 Ga0081540_1005999
2249 Ga0081540_1008954
2250 Ga0081540_1009843
2251 Ga0081540_1012693
2252 Ga0081540_1015357
2253 Ga0081540_1016330
2254 Ga0081540_1044846
2255 Ga0081539_10000265
2256 Ga0081539_10000966
2257 Ga0081539_10015864
2258 Ga0081539_10049888
2259 Ga0070717_10029553
2260 Ga0070717_10044938
2261 Ga0070717_10167557
2262 Ga0075365_10013341
2263 Ga0075365_10049882
2264 Ga0075365_10051135
2265 Ga0075368_10014896
2266 Ga0075363_100001175
2267 Ga0075363_100021411
2268 Ga0075363_100048774
2269 Ga0075363_100086490
2270 Ga0075364_10021970
2271 Ga0075364_10037508
2272 Ga0075364_10067636
2273 Ga0075364_10087356
2274 Ga0075432_10001464
2275 Ga0070715_10027530
2276 Ga0070716_100003613
2277 Ga0070716_100003799
2278 Ga0070716_100015416
2279 Ga0070712_100017531
2280 Ga0070712_100019139
2281 Ga0070712_100150895
2282 Ga0070712_100171105
2283 Ga0070712_100221306
2284 Ga0075362_10002382
2285 Ga0075362_10057222
2286 Ga0075367_10009497
2287 Ga0075367_10013375
2288 Ga0075367_10018489
2289 Ga0075367_10051257
2290 Ga0075369_10052055
2291 Ga0075427_10003015
2292 Ga0075366_10007698
2293 Ga0075366_10018053
2294 Ga0097621_100000569
2295 Ga0097621_100034909
2296 Ga0097621_100093302
2297 Ga0075370_10040354
2298 Ga0075370_10164691
2299 Ga0068871_100000012
2300 Ga0068871_100017133
2301 Ga0068871_100230754
2302 Ga0075428_100000797
2303 Ga0075428_100202612
2304 Ga0075430_100000045
2305 Ga0075430_100000509
2306 Ga0075430_100061183
2307 Ga0075431_100022535
2308 Ga0075431_100272852
2309 Ga0075431_100474964
2310 Ga0075433_10002970
2311 Ga0075433_10009693
2312 Ga0075433_10200207
2313 Ga0075434_100001007
2314 Ga0075434_100003473
2315 Ga0075434_100034517
2316 Ga0075434_100047837
2317 Ga0075434_100065389
2318 Ga0075434_100074246
2319 Ga0075434_100395196
2320 Ga0075429_100000214
2321 Ga0068865_100000209
2322 Ga0068865_100147074
2323 Ga0075436_100155156
2324 Ga0097620_100077157
2325 Ga0097620_100295636
2326 Ga0099824_1004485
2327 Ga0099824_1005993
2328 Ga0099822_1056885
2329 Ga0099823_1036201
2330 Ga0075435_100003730
2331 Ga0075435_100029012
2332 Ga0075435_100130294
2333 Ga0075435_100171867
2334 Ga0075435_100179585
2335 Ga0075435_100222601
2336 Ga0099794_10020050
2337 Ga0099795_10017879
2338 Ga0105251_10064373
2339 Ga0105244_10013466
2340 Ga0105250_10087777
2341 Ga0105240_10019597
2342 Ga0105240_10366977
2343 Ga0111539_10000693
2344 Ga0111539_10000941
2345 Ga0111539_10001081
2346 Ga0111539_10154547
2347 Ga0105245_10001284
2348 Ga0105245_10145013
2349 Ga0105245_10419824
2350 Ga0105247_10003522
2351 Ga0105247_10015712
2352 Ga0114129_10009653
2353 Ga0114129_10010881
2354 Ga0114129_10064508
2355 Ga0114129_10190930
2356 Ga0114129_10229703
2357 Ga0114129_10431643
2358 Ga0114129_10436172
2359 Ga0105243_10003373
2360 Ga0105243_10217864
2361 Ga0105241_10000053
2362 Ga0105241_10123177
2363 Ga0105242_10000492
2364 Ga0105242_10078474
2365 Ga0105248_10000934
2366 Ga0105248_10031696
2367 Ga0105248_10038013
2368 Ga0105248_10041758
2369 Ga0105248_10097830
2370 Ga0105248_10110014
2371 Ga0105237_10003661
2372 Ga0105237_10082006
2373 Ga0105237_10196605
2374 Ga0105238_10005232
2375 Ga0105238_10322524
2376 Ga0105249_10003582
2377 Ga0105249_10033319
2378 Ga0105249_10356389
2379 Ga0099796_10029818
2380 Ga0105239_10016523
2381 Ga0105239_10065271
2382 Ga0105239_10074495
2383 Ga0105239_10182570
2384 Ga0105246_10000055
2385 Ga0105246_10003672
2386 Ga0105246_10201643
2387 Ga0157320_1000638
2388 Ga0157373_10064543
2389 Ga0157371_10043951
2390 Ga0157370_10034537
2391 Ga0157370_10041817
2392 Ga0157370_10114858
2393 Ga0157370_10178554
2394 Ga0157370_10255425
2395 Ga0157369_10016644
2396 Ga0157369_10041997
2397 Ga0157369_10157244
2398 Ga0157374_10001308
2399 Ga0157374_10025888
2400 Ga0157374_10041871
2401 Ga0157374_10045186
2402 Ga0157374_10047928
2403 Ga0157378_10000986
2404 Ga0157378_10142354
2405 Ga0157378_10182480
2406 Ga0163162_10002432
2407 Ga0163162_10075871
2408 Ga0163162_10275342
2409 Ga0163162_10487935
2410 Ga0157372_10031748
2411 Ga0157372_10036245
2412 Ga0157372_10346278
2413 Ga0157372_10502847
2414 Ga0157375_10000933
2415 Ga0157375_10029408
2416 Ga0157375_10030809
2417 Ga0157375_10041036
2418 Ga0157375_10170070
2419 Ga0157375_10221031
2420 Ga0157375_10272322
2421 Ga0157375_10307118
2422 Ga0163163_10009027
2423 Ga0163163_10029817
2424 Ga0163163_10090954
2425 Ga0163163_10116963
2426 Ga0157380_10000821
2427 Ga0157380_10083969
2428 Ga0157380_10137302
2429 Ga0157380_10317590
2430 Ga0157377_10002329
2431 Ga0157379_10000679
2432 Ga0157379_10056130
2433 Ga0157379_10065272
2434 Ga0157379_10216790
2435 Ga0157376_10000527
2436 Ga0157376_10038272
2437 Ga0157376_10049122
2438 Ga0163161_10000770
2439 Ga0163161_10337736
2440 Ga0197907_11009316
2441 Ga0206356_11354353
2442 Ga0214544_1000016
2443 Ga0214542_1000016
2444 Ga0214545_1000008
2445 Ga0214543_1000043
2446 Ga0213876_10018008
2447 Ga0213875_10012959
2448 Ga0224712_10055462
2449 Ga0228598_1008246
2450 Ga0209563_101466
2451 Ga0209677_100936
2452 Ga0209148_1000504
2453 Ga0209233_1003870
2454 Ga0207666_1000026
2455 Ga0207666_1001597
2456 Ga0209455_1000957
2457 Ga0209758_1000069
2458 Ga0209758_1000253
2459 Ga0209758_1000351
2460 Ga0209758_1000990
2461 Ga0209758_1005097
2462 Ga0209758_1009810
2463 Ga0209758_1033376
2464 Ga0209256_1008686
2465 Ga0207426_1000420
2466 Ga0207426_1001001
2467 Ga0207426_1002779
2468 Ga0207426_1018465
2469 Ga0209257_1000564
2470 Ga0207697_10000245
2471 Ga0207697_10011834
2472 Ga0207656_10001442
2473 Ga0207656_10034259
2474 Ga0207682_10000029
2475 Ga0207682_10014795
2476 Ga0207692_10000218
2477 Ga0207692_10012824
2478 Ga0207692_10031373
2479 Ga0207642_10015391
2480 Ga0207642_10022067
2481 Ga0207710_10000676
2482 Ga0207710_10027072
2483 Ga0207688_10000084
2484 Ga0207688_10008498
2485 Ga0207680_10001429
2486 Ga0207647_10003716
2487 Ga0207647_10009100
2488 Ga0207647_10018094
2489 Ga0207647_10038424
2490 Ga0207685_10030478
2491 Ga0207685_10039930
2492 Ga0207699_10000145
2493 Ga0207699_10001859
2494 Ga0207699_10002344
2495 Ga0207699_10004700
2496 Ga0207699_10081951
2497 Ga0207699_10096259
2498 Ga0207699_10133912
2499 Ga0207699_10232911
2500 Ga0207645_10000090
2501 Ga0207645_10029552
2502 Ga0207645_10085115
2503 Ga0207643_10000044
2504 Ga0207643_10003440
2505 Ga0207643_10034241
2506 Ga0207705_10011060
2507 Ga0207705_10023489
2508 Ga0207705_10126273
2509 Ga0207705_10204922
2510 Ga0207684_10007412
2511 Ga0207654_10000143
2512 Ga0207654_10060218
2513 Ga0207707_10000580
2514 Ga0207707_10001318
2515 Ga0207707_10001462
2516 Ga0207707_10012685
2517 Ga0207707_10028941
2518 Ga0207707_10163134
2519 Ga0207707_10329992
2520 Ga0207707_10334625
2521 Ga0207695_10000148
2522 Ga0207695_10073547
2523 Ga0207695_10260447
2524 Ga0207671_10014374
2525 Ga0207671_10051753
2526 Ga0207693_10001456
2527 Ga0207693_10008645
2528 Ga0207693_10014519
2529 Ga0207693_10022611
2530 Ga0207693_10068117
2531 Ga0207693_10072991
2532 Ga0207693_10112390
2533 Ga0207663_10001778
2534 Ga0207663_10005840
2535 Ga0207663_10053706
2536 Ga0207660_10000653
2537 Ga0207660_10006180
2538 Ga0207660_10022078
2539 Ga0207660_10034613
2540 Ga0207660_10129792
2541 Ga0207660_10175813
2542 Ga0207662_10000104
2543 Ga0207662_10012668
2544 Ga0207662_10055424
2545 Ga0207662_10072216
2546 Ga0207662_10102891
2547 Ga0207662_10228246
2548 Ga0207657_10001095
2549 Ga0207657_10011813
2550 Ga0207657_10027567
2551 Ga0207649_10000057
2552 Ga0207649_10214061
2553 Ga0207652_10001436
2554 Ga0207652_10006195
2555 Ga0207652_10009939
2556 Ga0207652_10021448
2557 Ga0207652_10082063
2558 Ga0207652_10103257
2559 Ga0207652_10116157
2560 Ga0207652_10128330
2561 Ga0207652_10259545
2562 Ga0207646_10044687
2563 Ga0207681_10000154
2564 Ga0207681_10041806
2565 Ga0207681_10061535
2566 Ga0207681_10110822
2567 Ga0207694_10013631
2568 Ga0207694_10171615
2569 Ga0207650_10001069
2570 Ga0207650_10029876
2571 Ga0207650_10038377
2572 Ga0207650_10059701
2573 Ga0207659_10000028
2574 Ga0207659_10064129
2575 Ga0207659_10164353
2576 Ga0207687_10000249
2577 Ga0207687_10015275
2578 Ga0207687_10284289
2579 Ga0207700_10007100
2580 Ga0207700_10018744
2581 Ga0207700_10036980
2582 Ga0207700_10072688
2583 Ga0207700_10151033
2584 Ga0207700_10151669
2585 Ga0207664_10014021
2586 Ga0207664_10027440
2587 Ga0207644_10000776
2588 Ga0207644_10002109
2589 Ga0207644_10015442
2590 Ga0207644_10020295
2591 Ga0207644_10190573
2592 Ga0207690_10000225
2593 Ga0207690_10093886
2594 Ga0207690_10109743
2595 Ga0207706_10001675
2596 Ga0207706_10042501
2597 Ga0207706_10070446
2598 Ga0207706_10103738
2599 Ga0207686_10001701
2600 Ga0207686_10029111
2601 Ga0207709_10000291
2602 Ga0207670_10000463
2603 Ga0207670_10007249
2604 Ga0207670_10011845
2605 Ga0207670_10079765
2606 Ga0207669_10000019
2607 Ga0207704_10000230
2608 Ga0207704_10039730
2609 Ga0207704_10061285
2610 Ga0207704_10201241
2611 Ga0207665_10005663
2612 Ga0207665_10010796
2613 Ga0207665_10029367
2614 Ga0207665_10143824
2615 Ga0207665_10213294
2616 Ga0207691_10000882
2617 Ga0207691_10007777
2618 Ga0207691_10069856
2619 Ga0207691_10254055
2620 Ga0207691_10275295
2621 Ga0207711_10001381
2622 Ga0207711_10011217
2623 Ga0207711_10072837
2624 Ga0207711_10367605
2625 Ga0207689_10000228
2626 Ga0207689_10009830
2627 Ga0207689_10050716
2628 Ga0207661_10000107
2629 Ga0207661_10017315
2630 Ga0207661_10166725
2631 Ga0207679_10000026
2632 Ga0207679_10064593
2633 Ga0207667_10007642
2634 Ga0207667_10017783
2635 Ga0207667_10021717
2636 Ga0207667_10038306
2637 Ga0207667_10056568
2638 Ga0207667_10185843
2639 Ga0207651_10000069
2640 Ga0207651_10038302
2641 Ga0207651_10076837
2642 Ga0207712_10000242
2643 Ga0207712_10267673
2644 Ga0207668_10000049
2645 Ga0207668_10059373
2646 Ga0207668_10168639
2647 Ga0207640_10000301
2648 Ga0207640_10029527
2649 Ga0207640_10074211
2650 Ga0207640_10189847
2651 Ga0207658_10077114
2652 Ga0207658_10175261
2653 Ga0207677_10072040
2654 Ga0207677_10219393
2655 Ga0207677_10295039
2656 Ga0207703_10098502
2657 Ga0207703_10318466
2658 Ga0207639_10000413
2659 Ga0207639_10011576
2660 Ga0207639_10066094
2661 Ga0207639_10075818
2662 Ga0207678_10000920
2663 Ga0207678_10007714
2664 Ga0207678_10010132
2665 Ga0207678_10018124
2666 Ga0207678_10030856
2667 Ga0207678_10035645
2668 Ga0207678_10041352
2669 Ga0207678_10120737
2670 Ga0207708_10002680
2671 Ga0207708_10002682
2672 Ga0207708_10029309
2673 Ga0207708_10137658
2674 Ga0207702_10001310
2675 Ga0207702_10002075
2676 Ga0207641_10000542
2677 Ga0207648_10002093
2678 Ga0207648_10011369
2679 Ga0207676_10000511
2680 Ga0207676_10034980
2681 Ga0207676_10055650
2682 Ga0207676_10066499
2683 Ga0207676_10308686
2684 Ga0207674_10000882
2685 Ga0207674_10008675
2686 Ga0207674_10029762
2687 Ga0207674_10074468
2688 Ga0207674_10122257
2689 Ga0207674_10207300
2690 Ga0207675_100001599
2691 Ga0207675_100032506
2692 Ga0207675_100032967
2693 Ga0207675_100056412
2694 Ga0207675_100181195
2695 Ga0207675_100333112
2696 Ga0207683_10000653
2697 Ga0207683_10005584
2698 Ga0207683_10032212
2699 Ga0207683_10034787
2700 Ga0207683_10058314
2701 Ga0207683_10126366
2702 Ga0207683_10320810
2703 Ga0207698_10003176
2704 Ga0207698_10015074
2705 Ga0207698_10031914
2706 Ga0207698_10141417
2707 Ga0207698_10184510
2708 Ga0207698_10213466
2709 Ga0207698_10241296
2710 Ga0209389_1000033
2711 Ga0209389_1000071
2712 Ga0209589_1000040
2713 Ga0209489_100045
2714 Ga0209489_101361
2715 Ga0209700_100011
2716 Ga0209967_1004267
2717 Ga0209179_1004156
2718 Ga0210002_1005285
2719 Ga0209588_1021319
2720 Ga0209966_1009837
2721 Ga0209998_10000855
2722 Ga0209998_10000913
2723 Ga0209974_10001240
2724 Ga0207428_10000130
2725 Ga0207428_10000180
2726 Ga0207428_10000286
2727 Ga0265357_1000126
2728 Ga0268266_10000680
2729 Ga0268266_10001248
2730 Ga0268266_10011598
2731 Ga0268266_10013545
2732 Ga0268266_10019092
2733 Ga0268266_10047378
2734 Ga0268266_10061027
2735 Ga0268266_10084876
2736 Ga0268266_10146772
2737 Ga0268266_10192534
2738 Ga0268265_10000410
2739 Ga0268265_10109383
2740 Ga0268265_10136371
2741 Ga0268265_10243594
2742 Ga0268265_10346640
2743 Ga0268264_10001172
2744 Ga0265337_1000803
2745 Ga0307517_10000175
2746 Ga0307515_10010288
2747 Ga0265338_10082594
2748 Ga0265763_1000550
2749 Ga0265330_10013168
2750 Ga0265330_10017853
2751 Ga0265328_10005186
2752 Ga0265328_10012310
2753 Ga0265325_10000011
2754 Ga0265325_10000031
2755 Ga0265325_10009845
2756 Ga0265325_10010725
2757 Ga0265325_10043236
2758 Ga0265325_10060508
2759 Ga0265340_10000988
2760 Ga0265340_10002668
2761 Ga0265340_10015328
2762 Ga0265340_10016275
2763 Ga0265340_10019075
2764 Ga0265339_10000420
2765 Ga0265339_10023140
2766 Ga0265339_10029285
2767 Ga0265339_10033487
2768 Ga0265339_10081739
2769 Ga0265331_10065751
2770 Ga0265316_10012332
2771 Ga0265316_10031368
2772 Ga0265316_10156012
2773 Ga0307513_10079139
2774 Ga0265313_10000008
2775 Ga0265313_10000637
2776 Ga0265313_10004833
2777 Ga0265313_10007230
2778 Ga0265313_10008768
2779 Ga0265313_10020749
2780 Ga0265313_10023060
2781 Ga0265313_10023600
2782 Ga0265313_10025145
2783 Ga0307508_10000108
2784 Ga0307508_10044567
2785 Ga0307508_10109344
2786 Ga0316575_10005603
2787 Ga0316575_10013015
2788 Ga0316579_10006101
2789 Ga0265314_10002983
2790 Ga0265314_10011076
2791 Ga0265314_10072325
2792 Ga0265342_10004075
2793 Ga0265342_10008760
2794 Ga0265342_10034408
2795 Ga0265342_10051976
2796 Ga0265342_10053102
2797 Ga0265342_10118905
2798 Ga0307516_10275542
2799 Ga0307516_10287203
2800 Ga0307405_10039377
2801 Ga0307412_10131376
2802 Ga0316583_10000432
2803 Ga0307510_10172898
2804 Ga0373930_0002135
2805 Ga0373930_0004672
2806 Ga0373930_0006152
2807 Ga0373948_0019053
2808 Ga0373950_0004459
2809 Ga0373950_0009843
2810 Ga0373958_0001550
2811 Ga0373959_0000740
2812 Ga0373959_0002603
2813 Ga0373938_0000260
2814 Ga0373938_0001185
2815 Ga0373926_0045645
2816 Ga0373928_0000813
2817 Ga0373928_0008582
2818 Ga0373928_0011485
2819 Ga0373929_0001725
2820 Ga0373929_0005692
2821 Ga0373934_0052433
2822 Ga0373940_0000718
2823 Ga0373944_0007059
2824 Ga0373949_0000547
2825 Ga0373949_0011258
2826 Ga0373951_0001164
2827 Ga0373951_0002297
2828 Ga0373952_0000516
2829 Ga0373952_0000760
2830 Ga0373923_0010424
2831 Ga0373932_0000908
2832 Ga0373936_0106013
2833 Ga0373939_0000911
2834 Ga0373939_0014272
2835 Ga0373939_0024389
2836 Ga0373941_0000037
2837 Ga0373941_0001686
2838 Ga0373941_0017520
2839 Ga0373945_0004426
2840 Ga0373945_0008144
2841 Ga0373945_0023371
2842 Ga0373945_0026758
2843 Ga0373953_0001233
2844 Ga0373953_0018745
2845 Ga0373953_0022802
2846 Ga0373954_0000514
2847 Ga0373954_0003303
2848 Ga0373954_0024791
2849 Ga0373954_0100960
2850 Ga0373956_0003634
2851 Ga0373956_0005363
2852 Ga0373956_0007961
2853 Ga0373956_0015060
2854 Ga0373957_0001007
2855 Ga0373957_0006379
2856 Ga0373957_0011003
2857 Ga0373957_0019840
2858 Ga0373957_0024024
2859 Ga0373960_0000805
2860 Ga0373960_0001073
2861 Ga0373943_0000699
2862 Ga0373943_0004297
2863 Ga0373943_0007096
2864 Ga0373943_0010381
2865 Ga0373943_0010931
2866 Ga0373943_0030320
2867 Ga0373943_0136083
2868 Ga0373946_0004806
2869 Ga0373946_0009235
2870 Ga0373946_0014570
2871 Ga0373946_0032937
2872 Ga0373955_0000723
2873 Ga0373955_0001851
2874 Ga0373955_0007716
2875 Ga0373955_0014090
2876 Ga0373955_0019345
2877 Ga0373955_0030955
2878 Ga0373955_0103027
2879 Ga0373942_0000388
2880 Ga0373942_0010244
2881 Ga0373961_0000658
2882 Ga0373961_0010035
2883 Ga0373961_0024994
2884 Ga0373962_0004022
2885 Ga0373962_0005442
2886 Ga0373962_0008725
2887 Ga0373924_0003551
2888 Ga0373924_0005950
2889 Ga0373924_0014945
2890 Ga0373924_0033471
2891 Ga0373924_0082998
2892 Ga0373931_0001169
2893 Ga0373931_0002000
2894 Ga0373931_0021214
2895 Ga0373931_0024262
2896 Ga0373931_0041537
2897 Ga0373935_0000777
2898 Ga0373935_0015808
2899 Ga0373935_0016204
2900 Ga0373927_0000337
2901 Ga0373927_0000920
2902 Ga0373927_0007511
2903 Ga0373927_0063703
2904 Ga0373927_0070036
2905 Ga0373933_0000749
2906 Ga0373933_0008828
2907 Ga0373933_0016195
2908 Ga0373933_0020951
2909 Ga0373933_0097439
2910 Ga0373933_0177752
2911 Ga0373947_0001483
2912 Ga0373947_0001596
2913 Ga0373947_0004710
2914 Ga0373947_0004829
2915 Ga0373947_0010845
2916 Ga0373947_0011454
2917 Ga0373947_0012687
2918 Ga0373947_0035521
2919 Ga0373947_0037785
2920 Ga0373947_0098051
2921 Ga0373937_0001087
2922 Ga0373937_0004268
2923 Ga0373937_0012013
2924 Ga0373937_0020739
2925 Ga0373937_0027462
2926 Ga0373937_0034586
2927 Ga0373937_0040316
2928 Ga0373937_0059594
2929 Ga0373937_0129696
2930 Ga0373937_0327232
2931 Ga0373937_0331331
2932 Ga0373925_0000712
2933 Ga0373925_0002178
2934 Ga0373925_0012757
2935 Ga0373925_0070890
2936 Ga0373925_0071831
2937 Ga0373925_0074899
2938 Ga0373925_0167688
2939 Ga0373925_0179167
2940 Ga0373925_0242286
2941 Ga0395899_0013101
2942 Ga0395899_0072062
2943 Ga0395900_0002974
2944 Ga0395900_0010116
2945 Ga0395900_0101559
2946 Ga0395898_0005741
2947 Ga0395898_0011608
2948 Ga0395898_0014047
2949 Ga0395898_0113141
2950 Ga0395905_0009536
2951 Ga0395905_0023356
2952 Ga0436364_0091611
2953 Ga0395901_0003628
2954 Ga0395901_0012308
2955 Ga0395901_0092810
2956 Ga0436365_0113731
2957 Ga0436365_0254353
2958 Ga0436365_0270990
2959 Ga0436365_0671434
2960 Ga0436365_1550909
2961 Ga0436365_1927338
2962 Ga0436361_0438836
2963 Ga0436361_0676992
2964 Ga0436361_0764602
2965 Ga0436361_0842459
2966 Ga0436361_0869536
2967 Ga0436363_1655093
2968 Ga0436362_0320095
2969 Ga0439453_0001745
2970 Ga0439453_0015656
2971 Ga0439465_0015093
2972 Ga0439441_010110
2973 Ga0439455_0016975
2974 Ga0466969_0031199
2975 Ga0466972_0000107
2976 Ga0466965_0006278
2977 Ga0466966_0000429
2978 Ga0466966_0048482
2979 Ga0466966_0074503
2980 Ga0466961_0000074
2981 Ga0466963_0004354
2982 Ga0466963_0004518
2983 Ga0466963_0004913
2984 Ga0466963_0030079
2985 Ga0466963_0056684
2986 Ga0466968_0003762
2987 Ga0466957_0004324
2988 Ga0466957_0028192
2989 Ga0466960_0008577
2990 Ga0466960_0028229
2991 Ga0466959_0001671
2992 Ga0466959_0030925
2993 Ga0466959_0093715
2994 Ga0451576_0164471
2995 Ga0451576_0442507
2996 Ga0466958_0026534
2997 Ga0466967_0004481
2998 Ga0466967_0372979
2999 Ga0466967_0416113
3000 Ga0495592_0003132
3001 Ga0495592_0011587
3002 Ga0495592_0048616
3003 Ga0495592_0058912
3004 Ga0495592_0193907
3005 Ga0495603_0007593
3006 Ga0495603_0012985
3007 Ga0495603_0053315
3008 Ga0495603_0122267
3009 Ga0495629_0000124
3010 Ga0495629_0001397
3011 Ga0495629_0001747
3012 Ga0495629_0002750
3013 Ga0495629_0004000
3014 Ga0495629_0136391
3015 Ga0495638_0003214
3016 Ga0495638_0035809
3017 Ga0495638_0045581
3018 Ga0495638_0121170
3019 Ga0495651_0000828
3020 Ga0495651_0000848
3021 Ga0495651_0010521
3022 Ga0495651_0013380
3023 Ga0495651_0034381
3024 Ga0495651_0139182
3025 Ga0495653_0003214
3026 Ga0495653_0009388
3027 Ga0495653_0014317
3028 Ga0495653_0059128
3029 Ga0495580_0084249
3030 Ga0495580_0243244
3031 Ga0495582_0000494
3032 Ga0495582_0000612
3033 Ga0495582_0029848
3034 Ga0495605_0070490
3035 Ga0495639_0018656
3036 Ga0495639_0022341
3037 Ga0495662_0001524
3038 Ga0495664_0003608
3039 Ga0495664_0004132
3040 Ga0495664_0007442
3041 Ga0495664_0024956
3042 Ga0495664_0052403
3043 Ga0495584_0007686
3044 Ga0495584_0098033
3045 Ga0495585_0031324
3046 Ga0495594_0005394
3047 Ga0495583_0060554
3048 Ga0495606_0001875
3049 Ga0495606_0029132
3050 Ga0495606_0081523
3051 Ga0495606_0083098
3052 Ga0495606_0112941
3053 Ga0495608_0000289
3054 Ga0495608_0006800
3055 Ga0495608_0016797
3056 Ga0495608_0026000
3057 Ga0495608_0029737
3058 Ga0495608_0051514
3059 Ga0495610_0057783
3060 Ga0495616_0013598
3061 Ga0495616_0072093
3062 Ga0495616_0111407
3063 Ga0495618_0002332
3064 Ga0495618_0005683
3065 Ga0495618_0005818
3066 Ga0495618_0021212
3067 Ga0495620_0008453
3068 Ga0495628_0002019
3069 Ga0495628_0005743
3070 Ga0495628_0063328
3071 Ga0495628_0070770
3072 Ga0495628_0099426
3073 Ga0495628_0109037
3074 Ga0495630_0004265
3075 Ga0495630_0010648
3076 Ga0495630_0010684
3077 Ga0495632_0025333
3078 Ga0495648_0044784
3079 Ga0495648_0087688
3080 Ga0495666_0067927
3081 Ga0495652_0004566
3082 Ga0495652_0007469
3083 Ga0495652_0015031
3084 Ga0495652_0045490
3085 Ga0495652_0081641
3086 Ga0495652_0167720
3087 Ga0495652_0239116
3088 Ga0495654_0121070
3089 Ga0495665_0007626
3090 Ga0495665_0016023
3091 Ga0495665_0018434
3092 Ga0495640_0002278
3093 Ga0495640_0009218
3094 Ga0495640_0010515
3095 Ga0495640_0011275
3096 Ga0495640_0030298
3097 Ga0495640_0037763
3098 Ga0495640_0126222
3099 Ga0495640_0142826
3100 Ga0495586_0075916
3101 Ga0495587_0001579
3102 Ga0495587_0002055
3103 Ga0495587_0075738
3104 Ga0495598_0010358
3105 Ga0495609_0041186
3106 Ga0495621_0012445
3107 Ga0495645_0015600
3108 Ga0495645_0017012
3109 Ga0495645_0064816
3110 Ga0495622_0008280
3111 Ga0495622_0047417
3112 Ga0495622_0049876
3113 Ga0495667_0000745
3114 Ga0495667_0003972
3115 Ga0495667_0004942
3116 Ga0495667_0007291
3117 Ga0495667_0017408
3118 Ga0495667_0029968
3119 Ga0495667_0036611
3120 Ga0495656_0026478
3121 Ga0495668_0024098
3122 Ga0495634_0000886
3123 Ga0495634_0010854
3124 Ga0495634_0035418
3125 Ga0495634_0059475
3126 Ga0495634_0108579
3127 Ga0495635_0000288
3128 Ga0495635_0000628
3129 Ga0495635_0007880
3130 Ga0495635_0010659
3131 Ga0495635_0019422
3132 Ga0495635_0030423
3133 Ga0495635_0115167
3134 Ga0495635_0127602
3135 Ga0495659_0004621
3136 Ga0495661_0111970
3137 Ga0495588_0006045
3138 Ga0495588_0049532
3139 Ga0495657_0000869
3140 Ga0495657_0001357
3141 Ga0495657_0009320
3142 Ga0495657_0023590
3143 Ga0495657_0134114
3144 Ga0495599_0002342
3145 Ga0495599_0012613
3146 Ga0495599_0019939
3147 Ga0495599_0032432
3148 Ga0495623_0002014
3149 Ga0495623_0002560
3150 Ga0495623_0004925
3151 Ga0495623_0011972
3152 Ga0495623_0119677
3153 Ga0495646_0001350
3154 Ga0495646_0003278
3155 Ga0495646_0080599
3156 Ga0495647_0010897
3157 Ga0495647_0028792
3158 Ga0495658_0005405
3159 Ga0495658_0007867
3160 Ga0495658_0061430
3161 Ga0495669_0023835
3162 Ga0495669_0113690
3163 Ga0495613_0002256
3164 Ga0495613_0030094
3165 Ga0495613_0092460
3166 Ga0495613_0104223
3167 Ga0495613_0148608
3168 Ga0495613_0160595
3169 Ga0495613_0241365
3170 Ga0495624_0000867
3171 Ga0495624_0070358
3172 Ga0495670_0008005
3173 Ga0495670_0059673
3174 Ga0495671_0031480
3175 Ga0495649_0006343
3176 Ga0495600_0001518
3177 Ga0495600_0020307
3178 Ga0495600_0040052
3179 Ga0495600_0058682
3180 Ga0495600_0123335
3181 Ga0495581_0116575
3182 Ga0495604_0000613
3183 Ga0495604_0002473
3184 Ga0495604_0005447
3185 Ga0495604_0033969
3186 Ga0495604_0062471
3187 Ga0495604_0101529
3188 Ga0495604_0199296
3189 Ga0495636_0021260
3190 Ga0495674_0005148
3191 Ga0495674_0009345
3192 Ga0495674_0016916
3193 Ga0495674_0022408
3194 Ga0495674_0034750
3195 Ga0495674_0040150
3196 Ga0495674_0203789
3197 Ga0495672_0087515
3198 Ga0495676_0021648
3199 Ga0495676_0035932
3200 Ga0495680_0000791
3201 Ga0495680_0000871
3202 Ga0495680_0003706
3203 Ga0495680_0008347
3204 Ga0495680_0056497
3205 Ga0495680_0082360
3206 Ga0495683_0008398
3207 Ga0495683_0093686
3208 Ga0495687_008699
3209 Ga0495675_0000231
3210 Ga0495675_0004959
3211 Ga0495675_0006519
3212 Ga0495675_0046490
3213 Ga0495675_0136897
3214 Ga0495673_0064366
3215 Ga0495684_0000169
3216 Ga0495684_0006577
3217 Ga0495684_0017615
3218 Ga0495684_0024653
3219 Ga0495684_0033293
3220 Ga0495684_0040178
3221 Ga0495684_0048445
3222 Ga0495684_0061181
3223 Ga0495684_0076092
3224 Ga0495684_0111667
3225 Ga0495684_0176189
3226 Ga0495686_0069066
3227 Ga0495686_0084342
3228 Ga0495686_0124031
3229 Ga0495593_0006499
3230 Ga0495593_0015076
3231 Ga0495602_0006526
3232 Ga0495602_0007532
3233 Ga0495602_0008023
3234 Ga0495602_0109171
3235 Ga0495626_0019874
3236 Ga0496100_0001568
3237 Ga0496100_0015384
3238 Ga0496100_0029669
3239 Ga0496100_0039950
3240 Ga0496100_0056464
3241 Ga0496101_0000171
3242 Ga0496101_0001461
3243 Ga0496101_0002295
3244 Ga0496101_0061278
3245 Ga0496101_0094070
3246 Ga0496101_0264407
3247 Ga0496102_0001453
3248 Ga0496102_0004724
3249 Ga0496102_0024848
3250 Ga0496102_0132235
3251 Ga0496102_0170684
3252 Ga0496102_0221645
3253 Ga0496103_0005627
3254 Ga0496103_0005987
3255 Ga0496103_0017226
3256 Ga0496103_0216405
3257 Ga0496104_0000067
3258 Ga0496104_0003147
3259 Ga0496104_0012278
3260 Ga0496104_0037074
3261 Ga0496104_0064446
3262 Ga0496104_0081709
3263 Ga0496104_0089362
3264 Ga0496104_0138768
3265 Ga0496104_0176828
3266 Ga0496105_0000130
3267 Ga0496105_0004705
3268 Ga0496105_0011328
3269 Ga0496105_0050772
3270 Ga0496105_0054949
3271 Ga0496105_0108449
3272 Ga0496105_0189447
3273 Ga0496105_0192646
3274 Ga0496105_0218260
3275 Ga0496106_0002116
3276 Ga0496106_0005992
3277 Ga0496106_0013472
3278 Ga0496106_0013768
3279 Ga0496106_0019258
3280 Ga0496106_0035425
3281 Ga0496106_0053430
3282 Ga0496106_0063140
3283 Ga0496106_0139292
3284 Ga0496106_0177492
3285 Ga0496107_0002489
3286 Ga0496107_0003392
3287 Ga0496107_0005829
3288 Ga0496107_0009248
3289 Ga0496107_0010662
3290 Ga0496107_0036330
3291 Ga0496107_0103925
3292 Ga0496107_0120514
3293 Ga0496107_0280096
3294 Ga0496108_0003417
3295 Ga0496108_0005206
3296 Ga0496108_0006501
3297 Ga0496108_0025147
3298 Ga0496108_0025606
3299 Ga0496108_0039052
3300 Ga0496108_0047350
3301 Ga0496108_0064251
3302 Ga0496108_0132273
3303 Ga0496109_0000606
3304 Ga0496109_0000714
3305 Ga0496109_0004345
3306 Ga0496109_0004713
3307 Ga0496109_0024520
3308 Ga0496109_0030825
3309 Ga0496109_0084083
3310 Ga0496109_0084980
3311 Ga0496109_0122011
3312 Ga0496109_0125037
3313 Ga0496109_0151615
3314 Ga0496109_0210528
3315 Ga0496109_0218652
3316 Ga0496110_0011093
3317 Ga0496110_0031167
3318 Ga0496110_0073759
3319 Ga0496110_0080773
3320 Ga0496110_0083757
3321 Ga0496110_0149039
3322 Ga0496110_0407516
3323 Ga0496110_0453028
3324 Ga0496111_0038001
3325 Ga0496111_0039188
3326 Ga0496111_0111178
3327 Ga0496111_0141650
3328 Ga0496111_0160448
3329 Ga0496111_0172079
3330 Ga0496111_0172431
3331 Ga0496112_0002085
3332 Ga0496112_0003993
3333 Ga0496112_0007660
3334 Ga0496112_0018292
3335 Ga0496112_0090589
3336 Ga0496112_0091411
3337 Ga0496112_0130032
3338 Ga0496112_0154841
3339 Ga0496112_0156781
3340 Ga0496112_0204664
3341 Ga0496112_0250203
3342 Ga0496112_0309730
3343 Ga0496113_0000399
3344 Ga0496113_0002831
3345 Ga0496113_0034822
3346 Ga0496113_0035652
3347 Ga0496113_0042451
3348 Ga0496113_0067886
3349 Ga0496113_0092424
3350 Ga0496114_0008317
3351 Ga0496114_0028520
3352 Ga0496114_0029718
3353 Ga0496114_0041803
3354 Ga0496114_0096651
3355 Ga0496114_0174186
3356 Ga0496114_0178178
3357 Ga0496114_0216719
3358 Ga0496114_0225839
3359 Ga0496114_0238726
3360 Ga0496114_0267825
3361 Ga0496115_0001189
3362 Ga0496115_0006380
3363 Ga0496115_0085724
3364 Ga0496115_0100555
3365 Ga0496115_0101360
3366 Ga0496115_0105381
3367 Ga0496115_0116269
3368 Ga0496115_0130782
3369 Ga0496115_0189688
3370 Ga0496115_0207959
3371 Ga0496115_0280027
3372 Ga0496116_0003460
3373 Ga0496116_0097457
3374 Ga0496117_0027790
3375 Ga0496117_0030958
3376 Ga0496117_0037619
3377 Ga0496118_0015666
3378 Ga0496118_0016153
3379 Ga0496118_0037789
3380 Ga0496118_0047600
3381 Ga0496118_0074444
3382 Ga0496118_0167974
3383 Ga0496119_0025737
3384 Ga0496119_0042676
3385 Ga0496119_0045738
3386 Ga0496119_0048007
3387 Ga0496120_0024841
3388 Ga0496121_0010952
3389 Ga0496121_0012201
3390 Ga0496121_0017146
3391 Ga0496121_0022980
3392 Ga0496121_0023489
3393 Ga0496121_0025833
3394 Ga0496121_0043880
3395 Ga0496121_0085681
3396 Ga0496121_0229765
3397 Ga0496122_0002797
3398 Ga0496122_0016307
3399 Ga0496122_0050808
3400 Ga0496123_0001238
3401 Ga0496123_0033846
3402 Ga0496123_0109376
3403 Ga0496124_0038924
3404 Ga0496125_0006390
3405 Ga0496125_0016099
3406 Ga0496125_0039975
3407 Ga0496125_0064054
3408 Ga0496125_0208572
3409 Ga0496126_0015873
3410 Ga0496126_0032674
3411 Ga0496126_0038151
3412 Ga0496126_0042128
3413 Ga0496126_0042747
3414 Ga0496126_0050585
3415 Ga0496126_0072076
3416 Ga0496126_0072748
3417 Ga0496126_0228588
3418 Ga0496126_0266403
3419 Ga0496126_0297037
3420 Ga0501032_0006146
3421 Ga0501032_0011555
3422 Ga0501032_0041414
3423 Ga0501032_0042184
3424 Ga0501032_0181234
3425 Ga0501033_0008505
3426 Ga0501033_0027308
3427 Ga0501033_0052754
3428 Ga0501033_0062434
3429 Ga0501033_0138088
3430 Ga0501034_0000374
3431 Ga0501034_0001727
3432 Ga0501034_0009449
3433 Ga0501034_0011524
3434 Ga0501034_0015758
3435 Ga0501034_0060482
3436 Ga0501034_0064804
3437 Ga0501034_0084794
3438 Ga0501034_0088636
3439 Ga0501034_0102221
3440 Ga0501034_0116629
3441 Ga0501034_0198434
3442 Ga0501034_0252815
3443 Ga0501034_0274474
3444 Ga0501036_0000123
3445 Ga0501036_0018169
3446 Ga0501036_0030032
3447 Ga0501036_0130862
3448 Ga0501036_0167670
3449 Ga0501036_0404633
3450 Ga0501037_0019490
3451 Ga0501037_0055241
3452 Ga0501037_0074458
3453 Ga0501037_0169336
3454 Ga0501037_0185034
3455 Ga0501037_0263644
3456 Ga0501038_0004971
3457 Ga0501038_0023342
3458 Ga0501038_0034764
3459 Ga0501038_0054112
3460 Ga0501038_0101697
3461 Ga0501038_0116515
3462 Ga0501039_0027874
3463 Ga0501039_0051218
3464 Ga0501039_0125510
3465 Ga0501039_0256922
3466 Ga0501039_0308719
3467 Ga0501039_0353512
3468 Ga0501040_0154134
3469 Ga0501043_0016075
3470 Ga0501043_0027703
3471 Ga0501043_0139039
3472 Ga0501043_0181334
3473 Ga0501043_0182719
3474 Ga0501043_0188076
3475 Ga0501046_0028653
3476 Ga0501046_0060697
3477 Ga0501046_0125307
3478 Ga0501046_0168359
3479 Ga0501047_0000234
3480 Ga0501047_0014755
3481 Ga0501047_0020561
3482 Ga0501047_0024694
3483 Ga0501047_0059180
3484 Ga0501047_0069949
3485 Ga0501047_0107349
3486 Ga0501047_0322777
3487 Ga0501047_0399451
3488 Ga0501048_0000051
3489 Ga0501067_0014452
3490 Ga0501067_0017895
3491 Ga0501067_0035608
3492 Ga0501068_0055285
3493 Ga0501068_0057599
3494 Ga0501068_0166882
3495 Ga0501068_0167124
3496 Ga0501069_0077136
3497 Ga0501069_0102353
3498 Ga0501070_0000886
3499 Ga0501070_0003306
3500 Ga0501070_0014454
3501 Ga0501070_0019784
3502 Ga0501070_0035784
3503 Ga0501070_0039056
3504 Ga0501070_0049732
3505 Ga0501070_0057621
3506 Ga0501070_0075239
3507 Ga0501070_0141871
3508 Ga0501070_0227283
3509 Ga0501071_0044011
3510 Ga0501071_0047958
3511 Ga0501071_0176720
3512 Ga0501072_0064463
3513 Ga0501072_0073920
3514 Ga0501072_0088730
3515 Ga0501072_0229559
3516 Ga0501073_0005359
3517 Ga0501073_0012550
3518 Ga0501073_0029845
3519 Ga0501073_0039990
3520 Ga0501073_0056536
3521 Ga0501073_0068530
3522 Ga0501073_0071925
3523 Ga0501074_0061808
3524 Ga0501074_0062480
3525 Ga0501074_0083248
3526 Ga0501074_0083519
3527 Ga0501074_0090261
3528 Ga0501074_0098863
3529 Ga0501074_0108317
3530 Ga0501075_0052437
3531 Ga0501076_0004635
3532 Ga0501076_0244478
3533 Ga0501077_0004508
3534 Ga0501077_0056520
3535 Ga0501079_0024017
3536 Ga0501079_0125840
3537 Ga0501079_0179179
3538 Ga0501080_0000528
3539 Ga0501080_0011183
3540 Ga0501080_0015520
3541 Ga0501080_0087545
3542 Ga0501080_0100490
3543 Ga0501080_0174595
3544 Ga0501080_0218127
3545 Ga0501080_0291167
3546 Ga0501080_0327262
3547 Ga0501081_0000718
3548 Ga0501083_0008673
3549 Ga0501083_0035017
3550 Ga0501083_0082630
3551 Ga0501083_0112684
3552 Ga0501083_0189704
3553 Ga0501035_0000366
3554 Ga0501035_0019199
3555 Ga0501035_0028768
3556 Ga0501035_0062570
3557 Ga0501035_0072916
3558 Ga0501035_0120311
3559 Ga0501035_0129680
3560 Ga0501035_0141264
3561 Ga0501035_0283915
3562 Ga0501035_0315516
3563 Ga0501044_0000122
3564 Ga0501044_0001683
3565 Ga0501044_0024050
3566 Ga0501044_0027004
3567 Ga0501044_0032759
3568 Ga0501044_0042684
3569 Ga0501044_0047844
3570 Ga0501044_0052709
3571 Ga0501044_0056059
3572 Ga0501044_0077803
3573 Ga0501044_0118929
3574 Ga0501044_0198312
3575 Ga0501044_0221720
3576 Ga0501044_0390894
3577 Ga0501045_0142865
3578 nmdc:mga03683_12219_c1
3579 nmdc:mga03n38_2270_c1
3580 nmdc:mga03n38_85112_c1
3581 nmdc:mga03n38_97343_c1
3582 nmdc:mga00v17_126688_c1
3583 nmdc:mga00v17_13149_c2
3584 nmdc:mga00v17_48336_c1
3585 nmdc:mga0yw44_19588_c2
3586 nmdc:mga0yw44_21048_c1
3587 nmdc:mga0yw44_52774_c1
3588 nmdc:mga0yw44_7314_c1
3589 nmdc:mga0yw44_94778_c1
3590 nmdc:mga0yw44_98163_c1
3591 nmdc:mga0k408_11019_c1
3592 nmdc:mga0k408_172928_c1
3593 nmdc:mga0k408_24659_c1
3594 nmdc:mga06z11_21831_c1
3595 nmdc:mga06z11_6887_c1
3596 nmdc:mga06z11_7520_c1
3597 nmdc:mga06z11_88854_c1
3598 nmdc:mga07m45_175977_c1
3599 nmdc:mga07m45_3560_c1
3600 nmdc:mga07m45_83115_c1
3601 nmdc:mga05p37_290_c1
3602 nmdc:mga05p37_357878_c1
3603 nmdc:mga05p37_46125_c1
3604 nmdc:mga05p37_58061_c1
3605 nmdc:mga09592_154530_c1
3606 nmdc:mga09592_2994_c1
3607 nmdc:mga0qj67_16217_c1
3608 nmdc:mga0qj67_2739_c1
3609 nmdc:mga0qj67_412_c1
3610 nmdc:mga06r32_2029_c1
3611 nmdc:mga06r32_475583_c1
3612 nmdc:mga08y16_126862_c1
3613 nmdc:mga08y16_1898_c1
3614 nmdc:mga08y16_2825_c1
3615 nmdc:mga08y16_844_c1
3616 nmdc:mga0n895_1061_c1
3617 nmdc:mga0n895_113418_c1
3618 nmdc:mga0n895_134613_c1
3619 nmdc:mga0n895_20783_c1
3620 nmdc:mga0n895_22046_c1
3621 nmdc:mga0n895_22082_c1
3622 nmdc:mga0n895_62410_c1
3623 nmdc:mga0rr50_276383_c1
3624 nmdc:mga0rr50_3611_c1
3625 nmdc:mga0rr50_6009_c1
3626 nmdc:mga08x19_80718_c1
3627 nmdc:mga0a205_3382_c1
3628 nmdc:mga0a205_8902_c1
3629 nmdc:mga0a205_9541_c1
3630 nmdc:mga0sz30_12054_c1
3631 nmdc:mga0sz30_18686_c1
3632 nmdc:mga0sz30_39804_c1
3633 Ga0495601_0001939
3634 Ga0495601_0002428
3635 Ga0495601_0004177
3636 Ga0495601_0074964
3637 Ga0495601_0150692
3638 Ga0495601_0229984
3639 Ga0495612_0003279
3640 Ga0495612_0003991
3641 Ga0495612_0008348
3642 Ga0495612_0014886
3643 Ga0495612_0027096
3644 Ga0495655_0005062
3645 Ga0495595_0000430
3646 Ga0495595_0002807
3647 Ga0495595_0003742
3648 Ga0495595_0011462
3649 Ga0495595_0011494
3650 Ga0495595_0028290
3651 Ga0495595_0028986
3652 Ga0495595_0029997
3653 Ga0495619_0000259
3654 Ga0495619_0000719
3655 Ga0495619_0006574
3656 Ga0495619_0007799
3657 Ga0495619_0007804
3658 Ga0495619_0009420
3659 Ga0495619_0022954
3660 Ga0495619_0047265
3661 Ga0495619_0048438
3662 Ga0495619_0073760
3663 Ga0500643_000076
3664 Ga0500643_002781
3665 Ga0500646_0011073
3666 Ga0500583_0014448
3667 Ga0500651_0011112
3668 Ga0500651_0152144
3669 Ga0500566_0000314
3670 Ga0500566_0002194
3671 Ga0500566_0085944
3672 Ga0500641_0018283
3673 Ga0500641_0019444
3674 Ga0500641_0038156
3675 Ga0500641_0042427
3676 Ga0500554_000886
3677 Ga0500555_020392
3678 Ga0500556_0000006
3679 Ga0500556_0000601
3680 Ga0500557_000059
3681 Ga0500562_005330
3682 Ga0500595_000001
3683 Ga0500595_000506
3684 Ga0500595_001968
3685 Ga0500595_008320
3686 Ga0500642_0000004
3687 Ga0500642_0000226
3688 Ga0500642_0011908
3689 Ga0500642_0084177
3690 Ga0500652_000033
3691 Ga0500652_009006
3692 Ga0500655_016310
3693 Ga0500658_0028460
3694 Ga0500559_0003127
3695 Ga0500559_0031663
3696 Ga0500568_0002010
3697 Ga0500568_0026877
3698 Ga0500568_0053198
3699 Ga0500577_0009852
3700 Ga0500590_047066
3701 Ga0500590_141494
3702 Ga0500604_0007979
3703 Ga0500616_0000001
3704 Ga0500616_0000022
3705 Ga0500616_0009597
3706 Ga0500616_0046260
3707 Ga0500616_0060370
3708 Ga0500619_049698
3709 Ga0500622_0001425
3710 Ga0500638_020622
3711 Ga0500638_072191
3712 Ga0500636_0000309
3713 Ga0500636_0017136
3714 Ga0500636_0024605
3715 Ga0500637_0000542
3716 Ga0500637_0053050
3717 Ga0500567_027363
3718 Ga0500625_009898
3719 Ga0500645_000189
3720 Ga0500645_003077
3721 Ga0500645_024562
3722 Ga0500609_001592
3723 Ga0500599_004040
3724 Ga0500601_000066
3725 Ga0501084_0021239
3726 Ga0501084_0050807
3727 Ga0501084_0064310
3728 Ga0501084_0114426
3729 Ga0501084_0162878
3730 Ga0501084_0170223
3731 Ga0500661_000578
3732 Ga0500661_013556
3733 Ga0501082_0027087
3734 Ga0501082_0034241
3735 Ga0501082_0046452
3736 Ga0501082_0055319
3737 Ga0501082_0059259
3738 Ga0501082_0086528
3739 Ga0501082_0105184
3740 Ga0501082_0308790
3741 Ga0501082_0372016
3742 Ga0530510_0048974
3743 2917554979
3744 2507505334
3745 2508539223
3746 2508695544
3747 2511401171
3748 2513591209
3749 2513625402
3750 2513642080
3751 2513651454
3752 2513675077
3753 2513695163
3754 2513699919
3755 2513718120
3756 2513873469
3757 2513888834
3758 2514012547
3759 2515627502
3760 2517107168
3761 2524440827
3762 2524469524
3763 2528854047
3764 2603858579
3765 2617352455
3766 2617373819
3767 2643758153
3768 2644290986
3769 2723841691
3770 2745081753
3771 2793062109
3772 2793073615
3773 2793080874
3774 2805915551
3775 2818237712
3776 2824604522
3777 2824616682
3778 2824631657
3779 2824671217
3780 2824695939
3781 2824732503
3782 2824748638
3783 2824763571
3784 2824772698
3785 2824779831
3786 2828309374
3787 2841945264
3788 2841952045
3789 2841965562
3790 2841970561
3791 2841981810
3792 2841985088
3793 2842043445
3794 2842052565
3795 2844315400
3796 2847931136
3797 2847942217
3798 2849083090
3799 2857511988
3800 2857526297
3801 2874594506
3802 2874624852
3803 2874628725
3804 2874649878
3805 2876770964
3806 2876773998
3807 2876809950
3808 2876821878
3809 2879078278
3810 2879085971
3811 2879105962
3812 2879112226
3813 2879130538
3814 2879147186
3815 2881365261
3816 2881668125
3817 2885370965
3818 2885392677
3819 2885415729
3820 2888379524
3821 2888390623
3822 2888420244
3823 2889793289
3824 2893067431
3825 2903732260
3826 2903754693
3827 2903777734
3828 2904670193
3829 2904691132
3830 2904713247
3831 2906604338
3832 2906613940
3833 2906628501
3834 2906652108
3835 2908756526
3836 2908776336
3837 2919073851
3838 2919452221
3839 2922363947
3840 2922369515
3841 2922392526
3842 2922394298
3843 2929618663
3844 2929628652
3845 2932790841
3846 2932794254
3847 2932808152
3848 2932812106
3849 2932823096
3850 2932833528
3851 2933580626
3852 2935615666
3853 2935623084
3854 2935644159
3855 2935653556
3856 2935662305
3857 2935672259
3858 2935679218
3859 2935686462
3860 2935700242
3861 2935710191
3862 2935716150
3863 2935723726
3864 2935735281
3865 2935743928
3866 2935752428
3867 2935763476
3868 2935772980
3869 2935783231
3870 2935788032
3871 2935808183
3872 2935816204
3873 2935825535
3874 2935833597
3875 2935844550
3876 2935853324
3877 2935861332
3878 2935869451
3879 2935879780
3880 2935890031
3881 2935914797
3882 2935918773
3883 2935931510
3884 2935940107
3885 2935947546
3886 2935956318
3887 2935962699
3888 2935973111
3889 2935980644
3890 2935985205
3891 2935997997
3892 2936008737
3893 2936016607
3894 2936025240
3895 2936034082
3896 2936041209
3897 2936052139
3898 2936056377
3899 2940558341
3900 2941535453
3901 2941543265
3902 3005489008
3903 3005509102
3904 3005591579
3905 3005595118
3906 3005711057
3907 3005718365
3908 8001845898
3909 8006967510
3910 8006990975
3911 8007000310
3912 8016518120
3913 8016544130
3914 8016549179
3915 8016557604
3916 8016569533
3917 8016582143
3918 8016586298
3919 8016606492
3920 8016618393
3921 8016623040
3922 8017058524
3923 8019531103
3924 8019540452
3925 8019550043
3926 8019577167
3927 8019595241
3928 8019612012
3929 8019623034
3930 8019630065
3931 8019640544
3932 8019652403
3933 8019676661
3934 8019679332
3935 8019696177
3936 8055742513
3937 8056691016
3938 8056971351

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00814

TsaD

tRNA N6-adenosine threonylcarbamoyltransferase

26

316

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
4wq5-assembly1.cif.gz_A ygjd(v85e)-yeaz heterodimer in complex with atp 0.9449 1 341
4wq5-assembly1.cif.gz_A ygjd(v85e)-yeaz heterodimer in complex with atp 0.9421 1 341
4ydu-assembly1.cif.gz_A crystal structure of e. coli ygjd-yeaz heterodimer in complex with adp 0.9394 1 342
4wq4-assembly2.cif.gz_B e. coli ygjd(e12a)-yeaz heterodimer in complex with atp 0.9386 1 342
3zeu-assembly2.cif.gz_B structure of a salmonella typhimurium ygjd-yeaz heterodimer bound to atpgammas 0.937 1 342
ID Description Score Start End Superfamily
af_Q2FWL2_8_131_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9579 6 131 3.30.420.40
af_O94710_43_179_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9495 6 133 3.30.420.40
af_Q32LQ3_26_143_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9478 3 122 3.30.420.40
3zeuB02 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9451 132 301 3.30.420.40
af_A0A1D6MRI9_77_194_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.9432 4 124 3.30.420.40
ID Description Score Start End GO Terms
AF-A0A537TKF1-F1-model_v4 N(6)-L-threonylcarbamoyladenine synthase (EC 2.3.1.234) 0.9955 108 340 GO:0008033
GO:0046872
GO:0061711
AF-B1Z700-F1-model_v4 tRNA N6-adenosine threonylcarbamoyltransferase (EC 2.3.1.234) (N6-L-threonylcarbamoyladenine synthase) (t(6)A synthase) (t(6)A37 threonylcarbamoyladenosine biosynthesis protein TsaD) (tRNA threonylcarbamoyladenosine biosynthesis protein TsaD) 0.9857 1 342 GO:0002949
GO:0005506
GO:0005737
GO:0061711
AF-A0A534P8N4-F1-model_v4 N(6)-L-threonylcarbamoyladenine synthase (EC 2.3.1.234) 0.9851 1 113 GO:0008033
GO:0046872
GO:0061711
AF-A0A529W6E4-F1-model_v4 N(6)-L-threonylcarbamoyladenine synthase (EC 2.3.1.234) 0.9841 1 101 GO:0008033
GO:0046872
GO:0061711
AF-A0A849TMG7-F1-model_v4 N(6)-L-threonylcarbamoyladenine synthase (EC 2.3.1.234) 0.9835 1 265 GO:0002949
GO:0016746
GO:0046872

Map