F496172
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1969 | 744 | 3938 | 359 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2917554339|2917554979 |
| Length | 357 |
| Sequence | LVLGLETSCDETAAAVVARDADGRGRILSNVVLSQVEAHAAFGGVVPEVAARAHVEAIDGVVRAALTEAGVALSAVDAVAATAGPGLIGGVLVGLTTAKALAFAAGKPLVAVNHLEGHALTARLTDGVAFPYLLLLVSGGHTQIVRVDGVGRYRRLGTTIDDALGEAFDKTAKLLGLGYPGGPAVERAAAAGDPSRFALPRPMTGRKAPDFSFSGLKTAVRLEAEAAAPLGPKDVADLCAAFQAAVGDVVADRVGIALRAFRADAADVQPVLVVAGGVAANRSIAARLRGLADREGARLIVPPLALCTDNGAMIAWAGAERLALGLHDDLAAPARARWPLDGDTAPVVGHGRLGAKV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2209111006 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 | Metagenome | Rhizosphere |
| 2 | 3300000042 | Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young | Metagenome | Rhizosphere |
| 3 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 4 | 3300000045 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere | Metagenome | Rhizosphere |
| 5 | 3300000549 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled | Metagenome | Rhizosphere |
| 6 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 7 | 3300001430 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 | Metagenome | Rhizosphere |
| 8 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 9 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 10 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 11 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 12 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 13 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 14 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 15 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 16 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 17 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 18 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 19 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 20 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 21 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 22 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 23 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 24 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 28 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 31 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 35 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 37 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 48 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 59 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 63 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 64 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 65 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 66 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 67 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 69 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 70 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 71 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 73 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 74 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 78 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 79 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 81 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 82 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 83 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 85 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 86 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 87 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 88 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 89 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 90 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 91 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 92 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 93 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 94 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 95 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 96 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 97 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 98 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 99 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 100 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 101 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 102 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 103 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 104 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 105 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 106 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 107 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 108 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 109 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 110 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 111 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 112 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 114 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 115 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 116 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 117 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 118 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 119 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 120 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 121 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 122 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 123 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 125 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 126 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 127 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 128 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 129 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 130 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 137 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 139 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 140 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 141 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 142 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 143 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 144 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 145 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 146 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 147 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 148 | 3300012481 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610 | Metagenome | Rhizosphere |
| 149 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 153 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 155 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 156 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 157 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 158 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 159 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 160 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 161 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 162 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 163 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 164 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 165 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 166 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 167 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 168 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 169 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 170 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 171 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 172 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 173 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 174 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 175 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 176 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 177 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 178 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 180 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 181 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 182 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 183 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 184 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 252 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 253 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 254 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 255 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 258 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 259 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 260 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 261 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 262 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 263 | 3300028023 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 | Metagenome | Rhizosphere |
| 264 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 265 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 266 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 267 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 268 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 269 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 270 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 271 | 3300030763 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 272 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 273 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 274 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 275 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 276 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 277 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 278 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 279 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 280 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 281 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 282 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 283 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 284 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 285 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 286 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 287 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 288 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 289 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 290 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 291 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 292 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 293 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 294 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 295 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 296 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 297 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 298 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 299 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 300 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 301 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 302 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 303 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 304 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 305 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 306 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 307 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 308 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 309 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 310 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 311 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 312 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 313 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 314 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 315 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 316 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 317 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 318 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 319 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 320 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 321 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 322 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 323 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 324 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 325 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 326 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 327 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 328 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 329 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 330 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 331 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 332 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 333 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 334 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 335 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 336 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 337 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 338 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 339 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 340 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 341 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 342 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 343 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 344 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 345 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 346 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 347 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 348 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 349 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 350 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 351 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 352 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 353 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 354 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 355 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 356 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 357 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 358 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 422 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 423 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 424 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 425 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 426 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 427 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 428 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 429 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 430 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 431 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 432 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 433 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 434 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 435 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 436 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 437 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 438 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 439 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 440 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 441 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 442 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 443 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 444 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 445 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 446 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 447 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 448 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 449 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 450 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 451 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 452 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 453 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 454 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 455 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 456 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 457 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 458 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 459 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 460 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 461 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 462 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 463 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 464 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 465 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 466 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 467 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 468 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 469 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 470 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 471 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 472 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 473 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 474 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 475 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 476 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 477 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 478 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 479 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 480 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 481 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 482 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 483 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 484 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 485 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 486 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 487 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 488 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 489 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 490 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 491 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 492 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 493 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 494 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 495 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 496 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 497 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 498 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 499 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 500 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 501 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 502 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 503 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 504 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 505 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 506 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 507 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 508 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 509 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 510 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 511 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 512 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 513 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 514 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 515 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 516 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 517 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 518 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 519 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 520 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 521 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 522 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 523 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 524 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 525 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 526 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 527 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 528 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 529 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 530 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 531 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 532 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 533 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 534 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 535 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 536 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 537 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 538 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 539 | 3300053723 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere | Metagenome | Endosphere |
| 540 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 541 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 542 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 543 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 544 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 545 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 546 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 547 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 548 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 549 | 2917554339 | Chthonobacter rhizosphaerae yh7-1 | Isolate | Rhizosphere |
| 550 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 551 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 552 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 553 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 554 | 2513237087 | Azorhizobium doebereinerae UFLA1-100 | Isolate | Nodule |
| 555 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 556 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 557 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 558 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 559 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 560 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 561 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 562 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 563 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 564 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 565 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 566 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 567 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 568 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 569 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 570 | 2602042107 | Bradyrhizobium sp. NFR13 | Isolate | Rhizoplane |
| 571 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 572 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 573 | 2643221547 | Pseudolabrys sp. Root1462 | Isolate | Unclassified |
| 574 | 2643221651 | Afipia sp. Root123D2 | Isolate | Unclassified |
| 575 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 576 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 577 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 578 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 579 | 2791355199 | |||
| 580 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 581 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 582 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 583 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 584 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 585 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 586 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 587 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 588 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 589 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 590 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 591 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 592 | 2828305725 | Xanthobacter tagetidis DSM 11105 | Isolate | Unclassified |
| 593 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 594 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 595 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 596 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 597 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 598 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 599 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 600 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 601 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 602 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 603 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 604 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 605 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 606 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 607 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 608 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 609 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 610 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 611 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 612 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 613 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 614 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 615 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 616 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 617 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 618 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 619 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 620 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 621 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 622 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 623 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 624 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 625 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 626 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 627 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 628 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 629 | 2889790730 | Chelativorans xinjiangense lm93 | Isolate | Rhizosphere |
| 630 | 2893066018 | Tardiphaga sp. P9-11 | Isolate | Unclassified |
| 631 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 632 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 633 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 634 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 635 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 636 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 637 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 638 | 2906610324 | |||
| 639 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 640 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 641 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 642 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 643 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 644 | 2919450847 | Ancylobacter sp. 3268 | Isolate | Rhizosphere |
| 645 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 646 | 2922368715 | |||
| 647 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 648 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 649 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 650 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 651 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 652 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 653 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 654 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 655 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 656 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 657 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 658 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 659 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 660 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 661 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 662 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 663 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 664 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 665 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 666 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 667 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 668 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 669 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 670 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 671 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 672 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 673 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 674 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 675 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 676 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 677 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 678 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 679 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 680 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 681 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 682 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 683 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 684 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 685 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 686 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 687 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 688 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 689 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 690 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 691 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 692 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 693 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 694 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 695 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 696 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 697 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 698 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 699 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 700 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 701 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 702 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 703 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 704 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 705 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 706 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 707 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 708 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 709 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 710 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 711 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 712 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 713 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 714 | 8001845381 | Ancylobacter sonchi VKM B-3145 | Isolate | Unclassified |
| 715 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 716 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 717 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 718 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 719 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 720 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 721 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 722 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 723 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 724 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 725 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 726 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 727 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 728 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 729 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 730 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 731 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 732 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 733 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 734 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 735 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 736 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 737 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 738 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 739 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 740 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 741 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 742 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 743 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
| 744 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 89.98 |
| Metatranscriptomes | 0.2 |
| Isolates | 9.82 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7.21 |
| Nodule | 7.87 |
| Rhizoplane | 6.96 |
| Rhizosphere | 72.02 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | 2214911852 | 2209111006 | Bacteria | 7073 |
| 2 | ARSoilYngRDRAFT_c00080 | 3300000042 | Bacteria | 16083 |
| 3 | ARcpr5yngRDRAFT_c000055 | 3300000043 | Bacteria | 18216 |
| 4 | ARCol0oldRDRAFT_c00230 | 3300000045 | Bacteria | 5194 |
| 5 | LJQas_1007647 | 3300000549 | Bacteria | 1326 |
| 6 | ARCol0yngRDRAFT_1000007 | 3300000652 | Bacteria | 46089 |
| 7 | JGI24032J14994_100153 | 3300001430 | Bacteria | 3352 |
| 8 | JGI24752J21851_1003516 | 3300001976 | Bacteria | 2064 |
| 9 | JGI24737J22298_10000509 | 3300001990 | Bacteria | 13587 |
| 10 | JGI24750J21931_1001269 | 3300002070 | Bacteria | 3185 |
| 11 | JGI24738J21930_10000120 | 3300002075 | Bacteria | 18716 |
| 12 | JGI24035J26624_1000291 | 3300002126 | Bacteria | 4658 |
| 13 | JGI24033J26618_1000558 | 3300002155 | Bacteria | 3589 |
| 14 | JGI24034J26672_10000187 | 3300002239 | Bacteria | 8364 |
| 15 | JGI24742J22300_10000029 | 3300002244 | Bacteria | 23366 |
| 16 | JGI25406J46586_10006206 | 3300003203 | Bacteria | 5518 |
| 17 | JGI25406J46586_10011555 | 3300003203 | Bacteria | 3870 |
| 18 | JGI25153J46596_10001726 | 3300003215 | Bacteria | 12962 |
| 19 | JGI25153J46596_10001794 | 3300003215 | Bacteria | 12730 |
| 20 | JGI25153J46596_10007254 | 3300003215 | Bacteria | 5483 |
| 21 | JGI25153J46596_10009299 | 3300003215 | Bacteria | 4589 |
| 22 | JGI25160J50197_1000637 | 3300003354 | Bacteria | 19539 |
| 23 | JGI25160J50197_1002896 | 3300003354 | Bacteria | 7854 |
| 24 | Ga0055531_10003548 | 3300003794 | Bacteria | 9902 |
| 25 | Ga0065165_1001452 | 3300005262 | Bacteria | 25650 |
| 26 | Ga0065165_1006072 | 3300005262 | Bacteria | 6478 |
| 27 | Ga0065165_1015074 | 3300005262 | Bacteria | 2964 |
| 28 | Ga0065165_1017160 | 3300005262 | Bacteria | 2679 |
| 29 | Ga0065704_10096592 | 3300005289 | Bacteria | 2434 |
| 30 | Ga0065712_10000690 | 3300005290 | Bacteria | 10070 |
| 31 | Ga0065712_10001626 | 3300005290 | Bacteria | 6725 |
| 32 | Ga0065715_10001262 | 3300005293 | Bacteria | 15576 |
| 33 | Ga0065715_10008806 | 3300005293 | Bacteria | 2738 |
| 34 | Ga0070658_10015046 | 3300005327 | Bacteria | 6193 |
| 35 | Ga0070658_10019709 | 3300005327 | Bacteria | 5401 |
| 36 | Ga0070658_10034887 | 3300005327 | Bacteria | 4049 |
| 37 | Ga0070676_10003502 | 3300005328 | Bacteria | 8194 |
| 38 | Ga0070676_10074001 | 3300005328 | Bacteria | 2051 |
| 39 | Ga0070676_10102198 | 3300005328 | Bacteria | 1773 |
| 40 | Ga0070683_100000116 | 3300005329 | Bacteria | 51956 |
| 41 | Ga0070683_100031209 | 3300005329 | Bacteria | 4843 |
| 42 | Ga0070683_100113145 | 3300005329 | Bacteria | 2561 |
| 43 | Ga0070683_100138935 | 3300005329 | Bacteria | 2301 |
| 44 | Ga0070690_100005618 | 3300005330 | Bacteria | 7057 |
| 45 | Ga0070690_100014607 | 3300005330 | Bacteria | 4660 |
| 46 | Ga0070690_100210064 | 3300005330 | Bacteria | 1358 |
| 47 | Ga0070670_100006964 | 3300005331 | Bacteria | 9582 |
| 48 | Ga0070670_100017200 | 3300005331 | Bacteria | 6203 |
| 49 | Ga0070670_100125130 | 3300005331 | Bacteria | 2219 |
| 50 | Ga0070670_100163497 | 3300005331 | Bacteria | 1929 |
| 51 | Ga0070670_100184120 | 3300005331 | Bacteria | 1813 |
| 52 | Ga0070670_100185074 | 3300005331 | Bacteria | 1808 |
| 53 | Ga0070677_10000097 | 3300005333 | Bacteria | 28703 |
| 54 | Ga0068869_100002566 | 3300005334 | Bacteria | 10965 |
| 55 | Ga0068869_100129609 | 3300005334 | Bacteria | 1937 |
| 56 | Ga0068869_100146062 | 3300005334 | Bacteria | 1830 |
| 57 | Ga0068869_100188240 | 3300005334 | Bacteria | 1622 |
| 58 | Ga0070666_10003937 | 3300005335 | Bacteria | 9018 |
| 59 | Ga0070666_10050475 | 3300005335 | Bacteria | 2798 |
| 60 | Ga0070666_10183415 | 3300005335 | Bacteria | 1469 |
| 61 | Ga0070680_100013619 | 3300005336 | Bacteria | 6338 |
| 62 | Ga0070680_100022146 | 3300005336 | Bacteria | 5055 |
| 63 | Ga0070680_100041923 | 3300005336 | Bacteria | 3712 |
| 64 | Ga0070680_100047006 | 3300005336 | Bacteria | 3513 |
| 65 | Ga0070680_100066975 | 3300005336 | Bacteria | 2945 |
| 66 | Ga0070680_100151413 | 3300005336 | Bacteria | 1947 |
| 67 | Ga0070680_100218103 | 3300005336 | Bacteria | 1610 |
| 68 | Ga0070682_100001635 | 3300005337 | Bacteria | 12449 |
| 69 | Ga0068868_100028104 | 3300005338 | Bacteria | 4297 |
| 70 | Ga0068868_100035020 | 3300005338 | Bacteria | 3879 |
| 71 | Ga0068868_100064549 | 3300005338 | Bacteria | 2907 |
| 72 | Ga0070660_100009547 | 3300005339 | Bacteria | 6832 |
| 73 | Ga0070660_100021366 | 3300005339 | Bacteria | 4772 |
| 74 | Ga0070660_100031050 | 3300005339 | Bacteria | 4010 |
| 75 | Ga0070660_100247606 | 3300005339 | Bacteria | 1453 |
| 76 | Ga0070689_100000461 | 3300005340 | Bacteria | 24086 |
| 77 | Ga0070691_10000048 | 3300005341 | Bacteria | 33217 |
| 78 | Ga0070687_100002383 | 3300005343 | Bacteria | 7019 |
| 79 | Ga0070687_100091231 | 3300005343 | Bacteria | 1686 |
| 80 | Ga0070661_100000228 | 3300005344 | Bacteria | 46622 |
| 81 | Ga0070661_100059239 | 3300005344 | Bacteria | 2807 |
| 82 | Ga0070692_10000050 | 3300005345 | Bacteria | 22340 |
| 83 | Ga0070668_100010524 | 3300005347 | Bacteria | 6877 |
| 84 | Ga0070668_100022397 | 3300005347 | Bacteria | 4775 |
| 85 | Ga0070668_100108131 | 3300005347 | Bacteria | 2211 |
| 86 | Ga0070668_100110742 | 3300005347 | Bacteria | 2185 |
| 87 | Ga0070669_100031291 | 3300005353 | Bacteria | 3844 |
| 88 | Ga0070669_100047132 | 3300005353 | Bacteria | 3144 |
| 89 | Ga0070669_100065519 | 3300005353 | Bacteria | 2676 |
| 90 | Ga0070669_100091246 | 3300005353 | Bacteria | 2284 |
| 91 | Ga0070669_100251401 | 3300005353 | Bacteria | 1407 |
| 92 | Ga0070675_100000503 | 3300005354 | Bacteria | 26846 |
| 93 | Ga0070675_100104609 | 3300005354 | Bacteria | 2388 |
| 94 | Ga0070671_100000720 | 3300005355 | Bacteria | 23686 |
| 95 | Ga0070671_100056367 | 3300005355 | Bacteria | 3269 |
| 96 | Ga0070671_100124906 | 3300005355 | Bacteria | 2166 |
| 97 | Ga0070671_100170681 | 3300005355 | Bacteria | 1839 |
| 98 | Ga0070674_100000570 | 3300005356 | Bacteria | 18571 |
| 99 | Ga0070674_100093821 | 3300005356 | Bacteria | 2172 |
| 100 | Ga0070673_100000045 | 3300005364 | Bacteria | 50756 |
| 101 | Ga0070673_100003240 | 3300005364 | Bacteria | 10097 |
| 102 | Ga0070688_100000308 | 3300005365 | Bacteria | 24884 |
| 103 | Ga0070688_100039274 | 3300005365 | Bacteria | 2896 |
| 104 | Ga0070688_100086423 | 3300005365 | Bacteria | 2040 |
| 105 | Ga0070688_100102450 | 3300005365 | Bacteria | 1890 |
| 106 | Ga0070688_100231664 | 3300005365 | Bacteria | 1307 |
| 107 | Ga0070659_100000183 | 3300005366 | Bacteria | 47789 |
| 108 | Ga0070659_100009946 | 3300005366 | Bacteria | 6996 |
| 109 | Ga0070659_100047796 | 3300005366 | Bacteria | 3359 |
| 110 | Ga0070659_100059804 | 3300005366 | Bacteria | 3009 |
| 111 | Ga0070659_100110299 | 3300005366 | Bacteria | 2221 |
| 112 | Ga0070667_100003874 | 3300005367 | Bacteria | 12703 |
| 113 | Ga0070667_100055839 | 3300005367 | Bacteria | 3334 |
| 114 | Ga0070667_100068432 | 3300005367 | Bacteria | 3021 |
| 115 | Ga0070709_10003045 | 3300005434 | Bacteria | 8994 |
| 116 | Ga0070709_10074808 | 3300005434 | Bacteria | 2196 |
| 117 | Ga0070709_10076543 | 3300005434 | Bacteria | 2173 |
| 118 | Ga0070709_10126515 | 3300005434 | Bacteria | 1739 |
| 119 | Ga0070709_10207040 | 3300005434 | Bacteria | 1392 |
| 120 | Ga0070714_100006355 | 3300005435 | Bacteria | 9113 |
| 121 | Ga0070714_100020893 | 3300005435 | Bacteria | 5352 |
| 122 | Ga0070714_100021163 | 3300005435 | Bacteria | 5318 |
| 123 | Ga0070714_100032110 | 3300005435 | Bacteria | 4383 |
| 124 | Ga0070714_100056532 | 3300005435 | Bacteria | 3356 |
| 125 | Ga0070714_100062909 | 3300005435 | Bacteria | 3190 |
| 126 | Ga0070714_100271604 | 3300005435 | Bacteria | 1572 |
| 127 | Ga0070713_100007601 | 3300005436 | Bacteria | 7624 |
| 128 | Ga0070713_100009557 | 3300005436 | Bacteria | 6952 |
| 129 | Ga0070713_100016407 | 3300005436 | Bacteria | 5568 |
| 130 | Ga0070713_100074482 | 3300005436 | Bacteria | 2876 |
| 131 | Ga0070713_100218875 | 3300005436 | Bacteria | 1727 |
| 132 | Ga0070713_100261749 | 3300005436 | Bacteria | 1581 |
| 133 | Ga0070710_10002948 | 3300005437 | Bacteria | 8080 |
| 134 | Ga0070710_10005418 | 3300005437 | Bacteria | 6059 |
| 135 | Ga0070710_10006006 | 3300005437 | Bacteria | 5800 |
| 136 | Ga0070710_10033282 | 3300005437 | Bacteria | 2798 |
| 137 | Ga0070710_10039227 | 3300005437 | Bacteria | 2605 |
| 138 | Ga0070701_10002546 | 3300005438 | Bacteria | 7056 |
| 139 | Ga0070701_10020704 | 3300005438 | Bacteria | 3126 |
| 140 | Ga0070701_10123381 | 3300005438 | Bacteria | 1463 |
| 141 | Ga0070711_100000599 | 3300005439 | Bacteria | 18773 |
| 142 | Ga0070711_100014115 | 3300005439 | Bacteria | 5028 |
| 143 | Ga0070711_100016274 | 3300005439 | Bacteria | 4721 |
| 144 | Ga0070711_100017625 | 3300005439 | Bacteria | 4549 |
| 145 | Ga0070711_100022586 | 3300005439 | Bacteria | 4079 |
| 146 | Ga0070711_100049014 | 3300005439 | Bacteria | 2891 |
| 147 | Ga0070711_100217366 | 3300005439 | Bacteria | 1483 |
| 148 | Ga0070705_100001770 | 3300005440 | Bacteria | 11188 |
| 149 | Ga0070700_100000239 | 3300005441 | Bacteria | 30133 |
| 150 | Ga0070694_100003730 | 3300005444 | Bacteria | 9088 |
| 151 | Ga0070694_100164114 | 3300005444 | Bacteria | 1632 |
| 152 | Ga0070708_100182315 | 3300005445 | Bacteria | 1963 |
| 153 | Ga0070663_100000328 | 3300005455 | Bacteria | 24676 |
| 154 | Ga0070663_100000390 | 3300005455 | Bacteria | 23042 |
| 155 | Ga0070663_100024158 | 3300005455 | Bacteria | 4085 |
| 156 | Ga0070663_100073835 | 3300005455 | Bacteria | 2489 |
| 157 | Ga0070663_100137505 | 3300005455 | Bacteria | 1861 |
| 158 | Ga0070663_100188839 | 3300005455 | Bacteria | 1603 |
| 159 | Ga0070678_100000576 | 3300005456 | Bacteria | 17985 |
| 160 | Ga0070678_100043325 | 3300005456 | Bacteria | 3205 |
| 161 | Ga0070678_100086322 | 3300005456 | Bacteria | 2393 |
| 162 | Ga0070681_10000933 | 3300005458 | Bacteria | 24595 |
| 163 | Ga0070681_10015684 | 3300005458 | Bacteria | 7549 |
| 164 | Ga0070681_10036877 | 3300005458 | Bacteria | 4908 |
| 165 | Ga0070681_10078407 | 3300005458 | Bacteria | 3260 |
| 166 | Ga0070681_10102279 | 3300005458 | Bacteria | 2810 |
| 167 | Ga0068867_100147962 | 3300005459 | Bacteria | 1842 |
| 168 | Ga0070685_10003069 | 3300005466 | Bacteria | 8508 |
| 169 | Ga0070685_10013737 | 3300005466 | Bacteria | 4277 |
| 170 | Ga0070685_10019816 | 3300005466 | Bacteria | 3634 |
| 171 | Ga0070685_10125147 | 3300005466 | Bacteria | 1600 |
| 172 | Ga0070685_10142471 | 3300005466 | Bacteria | 1511 |
| 173 | Ga0070685_10257511 | 3300005466 | Bacteria | 1159 |
| 174 | Ga0070707_100047831 | 3300005468 | Bacteria | 4096 |
| 175 | Ga0070707_100314659 | 3300005468 | Bacteria | 1521 |
| 176 | Ga0070698_100039216 | 3300005471 | Bacteria | 4876 |
| 177 | Ga0070699_100004245 | 3300005518 | Bacteria | 12669 |
| 178 | Ga0070679_100005744 | 3300005530 | Bacteria | 11509 |
| 179 | Ga0070679_100016653 | 3300005530 | Bacteria | 7100 |
| 180 | Ga0070679_100058275 | 3300005530 | Bacteria | 3848 |
| 181 | Ga0070679_100073903 | 3300005530 | Bacteria | 3400 |
| 182 | Ga0070679_100113836 | 3300005530 | Bacteria | 2690 |
| 183 | Ga0070679_100135947 | 3300005530 | Bacteria | 2439 |
| 184 | Ga0070679_100191906 | 3300005530 | Bacteria | 2011 |
| 185 | Ga0070679_100390868 | 3300005530 | Bacteria | 1337 |
| 186 | Ga0070684_100000352 | 3300005535 | Bacteria | 31642 |
| 187 | Ga0070684_100006584 | 3300005535 | Bacteria | 8997 |
| 188 | Ga0070684_100020670 | 3300005535 | Bacteria | 5460 |
| 189 | Ga0070684_100038063 | 3300005535 | Bacteria | 4130 |
| 190 | Ga0070684_100145709 | 3300005535 | Bacteria | 2143 |
| 191 | Ga0068853_100000902 | 3300005539 | Bacteria | 20677 |
| 192 | Ga0068853_100026207 | 3300005539 | Bacteria | 4894 |
| 193 | Ga0068853_100087721 | 3300005539 | Bacteria | 2730 |
| 194 | Ga0068853_100164786 | 3300005539 | Bacteria | 2002 |
| 195 | Ga0068853_100285634 | 3300005539 | Bacteria | 1522 |
| 196 | Ga0070672_100000016 | 3300005543 | Bacteria | 71848 |
| 197 | Ga0070686_100005714 | 3300005544 | Bacteria | 6892 |
| 198 | Ga0070686_100017851 | 3300005544 | Bacteria | 4153 |
| 199 | Ga0070686_100121576 | 3300005544 | Bacteria | 1793 |
| 200 | Ga0070695_100001458 | 3300005545 | Bacteria | 13124 |
| 201 | Ga0070695_100004098 | 3300005545 | Bacteria | 8517 |
| 202 | Ga0070696_100006179 | 3300005546 | Bacteria | 8004 |
| 203 | Ga0070696_100202216 | 3300005546 | Bacteria | 1483 |
| 204 | Ga0070693_100037529 | 3300005547 | Bacteria | 2702 |
| 205 | Ga0070665_100014898 | 3300005548 | Bacteria | 7804 |
| 206 | Ga0070665_100024748 | 3300005548 | Bacteria | 6048 |
| 207 | Ga0070665_100025556 | 3300005548 | Bacteria | 5949 |
| 208 | Ga0070665_100070182 | 3300005548 | Bacteria | 3510 |
| 209 | Ga0070665_100072923 | 3300005548 | Bacteria | 3441 |
| 210 | Ga0070665_100095421 | 3300005548 | Bacteria | 2979 |
| 211 | Ga0070665_100098599 | 3300005548 | Bacteria | 2927 |
| 212 | Ga0070665_100099991 | 3300005548 | Bacteria | 2904 |
| 213 | Ga0070665_100145785 | 3300005548 | Bacteria | 2370 |
| 214 | Ga0070704_100004902 | 3300005549 | Bacteria | 7767 |
| 215 | Ga0070704_100014046 | 3300005549 | Bacteria | 4991 |
| 216 | Ga0068855_100003504 | 3300005563 | Bacteria | 19223 |
| 217 | Ga0068855_100019804 | 3300005563 | Bacteria | 8084 |
| 218 | Ga0068855_100020035 | 3300005563 | Bacteria | 8031 |
| 219 | Ga0068855_100071356 | 3300005563 | Bacteria | 4039 |
| 220 | Ga0068855_100076667 | 3300005563 | Bacteria | 3879 |
| 221 | Ga0068855_100123814 | 3300005563 | Bacteria | 2957 |
| 222 | Ga0068855_100232988 | 3300005563 | Bacteria | 2061 |
| 223 | Ga0068855_100271037 | 3300005563 | Bacteria | 1887 |
| 224 | Ga0070664_100000067 | 3300005564 | Bacteria | 65201 |
| 225 | Ga0070664_100179259 | 3300005564 | Bacteria | 1882 |
| 226 | Ga0070664_100248730 | 3300005564 | Bacteria | 1598 |
| 227 | Ga0068857_100003331 | 3300005577 | Bacteria | 13366 |
| 228 | Ga0068857_100022002 | 3300005577 | Bacteria | 5611 |
| 229 | Ga0068854_100062790 | 3300005578 | Bacteria | 2695 |
| 230 | Ga0068854_100098345 | 3300005578 | Bacteria | 2190 |
| 231 | Ga0068854_100118938 | 3300005578 | Bacteria | 2003 |
| 232 | Ga0068856_100002341 | 3300005614 | Bacteria | 19506 |
| 233 | Ga0068856_100042629 | 3300005614 | Bacteria | 4464 |
| 234 | Ga0068856_100053053 | 3300005614 | Bacteria | 3999 |
| 235 | Ga0068856_100070685 | 3300005614 | Bacteria | 3453 |
| 236 | Ga0070702_100001107 | 3300005615 | Bacteria | 10796 |
| 237 | Ga0068852_100014075 | 3300005616 | Bacteria | 6140 |
| 238 | Ga0068852_100015623 | 3300005616 | Bacteria | 5896 |
| 239 | Ga0068852_100091383 | 3300005616 | Bacteria | 2724 |
| 240 | Ga0068852_100193773 | 3300005616 | Bacteria | 1919 |
| 241 | Ga0068852_100214060 | 3300005616 | Bacteria | 1829 |
| 242 | Ga0068859_100077162 | 3300005617 | Bacteria | 3373 |
| 243 | Ga0068859_100295653 | 3300005617 | Bacteria | 1712 |
| 244 | Ga0068864_100000234 | 3300005618 | Bacteria | 49663 |
| 245 | Ga0068864_100059635 | 3300005618 | Bacteria | 3302 |
| 246 | Ga0068864_100158116 | 3300005618 | Bacteria | 2058 |
| 247 | Ga0068866_10016142 | 3300005718 | Bacteria | 3332 |
| 248 | Ga0068861_100000241 | 3300005719 | Bacteria | 30096 |
| 249 | Ga0068861_100015670 | 3300005719 | Bacteria | 5348 |
| 250 | Ga0068861_100137862 | 3300005719 | Bacteria | 1988 |
| 251 | Ga0068861_100139783 | 3300005719 | Bacteria | 1975 |
| 252 | Ga0068851_10013343 | 3300005834 | Bacteria | 3890 |
| 253 | Ga0068851_10069059 | 3300005834 | Bacteria | 1825 |
| 254 | Ga0068851_10145527 | 3300005834 | Bacteria | 1292 |
| 255 | Ga0068870_10000009 | 3300005840 | Bacteria | 70353 |
| 256 | Ga0068870_10055073 | 3300005840 | Bacteria | 2118 |
| 257 | Ga0068863_100003248 | 3300005841 | Bacteria | 16072 |
| 258 | Ga0068863_100098163 | 3300005841 | Bacteria | 2782 |
| 259 | Ga0068863_100175337 | 3300005841 | Bacteria | 2057 |
| 260 | Ga0068863_100191047 | 3300005841 | Bacteria | 1968 |
| 261 | Ga0068858_100001548 | 3300005842 | Bacteria | 23613 |
| 262 | Ga0068860_100000508 | 3300005843 | Bacteria | 48302 |
| 263 | Ga0068860_100001050 | 3300005843 | Bacteria | 30441 |
| 264 | Ga0068860_100034650 | 3300005843 | Bacteria | 4843 |
| 265 | Ga0068860_100107472 | 3300005843 | Bacteria | 2666 |
| 266 | Ga0068860_100156416 | 3300005843 | Bacteria | 2197 |
| 267 | Ga0068862_100001143 | 3300005844 | Bacteria | 25122 |
| 268 | Ga0068862_100200451 | 3300005844 | Bacteria | 1799 |
| 269 | Ga0081455_10000002 | 3300005937 | Bacteria | 460472 |
| 270 | Ga0081455_10004068 | 3300005937 | Bacteria | 16566 |
| 271 | Ga0081455_10008760 | 3300005937 | Bacteria | 10474 |
| 272 | Ga0081455_10021942 | 3300005937 | Bacteria | 5980 |
| 273 | Ga0081455_10022833 | 3300005937 | Bacteria | 5834 |
| 274 | Ga0081455_10125580 | 3300005937 | Bacteria | 2014 |
| 275 | Ga0081455_10204121 | 3300005937 | Bacteria | 1478 |
| 276 | Ga0081540_1002394 | 3300005983 | Bacteria | 15299 |
| 277 | Ga0081540_1003646 | 3300005983 | Bacteria | 12081 |
| 278 | Ga0081540_1004307 | 3300005983 | Bacteria | 10902 |
| 279 | Ga0081540_1005999 | 3300005983 | Bacteria | 8950 |
| 280 | Ga0081540_1008954 | 3300005983 | Bacteria | 6930 |
| 281 | Ga0081540_1009843 | 3300005983 | Bacteria | 6538 |
| 282 | Ga0081540_1012693 | 3300005983 | Bacteria | 5526 |
| 283 | Ga0081540_1015357 | 3300005983 | Bacteria | 4851 |
| 284 | Ga0081540_1016330 | 3300005983 | Bacteria | 4651 |
| 285 | Ga0081540_1044846 | 3300005983 | Bacteria | 2252 |
| 286 | Ga0081539_10000265 | 3300005985 | Bacteria | 120457 |
| 287 | Ga0081539_10000966 | 3300005985 | Bacteria | 53690 |
| 288 | Ga0081539_10015864 | 3300005985 | Bacteria | 5434 |
| 289 | Ga0081539_10049888 | 3300005985 | Bacteria | 2371 |
| 290 | Ga0070717_10029553 | 3300006028 | Bacteria | 4397 |
| 291 | Ga0070717_10044938 | 3300006028 | Bacteria | 3609 |
| 292 | Ga0070717_10167557 | 3300006028 | Bacteria | 1909 |
| 293 | Ga0075365_10013341 | 3300006038 | Bacteria | 4910 |
| 294 | Ga0075365_10049882 | 3300006038 | Bacteria | 2759 |
| 295 | Ga0075365_10051135 | 3300006038 | Bacteria | 2728 |
| 296 | Ga0075368_10014896 | 3300006042 | Bacteria | 2878 |
| 297 | Ga0075363_100001175 | 3300006048 | Bacteria | 9625 |
| 298 | Ga0075363_100021411 | 3300006048 | Bacteria | 3256 |
| 299 | Ga0075363_100048774 | 3300006048 | Bacteria | 2253 |
| 300 | Ga0075363_100086490 | 3300006048 | Bacteria | 1721 |
| 301 | Ga0075364_10021970 | 3300006051 | Bacteria | 4025 |
| 302 | Ga0075364_10037508 | 3300006051 | Bacteria | 3139 |
| 303 | Ga0075364_10067636 | 3300006051 | Bacteria | 2349 |
| 304 | Ga0075364_10087356 | 3300006051 | Bacteria | 2066 |
| 305 | Ga0075432_10001464 | 3300006058 | Bacteria | 7696 |
| 306 | Ga0070715_10027530 | 3300006163 | Bacteria | 2272 |
| 307 | Ga0070716_100003613 | 3300006173 | Bacteria | 7309 |
| 308 | Ga0070716_100003799 | 3300006173 | Bacteria | 7162 |
| 309 | Ga0070716_100015416 | 3300006173 | Bacteria | 3926 |
| 310 | Ga0070712_100017531 | 3300006175 | Bacteria | 4637 |
| 311 | Ga0070712_100019139 | 3300006175 | Bacteria | 4459 |
| 312 | Ga0070712_100150895 | 3300006175 | Bacteria | 1784 |
| 313 | Ga0070712_100171105 | 3300006175 | Bacteria | 1685 |
| 314 | Ga0070712_100221306 | 3300006175 | Bacteria | 1499 |
| 315 | Ga0075362_10002382 | 3300006177 | Bacteria | 6298 |
| 316 | Ga0075362_10057222 | 3300006177 | Bacteria | 1757 |
| 317 | Ga0075367_10009497 | 3300006178 | Bacteria | 5088 |
| 318 | Ga0075367_10013375 | 3300006178 | Bacteria | 4410 |
| 319 | Ga0075367_10018489 | 3300006178 | Bacteria | 3846 |
| 320 | Ga0075367_10051257 | 3300006178 | Bacteria | 2439 |
| 321 | Ga0075369_10052055 | 3300006186 | Bacteria | 1774 |
| 322 | Ga0075427_10003015 | 3300006194 | Bacteria | 2295 |
| 323 | Ga0075366_10007698 | 3300006195 | Bacteria | 5965 |
| 324 | Ga0075366_10018053 | 3300006195 | Bacteria | 4072 |
| 325 | Ga0097621_100000569 | 3300006237 | Bacteria | 25928 |
| 326 | Ga0097621_100034909 | 3300006237 | Bacteria | 4014 |
| 327 | Ga0097621_100093302 | 3300006237 | Bacteria | 2522 |
| 328 | Ga0075370_10040354 | 3300006353 | Bacteria | 2632 |
| 329 | Ga0075370_10164691 | 3300006353 | Bacteria | 1302 |
| 330 | Ga0068871_100000012 | 3300006358 | Bacteria | 105267 |
| 331 | Ga0068871_100017133 | 3300006358 | Bacteria | 5475 |
| 332 | Ga0068871_100230754 | 3300006358 | Bacteria | 1606 |
| 333 | Ga0075428_100000797 | 3300006844 | Bacteria | 32864 |
| 334 | Ga0075428_100202612 | 3300006844 | Bacteria | 2145 |
| 335 | Ga0075430_100000045 | 3300006846 | Bacteria | 64983 |
| 336 | Ga0075430_100000509 | 3300006846 | Bacteria | 29219 |
| 337 | Ga0075430_100061183 | 3300006846 | Bacteria | 3164 |
| 338 | Ga0075431_100022535 | 3300006847 | Bacteria | 6440 |
| 339 | Ga0075431_100272852 | 3300006847 | Bacteria | 1713 |
| 340 | Ga0075431_100474964 | 3300006847 | Bacteria | 1244 |
| 341 | Ga0075433_10002970 | 3300006852 | Bacteria | 13023 |
| 342 | Ga0075433_10009693 | 3300006852 | Bacteria | 7712 |
| 343 | Ga0075433_10200207 | 3300006852 | Bacteria | 1776 |
| 344 | Ga0075434_100001007 | 3300006871 | Bacteria | 22897 |
| 345 | Ga0075434_100003473 | 3300006871 | Bacteria | 14090 |
| 346 | Ga0075434_100034517 | 3300006871 | Bacteria | 4995 |
| 347 | Ga0075434_100047837 | 3300006871 | Bacteria | 4244 |
| 348 | Ga0075434_100065389 | 3300006871 | Bacteria | 3622 |
| 349 | Ga0075434_100074246 | 3300006871 | Bacteria | 3394 |
| 350 | Ga0075434_100395196 | 3300006871 | Bacteria | 1403 |
| 351 | Ga0075429_100000214 | 3300006880 | Bacteria | 38983 |
| 352 | Ga0068865_100000209 | 3300006881 | Bacteria | 32559 |
| 353 | Ga0068865_100147074 | 3300006881 | Bacteria | 1783 |
| 354 | Ga0075436_100155156 | 3300006914 | Bacteria | 1612 |
| 355 | Ga0097620_100077157 | 3300006931 | Bacteria | 3373 |
| 356 | Ga0097620_100295636 | 3300006931 | Bacteria | 1712 |
| 357 | Ga0099824_1004485 | 3300006942 | Bacteria | 20097 |
| 358 | Ga0099824_1005993 | 3300006942 | Bacteria | 16885 |
| 359 | Ga0099822_1056885 | 3300006943 | Bacteria | 1409 |
| 360 | Ga0099823_1036201 | 3300006944 | Bacteria | 3805 |
| 361 | Ga0075435_100003730 | 3300007076 | Bacteria | 10380 |
| 362 | Ga0075435_100029012 | 3300007076 | Bacteria | 4342 |
| 363 | Ga0075435_100130294 | 3300007076 | Bacteria | 2104 |
| 364 | Ga0075435_100171867 | 3300007076 | Bacteria | 1828 |
| 365 | Ga0075435_100179585 | 3300007076 | Bacteria | 1789 |
| 366 | Ga0075435_100222601 | 3300007076 | Bacteria | 1602 |
| 367 | Ga0099794_10020050 | 3300007265 | Bacteria | 3022 |
| 368 | Ga0099795_10017879 | 3300007788 | Bacteria | 2267 |
| 369 | Ga0105251_10064373 | 3300009011 | Bacteria | 1719 |
| 370 | Ga0105244_10013466 | 3300009036 | Bacteria | 4780 |
| 371 | Ga0105250_10087777 | 3300009092 | Bacteria | 1263 |
| 372 | Ga0105240_10019597 | 3300009093 | Bacteria | 9035 |
| 373 | Ga0105240_10366977 | 3300009093 | Bacteria | 1629 |
| 374 | Ga0111539_10000693 | 3300009094 | Bacteria | 43665 |
| 375 | Ga0111539_10000941 | 3300009094 | Bacteria | 38137 |
| 376 | Ga0111539_10001081 | 3300009094 | Bacteria | 36017 |
| 377 | Ga0111539_10154547 | 3300009094 | Bacteria | 2685 |
| 378 | Ga0105245_10001284 | 3300009098 | Bacteria | 22645 |
| 379 | Ga0105245_10145013 | 3300009098 | Bacteria | 2240 |
| 380 | Ga0105245_10419824 | 3300009098 | Bacteria | 1341 |
| 381 | Ga0105247_10003522 | 3300009101 | Bacteria | 10175 |
| 382 | Ga0105247_10015712 | 3300009101 | Bacteria | 4532 |
| 383 | Ga0114129_10009653 | 3300009147 | Bacteria | 13772 |
| 384 | Ga0114129_10010881 | 3300009147 | Bacteria | 12959 |
| 385 | Ga0114129_10064508 | 3300009147 | Bacteria | 5112 |
| 386 | Ga0114129_10190930 | 3300009147 | Bacteria | 2781 |
| 387 | Ga0114129_10229703 | 3300009147 | Bacteria | 2499 |
| 388 | Ga0114129_10431643 | 3300009147 | Bacteria | 1731 |
| 389 | Ga0114129_10436172 | 3300009147 | Bacteria | 1720 |
| 390 | Ga0105243_10003373 | 3300009148 | Bacteria | 12960 |
| 391 | Ga0105243_10217864 | 3300009148 | Bacteria | 1685 |
| 392 | Ga0105241_10000053 | 3300009174 | Bacteria | 94578 |
| 393 | Ga0105241_10123177 | 3300009174 | Bacteria | 2091 |
| 394 | Ga0105242_10000492 | 3300009176 | Bacteria | 31218 |
| 395 | Ga0105242_10078474 | 3300009176 | Bacteria | 2757 |
| 396 | Ga0105248_10000934 | 3300009177 | Bacteria | 32542 |
| 397 | Ga0105248_10031696 | 3300009177 | Bacteria | 5906 |
| 398 | Ga0105248_10038013 | 3300009177 | Bacteria | 5385 |
| 399 | Ga0105248_10041758 | 3300009177 | Bacteria | 5143 |
| 400 | Ga0105248_10097830 | 3300009177 | Bacteria | 3306 |
| 401 | Ga0105248_10110014 | 3300009177 | Bacteria | 3107 |
| 402 | Ga0105237_10003661 | 3300009545 | Bacteria | 18122 |
| 403 | Ga0105237_10082006 | 3300009545 | Bacteria | 3216 |
| 404 | Ga0105237_10196605 | 3300009545 | Bacteria | 2016 |
| 405 | Ga0105238_10005232 | 3300009551 | Bacteria | 12822 |
| 406 | Ga0105238_10322524 | 3300009551 | Bacteria | 1531 |
| 407 | Ga0105249_10003582 | 3300009553 | Bacteria | 13439 |
| 408 | Ga0105249_10033319 | 3300009553 | Bacteria | 4664 |
| 409 | Ga0105249_10356389 | 3300009553 | Bacteria | 1483 |
| 410 | Ga0099796_10029818 | 3300010159 | Bacteria | 1764 |
| 411 | Ga0105239_10016523 | 3300010375 | Bacteria | 8160 |
| 412 | Ga0105239_10065271 | 3300010375 | Bacteria | 3997 |
| 413 | Ga0105239_10074495 | 3300010375 | Bacteria | 3732 |
| 414 | Ga0105239_10182570 | 3300010375 | Bacteria | 2347 |
| 415 | Ga0105246_10000055 | 3300011119 | Bacteria | 45431 |
| 416 | Ga0105246_10003672 | 3300011119 | Bacteria | 9292 |
| 417 | Ga0105246_10201643 | 3300011119 | Bacteria | 1547 |
| 418 | Ga0157320_1000638 | 3300012481 | Bacteria | 1511 |
| 419 | Ga0157373_10064543 | 3300013100 | Bacteria | 2592 |
| 420 | Ga0157371_10043951 | 3300013102 | Bacteria | 3182 |
| 421 | Ga0157370_10034537 | 3300013104 | Bacteria | 4921 |
| 422 | Ga0157370_10041817 | 3300013104 | Bacteria | 4418 |
| 423 | Ga0157370_10114858 | 3300013104 | Bacteria | 2515 |
| 424 | Ga0157370_10178554 | 3300013104 | Bacteria | 1973 |
| 425 | Ga0157370_10255425 | 3300013104 | Bacteria | 1621 |
| 426 | Ga0157369_10016644 | 3300013105 | Bacteria | 8267 |
| 427 | Ga0157369_10041997 | 3300013105 | Bacteria | 4990 |
| 428 | Ga0157369_10157244 | 3300013105 | Bacteria | 2400 |
| 429 | Ga0157374_10001308 | 3300013296 | Bacteria | 21203 |
| 430 | Ga0157374_10025888 | 3300013296 | Bacteria | 5274 |
| 431 | Ga0157374_10041871 | 3300013296 | Bacteria | 4223 |
| 432 | Ga0157374_10045186 | 3300013296 | Bacteria | 4076 |
| 433 | Ga0157374_10047928 | 3300013296 | Bacteria | 3963 |
| 434 | Ga0157378_10000986 | 3300013297 | Bacteria | 26065 |
| 435 | Ga0157378_10142354 | 3300013297 | Bacteria | 2228 |
| 436 | Ga0157378_10182480 | 3300013297 | Bacteria | 1975 |
| 437 | Ga0163162_10002432 | 3300013306 | Bacteria | 17549 |
| 438 | Ga0163162_10075871 | 3300013306 | Bacteria | 3423 |
| 439 | Ga0163162_10275342 | 3300013306 | Bacteria | 1815 |
| 440 | Ga0163162_10487935 | 3300013306 | Bacteria | 1363 |
| 441 | Ga0157372_10031748 | 3300013307 | Bacteria | 5786 |
| 442 | Ga0157372_10036245 | 3300013307 | Bacteria | 5436 |
| 443 | Ga0157372_10346278 | 3300013307 | Bacteria | 1731 |
| 444 | Ga0157372_10502847 | 3300013307 | Bacteria | 1413 |
| 445 | Ga0157375_10000933 | 3300013308 | Bacteria | 25341 |
| 446 | Ga0157375_10029408 | 3300013308 | Bacteria | 5167 |
| 447 | Ga0157375_10030809 | 3300013308 | Bacteria | 5063 |
| 448 | Ga0157375_10041036 | 3300013308 | Bacteria | 4466 |
| 449 | Ga0157375_10170070 | 3300013308 | Bacteria | 2326 |
| 450 | Ga0157375_10221031 | 3300013308 | Bacteria | 2052 |
| 451 | Ga0157375_10272322 | 3300013308 | Bacteria | 1855 |
| 452 | Ga0157375_10307118 | 3300013308 | Bacteria | 1750 |
| 453 | Ga0163163_10009027 | 3300014325 | Bacteria | 8883 |
| 454 | Ga0163163_10029817 | 3300014325 | Bacteria | 5250 |
| 455 | Ga0163163_10090954 | 3300014325 | Bacteria | 3065 |
| 456 | Ga0163163_10116963 | 3300014325 | Bacteria | 2698 |
| 457 | Ga0157380_10000821 | 3300014326 | Bacteria | 19478 |
| 458 | Ga0157380_10083969 | 3300014326 | Bacteria | 2610 |
| 459 | Ga0157380_10137302 | 3300014326 | Bacteria | 2095 |
| 460 | Ga0157380_10317590 | 3300014326 | Bacteria | 1443 |
| 461 | Ga0157377_10002329 | 3300014745 | Bacteria | 8365 |
| 462 | Ga0157379_10000679 | 3300014968 | Bacteria | 27606 |
| 463 | Ga0157379_10056130 | 3300014968 | Bacteria | 3519 |
| 464 | Ga0157379_10065272 | 3300014968 | Bacteria | 3254 |
| 465 | Ga0157379_10216790 | 3300014968 | Bacteria | 1734 |
| 466 | Ga0157376_10000527 | 3300014969 | Bacteria | 24607 |
| 467 | Ga0157376_10038272 | 3300014969 | Bacteria | 3901 |
| 468 | Ga0157376_10049122 | 3300014969 | Bacteria | 3493 |
| 469 | Ga0163161_10000770 | 3300017792 | Bacteria | 25240 |
| 470 | Ga0163161_10337736 | 3300017792 | Bacteria | 1194 |
| 471 | Ga0197907_11009316 | 3300020069 | Bacteria | 1331 |
| 472 | Ga0206356_11354353 | 3300020070 | Bacteria | 2542 |
| 473 | Ga0214544_1000016 | 3300021320 | Bacteria | 204278 |
| 474 | Ga0214542_1000016 | 3300021321 | Bacteria | 210332 |
| 475 | Ga0214545_1000008 | 3300021324 | Bacteria | 215190 |
| 476 | Ga0214543_1000043 | 3300021327 | Bacteria | 160517 |
| 477 | Ga0213876_10018008 | 3300021384 | Bacteria | 3727 |
| 478 | Ga0213875_10012959 | 3300021388 | Bacteria | 4105 |
| 479 | Ga0224712_10055462 | 3300022467 | Bacteria | 1559 |
| 480 | Ga0228598_1008246 | 3300024227 | Bacteria | 2109 |
| 481 | Ga0209563_101466 | 3300025230 | Bacteria | 6222 |
| 482 | Ga0209677_100936 | 3300025253 | Bacteria | 14294 |
| 483 | Ga0209148_1000504 | 3300025254 | Bacteria | 39653 |
| 484 | Ga0209233_1003870 | 3300025261 | Bacteria | 5205 |
| 485 | Ga0207666_1000026 | 3300025271 | Bacteria | 33873 |
| 486 | Ga0207666_1001597 | 3300025271 | Bacteria | 2680 |
| 487 | Ga0209455_1000957 | 3300025272 | Bacteria | 14712 |
| 488 | Ga0209758_1000069 | 3300025297 | Bacteria | 286161 |
| 489 | Ga0209758_1000253 | 3300025297 | Bacteria | 107937 |
| 490 | Ga0209758_1000351 | 3300025297 | Bacteria | 83626 |
| 491 | Ga0209758_1000990 | 3300025297 | Bacteria | 38049 |
| 492 | Ga0209758_1005097 | 3300025297 | Bacteria | 10401 |
| 493 | Ga0209758_1009810 | 3300025297 | Bacteria | 5863 |
| 494 | Ga0209758_1033376 | 3300025297 | Bacteria | 2069 |
| 495 | Ga0209256_1008686 | 3300025299 | Bacteria | 4644 |
| 496 | Ga0207426_1000420 | 3300025302 | Bacteria | 69895 |
| 497 | Ga0207426_1001001 | 3300025302 | Bacteria | 27520 |
| 498 | Ga0207426_1002779 | 3300025302 | Bacteria | 10534 |
| 499 | Ga0207426_1018465 | 3300025302 | Bacteria | 2456 |
| 500 | Ga0209257_1000564 | 3300025304 | Bacteria | 62815 |
| 501 | Ga0207697_10000245 | 3300025315 | Bacteria | 29793 |
| 502 | Ga0207697_10011834 | 3300025315 | Bacteria | 3679 |
| 503 | Ga0207656_10001442 | 3300025321 | Bacteria | 7887 |
| 504 | Ga0207656_10034259 | 3300025321 | Bacteria | 2120 |
| 505 | Ga0207682_10000029 | 3300025893 | Bacteria | 57930 |
| 506 | Ga0207682_10014795 | 3300025893 | Bacteria | 3039 |
| 507 | Ga0207692_10000218 | 3300025898 | Bacteria | 19284 |
| 508 | Ga0207692_10012824 | 3300025898 | Bacteria | 3614 |
| 509 | Ga0207692_10031373 | 3300025898 | Bacteria | 2545 |
| 510 | Ga0207642_10015391 | 3300025899 | Bacteria | 2849 |
| 511 | Ga0207642_10022067 | 3300025899 | Bacteria | 2518 |
| 512 | Ga0207710_10000676 | 3300025900 | Bacteria | 19190 |
| 513 | Ga0207710_10027072 | 3300025900 | Bacteria | 2481 |
| 514 | Ga0207688_10000084 | 3300025901 | Bacteria | 35752 |
| 515 | Ga0207688_10008498 | 3300025901 | Bacteria | 5588 |
| 516 | Ga0207680_10001429 | 3300025903 | Bacteria | 11322 |
| 517 | Ga0207647_10003716 | 3300025904 | Bacteria | 11411 |
| 518 | Ga0207647_10009100 | 3300025904 | Bacteria | 7070 |
| 519 | Ga0207647_10018094 | 3300025904 | Bacteria | 4776 |
| 520 | Ga0207647_10038424 | 3300025904 | Bacteria | 3027 |
| 521 | Ga0207685_10030478 | 3300025905 | Bacteria | 1920 |
| 522 | Ga0207685_10039930 | 3300025905 | Bacteria | 1746 |
| 523 | Ga0207699_10000145 | 3300025906 | Bacteria | 46647 |
| 524 | Ga0207699_10001859 | 3300025906 | Bacteria | 9947 |
| 525 | Ga0207699_10002344 | 3300025906 | Bacteria | 8946 |
| 526 | Ga0207699_10004700 | 3300025906 | Bacteria | 6524 |
| 527 | Ga0207699_10081951 | 3300025906 | Bacteria | 2003 |
| 528 | Ga0207699_10096259 | 3300025906 | Bacteria | 1869 |
| 529 | Ga0207699_10133912 | 3300025906 | Bacteria | 1620 |
| 530 | Ga0207699_10232911 | 3300025906 | Bacteria | 1262 |
| 531 | Ga0207645_10000090 | 3300025907 | Bacteria | 65569 |
| 532 | Ga0207645_10029552 | 3300025907 | Bacteria | 3532 |
| 533 | Ga0207645_10085115 | 3300025907 | Bacteria | 2030 |
| 534 | Ga0207643_10000044 | 3300025908 | Bacteria | 82217 |
| 535 | Ga0207643_10003440 | 3300025908 | Bacteria | 8518 |
| 536 | Ga0207643_10034241 | 3300025908 | Bacteria | 2846 |
| 537 | Ga0207705_10011060 | 3300025909 | Bacteria | 6542 |
| 538 | Ga0207705_10023489 | 3300025909 | Bacteria | 4398 |
| 539 | Ga0207705_10126273 | 3300025909 | Bacteria | 1902 |
| 540 | Ga0207705_10204922 | 3300025909 | Bacteria | 1495 |
| 541 | Ga0207684_10007412 | 3300025910 | Bacteria | 9880 |
| 542 | Ga0207654_10000143 | 3300025911 | Bacteria | 45654 |
| 543 | Ga0207654_10060218 | 3300025911 | Bacteria | 2217 |
| 544 | Ga0207707_10000580 | 3300025912 | Bacteria | 37172 |
| 545 | Ga0207707_10001318 | 3300025912 | Bacteria | 23068 |
| 546 | Ga0207707_10001462 | 3300025912 | Bacteria | 21837 |
| 547 | Ga0207707_10012685 | 3300025912 | Bacteria | 7324 |
| 548 | Ga0207707_10028941 | 3300025912 | Bacteria | 4842 |
| 549 | Ga0207707_10163134 | 3300025912 | Bacteria | 1948 |
| 550 | Ga0207707_10329992 | 3300025912 | Bacteria | 1316 |
| 551 | Ga0207707_10334625 | 3300025912 | Bacteria | 1306 |
| 552 | Ga0207695_10000148 | 3300025913 | Bacteria | 208344 |
| 553 | Ga0207695_10073547 | 3300025913 | Bacteria | 3482 |
| 554 | Ga0207695_10260447 | 3300025913 | Bacteria | 1632 |
| 555 | Ga0207671_10014374 | 3300025914 | Bacteria | 6260 |
| 556 | Ga0207671_10051753 | 3300025914 | Bacteria | 3043 |
| 557 | Ga0207693_10001456 | 3300025915 | Bacteria | 20941 |
| 558 | Ga0207693_10008645 | 3300025915 | Bacteria | 8331 |
| 559 | Ga0207693_10014519 | 3300025915 | Bacteria | 6330 |
| 560 | Ga0207693_10022611 | 3300025915 | Bacteria | 4995 |
| 561 | Ga0207693_10068117 | 3300025915 | Bacteria | 2786 |
| 562 | Ga0207693_10072991 | 3300025915 | Bacteria | 2686 |
| 563 | Ga0207693_10112390 | 3300025915 | Bacteria | 2136 |
| 564 | Ga0207663_10001778 | 3300025916 | Bacteria | 10168 |
| 565 | Ga0207663_10005840 | 3300025916 | Bacteria | 6240 |
| 566 | Ga0207663_10053706 | 3300025916 | Bacteria | 2519 |
| 567 | Ga0207660_10000653 | 3300025917 | Bacteria | 23385 |
| 568 | Ga0207660_10006180 | 3300025917 | Bacteria | 7780 |
| 569 | Ga0207660_10022078 | 3300025917 | Bacteria | 4285 |
| 570 | Ga0207660_10034613 | 3300025917 | Bacteria | 3502 |
| 571 | Ga0207660_10129792 | 3300025917 | Bacteria | 1917 |
| 572 | Ga0207660_10175813 | 3300025917 | Bacteria | 1660 |
| 573 | Ga0207662_10000104 | 3300025918 | Bacteria | 40365 |
| 574 | Ga0207662_10012668 | 3300025918 | Bacteria | 4699 |
| 575 | Ga0207662_10055424 | 3300025918 | Bacteria | 2366 |
| 576 | Ga0207662_10072216 | 3300025918 | Bacteria | 2091 |
| 577 | Ga0207662_10102891 | 3300025918 | Bacteria | 1772 |
| 578 | Ga0207662_10228246 | 3300025918 | Bacteria | 1215 |
| 579 | Ga0207657_10001095 | 3300025919 | Bacteria | 28754 |
| 580 | Ga0207657_10011813 | 3300025919 | Bacteria | 8646 |
| 581 | Ga0207657_10027567 | 3300025919 | Bacteria | 5201 |
| 582 | Ga0207649_10000057 | 3300025920 | Bacteria | 102314 |
| 583 | Ga0207649_10214061 | 3300025920 | Bacteria | 1369 |
| 584 | Ga0207652_10001436 | 3300025921 | Bacteria | 21120 |
| 585 | Ga0207652_10006195 | 3300025921 | Bacteria | 9661 |
| 586 | Ga0207652_10009939 | 3300025921 | Bacteria | 7659 |
| 587 | Ga0207652_10021448 | 3300025921 | Bacteria | 5331 |
| 588 | Ga0207652_10082063 | 3300025921 | Bacteria | 2821 |
| 589 | Ga0207652_10103257 | 3300025921 | Bacteria | 2520 |
| 590 | Ga0207652_10116157 | 3300025921 | Bacteria | 2377 |
| 591 | Ga0207652_10128330 | 3300025921 | Bacteria | 2260 |
| 592 | Ga0207652_10259545 | 3300025921 | Bacteria | 1567 |
| 593 | Ga0207646_10044687 | 3300025922 | Bacteria | 3976 |
| 594 | Ga0207681_10000154 | 3300025923 | Bacteria | 57555 |
| 595 | Ga0207681_10041806 | 3300025923 | Bacteria | 3058 |
| 596 | Ga0207681_10061535 | 3300025923 | Bacteria | 2581 |
| 597 | Ga0207681_10110822 | 3300025923 | Bacteria | 1996 |
| 598 | Ga0207694_10013631 | 3300025924 | Bacteria | 6128 |
| 599 | Ga0207694_10171615 | 3300025924 | Bacteria | 1756 |
| 600 | Ga0207650_10001069 | 3300025925 | Bacteria | 20358 |
| 601 | Ga0207650_10029876 | 3300025925 | Bacteria | 3921 |
| 602 | Ga0207650_10038377 | 3300025925 | Bacteria | 3497 |
| 603 | Ga0207650_10059701 | 3300025925 | Bacteria | 2844 |
| 604 | Ga0207659_10000028 | 3300025926 | Bacteria | 130804 |
| 605 | Ga0207659_10064129 | 3300025926 | Bacteria | 2658 |
| 606 | Ga0207659_10164353 | 3300025926 | Bacteria | 1746 |
| 607 | Ga0207687_10000249 | 3300025927 | Bacteria | 36556 |
| 608 | Ga0207687_10015275 | 3300025927 | Bacteria | 5031 |
| 609 | Ga0207687_10284289 | 3300025927 | Bacteria | 1327 |
| 610 | Ga0207700_10007100 | 3300025928 | Bacteria | 6820 |
| 611 | Ga0207700_10018744 | 3300025928 | Bacteria | 4659 |
| 612 | Ga0207700_10036980 | 3300025928 | Bacteria | 3531 |
| 613 | Ga0207700_10072688 | 3300025928 | Bacteria | 2653 |
| 614 | Ga0207700_10151033 | 3300025928 | Bacteria | 1919 |
| 615 | Ga0207700_10151669 | 3300025928 | Bacteria | 1916 |
| 616 | Ga0207664_10014021 | 3300025929 | Bacteria | 5777 |
| 617 | Ga0207664_10027440 | 3300025929 | Bacteria | 4316 |
| 618 | Ga0207644_10000776 | 3300025931 | Bacteria | 20251 |
| 619 | Ga0207644_10002109 | 3300025931 | Bacteria | 12894 |
| 620 | Ga0207644_10015442 | 3300025931 | Bacteria | 5126 |
| 621 | Ga0207644_10020295 | 3300025931 | Bacteria | 4517 |
| 622 | Ga0207644_10190573 | 3300025931 | Bacteria | 1612 |
| 623 | Ga0207690_10000225 | 3300025932 | Bacteria | 42706 |
| 624 | Ga0207690_10093886 | 3300025932 | Bacteria | 2127 |
| 625 | Ga0207690_10109743 | 3300025932 | Bacteria | 1985 |
| 626 | Ga0207706_10001675 | 3300025933 | Bacteria | 21873 |
| 627 | Ga0207706_10042501 | 3300025933 | Bacteria | 4028 |
| 628 | Ga0207706_10070446 | 3300025933 | Bacteria | 3076 |
| 629 | Ga0207706_10103738 | 3300025933 | Bacteria | 2502 |
| 630 | Ga0207686_10001701 | 3300025934 | Bacteria | 12258 |
| 631 | Ga0207686_10029111 | 3300025934 | Bacteria | 3255 |
| 632 | Ga0207709_10000291 | 3300025935 | Bacteria | 56621 |
| 633 | Ga0207670_10000463 | 3300025936 | Bacteria | 22617 |
| 634 | Ga0207670_10007249 | 3300025936 | Bacteria | 6178 |
| 635 | Ga0207670_10011845 | 3300025936 | Bacteria | 5078 |
| 636 | Ga0207670_10079765 | 3300025936 | Bacteria | 2286 |
| 637 | Ga0207669_10000019 | 3300025937 | Bacteria | 111630 |
| 638 | Ga0207704_10000230 | 3300025938 | Bacteria | 27729 |
| 639 | Ga0207704_10039730 | 3300025938 | Bacteria | 2743 |
| 640 | Ga0207704_10061285 | 3300025938 | Bacteria | 2333 |
| 641 | Ga0207704_10201241 | 3300025938 | Bacteria | 1458 |
| 642 | Ga0207665_10005663 | 3300025939 | Bacteria | 8322 |
| 643 | Ga0207665_10010796 | 3300025939 | Bacteria | 5997 |
| 644 | Ga0207665_10029367 | 3300025939 | Bacteria | 3634 |
| 645 | Ga0207665_10143824 | 3300025939 | Bacteria | 1703 |
| 646 | Ga0207665_10213294 | 3300025939 | Bacteria | 1411 |
| 647 | Ga0207691_10000882 | 3300025940 | Bacteria | 29793 |
| 648 | Ga0207691_10007777 | 3300025940 | Bacteria | 10322 |
| 649 | Ga0207691_10069856 | 3300025940 | Bacteria | 3172 |
| 650 | Ga0207691_10254055 | 3300025940 | Bacteria | 1517 |
| 651 | Ga0207691_10275295 | 3300025940 | Bacteria | 1449 |
| 652 | Ga0207711_10001381 | 3300025941 | Bacteria | 22842 |
| 653 | Ga0207711_10011217 | 3300025941 | Bacteria | 7446 |
| 654 | Ga0207711_10072837 | 3300025941 | Bacteria | 2985 |
| 655 | Ga0207711_10367605 | 3300025941 | Bacteria | 1333 |
| 656 | Ga0207689_10000228 | 3300025942 | Bacteria | 50020 |
| 657 | Ga0207689_10009830 | 3300025942 | Bacteria | 8245 |
| 658 | Ga0207689_10050716 | 3300025942 | Bacteria | 3421 |
| 659 | Ga0207661_10000107 | 3300025944 | Bacteria | 52429 |
| 660 | Ga0207661_10017315 | 3300025944 | Bacteria | 5328 |
| 661 | Ga0207661_10166725 | 3300025944 | Bacteria | 1915 |
| 662 | Ga0207679_10000026 | 3300025945 | Bacteria | 200073 |
| 663 | Ga0207679_10064593 | 3300025945 | Bacteria | 2736 |
| 664 | Ga0207667_10007642 | 3300025949 | Bacteria | 12950 |
| 665 | Ga0207667_10017783 | 3300025949 | Bacteria | 7994 |
| 666 | Ga0207667_10021717 | 3300025949 | Bacteria | 7111 |
| 667 | Ga0207667_10038306 | 3300025949 | Bacteria | 5122 |
| 668 | Ga0207667_10056568 | 3300025949 | Bacteria | 4120 |
| 669 | Ga0207667_10185843 | 3300025949 | Bacteria | 2133 |
| 670 | Ga0207651_10000069 | 3300025960 | Bacteria | 46408 |
| 671 | Ga0207651_10038302 | 3300025960 | Bacteria | 3150 |
| 672 | Ga0207651_10076837 | 3300025960 | Bacteria | 2388 |
| 673 | Ga0207712_10000242 | 3300025961 | Bacteria | 53794 |
| 674 | Ga0207712_10267673 | 3300025961 | Bacteria | 1389 |
| 675 | Ga0207668_10000049 | 3300025972 | Bacteria | 99391 |
| 676 | Ga0207668_10059373 | 3300025972 | Bacteria | 2679 |
| 677 | Ga0207668_10168639 | 3300025972 | Bacteria | 1714 |
| 678 | Ga0207640_10000301 | 3300025981 | Bacteria | 32802 |
| 679 | Ga0207640_10029527 | 3300025981 | Bacteria | 3367 |
| 680 | Ga0207640_10074211 | 3300025981 | Bacteria | 2301 |
| 681 | Ga0207640_10189847 | 3300025981 | Bacteria | 1548 |
| 682 | Ga0207658_10077114 | 3300025986 | Bacteria | 2542 |
| 683 | Ga0207658_10175261 | 3300025986 | Bacteria | 1770 |
| 684 | Ga0207677_10072040 | 3300026023 | Bacteria | 2441 |
| 685 | Ga0207677_10219393 | 3300026023 | Bacteria | 1524 |
| 686 | Ga0207677_10295039 | 3300026023 | Bacteria | 1337 |
| 687 | Ga0207703_10098502 | 3300026035 | Bacteria | 2473 |
| 688 | Ga0207703_10318466 | 3300026035 | Bacteria | 1424 |
| 689 | Ga0207639_10000413 | 3300026041 | Bacteria | 29583 |
| 690 | Ga0207639_10011576 | 3300026041 | Bacteria | 6129 |
| 691 | Ga0207639_10066094 | 3300026041 | Bacteria | 2809 |
| 692 | Ga0207639_10075818 | 3300026041 | Bacteria | 2646 |
| 693 | Ga0207678_10000920 | 3300026067 | Bacteria | 26941 |
| 694 | Ga0207678_10007714 | 3300026067 | Bacteria | 9507 |
| 695 | Ga0207678_10010132 | 3300026067 | Bacteria | 8270 |
| 696 | Ga0207678_10018124 | 3300026067 | Bacteria | 6184 |
| 697 | Ga0207678_10030856 | 3300026067 | Bacteria | 4679 |
| 698 | Ga0207678_10035645 | 3300026067 | Bacteria | 4331 |
| 699 | Ga0207678_10041352 | 3300026067 | Bacteria | 3997 |
| 700 | Ga0207678_10120737 | 3300026067 | Bacteria | 2237 |
| 701 | Ga0207708_10002680 | 3300026075 | Bacteria | 13080 |
| 702 | Ga0207708_10002682 | 3300026075 | Bacteria | 13078 |
| 703 | Ga0207708_10029309 | 3300026075 | Bacteria | 4171 |
| 704 | Ga0207708_10137658 | 3300026075 | Bacteria | 1913 |
| 705 | Ga0207702_10001310 | 3300026078 | Bacteria | 24935 |
| 706 | Ga0207702_10002075 | 3300026078 | Bacteria | 19368 |
| 707 | Ga0207641_10000542 | 3300026088 | Bacteria | 42352 |
| 708 | Ga0207648_10002093 | 3300026089 | Bacteria | 21739 |
| 709 | Ga0207648_10011369 | 3300026089 | Bacteria | 8390 |
| 710 | Ga0207676_10000511 | 3300026095 | Bacteria | 32689 |
| 711 | Ga0207676_10034980 | 3300026095 | Bacteria | 3808 |
| 712 | Ga0207676_10055650 | 3300026095 | Bacteria | 3107 |
| 713 | Ga0207676_10066499 | 3300026095 | Bacteria | 2875 |
| 714 | Ga0207676_10308686 | 3300026095 | Bacteria | 1447 |
| 715 | Ga0207674_10000882 | 3300026116 | Bacteria | 39274 |
| 716 | Ga0207674_10008675 | 3300026116 | Bacteria | 11703 |
| 717 | Ga0207674_10029762 | 3300026116 | Bacteria | 5745 |
| 718 | Ga0207674_10074468 | 3300026116 | Bacteria | 3407 |
| 719 | Ga0207674_10122257 | 3300026116 | Bacteria | 2569 |
| 720 | Ga0207674_10207300 | 3300026116 | Bacteria | 1909 |
| 721 | Ga0207675_100001599 | 3300026118 | Bacteria | 22695 |
| 722 | Ga0207675_100032506 | 3300026118 | Bacteria | 4859 |
| 723 | Ga0207675_100032967 | 3300026118 | Bacteria | 4826 |
| 724 | Ga0207675_100056412 | 3300026118 | Bacteria | 3664 |
| 725 | Ga0207675_100181195 | 3300026118 | Bacteria | 2017 |
| 726 | Ga0207675_100333112 | 3300026118 | Bacteria | 1484 |
| 727 | Ga0207683_10000653 | 3300026121 | Bacteria | 31779 |
| 728 | Ga0207683_10005584 | 3300026121 | Bacteria | 10781 |
| 729 | Ga0207683_10032212 | 3300026121 | Bacteria | 4553 |
| 730 | Ga0207683_10034787 | 3300026121 | Bacteria | 4380 |
| 731 | Ga0207683_10058314 | 3300026121 | Bacteria | 3390 |
| 732 | Ga0207683_10126366 | 3300026121 | Bacteria | 2298 |
| 733 | Ga0207683_10320810 | 3300026121 | Bacteria | 1419 |
| 734 | Ga0207698_10003176 | 3300026142 | Bacteria | 9855 |
| 735 | Ga0207698_10015074 | 3300026142 | Bacteria | 5165 |
| 736 | Ga0207698_10031914 | 3300026142 | Bacteria | 3809 |
| 737 | Ga0207698_10141417 | 3300026142 | Bacteria | 2074 |
| 738 | Ga0207698_10184510 | 3300026142 | Bacteria | 1852 |
| 739 | Ga0207698_10213466 | 3300026142 | Bacteria | 1738 |
| 740 | Ga0207698_10241296 | 3300026142 | Bacteria | 1647 |
| 741 | Ga0209389_1000033 | 3300027296 | Bacteria | 131516 |
| 742 | Ga0209389_1000071 | 3300027296 | Bacteria | 97411 |
| 743 | Ga0209589_1000040 | 3300027357 | Bacteria | 126550 |
| 744 | Ga0209489_100045 | 3300027361 | Bacteria | 158225 |
| 745 | Ga0209489_101361 | 3300027361 | Bacteria | 50193 |
| 746 | Ga0209700_100011 | 3300027363 | Bacteria | 362159 |
| 747 | Ga0209967_1004267 | 3300027364 | Bacteria | 1894 |
| 748 | Ga0209179_1004156 | 3300027512 | Bacteria | 2161 |
| 749 | Ga0210002_1005285 | 3300027617 | Bacteria | 1938 |
| 750 | Ga0209588_1021319 | 3300027671 | Bacteria | 2034 |
| 751 | Ga0209966_1009837 | 3300027695 | Bacteria | 1714 |
| 752 | Ga0209998_10000855 | 3300027717 | Bacteria | 7842 |
| 753 | Ga0209998_10000913 | 3300027717 | Bacteria | 7554 |
| 754 | Ga0209974_10001240 | 3300027876 | Bacteria | 9154 |
| 755 | Ga0207428_10000130 | 3300027907 | Bacteria | 104457 |
| 756 | Ga0207428_10000180 | 3300027907 | Bacteria | 88557 |
| 757 | Ga0207428_10000286 | 3300027907 | Bacteria | 68250 |
| 758 | Ga0265357_1000126 | 3300028023 | Bacteria | 3187 |
| 759 | Ga0268266_10000680 | 3300028379 | Bacteria | 45937 |
| 760 | Ga0268266_10001248 | 3300028379 | Bacteria | 31070 |
| 761 | Ga0268266_10011598 | 3300028379 | Bacteria | 7650 |
| 762 | Ga0268266_10013545 | 3300028379 | Bacteria | 7022 |
| 763 | Ga0268266_10019092 | 3300028379 | Bacteria | 5838 |
| 764 | Ga0268266_10047378 | 3300028379 | Bacteria | 3682 |
| 765 | Ga0268266_10061027 | 3300028379 | Bacteria | 3251 |
| 766 | Ga0268266_10084876 | 3300028379 | Bacteria | 2766 |
| 767 | Ga0268266_10146772 | 3300028379 | Bacteria | 2122 |
| 768 | Ga0268266_10192534 | 3300028379 | Bacteria | 1862 |
| 769 | Ga0268265_10000410 | 3300028380 | Bacteria | 45939 |
| 770 | Ga0268265_10109383 | 3300028380 | Bacteria | 2252 |
| 771 | Ga0268265_10136371 | 3300028380 | Bacteria | 2048 |
| 772 | Ga0268265_10243594 | 3300028380 | Bacteria | 1588 |
| 773 | Ga0268265_10346640 | 3300028380 | Bacteria | 1354 |
| 774 | Ga0268264_10001172 | 3300028381 | Bacteria | 25487 |
| 775 | Ga0265337_1000803 | 3300028556 | Bacteria | 16537 |
| 776 | Ga0307517_10000175 | 3300028786 | Bacteria | 105567 |
| 777 | Ga0307515_10010288 | 3300028794 | Bacteria | 17962 |
| 778 | Ga0265338_10082594 | 3300028800 | Bacteria | 2689 |
| 779 | Ga0265763_1000550 | 3300030763 | Bacteria | 2334 |
| 780 | Ga0265330_10013168 | 3300031235 | Bacteria | 3858 |
| 781 | Ga0265330_10017853 | 3300031235 | Bacteria | 3264 |
| 782 | Ga0265328_10005186 | 3300031239 | Bacteria | 5604 |
| 783 | Ga0265328_10012310 | 3300031239 | Bacteria | 3407 |
| 784 | Ga0265325_10000011 | 3300031241 | Bacteria | 150631 |
| 785 | Ga0265325_10000031 | 3300031241 | Bacteria | 102905 |
| 786 | Ga0265325_10009845 | 3300031241 | Bacteria | 5565 |
| 787 | Ga0265325_10010725 | 3300031241 | Bacteria | 5287 |
| 788 | Ga0265325_10043236 | 3300031241 | Bacteria | 2351 |
| 789 | Ga0265325_10060508 | 3300031241 | Bacteria | 1923 |
| 790 | Ga0265340_10000988 | 3300031247 | Bacteria | 16244 |
| 791 | Ga0265340_10002668 | 3300031247 | Bacteria | 10139 |
| 792 | Ga0265340_10015328 | 3300031247 | Bacteria | 3983 |
| 793 | Ga0265340_10016275 | 3300031247 | Bacteria | 3853 |
| 794 | Ga0265340_10019075 | 3300031247 | Bacteria | 3532 |
| 795 | Ga0265339_10000420 | 3300031249 | Bacteria | 33598 |
| 796 | Ga0265339_10023140 | 3300031249 | Bacteria | 3594 |
| 797 | Ga0265339_10029285 | 3300031249 | Bacteria | 3124 |
| 798 | Ga0265339_10033487 | 3300031249 | Bacteria | 2892 |
| 799 | Ga0265339_10081739 | 3300031249 | Bacteria | 1707 |
| 800 | Ga0265331_10065751 | 3300031250 | Bacteria | 1704 |
| 801 | Ga0265316_10012332 | 3300031344 | Bacteria | 7672 |
| 802 | Ga0265316_10031368 | 3300031344 | Bacteria | 4346 |
| 803 | Ga0265316_10156012 | 3300031344 | Bacteria | 1708 |
| 804 | Ga0307513_10079139 | 3300031456 | Bacteria | 3397 |
| 805 | Ga0265313_10000008 | 3300031595 | Bacteria | 173405 |
| 806 | Ga0265313_10000637 | 3300031595 | Bacteria | 36099 |
| 807 | Ga0265313_10004833 | 3300031595 | Bacteria | 10135 |
| 808 | Ga0265313_10007230 | 3300031595 | Bacteria | 7639 |
| 809 | Ga0265313_10008768 | 3300031595 | Bacteria | 6673 |
| 810 | Ga0265313_10020749 | 3300031595 | Bacteria | 3616 |
| 811 | Ga0265313_10023060 | 3300031595 | Bacteria | 3360 |
| 812 | Ga0265313_10023600 | 3300031595 | Bacteria | 3310 |
| 813 | Ga0265313_10025145 | 3300031595 | Bacteria | 3163 |
| 814 | Ga0307508_10000108 | 3300031616 | Bacteria | 97443 |
| 815 | Ga0307508_10044567 | 3300031616 | Bacteria | 3967 |
| 816 | Ga0307508_10109344 | 3300031616 | Bacteria | 2364 |
| 817 | Ga0316575_10005603 | 3300031665 | Bacteria | 4481 |
| 818 | Ga0316575_10013015 | 3300031665 | Bacteria | 3105 |
| 819 | Ga0316579_10006101 | 3300031691 | Bacteria | 4895 |
| 820 | Ga0265314_10002983 | 3300031711 | Bacteria | 16763 |
| 821 | Ga0265314_10011076 | 3300031711 | Bacteria | 7474 |
| 822 | Ga0265314_10072325 | 3300031711 | Bacteria | 2304 |
| 823 | Ga0265342_10004075 | 3300031712 | Bacteria | 11653 |
| 824 | Ga0265342_10008760 | 3300031712 | Bacteria | 7216 |
| 825 | Ga0265342_10034408 | 3300031712 | Bacteria | 3108 |
| 826 | Ga0265342_10051976 | 3300031712 | Bacteria | 2443 |
| 827 | Ga0265342_10053102 | 3300031712 | Bacteria | 2413 |
| 828 | Ga0265342_10118905 | 3300031712 | Bacteria | 1490 |
| 829 | Ga0307516_10275542 | 3300031730 | Bacteria | 1366 |
| 830 | Ga0307516_10287203 | 3300031730 | Bacteria | 1325 |
| 831 | Ga0307405_10039377 | 3300031731 | Bacteria | 2856 |
| 832 | Ga0307412_10131376 | 3300031911 | Bacteria | 1819 |
| 833 | Ga0316583_10000432 | 3300032133 | Bacteria | 12280 |
| 834 | Ga0307510_10172898 | 3300033180 | Bacteria | 1736 |
| 835 | Ga0373930_0002135 | 3300034816 | Bacteria | 3031 |
| 836 | Ga0373930_0004672 | 3300034816 | Bacteria | 2242 |
| 837 | Ga0373930_0006152 | 3300034816 | Bacteria | 2019 |
| 838 | Ga0373948_0019053 | 3300034817 | Bacteria | 1294 |
| 839 | Ga0373950_0004459 | 3300034818 | Bacteria | 2052 |
| 840 | Ga0373950_0009843 | 3300034818 | Bacteria | 1534 |
| 841 | Ga0373958_0001550 | 3300034819 | Bacteria | 3108 |
| 842 | Ga0373959_0000740 | 3300034820 | Bacteria | 5585 |
| 843 | Ga0373959_0002603 | 3300034820 | Bacteria | 2862 |
| 844 | Ga0373938_0000260 | 3300034957 | Bacteria | 8284 |
| 845 | Ga0373938_0001185 | 3300034957 | Bacteria | 4200 |
| 846 | Ga0373926_0045645 | 3300035083 | Bacteria | 1571 |
| 847 | Ga0373928_0000813 | 3300035084 | Bacteria | 6085 |
| 848 | Ga0373928_0008582 | 3300035084 | Bacteria | 1986 |
| 849 | Ga0373928_0011485 | 3300035084 | Bacteria | 1753 |
| 850 | Ga0373929_0001725 | 3300035085 | Bacteria | 4109 |
| 851 | Ga0373929_0005692 | 3300035085 | Bacteria | 2249 |
| 852 | Ga0373934_0052433 | 3300035086 | Bacteria | 1618 |
| 853 | Ga0373940_0000718 | 3300035088 | Bacteria | 5376 |
| 854 | Ga0373944_0007059 | 3300035089 | Bacteria | 3002 |
| 855 | Ga0373949_0000547 | 3300035090 | Bacteria | 12392 |
| 856 | Ga0373949_0011258 | 3300035090 | Bacteria | 1969 |
| 857 | Ga0373951_0001164 | 3300035091 | Bacteria | 6957 |
| 858 | Ga0373951_0002297 | 3300035091 | Bacteria | 4858 |
| 859 | Ga0373952_0000516 | 3300035092 | Bacteria | 6773 |
| 860 | Ga0373952_0000760 | 3300035092 | Bacteria | 5799 |
| 861 | Ga0373923_0010424 | 3300035111 | Bacteria | 3379 |
| 862 | Ga0373932_0000908 | 3300035112 | Bacteria | 8652 |
| 863 | Ga0373936_0106013 | 3300035113 | Bacteria | 1190 |
| 864 | Ga0373939_0000911 | 3300035114 | Bacteria | 7343 |
| 865 | Ga0373939_0014272 | 3300035114 | Bacteria | 2059 |
| 866 | Ga0373939_0024389 | 3300035114 | Bacteria | 1684 |
| 867 | Ga0373941_0000037 | 3300035115 | Bacteria | 19599 |
| 868 | Ga0373941_0001686 | 3300035115 | Bacteria | 4731 |
| 869 | Ga0373941_0017520 | 3300035115 | Bacteria | 1964 |
| 870 | Ga0373945_0004426 | 3300035116 | Bacteria | 4463 |
| 871 | Ga0373945_0008144 | 3300035116 | Bacteria | 3407 |
| 872 | Ga0373945_0023371 | 3300035116 | Bacteria | 2135 |
| 873 | Ga0373945_0026758 | 3300035116 | Bacteria | 2010 |
| 874 | Ga0373953_0001233 | 3300035117 | Bacteria | 7299 |
| 875 | Ga0373953_0018745 | 3300035117 | Bacteria | 2565 |
| 876 | Ga0373953_0022802 | 3300035117 | Bacteria | 2365 |
| 877 | Ga0373954_0000514 | 3300035118 | Bacteria | 14516 |
| 878 | Ga0373954_0003303 | 3300035118 | Bacteria | 6814 |
| 879 | Ga0373954_0024791 | 3300035118 | Bacteria | 2737 |
| 880 | Ga0373954_0100960 | 3300035118 | Bacteria | 1392 |
| 881 | Ga0373956_0003634 | 3300035119 | Bacteria | 6226 |
| 882 | Ga0373956_0005363 | 3300035119 | Bacteria | 5133 |
| 883 | Ga0373956_0007961 | 3300035119 | Bacteria | 4281 |
| 884 | Ga0373956_0015060 | 3300035119 | Bacteria | 3234 |
| 885 | Ga0373957_0001007 | 3300035120 | Bacteria | 7408 |
| 886 | Ga0373957_0006379 | 3300035120 | Bacteria | 3713 |
| 887 | Ga0373957_0011003 | 3300035120 | Bacteria | 3008 |
| 888 | Ga0373957_0019840 | 3300035120 | Bacteria | 2370 |
| 889 | Ga0373957_0024024 | 3300035120 | Bacteria | 2185 |
| 890 | Ga0373960_0000805 | 3300035121 | Bacteria | 6600 |
| 891 | Ga0373960_0001073 | 3300035121 | Bacteria | 5899 |
| 892 | Ga0373943_0000699 | 3300035170 | Bacteria | 14633 |
| 893 | Ga0373943_0004297 | 3300035170 | Bacteria | 6466 |
| 894 | Ga0373943_0007096 | 3300035170 | Bacteria | 5027 |
| 895 | Ga0373943_0010381 | 3300035170 | Bacteria | 4174 |
| 896 | Ga0373943_0010931 | 3300035170 | Bacteria | 4079 |
| 897 | Ga0373943_0030320 | 3300035170 | Bacteria | 2558 |
| 898 | Ga0373943_0136083 | 3300035170 | Bacteria | 1319 |
| 899 | Ga0373946_0004806 | 3300035171 | Bacteria | 4863 |
| 900 | Ga0373946_0009235 | 3300035171 | Bacteria | 3628 |
| 901 | Ga0373946_0014570 | 3300035171 | Bacteria | 2966 |
| 902 | Ga0373946_0032937 | 3300035171 | Bacteria | 2083 |
| 903 | Ga0373955_0000723 | 3300035172 | Bacteria | 14148 |
| 904 | Ga0373955_0001851 | 3300035172 | Bacteria | 9104 |
| 905 | Ga0373955_0007716 | 3300035172 | Bacteria | 4956 |
| 906 | Ga0373955_0014090 | 3300035172 | Bacteria | 3882 |
| 907 | Ga0373955_0019345 | 3300035172 | Bacteria | 3401 |
| 908 | Ga0373955_0030955 | 3300035172 | Bacteria | 2799 |
| 909 | Ga0373955_0103027 | 3300035172 | Bacteria | 1641 |
| 910 | Ga0373942_0000388 | 3300035207 | Bacteria | 12155 |
| 911 | Ga0373942_0010244 | 3300035207 | Bacteria | 2203 |
| 912 | Ga0373961_0000658 | 3300035241 | Bacteria | 12233 |
| 913 | Ga0373961_0010035 | 3300035241 | Bacteria | 2328 |
| 914 | Ga0373961_0024994 | 3300035241 | Bacteria | 1620 |
| 915 | Ga0373962_0004022 | 3300035242 | Bacteria | 3540 |
| 916 | Ga0373962_0005442 | 3300035242 | Bacteria | 3082 |
| 917 | Ga0373962_0008725 | 3300035242 | Bacteria | 2501 |
| 918 | Ga0373924_0003551 | 3300035410 | Bacteria | 5372 |
| 919 | Ga0373924_0005950 | 3300035410 | Bacteria | 4348 |
| 920 | Ga0373924_0014945 | 3300035410 | Bacteria | 2940 |
| 921 | Ga0373924_0033471 | 3300035410 | Bacteria | 2075 |
| 922 | Ga0373924_0082998 | 3300035410 | Bacteria | 1364 |
| 923 | Ga0373931_0001169 | 3300035691 | Bacteria | 11182 |
| 924 | Ga0373931_0002000 | 3300035691 | Bacteria | 8971 |
| 925 | Ga0373931_0021214 | 3300035691 | Bacteria | 3258 |
| 926 | Ga0373931_0024262 | 3300035691 | Bacteria | 3070 |
| 927 | Ga0373931_0041537 | 3300035691 | Bacteria | 2416 |
| 928 | Ga0373935_0000777 | 3300035692 | Bacteria | 16996 |
| 929 | Ga0373935_0015808 | 3300035692 | Bacteria | 4566 |
| 930 | Ga0373935_0016204 | 3300035692 | Bacteria | 4510 |
| 931 | Ga0373927_0000337 | 3300035695 | Bacteria | 36861 |
| 932 | Ga0373927_0000920 | 3300035695 | Bacteria | 22344 |
| 933 | Ga0373927_0007511 | 3300035695 | Bacteria | 7373 |
| 934 | Ga0373927_0063703 | 3300035695 | Bacteria | 2385 |
| 935 | Ga0373927_0070036 | 3300035695 | Bacteria | 2270 |
| 936 | Ga0373933_0000749 | 3300035724 | Bacteria | 19837 |
| 937 | Ga0373933_0008828 | 3300035724 | Bacteria | 5495 |
| 938 | Ga0373933_0016195 | 3300035724 | Bacteria | 4166 |
| 939 | Ga0373933_0020951 | 3300035724 | Bacteria | 3708 |
| 940 | Ga0373933_0097439 | 3300035724 | Bacteria | 1821 |
| 941 | Ga0373933_0177752 | 3300035724 | Bacteria | 1356 |
| 942 | Ga0373947_0001483 | 3300035725 | Bacteria | 14409 |
| 943 | Ga0373947_0001596 | 3300035725 | Bacteria | 13905 |
| 944 | Ga0373947_0004710 | 3300035725 | Bacteria | 7993 |
| 945 | Ga0373947_0004829 | 3300035725 | Bacteria | 7879 |
| 946 | Ga0373947_0010845 | 3300035725 | Bacteria | 5228 |
| 947 | Ga0373947_0011454 | 3300035725 | Bacteria | 5087 |
| 948 | Ga0373947_0012687 | 3300035725 | Bacteria | 4832 |
| 949 | Ga0373947_0035521 | 3300035725 | Bacteria | 2951 |
| 950 | Ga0373947_0037785 | 3300035725 | Bacteria | 2866 |
| 951 | Ga0373947_0098051 | 3300035725 | Bacteria | 1838 |
| 952 | Ga0373937_0001087 | 3300036401 | Bacteria | 22920 |
| 953 | Ga0373937_0004268 | 3300036401 | Bacteria | 12113 |
| 954 | Ga0373937_0012013 | 3300036401 | Bacteria | 7601 |
| 955 | Ga0373937_0020739 | 3300036401 | Bacteria | 5894 |
| 956 | Ga0373937_0027462 | 3300036401 | Bacteria | 5147 |
| 957 | Ga0373937_0034586 | 3300036401 | Bacteria | 4596 |
| 958 | Ga0373937_0040316 | 3300036401 | Bacteria | 4256 |
| 959 | Ga0373937_0059594 | 3300036401 | Bacteria | 3508 |
| 960 | Ga0373937_0129696 | 3300036401 | Bacteria | 2355 |
| 961 | Ga0373937_0327232 | 3300036401 | Bacteria | 1450 |
| 962 | Ga0373937_0331331 | 3300036401 | Bacteria | 1441 |
| 963 | Ga0373925_0000712 | 3300037068 | Bacteria | 31050 |
| 964 | Ga0373925_0002178 | 3300037068 | Bacteria | 15945 |
| 965 | Ga0373925_0012757 | 3300037068 | Bacteria | 6088 |
| 966 | Ga0373925_0070890 | 3300037068 | Bacteria | 2635 |
| 967 | Ga0373925_0071831 | 3300037068 | Bacteria | 2618 |
| 968 | Ga0373925_0074899 | 3300037068 | Bacteria | 2564 |
| 969 | Ga0373925_0167688 | 3300037068 | Bacteria | 1732 |
| 970 | Ga0373925_0179167 | 3300037068 | Bacteria | 1676 |
| 971 | Ga0373925_0242286 | 3300037068 | Bacteria | 1444 |
| 972 | Ga0395899_0013101 | 3300037312 | Bacteria | 6342 |
| 973 | Ga0395899_0072062 | 3300037312 | Bacteria | 2528 |
| 974 | Ga0395900_0002974 | 3300037418 | Bacteria | 18448 |
| 975 | Ga0395900_0010116 | 3300037418 | Bacteria | 9647 |
| 976 | Ga0395900_0101559 | 3300037418 | Bacteria | 2954 |
| 977 | Ga0395898_0005741 | 3300037466 | Bacteria | 13364 |
| 978 | Ga0395898_0011608 | 3300037466 | Bacteria | 9143 |
| 979 | Ga0395898_0014047 | 3300037466 | Bacteria | 8229 |
| 980 | Ga0395898_0113141 | 3300037466 | Bacteria | 2601 |
| 981 | Ga0395905_0009536 | 3300037471 | Bacteria | 9483 |
| 982 | Ga0395905_0023356 | 3300037471 | Bacteria | 5845 |
| 983 | Ga0436364_0091611 | 3300037853 | Bacteria | 8138 |
| 984 | Ga0395901_0003628 | 3300038443 | Bacteria | 15574 |
| 985 | Ga0395901_0012308 | 3300038443 | Bacteria | 8683 |
| 986 | Ga0395901_0092810 | 3300038443 | Bacteria | 3160 |
| 987 | Ga0436365_0113731 | 3300039437 | Bacteria | 1517 |
| 988 | Ga0436365_0254353 | 3300039437 | Bacteria | 4466 |
| 989 | Ga0436365_0270990 | 3300039437 | Bacteria | 1951 |
| 990 | Ga0436365_0671434 | 3300039437 | Bacteria | 2715 |
| 991 | Ga0436365_1550909 | 3300039437 | Bacteria | 12274 |
| 992 | Ga0436365_1927338 | 3300039437 | Bacteria | 1636 |
| 993 | Ga0436361_0438836 | 3300039447 | Bacteria | 1625 |
| 994 | Ga0436361_0676992 | 3300039447 | Bacteria | 1904 |
| 995 | Ga0436361_0764602 | 3300039447 | Bacteria | 1327 |
| 996 | Ga0436361_0842459 | 3300039447 | Bacteria | 1417 |
| 997 | Ga0436361_0869536 | 3300039447 | Bacteria | 4068 |
| 998 | Ga0436363_1655093 | 3300039450 | Bacteria | 1861 |
| 999 | Ga0436362_0320095 | 3300039453 | Bacteria | 2860 |
| 1000 | Ga0439453_0001745 | 3300041408 | Bacteria | 2865 |
| 1001 | Ga0439453_0015656 | 3300041408 | Bacteria | 1314 |
| 1002 | Ga0439465_0015093 | 3300041413 | Bacteria | 2411 |
| 1003 | Ga0439441_010110 | 3300042001 | Bacteria | 1576 |
| 1004 | Ga0439455_0016975 | 3300042012 | Bacteria | 1690 |
| 1005 | Ga0466969_0031199 | 3300044656 | Bacteria | 2714 |
| 1006 | Ga0466972_0000107 | 3300044658 | Bacteria | 71873 |
| 1007 | Ga0466965_0006278 | 3300044683 | Bacteria | 5381 |
| 1008 | Ga0466966_0000429 | 3300044684 | Bacteria | 27002 |
| 1009 | Ga0466966_0048482 | 3300044684 | Bacteria | 2706 |
| 1010 | Ga0466966_0074503 | 3300044684 | Bacteria | 2122 |
| 1011 | Ga0466961_0000074 | 3300044693 | Bacteria | 61968 |
| 1012 | Ga0466963_0004354 | 3300044694 | Bacteria | 8220 |
| 1013 | Ga0466963_0004518 | 3300044694 | Bacteria | 8099 |
| 1014 | Ga0466963_0004913 | 3300044694 | Bacteria | 7794 |
| 1015 | Ga0466963_0030079 | 3300044694 | Bacteria | 3501 |
| 1016 | Ga0466963_0056684 | 3300044694 | Bacteria | 2608 |
| 1017 | Ga0466968_0003762 | 3300044735 | Bacteria | 5620 |
| 1018 | Ga0466957_0004324 | 3300044842 | Bacteria | 7887 |
| 1019 | Ga0466957_0028192 | 3300044842 | Bacteria | 3342 |
| 1020 | Ga0466960_0008577 | 3300044901 | Bacteria | 4189 |
| 1021 | Ga0466960_0028229 | 3300044901 | Bacteria | 2567 |
| 1022 | Ga0466959_0001671 | 3300045049 | Bacteria | 13739 |
| 1023 | Ga0466959_0030925 | 3300045049 | Bacteria | 3964 |
| 1024 | Ga0466959_0093715 | 3300045049 | Bacteria | 2155 |
| 1025 | Ga0451576_0164471 | 3300045051 | Bacteria | 2315 |
| 1026 | Ga0451576_0442507 | 3300045051 | Bacteria | 1364 |
| 1027 | Ga0466958_0026534 | 3300045836 | Bacteria | 3424 |
| 1028 | Ga0466967_0004481 | 3300045976 | Bacteria | 9428 |
| 1029 | Ga0466967_0372979 | 3300045976 | Bacteria | 1384 |
| 1030 | Ga0466967_0416113 | 3300045976 | Bacteria | 1309 |
| 1031 | Ga0495592_0003132 | 3300046454 | Bacteria | 11819 |
| 1032 | Ga0495592_0011587 | 3300046454 | Bacteria | 6678 |
| 1033 | Ga0495592_0048616 | 3300046454 | Bacteria | 3155 |
| 1034 | Ga0495592_0058912 | 3300046454 | Bacteria | 2830 |
| 1035 | Ga0495592_0193907 | 3300046454 | Bacteria | 1375 |
| 1036 | Ga0495603_0007593 | 3300046455 | Bacteria | 6525 |
| 1037 | Ga0495603_0012985 | 3300046455 | Bacteria | 5035 |
| 1038 | Ga0495603_0053315 | 3300046455 | Bacteria | 2399 |
| 1039 | Ga0495603_0122267 | 3300046455 | Bacteria | 1516 |
| 1040 | Ga0495629_0000124 | 3300046459 | Bacteria | 68796 |
| 1041 | Ga0495629_0001397 | 3300046459 | Bacteria | 19021 |
| 1042 | Ga0495629_0001747 | 3300046459 | Bacteria | 17032 |
| 1043 | Ga0495629_0002750 | 3300046459 | Bacteria | 13453 |
| 1044 | Ga0495629_0004000 | 3300046459 | Bacteria | 11075 |
| 1045 | Ga0495629_0136391 | 3300046459 | Bacteria | 1708 |
| 1046 | Ga0495638_0003214 | 3300046460 | Bacteria | 12926 |
| 1047 | Ga0495638_0035809 | 3300046460 | Bacteria | 3163 |
| 1048 | Ga0495638_0045581 | 3300046460 | Bacteria | 2758 |
| 1049 | Ga0495638_0121170 | 3300046460 | Bacteria | 1546 |
| 1050 | Ga0495651_0000828 | 3300046462 | Bacteria | 24059 |
| 1051 | Ga0495651_0000848 | 3300046462 | Bacteria | 23752 |
| 1052 | Ga0495651_0010521 | 3300046462 | Bacteria | 7109 |
| 1053 | Ga0495651_0013380 | 3300046462 | Bacteria | 6347 |
| 1054 | Ga0495651_0034381 | 3300046462 | Bacteria | 3950 |
| 1055 | Ga0495651_0139182 | 3300046462 | Bacteria | 1762 |
| 1056 | Ga0495653_0003214 | 3300046463 | Bacteria | 13088 |
| 1057 | Ga0495653_0009388 | 3300046463 | Bacteria | 8005 |
| 1058 | Ga0495653_0014317 | 3300046463 | Bacteria | 6468 |
| 1059 | Ga0495653_0059128 | 3300046463 | Bacteria | 2911 |
| 1060 | Ga0495580_0084249 | 3300046472 | Bacteria | 2214 |
| 1061 | Ga0495580_0243244 | 3300046472 | Bacteria | 1233 |
| 1062 | Ga0495582_0000494 | 3300046473 | Bacteria | 21572 |
| 1063 | Ga0495582_0000612 | 3300046473 | Bacteria | 19623 |
| 1064 | Ga0495582_0029848 | 3300046473 | Bacteria | 2993 |
| 1065 | Ga0495605_0070490 | 3300046474 | Bacteria | 1653 |
| 1066 | Ga0495639_0018656 | 3300046475 | Bacteria | 3022 |
| 1067 | Ga0495639_0022341 | 3300046475 | Bacteria | 2774 |
| 1068 | Ga0495662_0001524 | 3300046476 | Bacteria | 11502 |
| 1069 | Ga0495664_0003608 | 3300046477 | Bacteria | 8436 |
| 1070 | Ga0495664_0004132 | 3300046477 | Bacteria | 7926 |
| 1071 | Ga0495664_0007442 | 3300046477 | Bacteria | 6082 |
| 1072 | Ga0495664_0024956 | 3300046477 | Bacteria | 3476 |
| 1073 | Ga0495664_0052403 | 3300046477 | Bacteria | 2425 |
| 1074 | Ga0495584_0007686 | 3300046491 | Bacteria | 5613 |
| 1075 | Ga0495584_0098033 | 3300046491 | Bacteria | 1481 |
| 1076 | Ga0495585_0031324 | 3300046492 | Bacteria | 3019 |
| 1077 | Ga0495594_0005394 | 3300046499 | Bacteria | 6572 |
| 1078 | Ga0495583_0060554 | 3300046506 | Bacteria | 1692 |
| 1079 | Ga0495606_0001875 | 3300046507 | Bacteria | 26343 |
| 1080 | Ga0495606_0029132 | 3300046507 | Bacteria | 3881 |
| 1081 | Ga0495606_0081523 | 3300046507 | Bacteria | 2011 |
| 1082 | Ga0495606_0083098 | 3300046507 | Bacteria | 1986 |
| 1083 | Ga0495606_0112941 | 3300046507 | Bacteria | 1636 |
| 1084 | Ga0495608_0000289 | 3300046511 | Bacteria | 35308 |
| 1085 | Ga0495608_0006800 | 3300046511 | Bacteria | 8107 |
| 1086 | Ga0495608_0016797 | 3300046511 | Bacteria | 5064 |
| 1087 | Ga0495608_0026000 | 3300046511 | Bacteria | 3994 |
| 1088 | Ga0495608_0029737 | 3300046511 | Bacteria | 3703 |
| 1089 | Ga0495608_0051514 | 3300046511 | Bacteria | 2728 |
| 1090 | Ga0495610_0057783 | 3300046512 | Bacteria | 1859 |
| 1091 | Ga0495616_0013598 | 3300046513 | Bacteria | 4586 |
| 1092 | Ga0495616_0072093 | 3300046513 | Bacteria | 1668 |
| 1093 | Ga0495616_0111407 | 3300046513 | Bacteria | 1271 |
| 1094 | Ga0495618_0002332 | 3300046514 | Bacteria | 12272 |
| 1095 | Ga0495618_0005683 | 3300046514 | Bacteria | 7578 |
| 1096 | Ga0495618_0005818 | 3300046514 | Bacteria | 7498 |
| 1097 | Ga0495618_0021212 | 3300046514 | Bacteria | 4005 |
| 1098 | Ga0495620_0008453 | 3300046515 | Bacteria | 5526 |
| 1099 | Ga0495628_0002019 | 3300046516 | Bacteria | 18395 |
| 1100 | Ga0495628_0005743 | 3300046516 | Bacteria | 10869 |
| 1101 | Ga0495628_0063328 | 3300046516 | Bacteria | 2898 |
| 1102 | Ga0495628_0070770 | 3300046516 | Bacteria | 2719 |
| 1103 | Ga0495628_0099426 | 3300046516 | Bacteria | 2247 |
| 1104 | Ga0495628_0109037 | 3300046516 | Bacteria | 2131 |
| 1105 | Ga0495630_0004265 | 3300046517 | Bacteria | 10023 |
| 1106 | Ga0495630_0010648 | 3300046517 | Bacteria | 6638 |
| 1107 | Ga0495630_0010684 | 3300046517 | Bacteria | 6628 |
| 1108 | Ga0495632_0025333 | 3300046519 | Bacteria | 3139 |
| 1109 | Ga0495648_0044784 | 3300046524 | Bacteria | 2759 |
| 1110 | Ga0495648_0087688 | 3300046524 | Bacteria | 1751 |
| 1111 | Ga0495666_0067927 | 3300046526 | Bacteria | 1698 |
| 1112 | Ga0495652_0004566 | 3300046529 | Bacteria | 13203 |
| 1113 | Ga0495652_0007469 | 3300046529 | Bacteria | 10075 |
| 1114 | Ga0495652_0015031 | 3300046529 | Bacteria | 6934 |
| 1115 | Ga0495652_0045490 | 3300046529 | Bacteria | 3772 |
| 1116 | Ga0495652_0081641 | 3300046529 | Bacteria | 2666 |
| 1117 | Ga0495652_0167720 | 3300046529 | Bacteria | 1697 |
| 1118 | Ga0495652_0239116 | 3300046529 | Bacteria | 1353 |
| 1119 | Ga0495654_0121070 | 3300046530 | Bacteria | 1184 |
| 1120 | Ga0495665_0007626 | 3300046531 | Bacteria | 5862 |
| 1121 | Ga0495665_0016023 | 3300046531 | Bacteria | 4038 |
| 1122 | Ga0495665_0018434 | 3300046531 | Bacteria | 3751 |
| 1123 | Ga0495640_0002278 | 3300046533 | Bacteria | 15391 |
| 1124 | Ga0495640_0009218 | 3300046533 | Bacteria | 7699 |
| 1125 | Ga0495640_0010515 | 3300046533 | Bacteria | 7143 |
| 1126 | Ga0495640_0011275 | 3300046533 | Bacteria | 6881 |
| 1127 | Ga0495640_0030298 | 3300046533 | Bacteria | 3875 |
| 1128 | Ga0495640_0037763 | 3300046533 | Bacteria | 3403 |
| 1129 | Ga0495640_0126222 | 3300046533 | Bacteria | 1659 |
| 1130 | Ga0495640_0142826 | 3300046533 | Bacteria | 1542 |
| 1131 | Ga0495586_0075916 | 3300046535 | Bacteria | 1840 |
| 1132 | Ga0495587_0001579 | 3300046536 | Bacteria | 15169 |
| 1133 | Ga0495587_0002055 | 3300046536 | Bacteria | 13439 |
| 1134 | Ga0495587_0075738 | 3300046536 | Bacteria | 1954 |
| 1135 | Ga0495598_0010358 | 3300046537 | Bacteria | 2232 |
| 1136 | Ga0495609_0041186 | 3300046538 | Bacteria | 2077 |
| 1137 | Ga0495621_0012445 | 3300046539 | Bacteria | 2652 |
| 1138 | Ga0495645_0015600 | 3300046543 | Bacteria | 5404 |
| 1139 | Ga0495645_0017012 | 3300046543 | Bacteria | 5205 |
| 1140 | Ga0495645_0064816 | 3300046543 | Bacteria | 2643 |
| 1141 | Ga0495622_0008280 | 3300046557 | Bacteria | 4816 |
| 1142 | Ga0495622_0047417 | 3300046557 | Bacteria | 1996 |
| 1143 | Ga0495622_0049876 | 3300046557 | Bacteria | 1943 |
| 1144 | Ga0495667_0000745 | 3300046559 | Bacteria | 20880 |
| 1145 | Ga0495667_0003972 | 3300046559 | Bacteria | 9929 |
| 1146 | Ga0495667_0004942 | 3300046559 | Bacteria | 9014 |
| 1147 | Ga0495667_0007291 | 3300046559 | Bacteria | 7502 |
| 1148 | Ga0495667_0017408 | 3300046559 | Bacteria | 4853 |
| 1149 | Ga0495667_0029968 | 3300046559 | Bacteria | 3658 |
| 1150 | Ga0495667_0036611 | 3300046559 | Bacteria | 3274 |
| 1151 | Ga0495656_0026478 | 3300046615 | Bacteria | 2309 |
| 1152 | Ga0495668_0024098 | 3300046616 | Bacteria | 3463 |
| 1153 | Ga0495634_0000886 | 3300046642 | Bacteria | 28754 |
| 1154 | Ga0495634_0010854 | 3300046642 | Bacteria | 6655 |
| 1155 | Ga0495634_0035418 | 3300046642 | Bacteria | 3419 |
| 1156 | Ga0495634_0059475 | 3300046642 | Bacteria | 2545 |
| 1157 | Ga0495634_0108579 | 3300046642 | Bacteria | 1786 |
| 1158 | Ga0495635_0000288 | 3300046663 | Bacteria | 32286 |
| 1159 | Ga0495635_0000628 | 3300046663 | Bacteria | 22744 |
| 1160 | Ga0495635_0007880 | 3300046663 | Bacteria | 7439 |
| 1161 | Ga0495635_0010659 | 3300046663 | Bacteria | 6436 |
| 1162 | Ga0495635_0019422 | 3300046663 | Bacteria | 4736 |
| 1163 | Ga0495635_0030423 | 3300046663 | Bacteria | 3752 |
| 1164 | Ga0495635_0115167 | 3300046663 | Bacteria | 1835 |
| 1165 | Ga0495635_0127602 | 3300046663 | Bacteria | 1734 |
| 1166 | Ga0495659_0004621 | 3300046664 | Bacteria | 4334 |
| 1167 | Ga0495661_0111970 | 3300046665 | Bacteria | 1520 |
| 1168 | Ga0495588_0006045 | 3300046674 | Bacteria | 5430 |
| 1169 | Ga0495588_0049532 | 3300046674 | Bacteria | 2160 |
| 1170 | Ga0495657_0000869 | 3300046675 | Bacteria | 26665 |
| 1171 | Ga0495657_0001357 | 3300046675 | Bacteria | 21264 |
| 1172 | Ga0495657_0009320 | 3300046675 | Bacteria | 7450 |
| 1173 | Ga0495657_0023590 | 3300046675 | Bacteria | 4394 |
| 1174 | Ga0495657_0134114 | 3300046675 | Bacteria | 1548 |
| 1175 | Ga0495599_0002342 | 3300046678 | Bacteria | 11001 |
| 1176 | Ga0495599_0012613 | 3300046678 | Bacteria | 5211 |
| 1177 | Ga0495599_0019939 | 3300046678 | Bacteria | 4176 |
| 1178 | Ga0495599_0032432 | 3300046678 | Bacteria | 3279 |
| 1179 | Ga0495623_0002014 | 3300046679 | Bacteria | 13644 |
| 1180 | Ga0495623_0002560 | 3300046679 | Bacteria | 12022 |
| 1181 | Ga0495623_0004925 | 3300046679 | Bacteria | 8751 |
| 1182 | Ga0495623_0011972 | 3300046679 | Bacteria | 5620 |
| 1183 | Ga0495623_0119677 | 3300046679 | Bacteria | 1586 |
| 1184 | Ga0495646_0001350 | 3300046680 | Bacteria | 14492 |
| 1185 | Ga0495646_0003278 | 3300046680 | Bacteria | 10075 |
| 1186 | Ga0495646_0080599 | 3300046680 | Bacteria | 1898 |
| 1187 | Ga0495647_0010897 | 3300046681 | Bacteria | 3105 |
| 1188 | Ga0495647_0028792 | 3300046681 | Bacteria | 2050 |
| 1189 | Ga0495658_0005405 | 3300046683 | Bacteria | 6278 |
| 1190 | Ga0495658_0007867 | 3300046683 | Bacteria | 5279 |
| 1191 | Ga0495658_0061430 | 3300046683 | Bacteria | 2157 |
| 1192 | Ga0495669_0023835 | 3300046684 | Bacteria | 2666 |
| 1193 | Ga0495669_0113690 | 3300046684 | Bacteria | 1265 |
| 1194 | Ga0495613_0002256 | 3300046689 | Bacteria | 14570 |
| 1195 | Ga0495613_0030094 | 3300046689 | Bacteria | 4033 |
| 1196 | Ga0495613_0092460 | 3300046689 | Bacteria | 2190 |
| 1197 | Ga0495613_0104223 | 3300046689 | Bacteria | 2048 |
| 1198 | Ga0495613_0148608 | 3300046689 | Bacteria | 1672 |
| 1199 | Ga0495613_0160595 | 3300046689 | Bacteria | 1599 |
| 1200 | Ga0495613_0241365 | 3300046689 | Bacteria | 1263 |
| 1201 | Ga0495624_0000867 | 3300046690 | Bacteria | 24012 |
| 1202 | Ga0495624_0070358 | 3300046690 | Bacteria | 2178 |
| 1203 | Ga0495670_0008005 | 3300046691 | Bacteria | 5195 |
| 1204 | Ga0495670_0059673 | 3300046691 | Bacteria | 1915 |
| 1205 | Ga0495671_0031480 | 3300046692 | Bacteria | 2712 |
| 1206 | Ga0495649_0006343 | 3300046694 | Bacteria | 7362 |
| 1207 | Ga0495600_0001518 | 3300046809 | Bacteria | 12888 |
| 1208 | Ga0495600_0020307 | 3300046809 | Bacteria | 4249 |
| 1209 | Ga0495600_0040052 | 3300046809 | Bacteria | 3051 |
| 1210 | Ga0495600_0058682 | 3300046809 | Bacteria | 2514 |
| 1211 | Ga0495600_0123335 | 3300046809 | Bacteria | 1685 |
| 1212 | Ga0495581_0116575 | 3300047315 | Bacteria | 1553 |
| 1213 | Ga0495604_0000613 | 3300047317 | Bacteria | 30609 |
| 1214 | Ga0495604_0002473 | 3300047317 | Bacteria | 14751 |
| 1215 | Ga0495604_0005447 | 3300047317 | Bacteria | 10093 |
| 1216 | Ga0495604_0033969 | 3300047317 | Bacteria | 4036 |
| 1217 | Ga0495604_0062471 | 3300047317 | Bacteria | 2844 |
| 1218 | Ga0495604_0101529 | 3300047317 | Bacteria | 2113 |
| 1219 | Ga0495604_0199296 | 3300047317 | Bacteria | 1390 |
| 1220 | Ga0495636_0021260 | 3300047318 | Bacteria | 2620 |
| 1221 | Ga0495674_0005148 | 3300047319 | Bacteria | 12558 |
| 1222 | Ga0495674_0009345 | 3300047319 | Bacteria | 9321 |
| 1223 | Ga0495674_0016916 | 3300047319 | Bacteria | 6799 |
| 1224 | Ga0495674_0022408 | 3300047319 | Bacteria | 5826 |
| 1225 | Ga0495674_0034750 | 3300047319 | Bacteria | 4555 |
| 1226 | Ga0495674_0040150 | 3300047319 | Bacteria | 4188 |
| 1227 | Ga0495674_0203789 | 3300047319 | Bacteria | 1640 |
| 1228 | Ga0495672_0087515 | 3300047320 | Bacteria | 1720 |
| 1229 | Ga0495676_0021648 | 3300047321 | Bacteria | 5609 |
| 1230 | Ga0495676_0035932 | 3300047321 | Bacteria | 4142 |
| 1231 | Ga0495680_0000791 | 3300047322 | Bacteria | 35389 |
| 1232 | Ga0495680_0000871 | 3300047322 | Bacteria | 33528 |
| 1233 | Ga0495680_0003706 | 3300047322 | Bacteria | 14923 |
| 1234 | Ga0495680_0008347 | 3300047322 | Bacteria | 9419 |
| 1235 | Ga0495680_0056497 | 3300047322 | Bacteria | 3039 |
| 1236 | Ga0495680_0082360 | 3300047322 | Bacteria | 2428 |
| 1237 | Ga0495683_0008398 | 3300047323 | Bacteria | 5529 |
| 1238 | Ga0495683_0093686 | 3300047323 | Bacteria | 1452 |
| 1239 | Ga0495687_008699 | 3300047443 | Bacteria | 5772 |
| 1240 | Ga0495675_0000231 | 3300047444 | Bacteria | 40288 |
| 1241 | Ga0495675_0004959 | 3300047444 | Bacteria | 8105 |
| 1242 | Ga0495675_0006519 | 3300047444 | Bacteria | 7145 |
| 1243 | Ga0495675_0046490 | 3300047444 | Bacteria | 2763 |
| 1244 | Ga0495675_0136897 | 3300047444 | Bacteria | 1520 |
| 1245 | Ga0495673_0064366 | 3300047469 | Bacteria | 1560 |
| 1246 | Ga0495684_0000169 | 3300047471 | Bacteria | 49164 |
| 1247 | Ga0495684_0006577 | 3300047471 | Bacteria | 9011 |
| 1248 | Ga0495684_0017615 | 3300047471 | Bacteria | 5501 |
| 1249 | Ga0495684_0024653 | 3300047471 | Bacteria | 4629 |
| 1250 | Ga0495684_0033293 | 3300047471 | Bacteria | 3954 |
| 1251 | Ga0495684_0040178 | 3300047471 | Bacteria | 3586 |
| 1252 | Ga0495684_0048445 | 3300047471 | Bacteria | 3249 |
| 1253 | Ga0495684_0061181 | 3300047471 | Bacteria | 2865 |
| 1254 | Ga0495684_0076092 | 3300047471 | Bacteria | 2549 |
| 1255 | Ga0495684_0111667 | 3300047471 | Bacteria | 2062 |
| 1256 | Ga0495684_0176189 | 3300047471 | Bacteria | 1587 |
| 1257 | Ga0495686_0069066 | 3300047472 | Bacteria | 2179 |
| 1258 | Ga0495686_0084342 | 3300047472 | Bacteria | 1936 |
| 1259 | Ga0495686_0124031 | 3300047472 | Bacteria | 1537 |
| 1260 | Ga0495593_0006499 | 3300047673 | Bacteria | 6850 |
| 1261 | Ga0495593_0015076 | 3300047673 | Bacteria | 4390 |
| 1262 | Ga0495602_0006526 | 3300048088 | Bacteria | 12232 |
| 1263 | Ga0495602_0007532 | 3300048088 | Bacteria | 11388 |
| 1264 | Ga0495602_0008023 | 3300048088 | Bacteria | 11038 |
| 1265 | Ga0495602_0109171 | 3300048088 | Bacteria | 2251 |
| 1266 | Ga0495626_0019874 | 3300048091 | Bacteria | 3352 |
| 1267 | Ga0496100_0001568 | 3300048903 | Bacteria | 11248 |
| 1268 | Ga0496100_0015384 | 3300048903 | Bacteria | 4468 |
| 1269 | Ga0496100_0029669 | 3300048903 | Bacteria | 3385 |
| 1270 | Ga0496100_0039950 | 3300048903 | Bacteria | 2982 |
| 1271 | Ga0496100_0056464 | 3300048903 | Bacteria | 2568 |
| 1272 | Ga0496101_0000171 | 3300048904 | Bacteria | 53757 |
| 1273 | Ga0496101_0001461 | 3300048904 | Bacteria | 14113 |
| 1274 | Ga0496101_0002295 | 3300048904 | Bacteria | 11691 |
| 1275 | Ga0496101_0061278 | 3300048904 | Bacteria | 2732 |
| 1276 | Ga0496101_0094070 | 3300048904 | Bacteria | 2233 |
| 1277 | Ga0496101_0264407 | 3300048904 | Bacteria | 1342 |
| 1278 | Ga0496102_0001453 | 3300048905 | Bacteria | 20988 |
| 1279 | Ga0496102_0004724 | 3300048905 | Bacteria | 11533 |
| 1280 | Ga0496102_0024848 | 3300048905 | Bacteria | 5328 |
| 1281 | Ga0496102_0132235 | 3300048905 | Bacteria | 2336 |
| 1282 | Ga0496102_0170684 | 3300048905 | Bacteria | 2048 |
| 1283 | Ga0496102_0221645 | 3300048905 | Bacteria | 1783 |
| 1284 | Ga0496103_0005627 | 3300048906 | Bacteria | 7489 |
| 1285 | Ga0496103_0005987 | 3300048906 | Bacteria | 7274 |
| 1286 | Ga0496103_0017226 | 3300048906 | Bacteria | 4321 |
| 1287 | Ga0496103_0216405 | 3300048906 | Bacteria | 1232 |
| 1288 | Ga0496104_0000067 | 3300048907 | Bacteria | 108556 |
| 1289 | Ga0496104_0003147 | 3300048907 | Bacteria | 14223 |
| 1290 | Ga0496104_0012278 | 3300048907 | Bacteria | 7699 |
| 1291 | Ga0496104_0037074 | 3300048907 | Bacteria | 4559 |
| 1292 | Ga0496104_0064446 | 3300048907 | Bacteria | 3475 |
| 1293 | Ga0496104_0081709 | 3300048907 | Bacteria | 3082 |
| 1294 | Ga0496104_0089362 | 3300048907 | Bacteria | 2943 |
| 1295 | Ga0496104_0138768 | 3300048907 | Bacteria | 2336 |
| 1296 | Ga0496104_0176828 | 3300048907 | Bacteria | 2044 |
| 1297 | Ga0496105_0000130 | 3300048908 | Bacteria | 50576 |
| 1298 | Ga0496105_0004705 | 3300048908 | Bacteria | 10292 |
| 1299 | Ga0496105_0011328 | 3300048908 | Bacteria | 7042 |
| 1300 | Ga0496105_0050772 | 3300048908 | Bacteria | 3426 |
| 1301 | Ga0496105_0054949 | 3300048908 | Bacteria | 3287 |
| 1302 | Ga0496105_0108449 | 3300048908 | Bacteria | 2292 |
| 1303 | Ga0496105_0189447 | 3300048908 | Bacteria | 1682 |
| 1304 | Ga0496105_0192646 | 3300048908 | Bacteria | 1666 |
| 1305 | Ga0496105_0218260 | 3300048908 | Bacteria | 1553 |
| 1306 | Ga0496106_0002116 | 3300048909 | Bacteria | 14844 |
| 1307 | Ga0496106_0005992 | 3300048909 | Bacteria | 8988 |
| 1308 | Ga0496106_0013472 | 3300048909 | Bacteria | 6037 |
| 1309 | Ga0496106_0013768 | 3300048909 | Bacteria | 5975 |
| 1310 | Ga0496106_0019258 | 3300048909 | Bacteria | 5061 |
| 1311 | Ga0496106_0035425 | 3300048909 | Bacteria | 3732 |
| 1312 | Ga0496106_0053430 | 3300048909 | Bacteria | 3051 |
| 1313 | Ga0496106_0063140 | 3300048909 | Bacteria | 2814 |
| 1314 | Ga0496106_0139292 | 3300048909 | Bacteria | 1908 |
| 1315 | Ga0496106_0177492 | 3300048909 | Bacteria | 1690 |
| 1316 | Ga0496107_0002489 | 3300048910 | Bacteria | 11968 |
| 1317 | Ga0496107_0003392 | 3300048910 | Bacteria | 10660 |
| 1318 | Ga0496107_0005829 | 3300048910 | Bacteria | 8433 |
| 1319 | Ga0496107_0009248 | 3300048910 | Bacteria | 6831 |
| 1320 | Ga0496107_0010662 | 3300048910 | Bacteria | 6390 |
| 1321 | Ga0496107_0036330 | 3300048910 | Bacteria | 3534 |
| 1322 | Ga0496107_0103925 | 3300048910 | Bacteria | 2084 |
| 1323 | Ga0496107_0120514 | 3300048910 | Bacteria | 1933 |
| 1324 | Ga0496107_0280096 | 3300048910 | Bacteria | 1241 |
| 1325 | Ga0496108_0003417 | 3300048911 | Bacteria | 12751 |
| 1326 | Ga0496108_0005206 | 3300048911 | Bacteria | 10513 |
| 1327 | Ga0496108_0006501 | 3300048911 | Bacteria | 9482 |
| 1328 | Ga0496108_0025147 | 3300048911 | Bacteria | 4905 |
| 1329 | Ga0496108_0025606 | 3300048911 | Bacteria | 4863 |
| 1330 | Ga0496108_0039052 | 3300048911 | Bacteria | 3956 |
| 1331 | Ga0496108_0047350 | 3300048911 | Bacteria | 3594 |
| 1332 | Ga0496108_0064251 | 3300048911 | Bacteria | 3092 |
| 1333 | Ga0496108_0132273 | 3300048911 | Bacteria | 2144 |
| 1334 | Ga0496109_0000606 | 3300048912 | Bacteria | 29948 |
| 1335 | Ga0496109_0000714 | 3300048912 | Bacteria | 27676 |
| 1336 | Ga0496109_0004345 | 3300048912 | Bacteria | 11842 |
| 1337 | Ga0496109_0004713 | 3300048912 | Bacteria | 11387 |
| 1338 | Ga0496109_0024520 | 3300048912 | Bacteria | 5363 |
| 1339 | Ga0496109_0030825 | 3300048912 | Bacteria | 4807 |
| 1340 | Ga0496109_0084083 | 3300048912 | Bacteria | 2935 |
| 1341 | Ga0496109_0084980 | 3300048912 | Bacteria | 2920 |
| 1342 | Ga0496109_0122011 | 3300048912 | Bacteria | 2428 |
| 1343 | Ga0496109_0125037 | 3300048912 | Bacteria | 2397 |
| 1344 | Ga0496109_0151615 | 3300048912 | Bacteria | 2170 |
| 1345 | Ga0496109_0210528 | 3300048912 | Bacteria | 1828 |
| 1346 | Ga0496109_0218652 | 3300048912 | Bacteria | 1792 |
| 1347 | Ga0496110_0011093 | 3300048913 | Bacteria | 7361 |
| 1348 | Ga0496110_0031167 | 3300048913 | Bacteria | 4599 |
| 1349 | Ga0496110_0073759 | 3300048913 | Bacteria | 3029 |
| 1350 | Ga0496110_0080773 | 3300048913 | Bacteria | 2898 |
| 1351 | Ga0496110_0083757 | 3300048913 | Bacteria | 2845 |
| 1352 | Ga0496110_0149039 | 3300048913 | Bacteria | 2117 |
| 1353 | Ga0496110_0407516 | 3300048913 | Bacteria | 1239 |
| 1354 | Ga0496110_0453028 | 3300048913 | Bacteria | 1169 |
| 1355 | Ga0496111_0038001 | 3300048914 | Bacteria | 3447 |
| 1356 | Ga0496111_0039188 | 3300048914 | Bacteria | 3396 |
| 1357 | Ga0496111_0111178 | 3300048914 | Bacteria | 2018 |
| 1358 | Ga0496111_0141650 | 3300048914 | Bacteria | 1781 |
| 1359 | Ga0496111_0160448 | 3300048914 | Bacteria | 1669 |
| 1360 | Ga0496111_0172079 | 3300048914 | Bacteria | 1609 |
| 1361 | Ga0496111_0172431 | 3300048914 | Bacteria | 1607 |
| 1362 | Ga0496112_0002085 | 3300048915 | Bacteria | 15849 |
| 1363 | Ga0496112_0003993 | 3300048915 | Bacteria | 12365 |
| 1364 | Ga0496112_0007660 | 3300048915 | Bacteria | 9604 |
| 1365 | Ga0496112_0018292 | 3300048915 | Bacteria | 6596 |
| 1366 | Ga0496112_0090589 | 3300048915 | Bacteria | 3027 |
| 1367 | Ga0496112_0091411 | 3300048915 | Bacteria | 3012 |
| 1368 | Ga0496112_0130032 | 3300048915 | Bacteria | 2489 |
| 1369 | Ga0496112_0154841 | 3300048915 | Bacteria | 2259 |
| 1370 | Ga0496112_0156781 | 3300048915 | Bacteria | 2243 |
| 1371 | Ga0496112_0204664 | 3300048915 | Bacteria | 1932 |
| 1372 | Ga0496112_0250203 | 3300048915 | Bacteria | 1723 |
| 1373 | Ga0496112_0309730 | 3300048915 | Bacteria | 1524 |
| 1374 | Ga0496113_0000399 | 3300048916 | Bacteria | 20918 |
| 1375 | Ga0496113_0002831 | 3300048916 | Bacteria | 10199 |
| 1376 | Ga0496113_0034822 | 3300048916 | Bacteria | 3677 |
| 1377 | Ga0496113_0035652 | 3300048916 | Bacteria | 3639 |
| 1378 | Ga0496113_0042451 | 3300048916 | Bacteria | 3361 |
| 1379 | Ga0496113_0067886 | 3300048916 | Bacteria | 2705 |
| 1380 | Ga0496113_0092424 | 3300048916 | Bacteria | 2333 |
| 1381 | Ga0496114_0008317 | 3300048917 | Bacteria | 8221 |
| 1382 | Ga0496114_0028520 | 3300048917 | Bacteria | 4581 |
| 1383 | Ga0496114_0029718 | 3300048917 | Bacteria | 4493 |
| 1384 | Ga0496114_0041803 | 3300048917 | Bacteria | 3798 |
| 1385 | Ga0496114_0096651 | 3300048917 | Bacteria | 2515 |
| 1386 | Ga0496114_0174186 | 3300048917 | Bacteria | 1876 |
| 1387 | Ga0496114_0178178 | 3300048917 | Bacteria | 1855 |
| 1388 | Ga0496114_0216719 | 3300048917 | Bacteria | 1680 |
| 1389 | Ga0496114_0225839 | 3300048917 | Bacteria | 1644 |
| 1390 | Ga0496114_0238726 | 3300048917 | Bacteria | 1598 |
| 1391 | Ga0496114_0267825 | 3300048917 | Bacteria | 1505 |
| 1392 | Ga0496115_0001189 | 3300048918 | Bacteria | 18669 |
| 1393 | Ga0496115_0006380 | 3300048918 | Bacteria | 8641 |
| 1394 | Ga0496115_0085724 | 3300048918 | Bacteria | 2569 |
| 1395 | Ga0496115_0100555 | 3300048918 | Bacteria | 2370 |
| 1396 | Ga0496115_0101360 | 3300048918 | Bacteria | 2361 |
| 1397 | Ga0496115_0105381 | 3300048918 | Bacteria | 2314 |
| 1398 | Ga0496115_0116269 | 3300048918 | Bacteria | 2200 |
| 1399 | Ga0496115_0130782 | 3300048918 | Bacteria | 2069 |
| 1400 | Ga0496115_0189688 | 3300048918 | Bacteria | 1698 |
| 1401 | Ga0496115_0207959 | 3300048918 | Bacteria | 1616 |
| 1402 | Ga0496115_0280027 | 3300048918 | Bacteria | 1369 |
| 1403 | Ga0496116_0003460 | 3300048919 | Bacteria | 15569 |
| 1404 | Ga0496116_0097457 | 3300048919 | Bacteria | 1768 |
| 1405 | Ga0496117_0027790 | 3300048920 | Bacteria | 4396 |
| 1406 | Ga0496117_0030958 | 3300048920 | Bacteria | 4094 |
| 1407 | Ga0496117_0037619 | 3300048920 | Bacteria | 3603 |
| 1408 | Ga0496118_0015666 | 3300048921 | Bacteria | 7003 |
| 1409 | Ga0496118_0016153 | 3300048921 | Bacteria | 6865 |
| 1410 | Ga0496118_0037789 | 3300048921 | Bacteria | 3880 |
| 1411 | Ga0496118_0047600 | 3300048921 | Bacteria | 3321 |
| 1412 | Ga0496118_0074444 | 3300048921 | Bacteria | 2427 |
| 1413 | Ga0496118_0167974 | 3300048921 | Bacteria | 1345 |
| 1414 | Ga0496119_0025737 | 3300048922 | Bacteria | 4101 |
| 1415 | Ga0496119_0042676 | 3300048922 | Bacteria | 2874 |
| 1416 | Ga0496119_0045738 | 3300048922 | Bacteria | 2741 |
| 1417 | Ga0496119_0048007 | 3300048922 | Bacteria | 2651 |
| 1418 | Ga0496120_0024841 | 3300048923 | Bacteria | 3729 |
| 1419 | Ga0496121_0010952 | 3300048924 | Bacteria | 10129 |
| 1420 | Ga0496121_0012201 | 3300048924 | Bacteria | 9417 |
| 1421 | Ga0496121_0017146 | 3300048924 | Bacteria | 7418 |
| 1422 | Ga0496121_0022980 | 3300048924 | Bacteria | 6024 |
| 1423 | Ga0496121_0023489 | 3300048924 | Bacteria | 5936 |
| 1424 | Ga0496121_0025833 | 3300048924 | Bacteria | 5557 |
| 1425 | Ga0496121_0043880 | 3300048924 | Bacteria | 3866 |
| 1426 | Ga0496121_0085681 | 3300048924 | Bacteria | 2479 |
| 1427 | Ga0496121_0229765 | 3300048924 | Bacteria | 1300 |
| 1428 | Ga0496122_0002797 | 3300048925 | Bacteria | 23973 |
| 1429 | Ga0496122_0016307 | 3300048925 | Bacteria | 7045 |
| 1430 | Ga0496122_0050808 | 3300048925 | Bacteria | 3157 |
| 1431 | Ga0496123_0001238 | 3300048926 | Bacteria | 37104 |
| 1432 | Ga0496123_0033846 | 3300048926 | Bacteria | 3670 |
| 1433 | Ga0496123_0109376 | 3300048926 | Bacteria | 1584 |
| 1434 | Ga0496124_0038924 | 3300048927 | Bacteria | 4125 |
| 1435 | Ga0496125_0006390 | 3300048928 | Bacteria | 12771 |
| 1436 | Ga0496125_0016099 | 3300048928 | Bacteria | 7197 |
| 1437 | Ga0496125_0039975 | 3300048928 | Bacteria | 4030 |
| 1438 | Ga0496125_0064054 | 3300048928 | Bacteria | 2925 |
| 1439 | Ga0496125_0208572 | 3300048928 | Bacteria | 1271 |
| 1440 | Ga0496126_0015873 | 3300048929 | Bacteria | 7562 |
| 1441 | Ga0496126_0032674 | 3300048929 | Bacteria | 4901 |
| 1442 | Ga0496126_0038151 | 3300048929 | Bacteria | 4472 |
| 1443 | Ga0496126_0042128 | 3300048929 | Bacteria | 4218 |
| 1444 | Ga0496126_0042747 | 3300048929 | Bacteria | 4184 |
| 1445 | Ga0496126_0050585 | 3300048929 | Bacteria | 3785 |
| 1446 | Ga0496126_0072076 | 3300048929 | Bacteria | 3073 |
| 1447 | Ga0496126_0072748 | 3300048929 | Bacteria | 3057 |
| 1448 | Ga0496126_0228588 | 3300048929 | Bacteria | 1559 |
| 1449 | Ga0496126_0266403 | 3300048929 | Bacteria | 1423 |
| 1450 | Ga0496126_0297037 | 3300048929 | Bacteria | 1334 |
| 1451 | Ga0501032_0006146 | 3300049569 | Bacteria | 8839 |
| 1452 | Ga0501032_0011555 | 3300049569 | Bacteria | 6336 |
| 1453 | Ga0501032_0041414 | 3300049569 | Bacteria | 3128 |
| 1454 | Ga0501032_0042184 | 3300049569 | Bacteria | 3095 |
| 1455 | Ga0501032_0181234 | 3300049569 | Bacteria | 1379 |
| 1456 | Ga0501033_0008505 | 3300049570 | Bacteria | 7943 |
| 1457 | Ga0501033_0027308 | 3300049570 | Bacteria | 4291 |
| 1458 | Ga0501033_0052754 | 3300049570 | Bacteria | 3014 |
| 1459 | Ga0501033_0062434 | 3300049570 | Bacteria | 2743 |
| 1460 | Ga0501033_0138088 | 3300049570 | Bacteria | 1763 |
| 1461 | Ga0501034_0000374 | 3300049571 | Bacteria | 76280 |
| 1462 | Ga0501034_0001727 | 3300049571 | Bacteria | 28118 |
| 1463 | Ga0501034_0009449 | 3300049571 | Bacteria | 10204 |
| 1464 | Ga0501034_0011524 | 3300049571 | Bacteria | 9161 |
| 1465 | Ga0501034_0015758 | 3300049571 | Bacteria | 7762 |
| 1466 | Ga0501034_0060482 | 3300049571 | Bacteria | 3804 |
| 1467 | Ga0501034_0064804 | 3300049571 | Bacteria | 3667 |
| 1468 | Ga0501034_0084794 | 3300049571 | Bacteria | 3169 |
| 1469 | Ga0501034_0088636 | 3300049571 | Bacteria | 3092 |
| 1470 | Ga0501034_0102221 | 3300049571 | Bacteria | 2859 |
| 1471 | Ga0501034_0116629 | 3300049571 | Bacteria | 2658 |
| 1472 | Ga0501034_0198434 | 3300049571 | Bacteria | 1965 |
| 1473 | Ga0501034_0252815 | 3300049571 | Bacteria | 1706 |
| 1474 | Ga0501034_0274474 | 3300049571 | Bacteria | 1626 |
| 1475 | Ga0501036_0000123 | 3300049572 | Bacteria | 48776 |
| 1476 | Ga0501036_0018169 | 3300049572 | Bacteria | 5889 |
| 1477 | Ga0501036_0030032 | 3300049572 | Bacteria | 4592 |
| 1478 | Ga0501036_0130862 | 3300049572 | Bacteria | 2119 |
| 1479 | Ga0501036_0167670 | 3300049572 | Bacteria | 1850 |
| 1480 | Ga0501036_0404633 | 3300049572 | Bacteria | 1138 |
| 1481 | Ga0501037_0019490 | 3300049573 | Bacteria | 5004 |
| 1482 | Ga0501037_0055241 | 3300049573 | Bacteria | 2903 |
| 1483 | Ga0501037_0074458 | 3300049573 | Bacteria | 2467 |
| 1484 | Ga0501037_0169336 | 3300049573 | Bacteria | 1553 |
| 1485 | Ga0501037_0185034 | 3300049573 | Bacteria | 1477 |
| 1486 | Ga0501037_0263644 | 3300049573 | Bacteria | 1203 |
| 1487 | Ga0501038_0004971 | 3300049574 | Bacteria | 12354 |
| 1488 | Ga0501038_0023342 | 3300049574 | Bacteria | 5531 |
| 1489 | Ga0501038_0034764 | 3300049574 | Bacteria | 4428 |
| 1490 | Ga0501038_0054112 | 3300049574 | Bacteria | 3452 |
| 1491 | Ga0501038_0101697 | 3300049574 | Bacteria | 2392 |
| 1492 | Ga0501038_0116515 | 3300049574 | Bacteria | 2208 |
| 1493 | Ga0501039_0027874 | 3300049575 | Bacteria | 4344 |
| 1494 | Ga0501039_0051218 | 3300049575 | Bacteria | 3195 |
| 1495 | Ga0501039_0125510 | 3300049575 | Bacteria | 2013 |
| 1496 | Ga0501039_0256922 | 3300049575 | Bacteria | 1373 |
| 1497 | Ga0501039_0308719 | 3300049575 | Bacteria | 1243 |
| 1498 | Ga0501039_0353512 | 3300049575 | Bacteria | 1154 |
| 1499 | Ga0501040_0154134 | 3300049576 | Bacteria | 1622 |
| 1500 | Ga0501043_0016075 | 3300049579 | Bacteria | 5869 |
| 1501 | Ga0501043_0027703 | 3300049579 | Bacteria | 4448 |
| 1502 | Ga0501043_0139039 | 3300049579 | Bacteria | 1902 |
| 1503 | Ga0501043_0181334 | 3300049579 | Bacteria | 1640 |
| 1504 | Ga0501043_0182719 | 3300049579 | Bacteria | 1634 |
| 1505 | Ga0501043_0188076 | 3300049579 | Bacteria | 1607 |
| 1506 | Ga0501046_0028653 | 3300049580 | Bacteria | 4534 |
| 1507 | Ga0501046_0060697 | 3300049580 | Bacteria | 2958 |
| 1508 | Ga0501046_0125307 | 3300049580 | Bacteria | 1952 |
| 1509 | Ga0501046_0168359 | 3300049580 | Bacteria | 1645 |
| 1510 | Ga0501047_0000234 | 3300049581 | Bacteria | 65759 |
| 1511 | Ga0501047_0014755 | 3300049581 | Bacteria | 7434 |
| 1512 | Ga0501047_0020561 | 3300049581 | Bacteria | 6338 |
| 1513 | Ga0501047_0024694 | 3300049581 | Bacteria | 5771 |
| 1514 | Ga0501047_0059180 | 3300049581 | Bacteria | 3699 |
| 1515 | Ga0501047_0069949 | 3300049581 | Bacteria | 3379 |
| 1516 | Ga0501047_0107349 | 3300049581 | Bacteria | 2673 |
| 1517 | Ga0501047_0322777 | 3300049581 | Bacteria | 1383 |
| 1518 | Ga0501047_0399451 | 3300049581 | Bacteria | 1207 |
| 1519 | Ga0501048_0000051 | 3300049582 | Bacteria | 57320 |
| 1520 | Ga0501067_0014452 | 3300049583 | Bacteria | 4371 |
| 1521 | Ga0501067_0017895 | 3300049583 | Bacteria | 3923 |
| 1522 | Ga0501067_0035608 | 3300049583 | Bacteria | 2764 |
| 1523 | Ga0501068_0055285 | 3300049584 | Bacteria | 2405 |
| 1524 | Ga0501068_0057599 | 3300049584 | Bacteria | 2356 |
| 1525 | Ga0501068_0166882 | 3300049584 | Bacteria | 1389 |
| 1526 | Ga0501068_0167124 | 3300049584 | Bacteria | 1387 |
| 1527 | Ga0501069_0077136 | 3300049585 | Bacteria | 1874 |
| 1528 | Ga0501069_0102353 | 3300049585 | Bacteria | 1626 |
| 1529 | Ga0501070_0000886 | 3300049586 | Bacteria | 27179 |
| 1530 | Ga0501070_0003306 | 3300049586 | Bacteria | 13999 |
| 1531 | Ga0501070_0014454 | 3300049586 | Bacteria | 6643 |
| 1532 | Ga0501070_0019784 | 3300049586 | Bacteria | 5646 |
| 1533 | Ga0501070_0035784 | 3300049586 | Bacteria | 4146 |
| 1534 | Ga0501070_0039056 | 3300049586 | Bacteria | 3961 |
| 1535 | Ga0501070_0049732 | 3300049586 | Bacteria | 3481 |
| 1536 | Ga0501070_0057621 | 3300049586 | Bacteria | 3221 |
| 1537 | Ga0501070_0075239 | 3300049586 | Bacteria | 2795 |
| 1538 | Ga0501070_0141871 | 3300049586 | Bacteria | 1983 |
| 1539 | Ga0501070_0227283 | 3300049586 | Bacteria | 1529 |
| 1540 | Ga0501071_0044011 | 3300049587 | Bacteria | 3202 |
| 1541 | Ga0501071_0047958 | 3300049587 | Bacteria | 3070 |
| 1542 | Ga0501071_0176720 | 3300049587 | Bacteria | 1599 |
| 1543 | Ga0501072_0064463 | 3300049588 | Bacteria | 2889 |
| 1544 | Ga0501072_0073920 | 3300049588 | Bacteria | 2695 |
| 1545 | Ga0501072_0088730 | 3300049588 | Bacteria | 2454 |
| 1546 | Ga0501072_0229559 | 3300049588 | Bacteria | 1479 |
| 1547 | Ga0501073_0005359 | 3300049589 | Bacteria | 9616 |
| 1548 | Ga0501073_0012550 | 3300049589 | Bacteria | 6184 |
| 1549 | Ga0501073_0029845 | 3300049589 | Bacteria | 3896 |
| 1550 | Ga0501073_0039990 | 3300049589 | Bacteria | 3321 |
| 1551 | Ga0501073_0056536 | 3300049589 | Bacteria | 2744 |
| 1552 | Ga0501073_0068530 | 3300049589 | Bacteria | 2472 |
| 1553 | Ga0501073_0071925 | 3300049589 | Bacteria | 2409 |
| 1554 | Ga0501074_0061808 | 3300049590 | Bacteria | 2698 |
| 1555 | Ga0501074_0062480 | 3300049590 | Bacteria | 2682 |
| 1556 | Ga0501074_0083248 | 3300049590 | Bacteria | 2293 |
| 1557 | Ga0501074_0083519 | 3300049590 | Bacteria | 2290 |
| 1558 | Ga0501074_0090261 | 3300049590 | Bacteria | 2194 |
| 1559 | Ga0501074_0098863 | 3300049590 | Bacteria | 2089 |
| 1560 | Ga0501074_0108317 | 3300049590 | Bacteria | 1988 |
| 1561 | Ga0501075_0052437 | 3300049591 | Bacteria | 3067 |
| 1562 | Ga0501076_0004635 | 3300049592 | Bacteria | 9795 |
| 1563 | Ga0501076_0244478 | 3300049592 | Bacteria | 1468 |
| 1564 | Ga0501077_0004508 | 3300049593 | Bacteria | 8465 |
| 1565 | Ga0501077_0056520 | 3300049593 | Bacteria | 2491 |
| 1566 | Ga0501079_0024017 | 3300049741 | Bacteria | 4676 |
| 1567 | Ga0501079_0125840 | 3300049741 | Bacteria | 1994 |
| 1568 | Ga0501079_0179179 | 3300049741 | Bacteria | 1653 |
| 1569 | Ga0501080_0000528 | 3300049742 | Bacteria | 30043 |
| 1570 | Ga0501080_0011183 | 3300049742 | Bacteria | 8214 |
| 1571 | Ga0501080_0015520 | 3300049742 | Bacteria | 7024 |
| 1572 | Ga0501080_0087545 | 3300049742 | Bacteria | 2893 |
| 1573 | Ga0501080_0100490 | 3300049742 | Bacteria | 2683 |
| 1574 | Ga0501080_0174595 | 3300049742 | Bacteria | 1980 |
| 1575 | Ga0501080_0218127 | 3300049742 | Bacteria | 1746 |
| 1576 | Ga0501080_0291167 | 3300049742 | Bacteria | 1482 |
| 1577 | Ga0501080_0327262 | 3300049742 | Bacteria | 1386 |
| 1578 | Ga0501081_0000718 | 3300049743 | Bacteria | 19248 |
| 1579 | Ga0501083_0008673 | 3300049744 | Bacteria | 7171 |
| 1580 | Ga0501083_0035017 | 3300049744 | Bacteria | 3431 |
| 1581 | Ga0501083_0082630 | 3300049744 | Bacteria | 2128 |
| 1582 | Ga0501083_0112684 | 3300049744 | Bacteria | 1787 |
| 1583 | Ga0501083_0189704 | 3300049744 | Bacteria | 1341 |
| 1584 | Ga0501035_0000366 | 3300049822 | Bacteria | 52132 |
| 1585 | Ga0501035_0019199 | 3300049822 | Bacteria | 6294 |
| 1586 | Ga0501035_0028768 | 3300049822 | Bacteria | 5071 |
| 1587 | Ga0501035_0062570 | 3300049822 | Bacteria | 3311 |
| 1588 | Ga0501035_0072916 | 3300049822 | Bacteria | 3038 |
| 1589 | Ga0501035_0120311 | 3300049822 | Bacteria | 2296 |
| 1590 | Ga0501035_0129680 | 3300049822 | Bacteria | 2199 |
| 1591 | Ga0501035_0141264 | 3300049822 | Bacteria | 2093 |
| 1592 | Ga0501035_0283915 | 3300049822 | Bacteria | 1398 |
| 1593 | Ga0501035_0315516 | 3300049822 | Bacteria | 1314 |
| 1594 | Ga0501044_0000122 | 3300049823 | Bacteria | 93246 |
| 1595 | Ga0501044_0001683 | 3300049823 | Bacteria | 25978 |
| 1596 | Ga0501044_0024050 | 3300049823 | Bacteria | 6472 |
| 1597 | Ga0501044_0027004 | 3300049823 | Bacteria | 6073 |
| 1598 | Ga0501044_0032759 | 3300049823 | Bacteria | 5462 |
| 1599 | Ga0501044_0042684 | 3300049823 | Bacteria | 4715 |
| 1600 | Ga0501044_0047844 | 3300049823 | Bacteria | 4422 |
| 1601 | Ga0501044_0052709 | 3300049823 | Bacteria | 4190 |
| 1602 | Ga0501044_0056059 | 3300049823 | Bacteria | 4046 |
| 1603 | Ga0501044_0077803 | 3300049823 | Bacteria | 3363 |
| 1604 | Ga0501044_0118929 | 3300049823 | Bacteria | 2644 |
| 1605 | Ga0501044_0198312 | 3300049823 | Bacteria | 1966 |
| 1606 | Ga0501044_0221720 | 3300049823 | Bacteria | 1841 |
| 1607 | Ga0501044_0390894 | 3300049823 | Bacteria | 1305 |
| 1608 | Ga0501045_0142865 | 3300049824 | Bacteria | 1780 |
| 1609 | nmdc:mga03683_12219_c1 | 3300050489 | Bacteria | 3131 |
| 1610 | nmdc:mga03n38_2270_c1 | 3300050490 | Bacteria | 5886 |
| 1611 | nmdc:mga03n38_85112_c1 | 3300050490 | Bacteria | 1494 |
| 1612 | nmdc:mga03n38_97343_c1 | 3300050490 | Bacteria | 1413 |
| 1613 | nmdc:mga00v17_126688_c1 | 3300050491 | Bacteria | 1629 |
| 1614 | nmdc:mga00v17_13149_c2 | 3300050491 | Bacteria | 3469 |
| 1615 | nmdc:mga00v17_48336_c1 | 3300050491 | Bacteria | 2578 |
| 1616 | nmdc:mga0yw44_19588_c2 | 3300050492 | Bacteria | 2125 |
| 1617 | nmdc:mga0yw44_21048_c1 | 3300050492 | Bacteria | 3632 |
| 1618 | nmdc:mga0yw44_52774_c1 | 3300050492 | Bacteria | 2466 |
| 1619 | nmdc:mga0yw44_7314_c1 | 3300050492 | Bacteria | 5421 |
| 1620 | nmdc:mga0yw44_94778_c1 | 3300050492 | Bacteria | 1892 |
| 1621 | nmdc:mga0yw44_98163_c1 | 3300050492 | Bacteria | 1862 |
| 1622 | nmdc:mga0k408_11019_c1 | 3300050493 | Bacteria | 4909 |
| 1623 | nmdc:mga0k408_172928_c1 | 3300050493 | Bacteria | 1288 |
| 1624 | nmdc:mga0k408_24659_c1 | 3300050493 | Bacteria | 3401 |
| 1625 | nmdc:mga06z11_21831_c1 | 3300050494 | Bacteria | 2980 |
| 1626 | nmdc:mga06z11_6887_c1 | 3300050494 | Bacteria | 4650 |
| 1627 | nmdc:mga06z11_7520_c1 | 3300050494 | Bacteria | 4222 |
| 1628 | nmdc:mga06z11_88854_c1 | 3300050494 | Bacteria | 1674 |
| 1629 | nmdc:mga07m45_175977_c1 | 3300050496 | Bacteria | 1244 |
| 1630 | nmdc:mga07m45_3560_c1 | 3300050496 | Bacteria | 7524 |
| 1631 | nmdc:mga07m45_83115_c1 | 3300050496 | Bacteria | 1829 |
| 1632 | nmdc:mga05p37_290_c1 | 3300050507 | Bacteria | 52425 |
| 1633 | nmdc:mga05p37_357878_c1 | 3300050507 | Bacteria | 1717 |
| 1634 | nmdc:mga05p37_46125_c1 | 3300050507 | Bacteria | 5359 |
| 1635 | nmdc:mga05p37_58061_c1 | 3300050507 | Bacteria | 4766 |
| 1636 | nmdc:mga09592_154530_c1 | 3300050508 | Bacteria | 1980 |
| 1637 | nmdc:mga09592_2994_c1 | 3300050508 | Bacteria | 13696 |
| 1638 | nmdc:mga0qj67_16217_c1 | 3300050509 | Bacteria | 5646 |
| 1639 | nmdc:mga0qj67_2739_c1 | 3300050509 | Bacteria | 12638 |
| 1640 | nmdc:mga0qj67_412_c1 | 3300050509 | Bacteria | 29289 |
| 1641 | nmdc:mga06r32_2029_c1 | 3300050510 | Bacteria | 18097 |
| 1642 | nmdc:mga06r32_475583_c1 | 3300050510 | Bacteria | 1228 |
| 1643 | nmdc:mga08y16_126862_c1 | 3300050511 | Bacteria | 2654 |
| 1644 | nmdc:mga08y16_1898_c1 | 3300050511 | Bacteria | 21299 |
| 1645 | nmdc:mga08y16_2825_c1 | 3300050511 | Bacteria | 17843 |
| 1646 | nmdc:mga08y16_844_c1 | 3300050511 | Bacteria | 29426 |
| 1647 | nmdc:mga0n895_1061_c1 | 3300050512 | Bacteria | 20040 |
| 1648 | nmdc:mga0n895_113418_c1 | 3300050512 | Bacteria | 2728 |
| 1649 | nmdc:mga0n895_134613_c1 | 3300050512 | Bacteria | 2497 |
| 1650 | nmdc:mga0n895_20783_c1 | 3300050512 | Bacteria | 6130 |
| 1651 | nmdc:mga0n895_22046_c1 | 3300050512 | Bacteria | 5968 |
| 1652 | nmdc:mga0n895_22082_c1 | 3300050512 | Bacteria | 5964 |
| 1653 | nmdc:mga0n895_62410_c1 | 3300050512 | Bacteria | 3683 |
| 1654 | nmdc:mga0rr50_276383_c1 | 3300050513 | Bacteria | 1401 |
| 1655 | nmdc:mga0rr50_3611_c1 | 3300050513 | Bacteria | 8942 |
| 1656 | nmdc:mga0rr50_6009_c1 | 3300050513 | Bacteria | 7328 |
| 1657 | nmdc:mga08x19_80718_c1 | 3300050514 | Bacteria | 2135 |
| 1658 | nmdc:mga0a205_3382_c1 | 3300050515 | Bacteria | 14218 |
| 1659 | nmdc:mga0a205_8902_c1 | 3300050515 | Bacteria | 9148 |
| 1660 | nmdc:mga0a205_9541_c1 | 3300050515 | Bacteria | 8880 |
| 1661 | nmdc:mga0sz30_12054_c1 | 3300050516 | Bacteria | 3355 |
| 1662 | nmdc:mga0sz30_18686_c1 | 3300050516 | Bacteria | 1905 |
| 1663 | nmdc:mga0sz30_39804_c1 | 3300050516 | Bacteria | 1974 |
| 1664 | Ga0495601_0001939 | 3300053077 | Bacteria | 11573 |
| 1665 | Ga0495601_0002428 | 3300053077 | Bacteria | 10581 |
| 1666 | Ga0495601_0004177 | 3300053077 | Bacteria | 8330 |
| 1667 | Ga0495601_0074964 | 3300053077 | Bacteria | 2165 |
| 1668 | Ga0495601_0150692 | 3300053077 | Bacteria | 1518 |
| 1669 | Ga0495601_0229984 | 3300053077 | Bacteria | 1211 |
| 1670 | Ga0495612_0003279 | 3300053078 | Bacteria | 6711 |
| 1671 | Ga0495612_0003991 | 3300053078 | Bacteria | 6117 |
| 1672 | Ga0495612_0008348 | 3300053078 | Bacteria | 4202 |
| 1673 | Ga0495612_0014886 | 3300053078 | Bacteria | 3121 |
| 1674 | Ga0495612_0027096 | 3300053078 | Bacteria | 2304 |
| 1675 | Ga0495655_0005062 | 3300053083 | Bacteria | 2301 |
| 1676 | Ga0495595_0000430 | 3300053084 | Bacteria | 15913 |
| 1677 | Ga0495595_0002807 | 3300053084 | Bacteria | 6852 |
| 1678 | Ga0495595_0003742 | 3300053084 | Bacteria | 6050 |
| 1679 | Ga0495595_0011462 | 3300053084 | Bacteria | 3707 |
| 1680 | Ga0495595_0011494 | 3300053084 | Bacteria | 3702 |
| 1681 | Ga0495595_0028290 | 3300053084 | Bacteria | 2503 |
| 1682 | Ga0495595_0028986 | 3300053084 | Bacteria | 2474 |
| 1683 | Ga0495595_0029997 | 3300053084 | Bacteria | 2437 |
| 1684 | Ga0495619_0000259 | 3300053085 | Bacteria | 38593 |
| 1685 | Ga0495619_0000719 | 3300053085 | Bacteria | 21645 |
| 1686 | Ga0495619_0006574 | 3300053085 | Bacteria | 7353 |
| 1687 | Ga0495619_0007799 | 3300053085 | Bacteria | 6775 |
| 1688 | Ga0495619_0007804 | 3300053085 | Bacteria | 6773 |
| 1689 | Ga0495619_0009420 | 3300053085 | Bacteria | 6160 |
| 1690 | Ga0495619_0022954 | 3300053085 | Bacteria | 3994 |
| 1691 | Ga0495619_0047265 | 3300053085 | Bacteria | 2833 |
| 1692 | Ga0495619_0048438 | 3300053085 | Bacteria | 2800 |
| 1693 | Ga0495619_0073760 | 3300053085 | Bacteria | 2287 |
| 1694 | Ga0500643_000076 | 3300053087 | Bacteria | 106911 |
| 1695 | Ga0500643_002781 | 3300053087 | Bacteria | 8748 |
| 1696 | Ga0500646_0011073 | 3300053090 | Bacteria | 2317 |
| 1697 | Ga0500583_0014448 | 3300053092 | Bacteria | 3092 |
| 1698 | Ga0500651_0011112 | 3300053093 | Bacteria | 5419 |
| 1699 | Ga0500651_0152144 | 3300053093 | Bacteria | 1389 |
| 1700 | Ga0500566_0000314 | 3300053094 | Bacteria | 26180 |
| 1701 | Ga0500566_0002194 | 3300053094 | Bacteria | 11509 |
| 1702 | Ga0500566_0085944 | 3300053094 | Bacteria | 1744 |
| 1703 | Ga0500641_0018283 | 3300053096 | Bacteria | 2634 |
| 1704 | Ga0500641_0019444 | 3300053096 | Bacteria | 2568 |
| 1705 | Ga0500641_0038156 | 3300053096 | Bacteria | 1929 |
| 1706 | Ga0500641_0042427 | 3300053096 | Bacteria | 1843 |
| 1707 | Ga0500554_000886 | 3300053102 | Bacteria | 5866 |
| 1708 | Ga0500555_020392 | 3300053103 | Bacteria | 1909 |
| 1709 | Ga0500556_0000006 | 3300053104 | Bacteria | 453982 |
| 1710 | Ga0500556_0000601 | 3300053104 | Bacteria | 23232 |
| 1711 | Ga0500557_000059 | 3300053105 | Bacteria | 45905 |
| 1712 | Ga0500562_005330 | 3300053108 | Bacteria | 3229 |
| 1713 | Ga0500595_000001 | 3300053119 | Bacteria | 1088438 |
| 1714 | Ga0500595_000506 | 3300053119 | Bacteria | 23559 |
| 1715 | Ga0500595_001968 | 3300053119 | Bacteria | 10552 |
| 1716 | Ga0500595_008320 | 3300053119 | Bacteria | 4245 |
| 1717 | Ga0500642_0000004 | 3300053130 | Bacteria | 433122 |
| 1718 | Ga0500642_0000226 | 3300053130 | Bacteria | 22146 |
| 1719 | Ga0500642_0011908 | 3300053130 | Bacteria | 3133 |
| 1720 | Ga0500642_0084177 | 3300053130 | Bacteria | 1464 |
| 1721 | Ga0500652_000033 | 3300053131 | Bacteria | 80332 |
| 1722 | Ga0500652_009006 | 3300053131 | Bacteria | 3355 |
| 1723 | Ga0500655_016310 | 3300053133 | Bacteria | 1368 |
| 1724 | Ga0500658_0028460 | 3300053134 | Bacteria | 2168 |
| 1725 | Ga0500559_0003127 | 3300053136 | Bacteria | 8230 |
| 1726 | Ga0500559_0031663 | 3300053136 | Bacteria | 2269 |
| 1727 | Ga0500568_0002010 | 3300053139 | Bacteria | 12384 |
| 1728 | Ga0500568_0026877 | 3300053139 | Bacteria | 2411 |
| 1729 | Ga0500568_0053198 | 3300053139 | Bacteria | 1588 |
| 1730 | Ga0500577_0009852 | 3300053142 | Bacteria | 2789 |
| 1731 | Ga0500590_047066 | 3300053148 | Bacteria | 2203 |
| 1732 | Ga0500590_141494 | 3300053148 | Bacteria | 1099 |
| 1733 | Ga0500604_0007979 | 3300053151 | Bacteria | 2808 |
| 1734 | Ga0500616_0000001 | 3300053153 | Bacteria | 1986011 |
| 1735 | Ga0500616_0000022 | 3300053153 | Bacteria | 460463 |
| 1736 | Ga0500616_0009597 | 3300053153 | Bacteria | 5872 |
| 1737 | Ga0500616_0046260 | 3300053153 | Bacteria | 2314 |
| 1738 | Ga0500616_0060370 | 3300053153 | Bacteria | 1966 |
| 1739 | Ga0500619_049698 | 3300053154 | Bacteria | 1354 |
| 1740 | Ga0500622_0001425 | 3300053156 | Bacteria | 19200 |
| 1741 | Ga0500638_020622 | 3300053162 | Bacteria | 3105 |
| 1742 | Ga0500638_072191 | 3300053162 | Bacteria | 1649 |
| 1743 | Ga0500636_0000309 | 3300053177 | Bacteria | 26814 |
| 1744 | Ga0500636_0017136 | 3300053177 | Bacteria | 4273 |
| 1745 | Ga0500636_0024605 | 3300053177 | Bacteria | 3561 |
| 1746 | Ga0500637_0000542 | 3300053178 | Bacteria | 14772 |
| 1747 | Ga0500637_0053050 | 3300053178 | Bacteria | 2314 |
| 1748 | Ga0500567_027363 | 3300053723 | Bacteria | 2713 |
| 1749 | Ga0500625_009898 | 3300053729 | Bacteria | 4269 |
| 1750 | Ga0500645_000189 | 3300053730 | Bacteria | 47865 |
| 1751 | Ga0500645_003077 | 3300053730 | Bacteria | 6994 |
| 1752 | Ga0500645_024562 | 3300053730 | Bacteria | 1842 |
| 1753 | Ga0500609_001592 | 3300053731 | Bacteria | 3312 |
| 1754 | Ga0500599_004040 | 3300053736 | Bacteria | 1804 |
| 1755 | Ga0500601_000066 | 3300053737 | Bacteria | 21867 |
| 1756 | Ga0501084_0021239 | 3300054114 | Bacteria | 5413 |
| 1757 | Ga0501084_0050807 | 3300054114 | Bacteria | 3469 |
| 1758 | Ga0501084_0064310 | 3300054114 | Bacteria | 3070 |
| 1759 | Ga0501084_0114426 | 3300054114 | Bacteria | 2268 |
| 1760 | Ga0501084_0162878 | 3300054114 | Bacteria | 1882 |
| 1761 | Ga0501084_0170223 | 3300054114 | Bacteria | 1839 |
| 1762 | Ga0500661_000578 | 3300055283 | Bacteria | 6841 |
| 1763 | Ga0500661_013556 | 3300055283 | Bacteria | 1469 |
| 1764 | Ga0501082_0027087 | 3300060353 | Bacteria | 4939 |
| 1765 | Ga0501082_0034241 | 3300060353 | Bacteria | 4380 |
| 1766 | Ga0501082_0046452 | 3300060353 | Bacteria | 3743 |
| 1767 | Ga0501082_0055319 | 3300060353 | Bacteria | 3419 |
| 1768 | Ga0501082_0059259 | 3300060353 | Bacteria | 3300 |
| 1769 | Ga0501082_0086528 | 3300060353 | Bacteria | 2703 |
| 1770 | Ga0501082_0105184 | 3300060353 | Bacteria | 2442 |
| 1771 | Ga0501082_0308790 | 3300060353 | Bacteria | 1377 |
| 1772 | Ga0501082_0372016 | 3300060353 | Bacteria | 1246 |
| 1773 | Ga0530510_0048974 | 3300061734 | Bacteria | 3054 |
| 1774 | 2917554979 | 2917554339 | Bacteria | 4987857 |
| 1775 | 2507505334 | 2507262055 | Bacteria | 8048963 |
| 1776 | 2508539223 | 2508501009 | Bacteria | 7784016 |
| 1777 | 2508695544 | 2508501042 | Bacteria | 8719808 |
| 1778 | 2511401171 | 2511231028 | Bacteria | 8046582 |
| 1779 | 2513591209 | 2513237087 | Bacteria | 5817514 |
| 1780 | 2513625402 | 2513237092 | Bacteria | 8341956 |
| 1781 | 2513642080 | 2513237094 | Bacteria | 8789602 |
| 1782 | 2513651454 | 2513237095 | Bacteria | 8976980 |
| 1783 | 2513675077 | 2513237098 | Bacteria | 9902361 |
| 1784 | 2513695163 | 2513237101 | Bacteria | 7952346 |
| 1785 | 2513699919 | 2513237102 | Bacteria | 7703324 |
| 1786 | 2513718120 | 2513237104 | Bacteria | 10034502 |
| 1787 | 2513873469 | 2513237139 | Bacteria | 8737671 |
| 1788 | 2513888834 | 2513237141 | Bacteria | 8496279 |
| 1789 | 2514012547 | 2513237161 | Bacteria | 8871253 |
| 1790 | 2515627502 | 2515154112 | Bacteria | 8294334 |
| 1791 | 2517107168 | 2517093001 | Bacteria | 9002274 |
| 1792 | 2524440827 | 2524023205 | Bacteria | 8918781 |
| 1793 | 2524469524 | 2524023210 | Bacteria | 9029266 |
| 1794 | 2528854047 | 2528768022 | Bacteria | 10457665 |
| 1795 | 2603858579 | 2602042107 | Bacteria | 6226103 |
| 1796 | 2617352455 | 2617270735 | Bacteria | 9163226 |
| 1797 | 2617373819 | 2617270741 | Bacteria | 8201522 |
| 1798 | 2643758153 | 2643221547 | Bacteria | 4740017 |
| 1799 | 2644290986 | 2643221651 | Bacteria | 4798932 |
| 1800 | 2723841691 | 2721755755 | Bacteria | 8322773 |
| 1801 | 2745081753 | 2744054633 | Bacteria | 8678936 |
| 1802 | 2793062109 | 2791355196 | Bacteria | 7323613 |
| 1803 | 2793073615 | 2791355197 | Bacteria | 8420563 |
| 1804 | 2793080874 | |||
| 1805 | 2805915551 | 2802429603 | Bacteria | 8777136 |
| 1806 | 2818237712 | 2816332527 | Bacteria | 8933356 |
| 1807 | 2824604522 | 2824600985 | Bacteria | 8488197 |
| 1808 | 2824616682 | 2824609381 | Bacteria | 8672835 |
| 1809 | 2824631657 | 2824626560 | Bacteria | 8813858 |
| 1810 | 2824671217 | 2824661429 | Bacteria | 9877870 |
| 1811 | 2824695939 | 2824687955 | Bacteria | 8360029 |
| 1812 | 2824732503 | 2824723954 | Bacteria | 8758240 |
| 1813 | 2824748638 | 2824746037 | Bacteria | 7911610 |
| 1814 | 2824763571 | 2824753945 | Bacteria | 9787441 |
| 1815 | 2824772698 | 2824763712 | Bacteria | 9792355 |
| 1816 | 2824779831 | 2824773399 | Bacteria | 8360218 |
| 1817 | 2828309374 | 2828305725 | Bacteria | 4916900 |
| 1818 | 2841945264 | 2841941048 | Bacteria | 8688029 |
| 1819 | 2841952045 | 2841949485 | Bacteria | 8680857 |
| 1820 | 2841965562 | 2841957949 | Bacteria | 8652217 |
| 1821 | 2841970561 | 2841966195 | Bacteria | 8673214 |
| 1822 | 2841981810 | 2841974524 | Bacteria | 8931498 |
| 1823 | 2841985088 | 2841983080 | Bacteria | 8395090 |
| 1824 | 2842043445 | 2842038055 | Bacteria | 8002051 |
| 1825 | 2842052565 | 2842045827 | Bacteria | 8006841 |
| 1826 | 2844315400 | 2844315083 | Bacteria | 8138177 |
| 1827 | 2847931136 | 2847930680 | Bacteria | 9342022 |
| 1828 | 2847942217 | 2847939898 | Bacteria | 8606328 |
| 1829 | 2849083090 | 2849076700 | Bacteria | 7039503 |
| 1830 | 2857511988 | 2857509624 | Bacteria | 7472071 |
| 1831 | 2857526297 | 2857524615 | Bacteria | 6615449 |
| 1832 | 2874594506 | 2874590934 | Bacteria | 8299676 |
| 1833 | 2874624852 | 2874620515 | Bacteria | 8290088 |
| 1834 | 2874628725 | 2874628541 | Bacteria | 8630250 |
| 1835 | 2874649878 | 2874645413 | Bacteria | 8214782 |
| 1836 | 2876770964 | 2876761206 | Bacteria | 10111113 |
| 1837 | 2876773998 | 2876771140 | Bacteria | 8287509 |
| 1838 | 2876809950 | 2876808645 | Bacteria | 8824342 |
| 1839 | 2876821878 | 2876818435 | Bacteria | 8274608 |
| 1840 | 2879078278 | 2879074833 | Bacteria | 8279565 |
| 1841 | 2879085971 | 2879083081 | Bacteria | 8587928 |
| 1842 | 2879105962 | 2879099564 | Bacteria | 10442239 |
| 1843 | 2879112226 | 2879110137 | Bacteria | 8907982 |
| 1844 | 2879130538 | 2879127579 | Bacteria | 8294491 |
| 1845 | 2879147186 | 2879142872 | Bacteria | 8267021 |
| 1846 | 2881365261 | 2881364244 | Bacteria | 7710352 |
| 1847 | 2881668125 | 2881665667 | Bacteria | 8175609 |
| 1848 | 2885370965 | 2885366525 | Bacteria | 8326213 |
| 1849 | 2885392677 | 2885383462 | Bacteria | 9473874 |
| 1850 | 2885415729 | 2885409591 | Bacteria | 9235467 |
| 1851 | 2888379524 | 2888378607 | Bacteria | 9652610 |
| 1852 | 2888390623 | 2888388044 | Bacteria | 7304136 |
| 1853 | 2888420244 | 2888419890 | Bacteria | 7857137 |
| 1854 | 2889793289 | 2889790730 | Bacteria | 5689708 |
| 1855 | 2893067431 | 2893066018 | Bacteria | 6158120 |
| 1856 | 2903732260 | 2903727486 | Bacteria | 8281579 |
| 1857 | 2903754693 | 2903748898 | Bacteria | 9972761 |
| 1858 | 2903777734 | 2903768456 | Bacteria | 9749579 |
| 1859 | 2904670193 | 2904666416 | Bacteria | 8226587 |
| 1860 | 2904691132 | 2904690495 | Bacteria | 9412302 |
| 1861 | 2904713247 | 2904711408 | Bacteria | 9771557 |
| 1862 | 2906604338 | 2906602504 | Bacteria | 8295279 |
| 1863 | 2906613940 | |||
| 1864 | 2906628501 | 2906626472 | Bacteria | 8826946 |
| 1865 | 2906652108 | 2906643746 | Bacteria | 8722424 |
| 1866 | 2908756526 | 2908756301 | Bacteria | 8864324 |
| 1867 | 2908776336 | 2908775508 | Bacteria | 8092255 |
| 1868 | 2919073851 | 2919073203 | Bacteria | 6531949 |
| 1869 | 2919452221 | 2919450847 | Bacteria | 5631160 |
| 1870 | 2922363947 | 2922361189 | Bacteria | 7436256 |
| 1871 | 2922369515 | |||
| 1872 | 2922392526 | 2922386360 | Bacteria | 7017218 |
| 1873 | 2922394298 | 2922393267 | Bacteria | 8285685 |
| 1874 | 2929618663 | 2929615660 | Bacteria | 9193770 |
| 1875 | 2929628652 | 2929624759 | Bacteria | 9339455 |
| 1876 | 2932790841 | 2932784394 | Bacteria | 9704911 |
| 1877 | 2932794254 | 2932794094 | Bacteria | 7915132 |
| 1878 | 2932808152 | 2932801729 | Bacteria | 7987968 |
| 1879 | 2932812106 | 2932809354 | Bacteria | 9135765 |
| 1880 | 2932823096 | 2932818245 | Bacteria | 9955613 |
| 1881 | 2932833528 | 2932828146 | Bacteria | 9745859 |
| 1882 | 2933580626 | 2933577622 | Bacteria | 9116884 |
| 1883 | 2935615666 | 2935608549 | Bacteria | 8203142 |
| 1884 | 2935623084 | 2935616580 | Bacteria | 9032984 |
| 1885 | 2935644159 | 2935638405 | Bacteria | 10015038 |
| 1886 | 2935653556 | 2935648319 | Bacteria | 8801166 |
| 1887 | 2935662305 | 2935656913 | Bacteria | 8965014 |
| 1888 | 2935672259 | 2935665750 | Bacteria | 9571747 |
| 1889 | 2935679218 | 2935675223 | Bacteria | 9928132 |
| 1890 | 2935686462 | 2935684952 | Bacteria | 9590419 |
| 1891 | 2935700242 | 2935694250 | Bacteria | 9291695 |
| 1892 | 2935710191 | 2935703347 | Bacteria | 10242284 |
| 1893 | 2935716150 | 2935713505 | Bacteria | 9608509 |
| 1894 | 2935723726 | 2935722832 | Bacteria | 9608746 |
| 1895 | 2935735281 | 2935732158 | Bacteria | 9706831 |
| 1896 | 2935743928 | 2935741537 | Bacteria | 9707219 |
| 1897 | 2935752428 | 2935750917 | Bacteria | 9590372 |
| 1898 | 2935763476 | 2935760218 | Bacteria | 9817913 |
| 1899 | 2935772980 | 2935769743 | Bacteria | 7878163 |
| 1900 | 2935783231 | 2935777560 | Bacteria | 8077691 |
| 1901 | 2935788032 | 2935785616 | Bacteria | 7962367 |
| 1902 | 2935808183 | 2935801545 | Bacteria | 9301974 |
| 1903 | 2935816204 | 2935810662 | Bacteria | 9401221 |
| 1904 | 2935825535 | 2935819856 | Bacteria | 8261050 |
| 1905 | 2935833597 | 2935827899 | Bacteria | 10038562 |
| 1906 | 2935844550 | 2935837841 | Bacteria | 9454360 |
| 1907 | 2935853324 | 2935847175 | Bacteria | 8228321 |
| 1908 | 2935861332 | 2935855204 | Bacteria | 9035059 |
| 1909 | 2935869451 | 2935864058 | Bacteria | 9784707 |
| 1910 | 2935879780 | 2935873716 | Bacteria | 9632195 |
| 1911 | 2935890031 | 2935883170 | Bacteria | 7964738 |
| 1912 | 2935914797 | 2935908558 | Bacteria | 8568796 |
| 1913 | 2935918773 | 2935916978 | Bacteria | 9113783 |
| 1914 | 2935931510 | 2935926038 | Bacteria | 8601059 |
| 1915 | 2935940107 | 2935934488 | Bacteria | 8602579 |
| 1916 | 2935947546 | 2935942939 | Bacteria | 8599779 |
| 1917 | 2935956318 | 2935951376 | Bacteria | 8602333 |
| 1918 | 2935962699 | 2935959822 | Bacteria | 7869783 |
| 1919 | 2935973111 | 2935967501 | Bacteria | 8603075 |
| 1920 | 2935980644 | 2935975950 | Bacteria | 8347125 |
| 1921 | 2935985205 | 2935984226 | Bacteria | 8302647 |
| 1922 | 2935997997 | 2935992306 | Bacteria | 9802711 |
| 1923 | 2936008737 | 2936002035 | Bacteria | 9362176 |
| 1924 | 2936016607 | 2936011229 | Bacteria | 8801034 |
| 1925 | 2936025240 | 2936019824 | Bacteria | 8804134 |
| 1926 | 2936034082 | 2936028420 | Bacteria | 8965941 |
| 1927 | 2936041209 | 2936037263 | Bacteria | 9446081 |
| 1928 | 2936052139 | 2936046547 | Bacteria | 8903709 |
| 1929 | 2936056377 | 2936055302 | Bacteria | 8785755 |
| 1930 | 2940558341 | 2940556831 | Bacteria | 9590747 |
| 1931 | 2941535453 | 2941531003 | Bacteria | 7653939 |
| 1932 | 2941543265 | 2941538514 | Bacteria | 9402094 |
| 1933 | 3005489008 | 3005483717 | Bacteria | 7877331 |
| 1934 | 3005509102 | 3005506211 | Bacteria | 6943378 |
| 1935 | 3005591579 | 3005587118 | Bacteria | 7794411 |
| 1936 | 3005595118 | 3005594810 | Bacteria | 8716512 |
| 1937 | 3005711057 | 3005710791 | Bacteria | 7622528 |
| 1938 | 3005718365 | 3005718088 | Bacteria | 8283608 |
| 1939 | 8001845898 | 8001845381 | Bacteria | 5804942 |
| 1940 | 8006967510 | 8006964411 | Bacteria | 8966052 |
| 1941 | 8006990975 | 8006984368 | Bacteria | 9651211 |
| 1942 | 8007000310 | 8006994254 | Bacteria | 8309700 |
| 1943 | 8016518120 | 8016511872 | Bacteria | 9921665 |
| 1944 | 8016544130 | 8016539877 | Bacteria | 8155419 |
| 1945 | 8016549179 | 8016548790 | Bacteria | 8155074 |
| 1946 | 8016557604 | 8016557553 | Bacteria | 8154380 |
| 1947 | 8016569533 | 8016566248 | Bacteria | 8158151 |
| 1948 | 8016582143 | 8016575299 | Bacteria | 8154085 |
| 1949 | 8016586298 | 8016583857 | Bacteria | 10421953 |
| 1950 | 8016606492 | 8016603502 | Bacteria | 8731218 |
| 1951 | 8016618393 | 8016613128 | Bacteria | 8794220 |
| 1952 | 8016623040 | 8016622563 | Bacteria | 7999408 |
| 1953 | 8017058524 | 8017057580 | Bacteria | 10023680 |
| 1954 | 8019531103 | 8019530166 | Bacteria | 8155624 |
| 1955 | 8019540452 | 8019538911 | Bacteria | 7872763 |
| 1956 | 8019550043 | 8019547302 | Bacteria | 7996444 |
| 1957 | 8019577167 | 8019576017 | Bacteria | 10049540 |
| 1958 | 8019595241 | 8019586578 | Bacteria | 10212056 |
| 1959 | 8019612012 | 8019608314 | Bacteria | 10042931 |
| 1960 | 8019623034 | 8019619141 | Bacteria | 9218857 |
| 1961 | 8019630065 | 8019629233 | Bacteria | 8687553 |
| 1962 | 8019640544 | 8019638758 | Bacteria | 9062356 |
| 1963 | 8019652403 | 8019648815 | Bacteria | 10014479 |
| 1964 | 8019676661 | 8019668869 | Bacteria | 8791617 |
| 1965 | 8019679332 | 8019678201 | Bacteria | 8863603 |
| 1966 | 8019696177 | 8019687851 | Bacteria | 8712826 |
| 1967 | 8055742513 | 8055742211 | Bacteria | 9226248 |
| 1968 | 8056691016 | 8056689827 | Bacteria | 6712655 |
| 1969 | 8056971351 | 8056967851 | Bacteria | 9038162 |
| 1970 | 2214911852 | |||
| 1971 | ARSoilYngRDRAFT_c00080 | |||
| 1972 | ARcpr5yngRDRAFT_c000055 | |||
| 1973 | ARCol0oldRDRAFT_c00230 | |||
| 1974 | LJQas_1007647 | |||
| 1975 | ARCol0yngRDRAFT_1000007 | |||
| 1976 | JGI24032J14994_100153 | |||
| 1977 | JGI24752J21851_1003516 | |||
| 1978 | JGI24737J22298_10000509 | |||
| 1979 | JGI24750J21931_1001269 | |||
| 1980 | JGI24738J21930_10000120 | |||
| 1981 | JGI24035J26624_1000291 | |||
| 1982 | JGI24033J26618_1000558 | |||
| 1983 | JGI24034J26672_10000187 | |||
| 1984 | JGI24742J22300_10000029 | |||
| 1985 | JGI25406J46586_10006206 | |||
| 1986 | JGI25406J46586_10011555 | |||
| 1987 | JGI25153J46596_10001726 | |||
| 1988 | JGI25153J46596_10001794 | |||
| 1989 | JGI25153J46596_10007254 | |||
| 1990 | JGI25153J46596_10009299 | |||
| 1991 | JGI25160J50197_1000637 | |||
| 1992 | JGI25160J50197_1002896 | |||
| 1993 | Ga0055531_10003548 | |||
| 1994 | Ga0065165_1001452 | |||
| 1995 | Ga0065165_1006072 | |||
| 1996 | Ga0065165_1015074 | |||
| 1997 | Ga0065165_1017160 | |||
| 1998 | Ga0065704_10096592 | |||
| 1999 | Ga0065712_10000690 | |||
| 2000 | Ga0065712_10001626 | |||
| 2001 | Ga0065715_10001262 | |||
| 2002 | Ga0065715_10008806 | |||
| 2003 | Ga0070658_10015046 | |||
| 2004 | Ga0070658_10019709 | |||
| 2005 | Ga0070658_10034887 | |||
| 2006 | Ga0070676_10003502 | |||
| 2007 | Ga0070676_10074001 | |||
| 2008 | Ga0070676_10102198 | |||
| 2009 | Ga0070683_100000116 | |||
| 2010 | Ga0070683_100031209 | |||
| 2011 | Ga0070683_100113145 | |||
| 2012 | Ga0070683_100138935 | |||
| 2013 | Ga0070690_100005618 | |||
| 2014 | Ga0070690_100014607 | |||
| 2015 | Ga0070690_100210064 | |||
| 2016 | Ga0070670_100006964 | |||
| 2017 | Ga0070670_100017200 | |||
| 2018 | Ga0070670_100125130 | |||
| 2019 | Ga0070670_100163497 | |||
| 2020 | Ga0070670_100184120 | |||
| 2021 | Ga0070670_100185074 | |||
| 2022 | Ga0070677_10000097 | |||
| 2023 | Ga0068869_100002566 | |||
| 2024 | Ga0068869_100129609 | |||
| 2025 | Ga0068869_100146062 | |||
| 2026 | Ga0068869_100188240 | |||
| 2027 | Ga0070666_10003937 | |||
| 2028 | Ga0070666_10050475 | |||
| 2029 | Ga0070666_10183415 | |||
| 2030 | Ga0070680_100013619 | |||
| 2031 | Ga0070680_100022146 | |||
| 2032 | Ga0070680_100041923 | |||
| 2033 | Ga0070680_100047006 | |||
| 2034 | Ga0070680_100066975 | |||
| 2035 | Ga0070680_100151413 | |||
| 2036 | Ga0070680_100218103 | |||
| 2037 | Ga0070682_100001635 | |||
| 2038 | Ga0068868_100028104 | |||
| 2039 | Ga0068868_100035020 | |||
| 2040 | Ga0068868_100064549 | |||
| 2041 | Ga0070660_100009547 | |||
| 2042 | Ga0070660_100021366 | |||
| 2043 | Ga0070660_100031050 | |||
| 2044 | Ga0070660_100247606 | |||
| 2045 | Ga0070689_100000461 | |||
| 2046 | Ga0070691_10000048 | |||
| 2047 | Ga0070687_100002383 | |||
| 2048 | Ga0070687_100091231 | |||
| 2049 | Ga0070661_100000228 | |||
| 2050 | Ga0070661_100059239 | |||
| 2051 | Ga0070692_10000050 | |||
| 2052 | Ga0070668_100010524 | |||
| 2053 | Ga0070668_100022397 | |||
| 2054 | Ga0070668_100108131 | |||
| 2055 | Ga0070668_100110742 | |||
| 2056 | Ga0070669_100031291 | |||
| 2057 | Ga0070669_100047132 | |||
| 2058 | Ga0070669_100065519 | |||
| 2059 | Ga0070669_100091246 | |||
| 2060 | Ga0070669_100251401 | |||
| 2061 | Ga0070675_100000503 | |||
| 2062 | Ga0070675_100104609 | |||
| 2063 | Ga0070671_100000720 | |||
| 2064 | Ga0070671_100056367 | |||
| 2065 | Ga0070671_100124906 | |||
| 2066 | Ga0070671_100170681 | |||
| 2067 | Ga0070674_100000570 | |||
| 2068 | Ga0070674_100093821 | |||
| 2069 | Ga0070673_100000045 | |||
| 2070 | Ga0070673_100003240 | |||
| 2071 | Ga0070688_100000308 | |||
| 2072 | Ga0070688_100039274 | |||
| 2073 | Ga0070688_100086423 | |||
| 2074 | Ga0070688_100102450 | |||
| 2075 | Ga0070688_100231664 | |||
| 2076 | Ga0070659_100000183 | |||
| 2077 | Ga0070659_100009946 | |||
| 2078 | Ga0070659_100047796 | |||
| 2079 | Ga0070659_100059804 | |||
| 2080 | Ga0070659_100110299 | |||
| 2081 | Ga0070667_100003874 | |||
| 2082 | Ga0070667_100055839 | |||
| 2083 | Ga0070667_100068432 | |||
| 2084 | Ga0070709_10003045 | |||
| 2085 | Ga0070709_10074808 | |||
| 2086 | Ga0070709_10076543 | |||
| 2087 | Ga0070709_10126515 | |||
| 2088 | Ga0070709_10207040 | |||
| 2089 | Ga0070714_100006355 | |||
| 2090 | Ga0070714_100020893 | |||
| 2091 | Ga0070714_100021163 | |||
| 2092 | Ga0070714_100032110 | |||
| 2093 | Ga0070714_100056532 | |||
| 2094 | Ga0070714_100062909 | |||
| 2095 | Ga0070714_100271604 | |||
| 2096 | Ga0070713_100007601 | |||
| 2097 | Ga0070713_100009557 | |||
| 2098 | Ga0070713_100016407 | |||
| 2099 | Ga0070713_100074482 | |||
| 2100 | Ga0070713_100218875 | |||
| 2101 | Ga0070713_100261749 | |||
| 2102 | Ga0070710_10002948 | |||
| 2103 | Ga0070710_10005418 | |||
| 2104 | Ga0070710_10006006 | |||
| 2105 | Ga0070710_10033282 | |||
| 2106 | Ga0070710_10039227 | |||
| 2107 | Ga0070701_10002546 | |||
| 2108 | Ga0070701_10020704 | |||
| 2109 | Ga0070701_10123381 | |||
| 2110 | Ga0070711_100000599 | |||
| 2111 | Ga0070711_100014115 | |||
| 2112 | Ga0070711_100016274 | |||
| 2113 | Ga0070711_100017625 | |||
| 2114 | Ga0070711_100022586 | |||
| 2115 | Ga0070711_100049014 | |||
| 2116 | Ga0070711_100217366 | |||
| 2117 | Ga0070705_100001770 | |||
| 2118 | Ga0070700_100000239 | |||
| 2119 | Ga0070694_100003730 | |||
| 2120 | Ga0070694_100164114 | |||
| 2121 | Ga0070708_100182315 | |||
| 2122 | Ga0070663_100000328 | |||
| 2123 | Ga0070663_100000390 | |||
| 2124 | Ga0070663_100024158 | |||
| 2125 | Ga0070663_100073835 | |||
| 2126 | Ga0070663_100137505 | |||
| 2127 | Ga0070663_100188839 | |||
| 2128 | Ga0070678_100000576 | |||
| 2129 | Ga0070678_100043325 | |||
| 2130 | Ga0070678_100086322 | |||
| 2131 | Ga0070681_10000933 | |||
| 2132 | Ga0070681_10015684 | |||
| 2133 | Ga0070681_10036877 | |||
| 2134 | Ga0070681_10078407 | |||
| 2135 | Ga0070681_10102279 | |||
| 2136 | Ga0068867_100147962 | |||
| 2137 | Ga0070685_10003069 | |||
| 2138 | Ga0070685_10013737 | |||
| 2139 | Ga0070685_10019816 | |||
| 2140 | Ga0070685_10125147 | |||
| 2141 | Ga0070685_10142471 | |||
| 2142 | Ga0070685_10257511 | |||
| 2143 | Ga0070707_100047831 | |||
| 2144 | Ga0070707_100314659 | |||
| 2145 | Ga0070698_100039216 | |||
| 2146 | Ga0070699_100004245 | |||
| 2147 | Ga0070679_100005744 | |||
| 2148 | Ga0070679_100016653 | |||
| 2149 | Ga0070679_100058275 | |||
| 2150 | Ga0070679_100073903 | |||
| 2151 | Ga0070679_100113836 | |||
| 2152 | Ga0070679_100135947 | |||
| 2153 | Ga0070679_100191906 | |||
| 2154 | Ga0070679_100390868 | |||
| 2155 | Ga0070684_100000352 | |||
| 2156 | Ga0070684_100006584 | |||
| 2157 | Ga0070684_100020670 | |||
| 2158 | Ga0070684_100038063 | |||
| 2159 | Ga0070684_100145709 | |||
| 2160 | Ga0068853_100000902 | |||
| 2161 | Ga0068853_100026207 | |||
| 2162 | Ga0068853_100087721 | |||
| 2163 | Ga0068853_100164786 | |||
| 2164 | Ga0068853_100285634 | |||
| 2165 | Ga0070672_100000016 | |||
| 2166 | Ga0070686_100005714 | |||
| 2167 | Ga0070686_100017851 | |||
| 2168 | Ga0070686_100121576 | |||
| 2169 | Ga0070695_100001458 | |||
| 2170 | Ga0070695_100004098 | |||
| 2171 | Ga0070696_100006179 | |||
| 2172 | Ga0070696_100202216 | |||
| 2173 | Ga0070693_100037529 | |||
| 2174 | Ga0070665_100014898 | |||
| 2175 | Ga0070665_100024748 | |||
| 2176 | Ga0070665_100025556 | |||
| 2177 | Ga0070665_100070182 | |||
| 2178 | Ga0070665_100072923 | |||
| 2179 | Ga0070665_100095421 | |||
| 2180 | Ga0070665_100098599 | |||
| 2181 | Ga0070665_100099991 | |||
| 2182 | Ga0070665_100145785 | |||
| 2183 | Ga0070704_100004902 | |||
| 2184 | Ga0070704_100014046 | |||
| 2185 | Ga0068855_100003504 | |||
| 2186 | Ga0068855_100019804 | |||
| 2187 | Ga0068855_100020035 | |||
| 2188 | Ga0068855_100071356 | |||
| 2189 | Ga0068855_100076667 | |||
| 2190 | Ga0068855_100123814 | |||
| 2191 | Ga0068855_100232988 | |||
| 2192 | Ga0068855_100271037 | |||
| 2193 | Ga0070664_100000067 | |||
| 2194 | Ga0070664_100179259 | |||
| 2195 | Ga0070664_100248730 | |||
| 2196 | Ga0068857_100003331 | |||
| 2197 | Ga0068857_100022002 | |||
| 2198 | Ga0068854_100062790 | |||
| 2199 | Ga0068854_100098345 | |||
| 2200 | Ga0068854_100118938 | |||
| 2201 | Ga0068856_100002341 | |||
| 2202 | Ga0068856_100042629 | |||
| 2203 | Ga0068856_100053053 | |||
| 2204 | Ga0068856_100070685 | |||
| 2205 | Ga0070702_100001107 | |||
| 2206 | Ga0068852_100014075 | |||
| 2207 | Ga0068852_100015623 | |||
| 2208 | Ga0068852_100091383 | |||
| 2209 | Ga0068852_100193773 | |||
| 2210 | Ga0068852_100214060 | |||
| 2211 | Ga0068859_100077162 | |||
| 2212 | Ga0068859_100295653 | |||
| 2213 | Ga0068864_100000234 | |||
| 2214 | Ga0068864_100059635 | |||
| 2215 | Ga0068864_100158116 | |||
| 2216 | Ga0068866_10016142 | |||
| 2217 | Ga0068861_100000241 | |||
| 2218 | Ga0068861_100015670 | |||
| 2219 | Ga0068861_100137862 | |||
| 2220 | Ga0068861_100139783 | |||
| 2221 | Ga0068851_10013343 | |||
| 2222 | Ga0068851_10069059 | |||
| 2223 | Ga0068851_10145527 | |||
| 2224 | Ga0068870_10000009 | |||
| 2225 | Ga0068870_10055073 | |||
| 2226 | Ga0068863_100003248 | |||
| 2227 | Ga0068863_100098163 | |||
| 2228 | Ga0068863_100175337 | |||
| 2229 | Ga0068863_100191047 | |||
| 2230 | Ga0068858_100001548 | |||
| 2231 | Ga0068860_100000508 | |||
| 2232 | Ga0068860_100001050 | |||
| 2233 | Ga0068860_100034650 | |||
| 2234 | Ga0068860_100107472 | |||
| 2235 | Ga0068860_100156416 | |||
| 2236 | Ga0068862_100001143 | |||
| 2237 | Ga0068862_100200451 | |||
| 2238 | Ga0081455_10000002 | |||
| 2239 | Ga0081455_10004068 | |||
| 2240 | Ga0081455_10008760 | |||
| 2241 | Ga0081455_10021942 | |||
| 2242 | Ga0081455_10022833 | |||
| 2243 | Ga0081455_10125580 | |||
| 2244 | Ga0081455_10204121 | |||
| 2245 | Ga0081540_1002394 | |||
| 2246 | Ga0081540_1003646 | |||
| 2247 | Ga0081540_1004307 | |||
| 2248 | Ga0081540_1005999 | |||
| 2249 | Ga0081540_1008954 | |||
| 2250 | Ga0081540_1009843 | |||
| 2251 | Ga0081540_1012693 | |||
| 2252 | Ga0081540_1015357 | |||
| 2253 | Ga0081540_1016330 | |||
| 2254 | Ga0081540_1044846 | |||
| 2255 | Ga0081539_10000265 | |||
| 2256 | Ga0081539_10000966 | |||
| 2257 | Ga0081539_10015864 | |||
| 2258 | Ga0081539_10049888 | |||
| 2259 | Ga0070717_10029553 | |||
| 2260 | Ga0070717_10044938 | |||
| 2261 | Ga0070717_10167557 | |||
| 2262 | Ga0075365_10013341 | |||
| 2263 | Ga0075365_10049882 | |||
| 2264 | Ga0075365_10051135 | |||
| 2265 | Ga0075368_10014896 | |||
| 2266 | Ga0075363_100001175 | |||
| 2267 | Ga0075363_100021411 | |||
| 2268 | Ga0075363_100048774 | |||
| 2269 | Ga0075363_100086490 | |||
| 2270 | Ga0075364_10021970 | |||
| 2271 | Ga0075364_10037508 | |||
| 2272 | Ga0075364_10067636 | |||
| 2273 | Ga0075364_10087356 | |||
| 2274 | Ga0075432_10001464 | |||
| 2275 | Ga0070715_10027530 | |||
| 2276 | Ga0070716_100003613 | |||
| 2277 | Ga0070716_100003799 | |||
| 2278 | Ga0070716_100015416 | |||
| 2279 | Ga0070712_100017531 | |||
| 2280 | Ga0070712_100019139 | |||
| 2281 | Ga0070712_100150895 | |||
| 2282 | Ga0070712_100171105 | |||
| 2283 | Ga0070712_100221306 | |||
| 2284 | Ga0075362_10002382 | |||
| 2285 | Ga0075362_10057222 | |||
| 2286 | Ga0075367_10009497 | |||
| 2287 | Ga0075367_10013375 | |||
| 2288 | Ga0075367_10018489 | |||
| 2289 | Ga0075367_10051257 | |||
| 2290 | Ga0075369_10052055 | |||
| 2291 | Ga0075427_10003015 | |||
| 2292 | Ga0075366_10007698 | |||
| 2293 | Ga0075366_10018053 | |||
| 2294 | Ga0097621_100000569 | |||
| 2295 | Ga0097621_100034909 | |||
| 2296 | Ga0097621_100093302 | |||
| 2297 | Ga0075370_10040354 | |||
| 2298 | Ga0075370_10164691 | |||
| 2299 | Ga0068871_100000012 | |||
| 2300 | Ga0068871_100017133 | |||
| 2301 | Ga0068871_100230754 | |||
| 2302 | Ga0075428_100000797 | |||
| 2303 | Ga0075428_100202612 | |||
| 2304 | Ga0075430_100000045 | |||
| 2305 | Ga0075430_100000509 | |||
| 2306 | Ga0075430_100061183 | |||
| 2307 | Ga0075431_100022535 | |||
| 2308 | Ga0075431_100272852 | |||
| 2309 | Ga0075431_100474964 | |||
| 2310 | Ga0075433_10002970 | |||
| 2311 | Ga0075433_10009693 | |||
| 2312 | Ga0075433_10200207 | |||
| 2313 | Ga0075434_100001007 | |||
| 2314 | Ga0075434_100003473 | |||
| 2315 | Ga0075434_100034517 | |||
| 2316 | Ga0075434_100047837 | |||
| 2317 | Ga0075434_100065389 | |||
| 2318 | Ga0075434_100074246 | |||
| 2319 | Ga0075434_100395196 | |||
| 2320 | Ga0075429_100000214 | |||
| 2321 | Ga0068865_100000209 | |||
| 2322 | Ga0068865_100147074 | |||
| 2323 | Ga0075436_100155156 | |||
| 2324 | Ga0097620_100077157 | |||
| 2325 | Ga0097620_100295636 | |||
| 2326 | Ga0099824_1004485 | |||
| 2327 | Ga0099824_1005993 | |||
| 2328 | Ga0099822_1056885 | |||
| 2329 | Ga0099823_1036201 | |||
| 2330 | Ga0075435_100003730 | |||
| 2331 | Ga0075435_100029012 | |||
| 2332 | Ga0075435_100130294 | |||
| 2333 | Ga0075435_100171867 | |||
| 2334 | Ga0075435_100179585 | |||
| 2335 | Ga0075435_100222601 | |||
| 2336 | Ga0099794_10020050 | |||
| 2337 | Ga0099795_10017879 | |||
| 2338 | Ga0105251_10064373 | |||
| 2339 | Ga0105244_10013466 | |||
| 2340 | Ga0105250_10087777 | |||
| 2341 | Ga0105240_10019597 | |||
| 2342 | Ga0105240_10366977 | |||
| 2343 | Ga0111539_10000693 | |||
| 2344 | Ga0111539_10000941 | |||
| 2345 | Ga0111539_10001081 | |||
| 2346 | Ga0111539_10154547 | |||
| 2347 | Ga0105245_10001284 | |||
| 2348 | Ga0105245_10145013 | |||
| 2349 | Ga0105245_10419824 | |||
| 2350 | Ga0105247_10003522 | |||
| 2351 | Ga0105247_10015712 | |||
| 2352 | Ga0114129_10009653 | |||
| 2353 | Ga0114129_10010881 | |||
| 2354 | Ga0114129_10064508 | |||
| 2355 | Ga0114129_10190930 | |||
| 2356 | Ga0114129_10229703 | |||
| 2357 | Ga0114129_10431643 | |||
| 2358 | Ga0114129_10436172 | |||
| 2359 | Ga0105243_10003373 | |||
| 2360 | Ga0105243_10217864 | |||
| 2361 | Ga0105241_10000053 | |||
| 2362 | Ga0105241_10123177 | |||
| 2363 | Ga0105242_10000492 | |||
| 2364 | Ga0105242_10078474 | |||
| 2365 | Ga0105248_10000934 | |||
| 2366 | Ga0105248_10031696 | |||
| 2367 | Ga0105248_10038013 | |||
| 2368 | Ga0105248_10041758 | |||
| 2369 | Ga0105248_10097830 | |||
| 2370 | Ga0105248_10110014 | |||
| 2371 | Ga0105237_10003661 | |||
| 2372 | Ga0105237_10082006 | |||
| 2373 | Ga0105237_10196605 | |||
| 2374 | Ga0105238_10005232 | |||
| 2375 | Ga0105238_10322524 | |||
| 2376 | Ga0105249_10003582 | |||
| 2377 | Ga0105249_10033319 | |||
| 2378 | Ga0105249_10356389 | |||
| 2379 | Ga0099796_10029818 | |||
| 2380 | Ga0105239_10016523 | |||
| 2381 | Ga0105239_10065271 | |||
| 2382 | Ga0105239_10074495 | |||
| 2383 | Ga0105239_10182570 | |||
| 2384 | Ga0105246_10000055 | |||
| 2385 | Ga0105246_10003672 | |||
| 2386 | Ga0105246_10201643 | |||
| 2387 | Ga0157320_1000638 | |||
| 2388 | Ga0157373_10064543 | |||
| 2389 | Ga0157371_10043951 | |||
| 2390 | Ga0157370_10034537 | |||
| 2391 | Ga0157370_10041817 | |||
| 2392 | Ga0157370_10114858 | |||
| 2393 | Ga0157370_10178554 | |||
| 2394 | Ga0157370_10255425 | |||
| 2395 | Ga0157369_10016644 | |||
| 2396 | Ga0157369_10041997 | |||
| 2397 | Ga0157369_10157244 | |||
| 2398 | Ga0157374_10001308 | |||
| 2399 | Ga0157374_10025888 | |||
| 2400 | Ga0157374_10041871 | |||
| 2401 | Ga0157374_10045186 | |||
| 2402 | Ga0157374_10047928 | |||
| 2403 | Ga0157378_10000986 | |||
| 2404 | Ga0157378_10142354 | |||
| 2405 | Ga0157378_10182480 | |||
| 2406 | Ga0163162_10002432 | |||
| 2407 | Ga0163162_10075871 | |||
| 2408 | Ga0163162_10275342 | |||
| 2409 | Ga0163162_10487935 | |||
| 2410 | Ga0157372_10031748 | |||
| 2411 | Ga0157372_10036245 | |||
| 2412 | Ga0157372_10346278 | |||
| 2413 | Ga0157372_10502847 | |||
| 2414 | Ga0157375_10000933 | |||
| 2415 | Ga0157375_10029408 | |||
| 2416 | Ga0157375_10030809 | |||
| 2417 | Ga0157375_10041036 | |||
| 2418 | Ga0157375_10170070 | |||
| 2419 | Ga0157375_10221031 | |||
| 2420 | Ga0157375_10272322 | |||
| 2421 | Ga0157375_10307118 | |||
| 2422 | Ga0163163_10009027 | |||
| 2423 | Ga0163163_10029817 | |||
| 2424 | Ga0163163_10090954 | |||
| 2425 | Ga0163163_10116963 | |||
| 2426 | Ga0157380_10000821 | |||
| 2427 | Ga0157380_10083969 | |||
| 2428 | Ga0157380_10137302 | |||
| 2429 | Ga0157380_10317590 | |||
| 2430 | Ga0157377_10002329 | |||
| 2431 | Ga0157379_10000679 | |||
| 2432 | Ga0157379_10056130 | |||
| 2433 | Ga0157379_10065272 | |||
| 2434 | Ga0157379_10216790 | |||
| 2435 | Ga0157376_10000527 | |||
| 2436 | Ga0157376_10038272 | |||
| 2437 | Ga0157376_10049122 | |||
| 2438 | Ga0163161_10000770 | |||
| 2439 | Ga0163161_10337736 | |||
| 2440 | Ga0197907_11009316 | |||
| 2441 | Ga0206356_11354353 | |||
| 2442 | Ga0214544_1000016 | |||
| 2443 | Ga0214542_1000016 | |||
| 2444 | Ga0214545_1000008 | |||
| 2445 | Ga0214543_1000043 | |||
| 2446 | Ga0213876_10018008 | |||
| 2447 | Ga0213875_10012959 | |||
| 2448 | Ga0224712_10055462 | |||
| 2449 | Ga0228598_1008246 | |||
| 2450 | Ga0209563_101466 | |||
| 2451 | Ga0209677_100936 | |||
| 2452 | Ga0209148_1000504 | |||
| 2453 | Ga0209233_1003870 | |||
| 2454 | Ga0207666_1000026 | |||
| 2455 | Ga0207666_1001597 | |||
| 2456 | Ga0209455_1000957 | |||
| 2457 | Ga0209758_1000069 | |||
| 2458 | Ga0209758_1000253 | |||
| 2459 | Ga0209758_1000351 | |||
| 2460 | Ga0209758_1000990 | |||
| 2461 | Ga0209758_1005097 | |||
| 2462 | Ga0209758_1009810 | |||
| 2463 | Ga0209758_1033376 | |||
| 2464 | Ga0209256_1008686 | |||
| 2465 | Ga0207426_1000420 | |||
| 2466 | Ga0207426_1001001 | |||
| 2467 | Ga0207426_1002779 | |||
| 2468 | Ga0207426_1018465 | |||
| 2469 | Ga0209257_1000564 | |||
| 2470 | Ga0207697_10000245 | |||
| 2471 | Ga0207697_10011834 | |||
| 2472 | Ga0207656_10001442 | |||
| 2473 | Ga0207656_10034259 | |||
| 2474 | Ga0207682_10000029 | |||
| 2475 | Ga0207682_10014795 | |||
| 2476 | Ga0207692_10000218 | |||
| 2477 | Ga0207692_10012824 | |||
| 2478 | Ga0207692_10031373 | |||
| 2479 | Ga0207642_10015391 | |||
| 2480 | Ga0207642_10022067 | |||
| 2481 | Ga0207710_10000676 | |||
| 2482 | Ga0207710_10027072 | |||
| 2483 | Ga0207688_10000084 | |||
| 2484 | Ga0207688_10008498 | |||
| 2485 | Ga0207680_10001429 | |||
| 2486 | Ga0207647_10003716 | |||
| 2487 | Ga0207647_10009100 | |||
| 2488 | Ga0207647_10018094 | |||
| 2489 | Ga0207647_10038424 | |||
| 2490 | Ga0207685_10030478 | |||
| 2491 | Ga0207685_10039930 | |||
| 2492 | Ga0207699_10000145 | |||
| 2493 | Ga0207699_10001859 | |||
| 2494 | Ga0207699_10002344 | |||
| 2495 | Ga0207699_10004700 | |||
| 2496 | Ga0207699_10081951 | |||
| 2497 | Ga0207699_10096259 | |||
| 2498 | Ga0207699_10133912 | |||
| 2499 | Ga0207699_10232911 | |||
| 2500 | Ga0207645_10000090 | |||
| 2501 | Ga0207645_10029552 | |||
| 2502 | Ga0207645_10085115 | |||
| 2503 | Ga0207643_10000044 | |||
| 2504 | Ga0207643_10003440 | |||
| 2505 | Ga0207643_10034241 | |||
| 2506 | Ga0207705_10011060 | |||
| 2507 | Ga0207705_10023489 | |||
| 2508 | Ga0207705_10126273 | |||
| 2509 | Ga0207705_10204922 | |||
| 2510 | Ga0207684_10007412 | |||
| 2511 | Ga0207654_10000143 | |||
| 2512 | Ga0207654_10060218 | |||
| 2513 | Ga0207707_10000580 | |||
| 2514 | Ga0207707_10001318 | |||
| 2515 | Ga0207707_10001462 | |||
| 2516 | Ga0207707_10012685 | |||
| 2517 | Ga0207707_10028941 | |||
| 2518 | Ga0207707_10163134 | |||
| 2519 | Ga0207707_10329992 | |||
| 2520 | Ga0207707_10334625 | |||
| 2521 | Ga0207695_10000148 | |||
| 2522 | Ga0207695_10073547 | |||
| 2523 | Ga0207695_10260447 | |||
| 2524 | Ga0207671_10014374 | |||
| 2525 | Ga0207671_10051753 | |||
| 2526 | Ga0207693_10001456 | |||
| 2527 | Ga0207693_10008645 | |||
| 2528 | Ga0207693_10014519 | |||
| 2529 | Ga0207693_10022611 | |||
| 2530 | Ga0207693_10068117 | |||
| 2531 | Ga0207693_10072991 | |||
| 2532 | Ga0207693_10112390 | |||
| 2533 | Ga0207663_10001778 | |||
| 2534 | Ga0207663_10005840 | |||
| 2535 | Ga0207663_10053706 | |||
| 2536 | Ga0207660_10000653 | |||
| 2537 | Ga0207660_10006180 | |||
| 2538 | Ga0207660_10022078 | |||
| 2539 | Ga0207660_10034613 | |||
| 2540 | Ga0207660_10129792 | |||
| 2541 | Ga0207660_10175813 | |||
| 2542 | Ga0207662_10000104 | |||
| 2543 | Ga0207662_10012668 | |||
| 2544 | Ga0207662_10055424 | |||
| 2545 | Ga0207662_10072216 | |||
| 2546 | Ga0207662_10102891 | |||
| 2547 | Ga0207662_10228246 | |||
| 2548 | Ga0207657_10001095 | |||
| 2549 | Ga0207657_10011813 | |||
| 2550 | Ga0207657_10027567 | |||
| 2551 | Ga0207649_10000057 | |||
| 2552 | Ga0207649_10214061 | |||
| 2553 | Ga0207652_10001436 | |||
| 2554 | Ga0207652_10006195 | |||
| 2555 | Ga0207652_10009939 | |||
| 2556 | Ga0207652_10021448 | |||
| 2557 | Ga0207652_10082063 | |||
| 2558 | Ga0207652_10103257 | |||
| 2559 | Ga0207652_10116157 | |||
| 2560 | Ga0207652_10128330 | |||
| 2561 | Ga0207652_10259545 | |||
| 2562 | Ga0207646_10044687 | |||
| 2563 | Ga0207681_10000154 | |||
| 2564 | Ga0207681_10041806 | |||
| 2565 | Ga0207681_10061535 | |||
| 2566 | Ga0207681_10110822 | |||
| 2567 | Ga0207694_10013631 | |||
| 2568 | Ga0207694_10171615 | |||
| 2569 | Ga0207650_10001069 | |||
| 2570 | Ga0207650_10029876 | |||
| 2571 | Ga0207650_10038377 | |||
| 2572 | Ga0207650_10059701 | |||
| 2573 | Ga0207659_10000028 | |||
| 2574 | Ga0207659_10064129 | |||
| 2575 | Ga0207659_10164353 | |||
| 2576 | Ga0207687_10000249 | |||
| 2577 | Ga0207687_10015275 | |||
| 2578 | Ga0207687_10284289 | |||
| 2579 | Ga0207700_10007100 | |||
| 2580 | Ga0207700_10018744 | |||
| 2581 | Ga0207700_10036980 | |||
| 2582 | Ga0207700_10072688 | |||
| 2583 | Ga0207700_10151033 | |||
| 2584 | Ga0207700_10151669 | |||
| 2585 | Ga0207664_10014021 | |||
| 2586 | Ga0207664_10027440 | |||
| 2587 | Ga0207644_10000776 | |||
| 2588 | Ga0207644_10002109 | |||
| 2589 | Ga0207644_10015442 | |||
| 2590 | Ga0207644_10020295 | |||
| 2591 | Ga0207644_10190573 | |||
| 2592 | Ga0207690_10000225 | |||
| 2593 | Ga0207690_10093886 | |||
| 2594 | Ga0207690_10109743 | |||
| 2595 | Ga0207706_10001675 | |||
| 2596 | Ga0207706_10042501 | |||
| 2597 | Ga0207706_10070446 | |||
| 2598 | Ga0207706_10103738 | |||
| 2599 | Ga0207686_10001701 | |||
| 2600 | Ga0207686_10029111 | |||
| 2601 | Ga0207709_10000291 | |||
| 2602 | Ga0207670_10000463 | |||
| 2603 | Ga0207670_10007249 | |||
| 2604 | Ga0207670_10011845 | |||
| 2605 | Ga0207670_10079765 | |||
| 2606 | Ga0207669_10000019 | |||
| 2607 | Ga0207704_10000230 | |||
| 2608 | Ga0207704_10039730 | |||
| 2609 | Ga0207704_10061285 | |||
| 2610 | Ga0207704_10201241 | |||
| 2611 | Ga0207665_10005663 | |||
| 2612 | Ga0207665_10010796 | |||
| 2613 | Ga0207665_10029367 | |||
| 2614 | Ga0207665_10143824 | |||
| 2615 | Ga0207665_10213294 | |||
| 2616 | Ga0207691_10000882 | |||
| 2617 | Ga0207691_10007777 | |||
| 2618 | Ga0207691_10069856 | |||
| 2619 | Ga0207691_10254055 | |||
| 2620 | Ga0207691_10275295 | |||
| 2621 | Ga0207711_10001381 | |||
| 2622 | Ga0207711_10011217 | |||
| 2623 | Ga0207711_10072837 | |||
| 2624 | Ga0207711_10367605 | |||
| 2625 | Ga0207689_10000228 | |||
| 2626 | Ga0207689_10009830 | |||
| 2627 | Ga0207689_10050716 | |||
| 2628 | Ga0207661_10000107 | |||
| 2629 | Ga0207661_10017315 | |||
| 2630 | Ga0207661_10166725 | |||
| 2631 | Ga0207679_10000026 | |||
| 2632 | Ga0207679_10064593 | |||
| 2633 | Ga0207667_10007642 | |||
| 2634 | Ga0207667_10017783 | |||
| 2635 | Ga0207667_10021717 | |||
| 2636 | Ga0207667_10038306 | |||
| 2637 | Ga0207667_10056568 | |||
| 2638 | Ga0207667_10185843 | |||
| 2639 | Ga0207651_10000069 | |||
| 2640 | Ga0207651_10038302 | |||
| 2641 | Ga0207651_10076837 | |||
| 2642 | Ga0207712_10000242 | |||
| 2643 | Ga0207712_10267673 | |||
| 2644 | Ga0207668_10000049 | |||
| 2645 | Ga0207668_10059373 | |||
| 2646 | Ga0207668_10168639 | |||
| 2647 | Ga0207640_10000301 | |||
| 2648 | Ga0207640_10029527 | |||
| 2649 | Ga0207640_10074211 | |||
| 2650 | Ga0207640_10189847 | |||
| 2651 | Ga0207658_10077114 | |||
| 2652 | Ga0207658_10175261 | |||
| 2653 | Ga0207677_10072040 | |||
| 2654 | Ga0207677_10219393 | |||
| 2655 | Ga0207677_10295039 | |||
| 2656 | Ga0207703_10098502 | |||
| 2657 | Ga0207703_10318466 | |||
| 2658 | Ga0207639_10000413 | |||
| 2659 | Ga0207639_10011576 | |||
| 2660 | Ga0207639_10066094 | |||
| 2661 | Ga0207639_10075818 | |||
| 2662 | Ga0207678_10000920 | |||
| 2663 | Ga0207678_10007714 | |||
| 2664 | Ga0207678_10010132 | |||
| 2665 | Ga0207678_10018124 | |||
| 2666 | Ga0207678_10030856 | |||
| 2667 | Ga0207678_10035645 | |||
| 2668 | Ga0207678_10041352 | |||
| 2669 | Ga0207678_10120737 | |||
| 2670 | Ga0207708_10002680 | |||
| 2671 | Ga0207708_10002682 | |||
| 2672 | Ga0207708_10029309 | |||
| 2673 | Ga0207708_10137658 | |||
| 2674 | Ga0207702_10001310 | |||
| 2675 | Ga0207702_10002075 | |||
| 2676 | Ga0207641_10000542 | |||
| 2677 | Ga0207648_10002093 | |||
| 2678 | Ga0207648_10011369 | |||
| 2679 | Ga0207676_10000511 | |||
| 2680 | Ga0207676_10034980 | |||
| 2681 | Ga0207676_10055650 | |||
| 2682 | Ga0207676_10066499 | |||
| 2683 | Ga0207676_10308686 | |||
| 2684 | Ga0207674_10000882 | |||
| 2685 | Ga0207674_10008675 | |||
| 2686 | Ga0207674_10029762 | |||
| 2687 | Ga0207674_10074468 | |||
| 2688 | Ga0207674_10122257 | |||
| 2689 | Ga0207674_10207300 | |||
| 2690 | Ga0207675_100001599 | |||
| 2691 | Ga0207675_100032506 | |||
| 2692 | Ga0207675_100032967 | |||
| 2693 | Ga0207675_100056412 | |||
| 2694 | Ga0207675_100181195 | |||
| 2695 | Ga0207675_100333112 | |||
| 2696 | Ga0207683_10000653 | |||
| 2697 | Ga0207683_10005584 | |||
| 2698 | Ga0207683_10032212 | |||
| 2699 | Ga0207683_10034787 | |||
| 2700 | Ga0207683_10058314 | |||
| 2701 | Ga0207683_10126366 | |||
| 2702 | Ga0207683_10320810 | |||
| 2703 | Ga0207698_10003176 | |||
| 2704 | Ga0207698_10015074 | |||
| 2705 | Ga0207698_10031914 | |||
| 2706 | Ga0207698_10141417 | |||
| 2707 | Ga0207698_10184510 | |||
| 2708 | Ga0207698_10213466 | |||
| 2709 | Ga0207698_10241296 | |||
| 2710 | Ga0209389_1000033 | |||
| 2711 | Ga0209389_1000071 | |||
| 2712 | Ga0209589_1000040 | |||
| 2713 | Ga0209489_100045 | |||
| 2714 | Ga0209489_101361 | |||
| 2715 | Ga0209700_100011 | |||
| 2716 | Ga0209967_1004267 | |||
| 2717 | Ga0209179_1004156 | |||
| 2718 | Ga0210002_1005285 | |||
| 2719 | Ga0209588_1021319 | |||
| 2720 | Ga0209966_1009837 | |||
| 2721 | Ga0209998_10000855 | |||
| 2722 | Ga0209998_10000913 | |||
| 2723 | Ga0209974_10001240 | |||
| 2724 | Ga0207428_10000130 | |||
| 2725 | Ga0207428_10000180 | |||
| 2726 | Ga0207428_10000286 | |||
| 2727 | Ga0265357_1000126 | |||
| 2728 | Ga0268266_10000680 | |||
| 2729 | Ga0268266_10001248 | |||
| 2730 | Ga0268266_10011598 | |||
| 2731 | Ga0268266_10013545 | |||
| 2732 | Ga0268266_10019092 | |||
| 2733 | Ga0268266_10047378 | |||
| 2734 | Ga0268266_10061027 | |||
| 2735 | Ga0268266_10084876 | |||
| 2736 | Ga0268266_10146772 | |||
| 2737 | Ga0268266_10192534 | |||
| 2738 | Ga0268265_10000410 | |||
| 2739 | Ga0268265_10109383 | |||
| 2740 | Ga0268265_10136371 | |||
| 2741 | Ga0268265_10243594 | |||
| 2742 | Ga0268265_10346640 | |||
| 2743 | Ga0268264_10001172 | |||
| 2744 | Ga0265337_1000803 | |||
| 2745 | Ga0307517_10000175 | |||
| 2746 | Ga0307515_10010288 | |||
| 2747 | Ga0265338_10082594 | |||
| 2748 | Ga0265763_1000550 | |||
| 2749 | Ga0265330_10013168 | |||
| 2750 | Ga0265330_10017853 | |||
| 2751 | Ga0265328_10005186 | |||
| 2752 | Ga0265328_10012310 | |||
| 2753 | Ga0265325_10000011 | |||
| 2754 | Ga0265325_10000031 | |||
| 2755 | Ga0265325_10009845 | |||
| 2756 | Ga0265325_10010725 | |||
| 2757 | Ga0265325_10043236 | |||
| 2758 | Ga0265325_10060508 | |||
| 2759 | Ga0265340_10000988 | |||
| 2760 | Ga0265340_10002668 | |||
| 2761 | Ga0265340_10015328 | |||
| 2762 | Ga0265340_10016275 | |||
| 2763 | Ga0265340_10019075 | |||
| 2764 | Ga0265339_10000420 | |||
| 2765 | Ga0265339_10023140 | |||
| 2766 | Ga0265339_10029285 | |||
| 2767 | Ga0265339_10033487 | |||
| 2768 | Ga0265339_10081739 | |||
| 2769 | Ga0265331_10065751 | |||
| 2770 | Ga0265316_10012332 | |||
| 2771 | Ga0265316_10031368 | |||
| 2772 | Ga0265316_10156012 | |||
| 2773 | Ga0307513_10079139 | |||
| 2774 | Ga0265313_10000008 | |||
| 2775 | Ga0265313_10000637 | |||
| 2776 | Ga0265313_10004833 | |||
| 2777 | Ga0265313_10007230 | |||
| 2778 | Ga0265313_10008768 | |||
| 2779 | Ga0265313_10020749 | |||
| 2780 | Ga0265313_10023060 | |||
| 2781 | Ga0265313_10023600 | |||
| 2782 | Ga0265313_10025145 | |||
| 2783 | Ga0307508_10000108 | |||
| 2784 | Ga0307508_10044567 | |||
| 2785 | Ga0307508_10109344 | |||
| 2786 | Ga0316575_10005603 | |||
| 2787 | Ga0316575_10013015 | |||
| 2788 | Ga0316579_10006101 | |||
| 2789 | Ga0265314_10002983 | |||
| 2790 | Ga0265314_10011076 | |||
| 2791 | Ga0265314_10072325 | |||
| 2792 | Ga0265342_10004075 | |||
| 2793 | Ga0265342_10008760 | |||
| 2794 | Ga0265342_10034408 | |||
| 2795 | Ga0265342_10051976 | |||
| 2796 | Ga0265342_10053102 | |||
| 2797 | Ga0265342_10118905 | |||
| 2798 | Ga0307516_10275542 | |||
| 2799 | Ga0307516_10287203 | |||
| 2800 | Ga0307405_10039377 | |||
| 2801 | Ga0307412_10131376 | |||
| 2802 | Ga0316583_10000432 | |||
| 2803 | Ga0307510_10172898 | |||
| 2804 | Ga0373930_0002135 | |||
| 2805 | Ga0373930_0004672 | |||
| 2806 | Ga0373930_0006152 | |||
| 2807 | Ga0373948_0019053 | |||
| 2808 | Ga0373950_0004459 | |||
| 2809 | Ga0373950_0009843 | |||
| 2810 | Ga0373958_0001550 | |||
| 2811 | Ga0373959_0000740 | |||
| 2812 | Ga0373959_0002603 | |||
| 2813 | Ga0373938_0000260 | |||
| 2814 | Ga0373938_0001185 | |||
| 2815 | Ga0373926_0045645 | |||
| 2816 | Ga0373928_0000813 | |||
| 2817 | Ga0373928_0008582 | |||
| 2818 | Ga0373928_0011485 | |||
| 2819 | Ga0373929_0001725 | |||
| 2820 | Ga0373929_0005692 | |||
| 2821 | Ga0373934_0052433 | |||
| 2822 | Ga0373940_0000718 | |||
| 2823 | Ga0373944_0007059 | |||
| 2824 | Ga0373949_0000547 | |||
| 2825 | Ga0373949_0011258 | |||
| 2826 | Ga0373951_0001164 | |||
| 2827 | Ga0373951_0002297 | |||
| 2828 | Ga0373952_0000516 | |||
| 2829 | Ga0373952_0000760 | |||
| 2830 | Ga0373923_0010424 | |||
| 2831 | Ga0373932_0000908 | |||
| 2832 | Ga0373936_0106013 | |||
| 2833 | Ga0373939_0000911 | |||
| 2834 | Ga0373939_0014272 | |||
| 2835 | Ga0373939_0024389 | |||
| 2836 | Ga0373941_0000037 | |||
| 2837 | Ga0373941_0001686 | |||
| 2838 | Ga0373941_0017520 | |||
| 2839 | Ga0373945_0004426 | |||
| 2840 | Ga0373945_0008144 | |||
| 2841 | Ga0373945_0023371 | |||
| 2842 | Ga0373945_0026758 | |||
| 2843 | Ga0373953_0001233 | |||
| 2844 | Ga0373953_0018745 | |||
| 2845 | Ga0373953_0022802 | |||
| 2846 | Ga0373954_0000514 | |||
| 2847 | Ga0373954_0003303 | |||
| 2848 | Ga0373954_0024791 | |||
| 2849 | Ga0373954_0100960 | |||
| 2850 | Ga0373956_0003634 | |||
| 2851 | Ga0373956_0005363 | |||
| 2852 | Ga0373956_0007961 | |||
| 2853 | Ga0373956_0015060 | |||
| 2854 | Ga0373957_0001007 | |||
| 2855 | Ga0373957_0006379 | |||
| 2856 | Ga0373957_0011003 | |||
| 2857 | Ga0373957_0019840 | |||
| 2858 | Ga0373957_0024024 | |||
| 2859 | Ga0373960_0000805 | |||
| 2860 | Ga0373960_0001073 | |||
| 2861 | Ga0373943_0000699 | |||
| 2862 | Ga0373943_0004297 | |||
| 2863 | Ga0373943_0007096 | |||
| 2864 | Ga0373943_0010381 | |||
| 2865 | Ga0373943_0010931 | |||
| 2866 | Ga0373943_0030320 | |||
| 2867 | Ga0373943_0136083 | |||
| 2868 | Ga0373946_0004806 | |||
| 2869 | Ga0373946_0009235 | |||
| 2870 | Ga0373946_0014570 | |||
| 2871 | Ga0373946_0032937 | |||
| 2872 | Ga0373955_0000723 | |||
| 2873 | Ga0373955_0001851 | |||
| 2874 | Ga0373955_0007716 | |||
| 2875 | Ga0373955_0014090 | |||
| 2876 | Ga0373955_0019345 | |||
| 2877 | Ga0373955_0030955 | |||
| 2878 | Ga0373955_0103027 | |||
| 2879 | Ga0373942_0000388 | |||
| 2880 | Ga0373942_0010244 | |||
| 2881 | Ga0373961_0000658 | |||
| 2882 | Ga0373961_0010035 | |||
| 2883 | Ga0373961_0024994 | |||
| 2884 | Ga0373962_0004022 | |||
| 2885 | Ga0373962_0005442 | |||
| 2886 | Ga0373962_0008725 | |||
| 2887 | Ga0373924_0003551 | |||
| 2888 | Ga0373924_0005950 | |||
| 2889 | Ga0373924_0014945 | |||
| 2890 | Ga0373924_0033471 | |||
| 2891 | Ga0373924_0082998 | |||
| 2892 | Ga0373931_0001169 | |||
| 2893 | Ga0373931_0002000 | |||
| 2894 | Ga0373931_0021214 | |||
| 2895 | Ga0373931_0024262 | |||
| 2896 | Ga0373931_0041537 | |||
| 2897 | Ga0373935_0000777 | |||
| 2898 | Ga0373935_0015808 | |||
| 2899 | Ga0373935_0016204 | |||
| 2900 | Ga0373927_0000337 | |||
| 2901 | Ga0373927_0000920 | |||
| 2902 | Ga0373927_0007511 | |||
| 2903 | Ga0373927_0063703 | |||
| 2904 | Ga0373927_0070036 | |||
| 2905 | Ga0373933_0000749 | |||
| 2906 | Ga0373933_0008828 | |||
| 2907 | Ga0373933_0016195 | |||
| 2908 | Ga0373933_0020951 | |||
| 2909 | Ga0373933_0097439 | |||
| 2910 | Ga0373933_0177752 | |||
| 2911 | Ga0373947_0001483 | |||
| 2912 | Ga0373947_0001596 | |||
| 2913 | Ga0373947_0004710 | |||
| 2914 | Ga0373947_0004829 | |||
| 2915 | Ga0373947_0010845 | |||
| 2916 | Ga0373947_0011454 | |||
| 2917 | Ga0373947_0012687 | |||
| 2918 | Ga0373947_0035521 | |||
| 2919 | Ga0373947_0037785 | |||
| 2920 | Ga0373947_0098051 | |||
| 2921 | Ga0373937_0001087 | |||
| 2922 | Ga0373937_0004268 | |||
| 2923 | Ga0373937_0012013 | |||
| 2924 | Ga0373937_0020739 | |||
| 2925 | Ga0373937_0027462 | |||
| 2926 | Ga0373937_0034586 | |||
| 2927 | Ga0373937_0040316 | |||
| 2928 | Ga0373937_0059594 | |||
| 2929 | Ga0373937_0129696 | |||
| 2930 | Ga0373937_0327232 | |||
| 2931 | Ga0373937_0331331 | |||
| 2932 | Ga0373925_0000712 | |||
| 2933 | Ga0373925_0002178 | |||
| 2934 | Ga0373925_0012757 | |||
| 2935 | Ga0373925_0070890 | |||
| 2936 | Ga0373925_0071831 | |||
| 2937 | Ga0373925_0074899 | |||
| 2938 | Ga0373925_0167688 | |||
| 2939 | Ga0373925_0179167 | |||
| 2940 | Ga0373925_0242286 | |||
| 2941 | Ga0395899_0013101 | |||
| 2942 | Ga0395899_0072062 | |||
| 2943 | Ga0395900_0002974 | |||
| 2944 | Ga0395900_0010116 | |||
| 2945 | Ga0395900_0101559 | |||
| 2946 | Ga0395898_0005741 | |||
| 2947 | Ga0395898_0011608 | |||
| 2948 | Ga0395898_0014047 | |||
| 2949 | Ga0395898_0113141 | |||
| 2950 | Ga0395905_0009536 | |||
| 2951 | Ga0395905_0023356 | |||
| 2952 | Ga0436364_0091611 | |||
| 2953 | Ga0395901_0003628 | |||
| 2954 | Ga0395901_0012308 | |||
| 2955 | Ga0395901_0092810 | |||
| 2956 | Ga0436365_0113731 | |||
| 2957 | Ga0436365_0254353 | |||
| 2958 | Ga0436365_0270990 | |||
| 2959 | Ga0436365_0671434 | |||
| 2960 | Ga0436365_1550909 | |||
| 2961 | Ga0436365_1927338 | |||
| 2962 | Ga0436361_0438836 | |||
| 2963 | Ga0436361_0676992 | |||
| 2964 | Ga0436361_0764602 | |||
| 2965 | Ga0436361_0842459 | |||
| 2966 | Ga0436361_0869536 | |||
| 2967 | Ga0436363_1655093 | |||
| 2968 | Ga0436362_0320095 | |||
| 2969 | Ga0439453_0001745 | |||
| 2970 | Ga0439453_0015656 | |||
| 2971 | Ga0439465_0015093 | |||
| 2972 | Ga0439441_010110 | |||
| 2973 | Ga0439455_0016975 | |||
| 2974 | Ga0466969_0031199 | |||
| 2975 | Ga0466972_0000107 | |||
| 2976 | Ga0466965_0006278 | |||
| 2977 | Ga0466966_0000429 | |||
| 2978 | Ga0466966_0048482 | |||
| 2979 | Ga0466966_0074503 | |||
| 2980 | Ga0466961_0000074 | |||
| 2981 | Ga0466963_0004354 | |||
| 2982 | Ga0466963_0004518 | |||
| 2983 | Ga0466963_0004913 | |||
| 2984 | Ga0466963_0030079 | |||
| 2985 | Ga0466963_0056684 | |||
| 2986 | Ga0466968_0003762 | |||
| 2987 | Ga0466957_0004324 | |||
| 2988 | Ga0466957_0028192 | |||
| 2989 | Ga0466960_0008577 | |||
| 2990 | Ga0466960_0028229 | |||
| 2991 | Ga0466959_0001671 | |||
| 2992 | Ga0466959_0030925 | |||
| 2993 | Ga0466959_0093715 | |||
| 2994 | Ga0451576_0164471 | |||
| 2995 | Ga0451576_0442507 | |||
| 2996 | Ga0466958_0026534 | |||
| 2997 | Ga0466967_0004481 | |||
| 2998 | Ga0466967_0372979 | |||
| 2999 | Ga0466967_0416113 | |||
| 3000 | Ga0495592_0003132 | |||
| 3001 | Ga0495592_0011587 | |||
| 3002 | Ga0495592_0048616 | |||
| 3003 | Ga0495592_0058912 | |||
| 3004 | Ga0495592_0193907 | |||
| 3005 | Ga0495603_0007593 | |||
| 3006 | Ga0495603_0012985 | |||
| 3007 | Ga0495603_0053315 | |||
| 3008 | Ga0495603_0122267 | |||
| 3009 | Ga0495629_0000124 | |||
| 3010 | Ga0495629_0001397 | |||
| 3011 | Ga0495629_0001747 | |||
| 3012 | Ga0495629_0002750 | |||
| 3013 | Ga0495629_0004000 | |||
| 3014 | Ga0495629_0136391 | |||
| 3015 | Ga0495638_0003214 | |||
| 3016 | Ga0495638_0035809 | |||
| 3017 | Ga0495638_0045581 | |||
| 3018 | Ga0495638_0121170 | |||
| 3019 | Ga0495651_0000828 | |||
| 3020 | Ga0495651_0000848 | |||
| 3021 | Ga0495651_0010521 | |||
| 3022 | Ga0495651_0013380 | |||
| 3023 | Ga0495651_0034381 | |||
| 3024 | Ga0495651_0139182 | |||
| 3025 | Ga0495653_0003214 | |||
| 3026 | Ga0495653_0009388 | |||
| 3027 | Ga0495653_0014317 | |||
| 3028 | Ga0495653_0059128 | |||
| 3029 | Ga0495580_0084249 | |||
| 3030 | Ga0495580_0243244 | |||
| 3031 | Ga0495582_0000494 | |||
| 3032 | Ga0495582_0000612 | |||
| 3033 | Ga0495582_0029848 | |||
| 3034 | Ga0495605_0070490 | |||
| 3035 | Ga0495639_0018656 | |||
| 3036 | Ga0495639_0022341 | |||
| 3037 | Ga0495662_0001524 | |||
| 3038 | Ga0495664_0003608 | |||
| 3039 | Ga0495664_0004132 | |||
| 3040 | Ga0495664_0007442 | |||
| 3041 | Ga0495664_0024956 | |||
| 3042 | Ga0495664_0052403 | |||
| 3043 | Ga0495584_0007686 | |||
| 3044 | Ga0495584_0098033 | |||
| 3045 | Ga0495585_0031324 | |||
| 3046 | Ga0495594_0005394 | |||
| 3047 | Ga0495583_0060554 | |||
| 3048 | Ga0495606_0001875 | |||
| 3049 | Ga0495606_0029132 | |||
| 3050 | Ga0495606_0081523 | |||
| 3051 | Ga0495606_0083098 | |||
| 3052 | Ga0495606_0112941 | |||
| 3053 | Ga0495608_0000289 | |||
| 3054 | Ga0495608_0006800 | |||
| 3055 | Ga0495608_0016797 | |||
| 3056 | Ga0495608_0026000 | |||
| 3057 | Ga0495608_0029737 | |||
| 3058 | Ga0495608_0051514 | |||
| 3059 | Ga0495610_0057783 | |||
| 3060 | Ga0495616_0013598 | |||
| 3061 | Ga0495616_0072093 | |||
| 3062 | Ga0495616_0111407 | |||
| 3063 | Ga0495618_0002332 | |||
| 3064 | Ga0495618_0005683 | |||
| 3065 | Ga0495618_0005818 | |||
| 3066 | Ga0495618_0021212 | |||
| 3067 | Ga0495620_0008453 | |||
| 3068 | Ga0495628_0002019 | |||
| 3069 | Ga0495628_0005743 | |||
| 3070 | Ga0495628_0063328 | |||
| 3071 | Ga0495628_0070770 | |||
| 3072 | Ga0495628_0099426 | |||
| 3073 | Ga0495628_0109037 | |||
| 3074 | Ga0495630_0004265 | |||
| 3075 | Ga0495630_0010648 | |||
| 3076 | Ga0495630_0010684 | |||
| 3077 | Ga0495632_0025333 | |||
| 3078 | Ga0495648_0044784 | |||
| 3079 | Ga0495648_0087688 | |||
| 3080 | Ga0495666_0067927 | |||
| 3081 | Ga0495652_0004566 | |||
| 3082 | Ga0495652_0007469 | |||
| 3083 | Ga0495652_0015031 | |||
| 3084 | Ga0495652_0045490 | |||
| 3085 | Ga0495652_0081641 | |||
| 3086 | Ga0495652_0167720 | |||
| 3087 | Ga0495652_0239116 | |||
| 3088 | Ga0495654_0121070 | |||
| 3089 | Ga0495665_0007626 | |||
| 3090 | Ga0495665_0016023 | |||
| 3091 | Ga0495665_0018434 | |||
| 3092 | Ga0495640_0002278 | |||
| 3093 | Ga0495640_0009218 | |||
| 3094 | Ga0495640_0010515 | |||
| 3095 | Ga0495640_0011275 | |||
| 3096 | Ga0495640_0030298 | |||
| 3097 | Ga0495640_0037763 | |||
| 3098 | Ga0495640_0126222 | |||
| 3099 | Ga0495640_0142826 | |||
| 3100 | Ga0495586_0075916 | |||
| 3101 | Ga0495587_0001579 | |||
| 3102 | Ga0495587_0002055 | |||
| 3103 | Ga0495587_0075738 | |||
| 3104 | Ga0495598_0010358 | |||
| 3105 | Ga0495609_0041186 | |||
| 3106 | Ga0495621_0012445 | |||
| 3107 | Ga0495645_0015600 | |||
| 3108 | Ga0495645_0017012 | |||
| 3109 | Ga0495645_0064816 | |||
| 3110 | Ga0495622_0008280 | |||
| 3111 | Ga0495622_0047417 | |||
| 3112 | Ga0495622_0049876 | |||
| 3113 | Ga0495667_0000745 | |||
| 3114 | Ga0495667_0003972 | |||
| 3115 | Ga0495667_0004942 | |||
| 3116 | Ga0495667_0007291 | |||
| 3117 | Ga0495667_0017408 | |||
| 3118 | Ga0495667_0029968 | |||
| 3119 | Ga0495667_0036611 | |||
| 3120 | Ga0495656_0026478 | |||
| 3121 | Ga0495668_0024098 | |||
| 3122 | Ga0495634_0000886 | |||
| 3123 | Ga0495634_0010854 | |||
| 3124 | Ga0495634_0035418 | |||
| 3125 | Ga0495634_0059475 | |||
| 3126 | Ga0495634_0108579 | |||
| 3127 | Ga0495635_0000288 | |||
| 3128 | Ga0495635_0000628 | |||
| 3129 | Ga0495635_0007880 | |||
| 3130 | Ga0495635_0010659 | |||
| 3131 | Ga0495635_0019422 | |||
| 3132 | Ga0495635_0030423 | |||
| 3133 | Ga0495635_0115167 | |||
| 3134 | Ga0495635_0127602 | |||
| 3135 | Ga0495659_0004621 | |||
| 3136 | Ga0495661_0111970 | |||
| 3137 | Ga0495588_0006045 | |||
| 3138 | Ga0495588_0049532 | |||
| 3139 | Ga0495657_0000869 | |||
| 3140 | Ga0495657_0001357 | |||
| 3141 | Ga0495657_0009320 | |||
| 3142 | Ga0495657_0023590 | |||
| 3143 | Ga0495657_0134114 | |||
| 3144 | Ga0495599_0002342 | |||
| 3145 | Ga0495599_0012613 | |||
| 3146 | Ga0495599_0019939 | |||
| 3147 | Ga0495599_0032432 | |||
| 3148 | Ga0495623_0002014 | |||
| 3149 | Ga0495623_0002560 | |||
| 3150 | Ga0495623_0004925 | |||
| 3151 | Ga0495623_0011972 | |||
| 3152 | Ga0495623_0119677 | |||
| 3153 | Ga0495646_0001350 | |||
| 3154 | Ga0495646_0003278 | |||
| 3155 | Ga0495646_0080599 | |||
| 3156 | Ga0495647_0010897 | |||
| 3157 | Ga0495647_0028792 | |||
| 3158 | Ga0495658_0005405 | |||
| 3159 | Ga0495658_0007867 | |||
| 3160 | Ga0495658_0061430 | |||
| 3161 | Ga0495669_0023835 | |||
| 3162 | Ga0495669_0113690 | |||
| 3163 | Ga0495613_0002256 | |||
| 3164 | Ga0495613_0030094 | |||
| 3165 | Ga0495613_0092460 | |||
| 3166 | Ga0495613_0104223 | |||
| 3167 | Ga0495613_0148608 | |||
| 3168 | Ga0495613_0160595 | |||
| 3169 | Ga0495613_0241365 | |||
| 3170 | Ga0495624_0000867 | |||
| 3171 | Ga0495624_0070358 | |||
| 3172 | Ga0495670_0008005 | |||
| 3173 | Ga0495670_0059673 | |||
| 3174 | Ga0495671_0031480 | |||
| 3175 | Ga0495649_0006343 | |||
| 3176 | Ga0495600_0001518 | |||
| 3177 | Ga0495600_0020307 | |||
| 3178 | Ga0495600_0040052 | |||
| 3179 | Ga0495600_0058682 | |||
| 3180 | Ga0495600_0123335 | |||
| 3181 | Ga0495581_0116575 | |||
| 3182 | Ga0495604_0000613 | |||
| 3183 | Ga0495604_0002473 | |||
| 3184 | Ga0495604_0005447 | |||
| 3185 | Ga0495604_0033969 | |||
| 3186 | Ga0495604_0062471 | |||
| 3187 | Ga0495604_0101529 | |||
| 3188 | Ga0495604_0199296 | |||
| 3189 | Ga0495636_0021260 | |||
| 3190 | Ga0495674_0005148 | |||
| 3191 | Ga0495674_0009345 | |||
| 3192 | Ga0495674_0016916 | |||
| 3193 | Ga0495674_0022408 | |||
| 3194 | Ga0495674_0034750 | |||
| 3195 | Ga0495674_0040150 | |||
| 3196 | Ga0495674_0203789 | |||
| 3197 | Ga0495672_0087515 | |||
| 3198 | Ga0495676_0021648 | |||
| 3199 | Ga0495676_0035932 | |||
| 3200 | Ga0495680_0000791 | |||
| 3201 | Ga0495680_0000871 | |||
| 3202 | Ga0495680_0003706 | |||
| 3203 | Ga0495680_0008347 | |||
| 3204 | Ga0495680_0056497 | |||
| 3205 | Ga0495680_0082360 | |||
| 3206 | Ga0495683_0008398 | |||
| 3207 | Ga0495683_0093686 | |||
| 3208 | Ga0495687_008699 | |||
| 3209 | Ga0495675_0000231 | |||
| 3210 | Ga0495675_0004959 | |||
| 3211 | Ga0495675_0006519 | |||
| 3212 | Ga0495675_0046490 | |||
| 3213 | Ga0495675_0136897 | |||
| 3214 | Ga0495673_0064366 | |||
| 3215 | Ga0495684_0000169 | |||
| 3216 | Ga0495684_0006577 | |||
| 3217 | Ga0495684_0017615 | |||
| 3218 | Ga0495684_0024653 | |||
| 3219 | Ga0495684_0033293 | |||
| 3220 | Ga0495684_0040178 | |||
| 3221 | Ga0495684_0048445 | |||
| 3222 | Ga0495684_0061181 | |||
| 3223 | Ga0495684_0076092 | |||
| 3224 | Ga0495684_0111667 | |||
| 3225 | Ga0495684_0176189 | |||
| 3226 | Ga0495686_0069066 | |||
| 3227 | Ga0495686_0084342 | |||
| 3228 | Ga0495686_0124031 | |||
| 3229 | Ga0495593_0006499 | |||
| 3230 | Ga0495593_0015076 | |||
| 3231 | Ga0495602_0006526 | |||
| 3232 | Ga0495602_0007532 | |||
| 3233 | Ga0495602_0008023 | |||
| 3234 | Ga0495602_0109171 | |||
| 3235 | Ga0495626_0019874 | |||
| 3236 | Ga0496100_0001568 | |||
| 3237 | Ga0496100_0015384 | |||
| 3238 | Ga0496100_0029669 | |||
| 3239 | Ga0496100_0039950 | |||
| 3240 | Ga0496100_0056464 | |||
| 3241 | Ga0496101_0000171 | |||
| 3242 | Ga0496101_0001461 | |||
| 3243 | Ga0496101_0002295 | |||
| 3244 | Ga0496101_0061278 | |||
| 3245 | Ga0496101_0094070 | |||
| 3246 | Ga0496101_0264407 | |||
| 3247 | Ga0496102_0001453 | |||
| 3248 | Ga0496102_0004724 | |||
| 3249 | Ga0496102_0024848 | |||
| 3250 | Ga0496102_0132235 | |||
| 3251 | Ga0496102_0170684 | |||
| 3252 | Ga0496102_0221645 | |||
| 3253 | Ga0496103_0005627 | |||
| 3254 | Ga0496103_0005987 | |||
| 3255 | Ga0496103_0017226 | |||
| 3256 | Ga0496103_0216405 | |||
| 3257 | Ga0496104_0000067 | |||
| 3258 | Ga0496104_0003147 | |||
| 3259 | Ga0496104_0012278 | |||
| 3260 | Ga0496104_0037074 | |||
| 3261 | Ga0496104_0064446 | |||
| 3262 | Ga0496104_0081709 | |||
| 3263 | Ga0496104_0089362 | |||
| 3264 | Ga0496104_0138768 | |||
| 3265 | Ga0496104_0176828 | |||
| 3266 | Ga0496105_0000130 | |||
| 3267 | Ga0496105_0004705 | |||
| 3268 | Ga0496105_0011328 | |||
| 3269 | Ga0496105_0050772 | |||
| 3270 | Ga0496105_0054949 | |||
| 3271 | Ga0496105_0108449 | |||
| 3272 | Ga0496105_0189447 | |||
| 3273 | Ga0496105_0192646 | |||
| 3274 | Ga0496105_0218260 | |||
| 3275 | Ga0496106_0002116 | |||
| 3276 | Ga0496106_0005992 | |||
| 3277 | Ga0496106_0013472 | |||
| 3278 | Ga0496106_0013768 | |||
| 3279 | Ga0496106_0019258 | |||
| 3280 | Ga0496106_0035425 | |||
| 3281 | Ga0496106_0053430 | |||
| 3282 | Ga0496106_0063140 | |||
| 3283 | Ga0496106_0139292 | |||
| 3284 | Ga0496106_0177492 | |||
| 3285 | Ga0496107_0002489 | |||
| 3286 | Ga0496107_0003392 | |||
| 3287 | Ga0496107_0005829 | |||
| 3288 | Ga0496107_0009248 | |||
| 3289 | Ga0496107_0010662 | |||
| 3290 | Ga0496107_0036330 | |||
| 3291 | Ga0496107_0103925 | |||
| 3292 | Ga0496107_0120514 | |||
| 3293 | Ga0496107_0280096 | |||
| 3294 | Ga0496108_0003417 | |||
| 3295 | Ga0496108_0005206 | |||
| 3296 | Ga0496108_0006501 | |||
| 3297 | Ga0496108_0025147 | |||
| 3298 | Ga0496108_0025606 | |||
| 3299 | Ga0496108_0039052 | |||
| 3300 | Ga0496108_0047350 | |||
| 3301 | Ga0496108_0064251 | |||
| 3302 | Ga0496108_0132273 | |||
| 3303 | Ga0496109_0000606 | |||
| 3304 | Ga0496109_0000714 | |||
| 3305 | Ga0496109_0004345 | |||
| 3306 | Ga0496109_0004713 | |||
| 3307 | Ga0496109_0024520 | |||
| 3308 | Ga0496109_0030825 | |||
| 3309 | Ga0496109_0084083 | |||
| 3310 | Ga0496109_0084980 | |||
| 3311 | Ga0496109_0122011 | |||
| 3312 | Ga0496109_0125037 | |||
| 3313 | Ga0496109_0151615 | |||
| 3314 | Ga0496109_0210528 | |||
| 3315 | Ga0496109_0218652 | |||
| 3316 | Ga0496110_0011093 | |||
| 3317 | Ga0496110_0031167 | |||
| 3318 | Ga0496110_0073759 | |||
| 3319 | Ga0496110_0080773 | |||
| 3320 | Ga0496110_0083757 | |||
| 3321 | Ga0496110_0149039 | |||
| 3322 | Ga0496110_0407516 | |||
| 3323 | Ga0496110_0453028 | |||
| 3324 | Ga0496111_0038001 | |||
| 3325 | Ga0496111_0039188 | |||
| 3326 | Ga0496111_0111178 | |||
| 3327 | Ga0496111_0141650 | |||
| 3328 | Ga0496111_0160448 | |||
| 3329 | Ga0496111_0172079 | |||
| 3330 | Ga0496111_0172431 | |||
| 3331 | Ga0496112_0002085 | |||
| 3332 | Ga0496112_0003993 | |||
| 3333 | Ga0496112_0007660 | |||
| 3334 | Ga0496112_0018292 | |||
| 3335 | Ga0496112_0090589 | |||
| 3336 | Ga0496112_0091411 | |||
| 3337 | Ga0496112_0130032 | |||
| 3338 | Ga0496112_0154841 | |||
| 3339 | Ga0496112_0156781 | |||
| 3340 | Ga0496112_0204664 | |||
| 3341 | Ga0496112_0250203 | |||
| 3342 | Ga0496112_0309730 | |||
| 3343 | Ga0496113_0000399 | |||
| 3344 | Ga0496113_0002831 | |||
| 3345 | Ga0496113_0034822 | |||
| 3346 | Ga0496113_0035652 | |||
| 3347 | Ga0496113_0042451 | |||
| 3348 | Ga0496113_0067886 | |||
| 3349 | Ga0496113_0092424 | |||
| 3350 | Ga0496114_0008317 | |||
| 3351 | Ga0496114_0028520 | |||
| 3352 | Ga0496114_0029718 | |||
| 3353 | Ga0496114_0041803 | |||
| 3354 | Ga0496114_0096651 | |||
| 3355 | Ga0496114_0174186 | |||
| 3356 | Ga0496114_0178178 | |||
| 3357 | Ga0496114_0216719 | |||
| 3358 | Ga0496114_0225839 | |||
| 3359 | Ga0496114_0238726 | |||
| 3360 | Ga0496114_0267825 | |||
| 3361 | Ga0496115_0001189 | |||
| 3362 | Ga0496115_0006380 | |||
| 3363 | Ga0496115_0085724 | |||
| 3364 | Ga0496115_0100555 | |||
| 3365 | Ga0496115_0101360 | |||
| 3366 | Ga0496115_0105381 | |||
| 3367 | Ga0496115_0116269 | |||
| 3368 | Ga0496115_0130782 | |||
| 3369 | Ga0496115_0189688 | |||
| 3370 | Ga0496115_0207959 | |||
| 3371 | Ga0496115_0280027 | |||
| 3372 | Ga0496116_0003460 | |||
| 3373 | Ga0496116_0097457 | |||
| 3374 | Ga0496117_0027790 | |||
| 3375 | Ga0496117_0030958 | |||
| 3376 | Ga0496117_0037619 | |||
| 3377 | Ga0496118_0015666 | |||
| 3378 | Ga0496118_0016153 | |||
| 3379 | Ga0496118_0037789 | |||
| 3380 | Ga0496118_0047600 | |||
| 3381 | Ga0496118_0074444 | |||
| 3382 | Ga0496118_0167974 | |||
| 3383 | Ga0496119_0025737 | |||
| 3384 | Ga0496119_0042676 | |||
| 3385 | Ga0496119_0045738 | |||
| 3386 | Ga0496119_0048007 | |||
| 3387 | Ga0496120_0024841 | |||
| 3388 | Ga0496121_0010952 | |||
| 3389 | Ga0496121_0012201 | |||
| 3390 | Ga0496121_0017146 | |||
| 3391 | Ga0496121_0022980 | |||
| 3392 | Ga0496121_0023489 | |||
| 3393 | Ga0496121_0025833 | |||
| 3394 | Ga0496121_0043880 | |||
| 3395 | Ga0496121_0085681 | |||
| 3396 | Ga0496121_0229765 | |||
| 3397 | Ga0496122_0002797 | |||
| 3398 | Ga0496122_0016307 | |||
| 3399 | Ga0496122_0050808 | |||
| 3400 | Ga0496123_0001238 | |||
| 3401 | Ga0496123_0033846 | |||
| 3402 | Ga0496123_0109376 | |||
| 3403 | Ga0496124_0038924 | |||
| 3404 | Ga0496125_0006390 | |||
| 3405 | Ga0496125_0016099 | |||
| 3406 | Ga0496125_0039975 | |||
| 3407 | Ga0496125_0064054 | |||
| 3408 | Ga0496125_0208572 | |||
| 3409 | Ga0496126_0015873 | |||
| 3410 | Ga0496126_0032674 | |||
| 3411 | Ga0496126_0038151 | |||
| 3412 | Ga0496126_0042128 | |||
| 3413 | Ga0496126_0042747 | |||
| 3414 | Ga0496126_0050585 | |||
| 3415 | Ga0496126_0072076 | |||
| 3416 | Ga0496126_0072748 | |||
| 3417 | Ga0496126_0228588 | |||
| 3418 | Ga0496126_0266403 | |||
| 3419 | Ga0496126_0297037 | |||
| 3420 | Ga0501032_0006146 | |||
| 3421 | Ga0501032_0011555 | |||
| 3422 | Ga0501032_0041414 | |||
| 3423 | Ga0501032_0042184 | |||
| 3424 | Ga0501032_0181234 | |||
| 3425 | Ga0501033_0008505 | |||
| 3426 | Ga0501033_0027308 | |||
| 3427 | Ga0501033_0052754 | |||
| 3428 | Ga0501033_0062434 | |||
| 3429 | Ga0501033_0138088 | |||
| 3430 | Ga0501034_0000374 | |||
| 3431 | Ga0501034_0001727 | |||
| 3432 | Ga0501034_0009449 | |||
| 3433 | Ga0501034_0011524 | |||
| 3434 | Ga0501034_0015758 | |||
| 3435 | Ga0501034_0060482 | |||
| 3436 | Ga0501034_0064804 | |||
| 3437 | Ga0501034_0084794 | |||
| 3438 | Ga0501034_0088636 | |||
| 3439 | Ga0501034_0102221 | |||
| 3440 | Ga0501034_0116629 | |||
| 3441 | Ga0501034_0198434 | |||
| 3442 | Ga0501034_0252815 | |||
| 3443 | Ga0501034_0274474 | |||
| 3444 | Ga0501036_0000123 | |||
| 3445 | Ga0501036_0018169 | |||
| 3446 | Ga0501036_0030032 | |||
| 3447 | Ga0501036_0130862 | |||
| 3448 | Ga0501036_0167670 | |||
| 3449 | Ga0501036_0404633 | |||
| 3450 | Ga0501037_0019490 | |||
| 3451 | Ga0501037_0055241 | |||
| 3452 | Ga0501037_0074458 | |||
| 3453 | Ga0501037_0169336 | |||
| 3454 | Ga0501037_0185034 | |||
| 3455 | Ga0501037_0263644 | |||
| 3456 | Ga0501038_0004971 | |||
| 3457 | Ga0501038_0023342 | |||
| 3458 | Ga0501038_0034764 | |||
| 3459 | Ga0501038_0054112 | |||
| 3460 | Ga0501038_0101697 | |||
| 3461 | Ga0501038_0116515 | |||
| 3462 | Ga0501039_0027874 | |||
| 3463 | Ga0501039_0051218 | |||
| 3464 | Ga0501039_0125510 | |||
| 3465 | Ga0501039_0256922 | |||
| 3466 | Ga0501039_0308719 | |||
| 3467 | Ga0501039_0353512 | |||
| 3468 | Ga0501040_0154134 | |||
| 3469 | Ga0501043_0016075 | |||
| 3470 | Ga0501043_0027703 | |||
| 3471 | Ga0501043_0139039 | |||
| 3472 | Ga0501043_0181334 | |||
| 3473 | Ga0501043_0182719 | |||
| 3474 | Ga0501043_0188076 | |||
| 3475 | Ga0501046_0028653 | |||
| 3476 | Ga0501046_0060697 | |||
| 3477 | Ga0501046_0125307 | |||
| 3478 | Ga0501046_0168359 | |||
| 3479 | Ga0501047_0000234 | |||
| 3480 | Ga0501047_0014755 | |||
| 3481 | Ga0501047_0020561 | |||
| 3482 | Ga0501047_0024694 | |||
| 3483 | Ga0501047_0059180 | |||
| 3484 | Ga0501047_0069949 | |||
| 3485 | Ga0501047_0107349 | |||
| 3486 | Ga0501047_0322777 | |||
| 3487 | Ga0501047_0399451 | |||
| 3488 | Ga0501048_0000051 | |||
| 3489 | Ga0501067_0014452 | |||
| 3490 | Ga0501067_0017895 | |||
| 3491 | Ga0501067_0035608 | |||
| 3492 | Ga0501068_0055285 | |||
| 3493 | Ga0501068_0057599 | |||
| 3494 | Ga0501068_0166882 | |||
| 3495 | Ga0501068_0167124 | |||
| 3496 | Ga0501069_0077136 | |||
| 3497 | Ga0501069_0102353 | |||
| 3498 | Ga0501070_0000886 | |||
| 3499 | Ga0501070_0003306 | |||
| 3500 | Ga0501070_0014454 | |||
| 3501 | Ga0501070_0019784 | |||
| 3502 | Ga0501070_0035784 | |||
| 3503 | Ga0501070_0039056 | |||
| 3504 | Ga0501070_0049732 | |||
| 3505 | Ga0501070_0057621 | |||
| 3506 | Ga0501070_0075239 | |||
| 3507 | Ga0501070_0141871 | |||
| 3508 | Ga0501070_0227283 | |||
| 3509 | Ga0501071_0044011 | |||
| 3510 | Ga0501071_0047958 | |||
| 3511 | Ga0501071_0176720 | |||
| 3512 | Ga0501072_0064463 | |||
| 3513 | Ga0501072_0073920 | |||
| 3514 | Ga0501072_0088730 | |||
| 3515 | Ga0501072_0229559 | |||
| 3516 | Ga0501073_0005359 | |||
| 3517 | Ga0501073_0012550 | |||
| 3518 | Ga0501073_0029845 | |||
| 3519 | Ga0501073_0039990 | |||
| 3520 | Ga0501073_0056536 | |||
| 3521 | Ga0501073_0068530 | |||
| 3522 | Ga0501073_0071925 | |||
| 3523 | Ga0501074_0061808 | |||
| 3524 | Ga0501074_0062480 | |||
| 3525 | Ga0501074_0083248 | |||
| 3526 | Ga0501074_0083519 | |||
| 3527 | Ga0501074_0090261 | |||
| 3528 | Ga0501074_0098863 | |||
| 3529 | Ga0501074_0108317 | |||
| 3530 | Ga0501075_0052437 | |||
| 3531 | Ga0501076_0004635 | |||
| 3532 | Ga0501076_0244478 | |||
| 3533 | Ga0501077_0004508 | |||
| 3534 | Ga0501077_0056520 | |||
| 3535 | Ga0501079_0024017 | |||
| 3536 | Ga0501079_0125840 | |||
| 3537 | Ga0501079_0179179 | |||
| 3538 | Ga0501080_0000528 | |||
| 3539 | Ga0501080_0011183 | |||
| 3540 | Ga0501080_0015520 | |||
| 3541 | Ga0501080_0087545 | |||
| 3542 | Ga0501080_0100490 | |||
| 3543 | Ga0501080_0174595 | |||
| 3544 | Ga0501080_0218127 | |||
| 3545 | Ga0501080_0291167 | |||
| 3546 | Ga0501080_0327262 | |||
| 3547 | Ga0501081_0000718 | |||
| 3548 | Ga0501083_0008673 | |||
| 3549 | Ga0501083_0035017 | |||
| 3550 | Ga0501083_0082630 | |||
| 3551 | Ga0501083_0112684 | |||
| 3552 | Ga0501083_0189704 | |||
| 3553 | Ga0501035_0000366 | |||
| 3554 | Ga0501035_0019199 | |||
| 3555 | Ga0501035_0028768 | |||
| 3556 | Ga0501035_0062570 | |||
| 3557 | Ga0501035_0072916 | |||
| 3558 | Ga0501035_0120311 | |||
| 3559 | Ga0501035_0129680 | |||
| 3560 | Ga0501035_0141264 | |||
| 3561 | Ga0501035_0283915 | |||
| 3562 | Ga0501035_0315516 | |||
| 3563 | Ga0501044_0000122 | |||
| 3564 | Ga0501044_0001683 | |||
| 3565 | Ga0501044_0024050 | |||
| 3566 | Ga0501044_0027004 | |||
| 3567 | Ga0501044_0032759 | |||
| 3568 | Ga0501044_0042684 | |||
| 3569 | Ga0501044_0047844 | |||
| 3570 | Ga0501044_0052709 | |||
| 3571 | Ga0501044_0056059 | |||
| 3572 | Ga0501044_0077803 | |||
| 3573 | Ga0501044_0118929 | |||
| 3574 | Ga0501044_0198312 | |||
| 3575 | Ga0501044_0221720 | |||
| 3576 | Ga0501044_0390894 | |||
| 3577 | Ga0501045_0142865 | |||
| 3578 | nmdc:mga03683_12219_c1 | |||
| 3579 | nmdc:mga03n38_2270_c1 | |||
| 3580 | nmdc:mga03n38_85112_c1 | |||
| 3581 | nmdc:mga03n38_97343_c1 | |||
| 3582 | nmdc:mga00v17_126688_c1 | |||
| 3583 | nmdc:mga00v17_13149_c2 | |||
| 3584 | nmdc:mga00v17_48336_c1 | |||
| 3585 | nmdc:mga0yw44_19588_c2 | |||
| 3586 | nmdc:mga0yw44_21048_c1 | |||
| 3587 | nmdc:mga0yw44_52774_c1 | |||
| 3588 | nmdc:mga0yw44_7314_c1 | |||
| 3589 | nmdc:mga0yw44_94778_c1 | |||
| 3590 | nmdc:mga0yw44_98163_c1 | |||
| 3591 | nmdc:mga0k408_11019_c1 | |||
| 3592 | nmdc:mga0k408_172928_c1 | |||
| 3593 | nmdc:mga0k408_24659_c1 | |||
| 3594 | nmdc:mga06z11_21831_c1 | |||
| 3595 | nmdc:mga06z11_6887_c1 | |||
| 3596 | nmdc:mga06z11_7520_c1 | |||
| 3597 | nmdc:mga06z11_88854_c1 | |||
| 3598 | nmdc:mga07m45_175977_c1 | |||
| 3599 | nmdc:mga07m45_3560_c1 | |||
| 3600 | nmdc:mga07m45_83115_c1 | |||
| 3601 | nmdc:mga05p37_290_c1 | |||
| 3602 | nmdc:mga05p37_357878_c1 | |||
| 3603 | nmdc:mga05p37_46125_c1 | |||
| 3604 | nmdc:mga05p37_58061_c1 | |||
| 3605 | nmdc:mga09592_154530_c1 | |||
| 3606 | nmdc:mga09592_2994_c1 | |||
| 3607 | nmdc:mga0qj67_16217_c1 | |||
| 3608 | nmdc:mga0qj67_2739_c1 | |||
| 3609 | nmdc:mga0qj67_412_c1 | |||
| 3610 | nmdc:mga06r32_2029_c1 | |||
| 3611 | nmdc:mga06r32_475583_c1 | |||
| 3612 | nmdc:mga08y16_126862_c1 | |||
| 3613 | nmdc:mga08y16_1898_c1 | |||
| 3614 | nmdc:mga08y16_2825_c1 | |||
| 3615 | nmdc:mga08y16_844_c1 | |||
| 3616 | nmdc:mga0n895_1061_c1 | |||
| 3617 | nmdc:mga0n895_113418_c1 | |||
| 3618 | nmdc:mga0n895_134613_c1 | |||
| 3619 | nmdc:mga0n895_20783_c1 | |||
| 3620 | nmdc:mga0n895_22046_c1 | |||
| 3621 | nmdc:mga0n895_22082_c1 | |||
| 3622 | nmdc:mga0n895_62410_c1 | |||
| 3623 | nmdc:mga0rr50_276383_c1 | |||
| 3624 | nmdc:mga0rr50_3611_c1 | |||
| 3625 | nmdc:mga0rr50_6009_c1 | |||
| 3626 | nmdc:mga08x19_80718_c1 | |||
| 3627 | nmdc:mga0a205_3382_c1 | |||
| 3628 | nmdc:mga0a205_8902_c1 | |||
| 3629 | nmdc:mga0a205_9541_c1 | |||
| 3630 | nmdc:mga0sz30_12054_c1 | |||
| 3631 | nmdc:mga0sz30_18686_c1 | |||
| 3632 | nmdc:mga0sz30_39804_c1 | |||
| 3633 | Ga0495601_0001939 | |||
| 3634 | Ga0495601_0002428 | |||
| 3635 | Ga0495601_0004177 | |||
| 3636 | Ga0495601_0074964 | |||
| 3637 | Ga0495601_0150692 | |||
| 3638 | Ga0495601_0229984 | |||
| 3639 | Ga0495612_0003279 | |||
| 3640 | Ga0495612_0003991 | |||
| 3641 | Ga0495612_0008348 | |||
| 3642 | Ga0495612_0014886 | |||
| 3643 | Ga0495612_0027096 | |||
| 3644 | Ga0495655_0005062 | |||
| 3645 | Ga0495595_0000430 | |||
| 3646 | Ga0495595_0002807 | |||
| 3647 | Ga0495595_0003742 | |||
| 3648 | Ga0495595_0011462 | |||
| 3649 | Ga0495595_0011494 | |||
| 3650 | Ga0495595_0028290 | |||
| 3651 | Ga0495595_0028986 | |||
| 3652 | Ga0495595_0029997 | |||
| 3653 | Ga0495619_0000259 | |||
| 3654 | Ga0495619_0000719 | |||
| 3655 | Ga0495619_0006574 | |||
| 3656 | Ga0495619_0007799 | |||
| 3657 | Ga0495619_0007804 | |||
| 3658 | Ga0495619_0009420 | |||
| 3659 | Ga0495619_0022954 | |||
| 3660 | Ga0495619_0047265 | |||
| 3661 | Ga0495619_0048438 | |||
| 3662 | Ga0495619_0073760 | |||
| 3663 | Ga0500643_000076 | |||
| 3664 | Ga0500643_002781 | |||
| 3665 | Ga0500646_0011073 | |||
| 3666 | Ga0500583_0014448 | |||
| 3667 | Ga0500651_0011112 | |||
| 3668 | Ga0500651_0152144 | |||
| 3669 | Ga0500566_0000314 | |||
| 3670 | Ga0500566_0002194 | |||
| 3671 | Ga0500566_0085944 | |||
| 3672 | Ga0500641_0018283 | |||
| 3673 | Ga0500641_0019444 | |||
| 3674 | Ga0500641_0038156 | |||
| 3675 | Ga0500641_0042427 | |||
| 3676 | Ga0500554_000886 | |||
| 3677 | Ga0500555_020392 | |||
| 3678 | Ga0500556_0000006 | |||
| 3679 | Ga0500556_0000601 | |||
| 3680 | Ga0500557_000059 | |||
| 3681 | Ga0500562_005330 | |||
| 3682 | Ga0500595_000001 | |||
| 3683 | Ga0500595_000506 | |||
| 3684 | Ga0500595_001968 | |||
| 3685 | Ga0500595_008320 | |||
| 3686 | Ga0500642_0000004 | |||
| 3687 | Ga0500642_0000226 | |||
| 3688 | Ga0500642_0011908 | |||
| 3689 | Ga0500642_0084177 | |||
| 3690 | Ga0500652_000033 | |||
| 3691 | Ga0500652_009006 | |||
| 3692 | Ga0500655_016310 | |||
| 3693 | Ga0500658_0028460 | |||
| 3694 | Ga0500559_0003127 | |||
| 3695 | Ga0500559_0031663 | |||
| 3696 | Ga0500568_0002010 | |||
| 3697 | Ga0500568_0026877 | |||
| 3698 | Ga0500568_0053198 | |||
| 3699 | Ga0500577_0009852 | |||
| 3700 | Ga0500590_047066 | |||
| 3701 | Ga0500590_141494 | |||
| 3702 | Ga0500604_0007979 | |||
| 3703 | Ga0500616_0000001 | |||
| 3704 | Ga0500616_0000022 | |||
| 3705 | Ga0500616_0009597 | |||
| 3706 | Ga0500616_0046260 | |||
| 3707 | Ga0500616_0060370 | |||
| 3708 | Ga0500619_049698 | |||
| 3709 | Ga0500622_0001425 | |||
| 3710 | Ga0500638_020622 | |||
| 3711 | Ga0500638_072191 | |||
| 3712 | Ga0500636_0000309 | |||
| 3713 | Ga0500636_0017136 | |||
| 3714 | Ga0500636_0024605 | |||
| 3715 | Ga0500637_0000542 | |||
| 3716 | Ga0500637_0053050 | |||
| 3717 | Ga0500567_027363 | |||
| 3718 | Ga0500625_009898 | |||
| 3719 | Ga0500645_000189 | |||
| 3720 | Ga0500645_003077 | |||
| 3721 | Ga0500645_024562 | |||
| 3722 | Ga0500609_001592 | |||
| 3723 | Ga0500599_004040 | |||
| 3724 | Ga0500601_000066 | |||
| 3725 | Ga0501084_0021239 | |||
| 3726 | Ga0501084_0050807 | |||
| 3727 | Ga0501084_0064310 | |||
| 3728 | Ga0501084_0114426 | |||
| 3729 | Ga0501084_0162878 | |||
| 3730 | Ga0501084_0170223 | |||
| 3731 | Ga0500661_000578 | |||
| 3732 | Ga0500661_013556 | |||
| 3733 | Ga0501082_0027087 | |||
| 3734 | Ga0501082_0034241 | |||
| 3735 | Ga0501082_0046452 | |||
| 3736 | Ga0501082_0055319 | |||
| 3737 | Ga0501082_0059259 | |||
| 3738 | Ga0501082_0086528 | |||
| 3739 | Ga0501082_0105184 | |||
| 3740 | Ga0501082_0308790 | |||
| 3741 | Ga0501082_0372016 | |||
| 3742 | Ga0530510_0048974 | |||
| 3743 | 2917554979 | |||
| 3744 | 2507505334 | |||
| 3745 | 2508539223 | |||
| 3746 | 2508695544 | |||
| 3747 | 2511401171 | |||
| 3748 | 2513591209 | |||
| 3749 | 2513625402 | |||
| 3750 | 2513642080 | |||
| 3751 | 2513651454 | |||
| 3752 | 2513675077 | |||
| 3753 | 2513695163 | |||
| 3754 | 2513699919 | |||
| 3755 | 2513718120 | |||
| 3756 | 2513873469 | |||
| 3757 | 2513888834 | |||
| 3758 | 2514012547 | |||
| 3759 | 2515627502 | |||
| 3760 | 2517107168 | |||
| 3761 | 2524440827 | |||
| 3762 | 2524469524 | |||
| 3763 | 2528854047 | |||
| 3764 | 2603858579 | |||
| 3765 | 2617352455 | |||
| 3766 | 2617373819 | |||
| 3767 | 2643758153 | |||
| 3768 | 2644290986 | |||
| 3769 | 2723841691 | |||
| 3770 | 2745081753 | |||
| 3771 | 2793062109 | |||
| 3772 | 2793073615 | |||
| 3773 | 2793080874 | |||
| 3774 | 2805915551 | |||
| 3775 | 2818237712 | |||
| 3776 | 2824604522 | |||
| 3777 | 2824616682 | |||
| 3778 | 2824631657 | |||
| 3779 | 2824671217 | |||
| 3780 | 2824695939 | |||
| 3781 | 2824732503 | |||
| 3782 | 2824748638 | |||
| 3783 | 2824763571 | |||
| 3784 | 2824772698 | |||
| 3785 | 2824779831 | |||
| 3786 | 2828309374 | |||
| 3787 | 2841945264 | |||
| 3788 | 2841952045 | |||
| 3789 | 2841965562 | |||
| 3790 | 2841970561 | |||
| 3791 | 2841981810 | |||
| 3792 | 2841985088 | |||
| 3793 | 2842043445 | |||
| 3794 | 2842052565 | |||
| 3795 | 2844315400 | |||
| 3796 | 2847931136 | |||
| 3797 | 2847942217 | |||
| 3798 | 2849083090 | |||
| 3799 | 2857511988 | |||
| 3800 | 2857526297 | |||
| 3801 | 2874594506 | |||
| 3802 | 2874624852 | |||
| 3803 | 2874628725 | |||
| 3804 | 2874649878 | |||
| 3805 | 2876770964 | |||
| 3806 | 2876773998 | |||
| 3807 | 2876809950 | |||
| 3808 | 2876821878 | |||
| 3809 | 2879078278 | |||
| 3810 | 2879085971 | |||
| 3811 | 2879105962 | |||
| 3812 | 2879112226 | |||
| 3813 | 2879130538 | |||
| 3814 | 2879147186 | |||
| 3815 | 2881365261 | |||
| 3816 | 2881668125 | |||
| 3817 | 2885370965 | |||
| 3818 | 2885392677 | |||
| 3819 | 2885415729 | |||
| 3820 | 2888379524 | |||
| 3821 | 2888390623 | |||
| 3822 | 2888420244 | |||
| 3823 | 2889793289 | |||
| 3824 | 2893067431 | |||
| 3825 | 2903732260 | |||
| 3826 | 2903754693 | |||
| 3827 | 2903777734 | |||
| 3828 | 2904670193 | |||
| 3829 | 2904691132 | |||
| 3830 | 2904713247 | |||
| 3831 | 2906604338 | |||
| 3832 | 2906613940 | |||
| 3833 | 2906628501 | |||
| 3834 | 2906652108 | |||
| 3835 | 2908756526 | |||
| 3836 | 2908776336 | |||
| 3837 | 2919073851 | |||
| 3838 | 2919452221 | |||
| 3839 | 2922363947 | |||
| 3840 | 2922369515 | |||
| 3841 | 2922392526 | |||
| 3842 | 2922394298 | |||
| 3843 | 2929618663 | |||
| 3844 | 2929628652 | |||
| 3845 | 2932790841 | |||
| 3846 | 2932794254 | |||
| 3847 | 2932808152 | |||
| 3848 | 2932812106 | |||
| 3849 | 2932823096 | |||
| 3850 | 2932833528 | |||
| 3851 | 2933580626 | |||
| 3852 | 2935615666 | |||
| 3853 | 2935623084 | |||
| 3854 | 2935644159 | |||
| 3855 | 2935653556 | |||
| 3856 | 2935662305 | |||
| 3857 | 2935672259 | |||
| 3858 | 2935679218 | |||
| 3859 | 2935686462 | |||
| 3860 | 2935700242 | |||
| 3861 | 2935710191 | |||
| 3862 | 2935716150 | |||
| 3863 | 2935723726 | |||
| 3864 | 2935735281 | |||
| 3865 | 2935743928 | |||
| 3866 | 2935752428 | |||
| 3867 | 2935763476 | |||
| 3868 | 2935772980 | |||
| 3869 | 2935783231 | |||
| 3870 | 2935788032 | |||
| 3871 | 2935808183 | |||
| 3872 | 2935816204 | |||
| 3873 | 2935825535 | |||
| 3874 | 2935833597 | |||
| 3875 | 2935844550 | |||
| 3876 | 2935853324 | |||
| 3877 | 2935861332 | |||
| 3878 | 2935869451 | |||
| 3879 | 2935879780 | |||
| 3880 | 2935890031 | |||
| 3881 | 2935914797 | |||
| 3882 | 2935918773 | |||
| 3883 | 2935931510 | |||
| 3884 | 2935940107 | |||
| 3885 | 2935947546 | |||
| 3886 | 2935956318 | |||
| 3887 | 2935962699 | |||
| 3888 | 2935973111 | |||
| 3889 | 2935980644 | |||
| 3890 | 2935985205 | |||
| 3891 | 2935997997 | |||
| 3892 | 2936008737 | |||
| 3893 | 2936016607 | |||
| 3894 | 2936025240 | |||
| 3895 | 2936034082 | |||
| 3896 | 2936041209 | |||
| 3897 | 2936052139 | |||
| 3898 | 2936056377 | |||
| 3899 | 2940558341 | |||
| 3900 | 2941535453 | |||
| 3901 | 2941543265 | |||
| 3902 | 3005489008 | |||
| 3903 | 3005509102 | |||
| 3904 | 3005591579 | |||
| 3905 | 3005595118 | |||
| 3906 | 3005711057 | |||
| 3907 | 3005718365 | |||
| 3908 | 8001845898 | |||
| 3909 | 8006967510 | |||
| 3910 | 8006990975 | |||
| 3911 | 8007000310 | |||
| 3912 | 8016518120 | |||
| 3913 | 8016544130 | |||
| 3914 | 8016549179 | |||
| 3915 | 8016557604 | |||
| 3916 | 8016569533 | |||
| 3917 | 8016582143 | |||
| 3918 | 8016586298 | |||
| 3919 | 8016606492 | |||
| 3920 | 8016618393 | |||
| 3921 | 8016623040 | |||
| 3922 | 8017058524 | |||
| 3923 | 8019531103 | |||
| 3924 | 8019540452 | |||
| 3925 | 8019550043 | |||
| 3926 | 8019577167 | |||
| 3927 | 8019595241 | |||
| 3928 | 8019612012 | |||
| 3929 | 8019623034 | |||
| 3930 | 8019630065 | |||
| 3931 | 8019640544 | |||
| 3932 | 8019652403 | |||
| 3933 | 8019676661 | |||
| 3934 | 8019679332 | |||
| 3935 | 8019696177 | |||
| 3936 | 8055742513 | |||
| 3937 | 8056691016 | |||
| 3938 | 8056971351 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4wq5-assembly1.cif.gz_A | ygjd(v85e)-yeaz heterodimer in complex with atp | 0.9449 | 1 | 341 |
| 4wq5-assembly1.cif.gz_A | ygjd(v85e)-yeaz heterodimer in complex with atp | 0.9421 | 1 | 341 |
| 4ydu-assembly1.cif.gz_A | crystal structure of e. coli ygjd-yeaz heterodimer in complex with adp | 0.9394 | 1 | 342 |
| 4wq4-assembly2.cif.gz_B | e. coli ygjd(e12a)-yeaz heterodimer in complex with atp | 0.9386 | 1 | 342 |
| 3zeu-assembly2.cif.gz_B | structure of a salmonella typhimurium ygjd-yeaz heterodimer bound to atpgammas | 0.937 | 1 | 342 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2FWL2_8_131_3.30.420.40 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain | 0.9579 | 6 | 131 | 3.30.420.40 |
| af_O94710_43_179_3.30.420.40 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain | 0.9495 | 6 | 133 | 3.30.420.40 |
| af_Q32LQ3_26_143_3.30.420.40 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain | 0.9478 | 3 | 122 | 3.30.420.40 |
| 3zeuB02 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain | 0.9451 | 132 | 301 | 3.30.420.40 |
| af_A0A1D6MRI9_77_194_3.30.420.40 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain | 0.9432 | 4 | 124 | 3.30.420.40 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A537TKF1-F1-model_v4 | N(6)-L-threonylcarbamoyladenine synthase (EC 2.3.1.234) | 0.9955 | 108 | 340 |
GO:0008033
GO:0046872 GO:0061711 |
| AF-B1Z700-F1-model_v4 | tRNA N6-adenosine threonylcarbamoyltransferase (EC 2.3.1.234) (N6-L-threonylcarbamoyladenine synthase) (t(6)A synthase) (t(6)A37 threonylcarbamoyladenosine biosynthesis protein TsaD) (tRNA threonylcarbamoyladenosine biosynthesis protein TsaD) | 0.9857 | 1 | 342 |
GO:0002949
GO:0005506 GO:0005737 GO:0061711 |
| AF-A0A534P8N4-F1-model_v4 | N(6)-L-threonylcarbamoyladenine synthase (EC 2.3.1.234) | 0.9851 | 1 | 113 |
GO:0008033
GO:0046872 GO:0061711 |
| AF-A0A529W6E4-F1-model_v4 | N(6)-L-threonylcarbamoyladenine synthase (EC 2.3.1.234) | 0.9841 | 1 | 101 |
GO:0008033
GO:0046872 GO:0061711 |
| AF-A0A849TMG7-F1-model_v4 | N(6)-L-threonylcarbamoyladenine synthase (EC 2.3.1.234) | 0.9835 | 1 | 265 |
GO:0002949
GO:0016746 GO:0046872 |