F496050

General Info

Members Datasets Scaffolds Average Seq Length
1915 648 1879 108

Family's Representative Sequence

Representative Sequence 3300041451|Ga0451791_0599775|Ga0451791_0599775_95_496
Length 133
Sequence MIGGDRLSRQVTGQSSAKARFPGICMPRFTIHDLAETIDARAAAGGEASYTRKLLDKGAEHCAKKFGEEAVETVIAAVENDRAHLIAEGADLLYHFLVLLKARGVKLEEVEAALDKRTNMSGLEEKASRKGGS

Samples

Sample ID Description Type Environment
1 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
2 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
3 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
4 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
5 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
6 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
7 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
8 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
9 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
10 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
11 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
12 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
13 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
14 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
15 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
16 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
17 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
18 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
19 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
20 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
21 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
22 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
23 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
24 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
25 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
26 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
27 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
28 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
29 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
30 3300000531 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNB_Illumina_Assembled Metagenome Rhizosphere
31 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
32 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
33 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
34 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
35 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
36 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
37 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
38 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
39 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
40 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
41 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
42 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
43 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
44 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
45 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
46 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
47 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
48 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
49 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
50 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
51 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
52 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
53 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
54 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
55 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
56 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
57 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
58 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
59 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
60 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
61 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
62 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
63 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
64 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
65 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
66 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
67 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
68 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
69 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
70 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
71 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
72 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
73 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
74 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
75 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
76 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
77 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
78 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
79 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
80 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
81 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
82 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
83 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
84 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
85 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
86 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
87 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
88 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
89 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
90 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
91 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
92 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
93 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
94 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
95 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
96 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
97 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
98 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
99 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
100 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
101 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
102 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
103 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
104 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
105 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
106 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
107 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
108 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
109 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
110 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
111 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
112 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
113 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
114 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
115 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
116 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
117 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
118 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
119 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
120 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
121 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
122 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
123 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
124 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
125 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
126 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
127 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
128 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
129 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
130 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
131 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
132 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
133 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
134 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
135 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
136 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
137 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
138 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
139 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
140 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
141 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
142 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
143 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
144 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
145 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
146 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
147 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
148 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
149 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
150 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
151 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
152 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
153 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
154 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
155 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
156 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
157 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
158 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
159 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
160 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
161 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
162 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
163 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
164 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
165 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
166 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
167 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
168 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
169 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
170 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
171 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
172 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
173 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
174 3300012503 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R Metagenome Rhizosphere
175 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
176 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
177 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
178 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
179 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
180 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
181 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
182 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
183 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
184 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
185 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
186 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
187 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
188 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
189 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
190 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
191 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
192 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
193 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
194 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
195 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
196 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
197 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
198 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
199 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
200 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
201 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
202 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
203 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
204 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
205 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
206 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
207 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
208 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
209 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
210 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
211 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
212 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
213 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
214 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
215 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
248 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
249 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
250 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
251 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
252 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
253 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
254 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
255 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
256 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
257 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
258 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
259 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
260 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
261 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
262 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
263 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
264 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
265 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
266 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
267 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
268 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
269 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
270 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
271 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
272 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
273 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
274 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
275 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
276 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
277 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
278 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
279 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
280 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
281 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
282 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
283 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
284 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
285 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
286 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
287 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
288 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
289 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
290 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
291 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
292 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
293 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
294 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
295 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
296 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
297 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
298 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
299 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
300 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
301 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
302 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
303 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
304 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
305 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
306 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
307 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
308 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
309 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
310 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
311 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
312 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
313 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
314 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
315 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
316 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
317 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
318 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
319 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
320 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
321 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
322 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
323 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
324 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
325 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
326 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
327 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
328 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
329 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
330 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
331 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
332 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
333 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
334 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
335 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
336 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
337 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
338 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
339 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
340 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
341 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
342 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
343 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
344 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
345 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
346 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
347 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
348 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
349 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
350 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
351 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
352 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
353 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
354 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
355 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
356 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
357 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
358 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
359 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
360 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
361 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
362 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
363 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
364 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
365 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
366 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
367 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
368 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
369 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
370 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
371 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
372 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
373 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
374 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
375 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
376 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
377 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
378 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
379 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
380 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
381 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
382 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
383 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
384 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
385 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
386 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
387 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
388 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
389 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
390 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
391 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
392 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
393 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
394 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
395 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
396 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
397 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
398 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
399 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
400 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
401 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
402 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
403 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
404 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
405 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
406 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
407 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
408 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
409 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
410 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
411 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
412 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
413 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
414 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
415 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
416 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
417 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
418 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
419 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
420 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
421 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
422 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
423 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
424 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
425 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
426 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
427 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
428 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
429 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
430 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
431 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
432 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
433 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
434 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
435 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
436 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
437 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
438 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
439 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
440 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
441 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
442 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
443 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
444 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
445 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
446 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
447 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
448 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
449 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
450 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
451 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
452 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
453 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
454 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
455 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
456 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
457 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
458 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
459 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
460 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
461 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
462 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
463 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
464 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
465 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
466 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
467 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
468 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
469 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
470 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
471 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
472 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
473 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
474 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
475 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
476 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
477 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
478 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
479 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
480 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
481 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
482 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
483 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
484 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
485 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
486 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
487 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
488 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
489 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
490 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
491 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
492 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
493 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
494 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
495 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
496 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
497 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
498 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
499 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
500 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
501 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
502 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
503 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
504 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
505 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
506 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
507 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
508 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
509 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
510 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
511 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
512 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
513 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
514 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
515 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
516 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
517 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
518 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
519 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
520 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
521 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
522 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
523 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
524 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
525 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
526 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
527 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
528 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
529 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
530 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
531 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
532 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
533 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
534 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
535 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
536 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
537 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
538 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
539 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
540 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
541 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
542 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
543 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
544 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
545 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
546 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
547 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
548 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
549 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
550 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
551 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
552 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
553 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
554 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
555 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
556 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
557 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
558 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
559 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
560 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
561 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
562 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
563 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
564 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
565 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
566 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
567 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
568 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
569 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
570 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
571 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
572 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
573 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
574 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
575 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
576 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
577 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
578 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
579 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
580 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
581 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
582 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
583 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
584 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
585 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
586 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
587 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
588 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
589 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
590 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
591 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
592 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
593 3300053097 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere Metagenome Endosphere
594 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
595 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
596 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
597 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
598 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
599 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
600 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
601 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
602 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
603 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
604 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
605 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
606 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
607 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
608 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
609 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
610 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
611 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
612 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
613 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
614 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
615 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
616 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
617 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
618 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
619 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
620 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
621 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
622 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
623 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
624 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
625 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
626 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
627 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
628 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
629 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
630 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
631 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
632 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
633 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
634 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
635 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
636 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
637 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
638 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
639 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
640 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
641 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
642 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
643 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
644 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
645 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
646 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
647 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
648 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.86
Metatranscriptomes 0.26
Isolates 1.88

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.17
Nodule 2.56
Rhizoplane 6.01
Rhizosphere 75.04
Stem 0
Stem Tuber 0
Unclassified 5.22

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 CNBas_1002966 3300000531 Bacteria 940
2 CNAas_1012198 3300000532 Bacteria 587
3 JGI24736J21556_1024079 3300001904 Bacteria 950
4 JGI24739J22299_10117614 3300001989 Bacteria 795
5 JGI24739J22299_10264068 3300001989 Bacteria 504
6 JGI24737J22298_10187533 3300001990 Bacteria 610
7 JGI24737J22298_10211218 3300001990 Bacteria 573
8 JGI24735J21928_10063713 3300002067 Bacteria 1058
9 JGI24750J21931_1013141 3300002070 Bacteria 1104
10 JGI24748J21848_1032288 3300002074 Bacteria 650
11 JGI24744J21845_10036124 3300002077 Bacteria 933
12 JGI24033J26618_1047418 3300002155 Bacteria 611
13 JGI24742J22300_10021885 3300002244 Bacteria 1094
14 JGI25153J46596_10000221 3300003215 Bacteria 49033
15 JGI25153J46596_10001035 3300003215 Bacteria 16956
16 JGI25153J46596_10005832 3300003215 Bacteria 6399
17 JGI25153J46596_10019717 3300003215 Bacteria 2573
18 JGI25153J46596_10054684 3300003215 Bacteria 1122
19 JGI25160J50197_1001121 3300003354 Bacteria 13681
20 JGI25160J50197_1006536 3300003354 Bacteria 4703
21 JGI25160J50197_1018359 3300003354 Bacteria 2184
22 JGI25404J52841_10009687 3300003659 Bacteria 2063
23 JGI25404J52841_10109270 3300003659 Bacteria 581
24 Ga0055539_1014059 3300003752 Bacteria 978
25 Ga0055542_1015953 3300003762 Bacteria 1194
26 Ga0055526_1031307 3300003771 Bacteria 1528
27 Ga0055524_1024613 3300003775 Bacteria 1904
28 Ga0055531_10016379 3300003794 Bacteria 3200
29 Ga0055543_1007248 3300004625 Bacteria 2585
30 Ga0058861_11389720 3300004800 Bacteria 510
31 Ga0065165_1001316 3300005262 Bacteria 27718
32 Ga0065165_1003932 3300005262 Bacteria 9781
33 Ga0065165_1026366 3300005262 Bacteria 1913
34 Ga0065165_1027065 3300005262 Bacteria 1875
35 Ga0065707_10035201 3300005295 Bacteria 1209
36 Ga0070658_10246411 3300005327 Bacteria 1515
37 Ga0070658_10253980 3300005327 Bacteria 1492
38 Ga0070658_10396160 3300005327 Bacteria 1186
39 Ga0070658_10426702 3300005327 Bacteria 1141
40 Ga0070676_10165502 3300005328 Bacteria 1426
41 Ga0070676_10565386 3300005328 Bacteria 816
42 Ga0070676_10825100 3300005328 Bacteria 686
43 Ga0070683_100012115 3300005329 Bacteria 7484
44 Ga0070683_100032899 3300005329 Bacteria 4726
45 Ga0070683_100296902 3300005329 Bacteria 1537
46 Ga0070683_101332988 3300005329 Bacteria 690
47 Ga0070690_100107265 3300005330 Bacteria 1859
48 Ga0070690_100200909 3300005330 Bacteria 1387
49 Ga0070690_100659830 3300005330 Bacteria 800
50 Ga0070670_100124293 3300005331 Bacteria 2227
51 Ga0070677_10125740 3300005333 Bacteria 1164
52 Ga0068869_100200481 3300005334 Bacteria 1573
53 Ga0068869_100654083 3300005334 Bacteria 892
54 Ga0068869_100779365 3300005334 Bacteria 820
55 Ga0068869_101312554 3300005334 Bacteria 638
56 Ga0068869_101679646 3300005334 Bacteria 566
57 Ga0070666_10084658 3300005335 Bacteria 2171
58 Ga0070666_10224326 3300005335 Bacteria 1326
59 Ga0070666_10412595 3300005335 Bacteria 972
60 Ga0070666_10938083 3300005335 Bacteria 641
61 Ga0070680_100021893 3300005336 Bacteria 5085
62 Ga0070680_100041333 3300005336 Bacteria 3738
63 Ga0070680_100061088 3300005336 Bacteria 3085
64 Ga0070680_100081735 3300005336 Bacteria 2666
65 Ga0070680_100081948 3300005336 Bacteria 2662
66 Ga0070680_100397562 3300005336 Bacteria 1174
67 Ga0070680_101151084 3300005336 Bacteria 671
68 Ga0070680_101406289 3300005336 Bacteria 604
69 Ga0070682_100548039 3300005337 Bacteria 905
70 Ga0070682_100857770 3300005337 Bacteria 743
71 Ga0070682_101905023 3300005337 Bacteria 521
72 Ga0068868_100036523 3300005338 Bacteria 3803
73 Ga0068868_100112352 3300005338 Bacteria 2215
74 Ga0068868_100248452 3300005338 Bacteria 1497
75 Ga0068868_100521005 3300005338 Bacteria 1044
76 Ga0068868_100966144 3300005338 Bacteria 778
77 Ga0070660_100522676 3300005339 Bacteria 988
78 Ga0070660_100537287 3300005339 Bacteria 974
79 Ga0070660_100555828 3300005339 Bacteria 958
80 Ga0070660_100997233 3300005339 Bacteria 708
81 Ga0070689_101092291 3300005340 Bacteria 713
82 Ga0070691_10125712 3300005341 Bacteria 1295
83 Ga0070691_10501061 3300005341 Bacteria 702
84 Ga0070687_100559040 3300005343 Bacteria 780
85 Ga0070661_100407786 3300005344 Bacteria 1075
86 Ga0070661_100511131 3300005344 Bacteria 962
87 Ga0070661_100519782 3300005344 Bacteria 955
88 Ga0070661_100843811 3300005344 Bacteria 754
89 Ga0070692_10453986 3300005345 Bacteria 821
90 Ga0070692_10540729 3300005345 Bacteria 762
91 Ga0070692_10654704 3300005345 Bacteria 702
92 Ga0070668_100139683 3300005347 Bacteria 1951
93 Ga0070668_100181981 3300005347 Bacteria 1717
94 Ga0070668_100208285 3300005347 Bacteria 1607
95 Ga0070668_100234097 3300005347 Bacteria 1519
96 Ga0070668_100248638 3300005347 Bacteria 1475
97 Ga0070668_100654400 3300005347 Bacteria 923
98 Ga0070668_100921811 3300005347 Bacteria 782
99 Ga0070668_101721529 3300005347 Bacteria 576
100 Ga0070669_100162026 3300005353 Bacteria 1739
101 Ga0070669_100619312 3300005353 Bacteria 908
102 Ga0070669_100720093 3300005353 Bacteria 844
103 Ga0070675_100258468 3300005354 Bacteria 1525
104 Ga0070675_100306301 3300005354 Bacteria 1401
105 Ga0070675_101686990 3300005354 Bacteria 585
106 Ga0070671_100286033 3300005355 Bacteria 1403
107 Ga0070671_100325327 3300005355 Bacteria 1310
108 Ga0070671_100912382 3300005355 Bacteria 768
109 Ga0070671_101076625 3300005355 Bacteria 706
110 Ga0070671_101286845 3300005355 Bacteria 645
111 Ga0070671_101294891 3300005355 Bacteria 643
112 Ga0070674_100025078 3300005356 Bacteria 3877
113 Ga0070674_100053579 3300005356 Bacteria 2786
114 Ga0070674_101009521 3300005356 Bacteria 730
115 Ga0070674_101751632 3300005356 Bacteria 562
116 Ga0070673_100658993 3300005364 Bacteria 959
117 Ga0070673_102054431 3300005364 Bacteria 543
118 Ga0070688_100556269 3300005365 Bacteria 873
119 Ga0070688_100702043 3300005365 Bacteria 784
120 Ga0070659_100312812 3300005366 Bacteria 1312
121 Ga0070659_100349311 3300005366 Bacteria 1240
122 Ga0070659_101197785 3300005366 Bacteria 672
123 Ga0070659_101351673 3300005366 Bacteria 632
124 Ga0070667_100151700 3300005367 Bacteria 2036
125 Ga0070667_100379127 3300005367 Bacteria 1284
126 Ga0070667_101039530 3300005367 Bacteria 765
127 Ga0070667_102175287 3300005367 Bacteria 522
128 Ga0070703_10060921 3300005406 Bacteria 1235
129 Ga0070709_10001093 3300005434 Bacteria 14975
130 Ga0070709_10002047 3300005434 Bacteria 10949
131 Ga0070709_10060399 3300005434 Bacteria 2409
132 Ga0070709_10771506 3300005434 Bacteria 753
133 Ga0070714_100024145 3300005435 Bacteria 5000
134 Ga0070714_100151553 3300005435 Bacteria 2090
135 Ga0070714_100307662 3300005435 Bacteria 1479
136 Ga0070714_100480845 3300005435 Bacteria 1182
137 Ga0070714_101833280 3300005435 Bacteria 592
138 Ga0070713_100002424 3300005436 Bacteria 12160
139 Ga0070713_100010687 3300005436 Bacteria 6644
140 Ga0070713_100018563 3300005436 Bacteria 5286
141 Ga0070713_100289988 3300005436 Bacteria 1503
142 Ga0070713_102056293 3300005436 Bacteria 554
143 Ga0070713_102127381 3300005436 Bacteria 544
144 Ga0070710_10001602 3300005437 Bacteria 10681
145 Ga0070710_10027306 3300005437 Bacteria 3042
146 Ga0070710_10078656 3300005437 Bacteria 1919
147 Ga0070710_10738529 3300005437 Bacteria 698
148 Ga0070710_11171342 3300005437 Bacteria 567
149 Ga0070701_10127778 3300005438 Bacteria 1440
150 Ga0070711_100004532 3300005439 Bacteria 8215
151 Ga0070711_100027072 3300005439 Bacteria 3761
152 Ga0070711_100037077 3300005439 Bacteria 3270
153 Ga0070711_100243523 3300005439 Bacteria 1407
154 Ga0070711_100309990 3300005439 Bacteria 1258
155 Ga0070705_100180782 3300005440 Bacteria 1428
156 Ga0070700_100204092 3300005441 Bacteria 1390
157 Ga0070700_100309410 3300005441 Bacteria 1156
158 Ga0070694_100292553 3300005444 Bacteria 1245
159 Ga0070694_101740893 3300005444 Bacteria 530
160 Ga0070708_100985474 3300005445 Bacteria 790
161 Ga0070708_102220742 3300005445 Bacteria 507
162 Ga0070663_100026919 3300005455 Bacteria 3900
163 Ga0070663_100041057 3300005455 Bacteria 3242
164 Ga0070663_100129420 3300005455 Bacteria 1915
165 Ga0070663_100210427 3300005455 Bacteria 1522
166 Ga0070663_100229402 3300005455 Bacteria 1461
167 Ga0070663_100296680 3300005455 Bacteria 1292
168 Ga0070663_100532632 3300005455 Bacteria 979
169 Ga0070663_100677573 3300005455 Bacteria 874
170 Ga0070678_100102458 3300005456 Bacteria 2221
171 Ga0070678_100273513 3300005456 Bacteria 1425
172 Ga0070678_100371813 3300005456 Bacteria 1234
173 Ga0070678_100774182 3300005456 Bacteria 869
174 Ga0070662_100532736 3300005457 Bacteria 982
175 Ga0070662_100604614 3300005457 Bacteria 922
176 Ga0070662_100838270 3300005457 Bacteria 782
177 Ga0070662_101119770 3300005457 Bacteria 676
178 Ga0070681_10006927 3300005458 Bacteria 11037
179 Ga0070681_10039716 3300005458 Bacteria 4716
180 Ga0070681_10292228 3300005458 Bacteria 1540
181 Ga0070681_10419257 3300005458 Bacteria 1250
182 Ga0068867_100150313 3300005459 Bacteria 1828
183 Ga0068867_100486950 3300005459 Bacteria 1058
184 Ga0068867_100555072 3300005459 Bacteria 995
185 Ga0068867_101318992 3300005459 Bacteria 667
186 Ga0068867_101712036 3300005459 Bacteria 590
187 Ga0068867_101755964 3300005459 Bacteria 583
188 Ga0068867_102382347 3300005459 Bacteria 504
189 Ga0070685_10113689 3300005466 Bacteria 1672
190 Ga0070706_100394146 3300005467 Bacteria 1289
191 Ga0070706_100497850 3300005467 Bacteria 1134
192 Ga0070706_101366872 3300005467 Bacteria 649
193 Ga0070706_101777937 3300005467 Bacteria 560
194 Ga0070699_100092503 3300005518 Bacteria 2645
195 Ga0070679_100024870 3300005530 Bacteria 5869
196 Ga0070679_100039539 3300005530 Bacteria 4687
197 Ga0070679_100043536 3300005530 Bacteria 4471
198 Ga0070679_100065012 3300005530 Bacteria 3636
199 Ga0070684_100030415 3300005535 Bacteria 4587
200 Ga0070684_100078765 3300005535 Bacteria 2912
201 Ga0070684_100666325 3300005535 Bacteria 969
202 Ga0070684_101038211 3300005535 Bacteria 770
203 Ga0070684_101359640 3300005535 Bacteria 669
204 Ga0070697_100334614 3300005536 Bacteria 1306
205 Ga0070697_100337494 3300005536 Bacteria 1300
206 Ga0068853_100143372 3300005539 Bacteria 2145
207 Ga0068853_100354768 3300005539 Bacteria 1365
208 Ga0068853_100520442 3300005539 Bacteria 1124
209 Ga0068853_100709847 3300005539 Bacteria 959
210 Ga0068853_100888270 3300005539 Bacteria 856
211 Ga0068853_101410841 3300005539 Bacteria 674
212 Ga0070672_100111128 3300005543 Bacteria 2233
213 Ga0070672_100118941 3300005543 Bacteria 2161
214 Ga0070672_100201667 3300005543 Bacteria 1664
215 Ga0070672_100795956 3300005543 Bacteria 832
216 Ga0070686_100131755 3300005544 Bacteria 1730
217 Ga0070686_100871560 3300005544 Bacteria 730
218 Ga0070696_100329256 3300005546 Bacteria 1177
219 Ga0070693_100079188 3300005547 Bacteria 1955
220 Ga0070693_100243608 3300005547 Bacteria 1189
221 Ga0070693_100498195 3300005547 Bacteria 864
222 Ga0070693_100512522 3300005547 Bacteria 853
223 Ga0070665_100009471 3300005548 Bacteria 9855
224 Ga0070665_100061030 3300005548 Bacteria 3779
225 Ga0070665_100104790 3300005548 Bacteria 2830
226 Ga0070665_100110787 3300005548 Bacteria 2747
227 Ga0070665_100227219 3300005548 Bacteria 1866
228 Ga0070665_100315093 3300005548 Bacteria 1568
229 Ga0070665_100547230 3300005548 Bacteria 1170
230 Ga0070665_100622349 3300005548 Bacteria 1093
231 Ga0070665_100944618 3300005548 Bacteria 875
232 Ga0070665_101927303 3300005548 Bacteria 597
233 Ga0070704_100269665 3300005549 Bacteria 1406
234 Ga0070704_102158983 3300005549 Bacteria 518
235 Ga0068855_100084885 3300005563 Bacteria 3664
236 Ga0068855_100151304 3300005563 Bacteria 2638
237 Ga0068855_100161333 3300005563 Bacteria 2544
238 Ga0068855_100427183 3300005563 Bacteria 1448
239 Ga0068855_100792747 3300005563 Bacteria 1007
240 Ga0068855_101198613 3300005563 Bacteria 790
241 Ga0070664_100155773 3300005564 Bacteria 2019
242 Ga0070664_100192653 3300005564 Bacteria 1817
243 Ga0070664_100976107 3300005564 Bacteria 796
244 Ga0068857_100096869 3300005577 Bacteria 2644
245 Ga0068857_100522431 3300005577 Bacteria 1116
246 Ga0068854_100472931 3300005578 Bacteria 1051
247 Ga0068854_100543199 3300005578 Bacteria 984
248 Ga0068854_100728123 3300005578 Bacteria 858
249 Ga0068854_100968116 3300005578 Bacteria 752
250 Ga0068856_100006298 3300005614 Bacteria 11641
251 Ga0068856_100199112 3300005614 Bacteria 2017
252 Ga0068856_100308614 3300005614 Bacteria 1600
253 Ga0068856_100560752 3300005614 Bacteria 1163
254 Ga0068856_100596687 3300005614 Bacteria 1125
255 Ga0068856_100693739 3300005614 Bacteria 1038
256 Ga0068856_101028802 3300005614 Bacteria 842
257 Ga0068856_101224351 3300005614 Bacteria 767
258 Ga0068856_101851719 3300005614 Bacteria 615
259 Ga0070702_100135495 3300005615 Bacteria 1562
260 Ga0070702_100194365 3300005615 Bacteria 1338
261 Ga0070702_100446817 3300005615 Bacteria 937
262 Ga0070702_101315052 3300005615 Bacteria 587
263 Ga0068852_100059448 3300005616 Bacteria 3314
264 Ga0068852_100060314 3300005616 Bacteria 3293
265 Ga0068852_100169060 3300005616 Bacteria 2048
266 Ga0068852_100357009 3300005616 Bacteria 1429
267 Ga0068852_100578541 3300005616 Bacteria 1126
268 Ga0068852_101478324 3300005616 Bacteria 702
269 Ga0068852_102004022 3300005616 Bacteria 601
270 Ga0068852_102534216 3300005616 Bacteria 533
271 Ga0068852_102631012 3300005616 Bacteria 523
272 Ga0068859_100273826 3300005617 Bacteria 1780
273 Ga0068859_100427224 3300005617 Bacteria 1421
274 Ga0068859_101634509 3300005617 Bacteria 711
275 Ga0068859_101793874 3300005617 Bacteria 678
276 Ga0068859_102836019 3300005617 Bacteria 532
277 Ga0068866_10010313 3300005718 Bacteria 4001
278 Ga0068866_10083946 3300005718 Bacteria 1718
279 Ga0068861_100046609 3300005719 Bacteria 3268
280 Ga0068861_100340921 3300005719 Bacteria 1312
281 Ga0068861_100410806 3300005719 Bacteria 1204
282 Ga0068861_100839046 3300005719 Bacteria 865
283 Ga0068861_101135696 3300005719 Bacteria 752
284 Ga0068861_102423037 3300005719 Bacteria 528
285 Ga0068851_10292949 3300005834 Bacteria 934
286 Ga0068851_10645094 3300005834 Bacteria 648
287 Ga0068851_11019605 3300005834 Bacteria 523
288 Ga0068870_10069899 3300005840 Bacteria 1911
289 Ga0068870_10277824 3300005840 Bacteria 1049
290 Ga0068870_10499468 3300005840 Bacteria 811
291 Ga0068870_11143007 3300005840 Bacteria 561
292 Ga0068863_100346564 3300005841 Bacteria 1446
293 Ga0068863_100563547 3300005841 Bacteria 1125
294 Ga0068863_100762772 3300005841 Bacteria 964
295 Ga0068863_101209785 3300005841 Bacteria 761
296 Ga0068863_101929299 3300005841 Bacteria 601
297 Ga0068858_100051837 3300005842 Bacteria 3796
298 Ga0068858_100157005 3300005842 Bacteria 2140
299 Ga0068858_100547893 3300005842 Bacteria 1120
300 Ga0068858_100563276 3300005842 Bacteria 1103
301 Ga0068858_100570231 3300005842 Bacteria 1096
302 Ga0068858_100611555 3300005842 Bacteria 1058
303 Ga0068858_102225217 3300005842 Bacteria 542
304 Ga0068860_100582875 3300005843 Bacteria 1123
305 Ga0068860_100606364 3300005843 Bacteria 1100
306 Ga0068860_100888958 3300005843 Bacteria 907
307 Ga0068860_101344306 3300005843 Bacteria 735
308 Ga0068862_100358579 3300005844 Bacteria 1354
309 Ga0068862_100372674 3300005844 Bacteria 1329
310 Ga0068862_100887281 3300005844 Bacteria 876
311 Ga0068862_101274493 3300005844 Bacteria 735
312 Ga0068862_102096722 3300005844 Bacteria 576
313 Ga0081455_10034429 3300005937 Bacteria 4537
314 Ga0081455_10117581 3300005937 Bacteria 2101
315 Ga0081455_10159746 3300005937 Bacteria 1729
316 Ga0081540_1003522 3300005983 Bacteria 12352
317 Ga0081540_1015783 3300005983 Bacteria 4764
318 Ga0081540_1026167 3300005983 Bacteria 3337
319 Ga0081540_1038652 3300005983 Bacteria 2513
320 Ga0081540_1062218 3300005983 Bacteria 1774
321 Ga0081540_1076436 3300005983 Bacteria 1526
322 Ga0081539_10000064 3300005985 Bacteria 247020
323 Ga0081539_10163800 3300005985 Bacteria 1057
324 Ga0070717_10000598 3300006028 Bacteria 23163
325 Ga0070717_10092551 3300006028 Bacteria 2554
326 Ga0070717_10389258 3300006028 Bacteria 1251
327 Ga0070717_10812284 3300006028 Bacteria 851
328 Ga0070717_11811540 3300006028 Bacteria 551
329 Ga0070717_12090698 3300006028 Bacteria 510
330 Ga0075365_10018847 3300006038 Bacteria 4251
331 Ga0075365_10038824 3300006038 Bacteria 3097
332 Ga0075365_10059779 3300006038 Bacteria 2541
333 Ga0075365_10127145 3300006038 Bacteria 1762
334 Ga0075365_10164646 3300006038 Bacteria 1546
335 Ga0075365_10297590 3300006038 Bacteria 1135
336 Ga0075365_10336643 3300006038 Bacteria 1063
337 Ga0075365_10362132 3300006038 Bacteria 1022
338 Ga0075365_10440310 3300006038 Bacteria 920
339 Ga0075365_10457444 3300006038 Bacteria 901
340 Ga0075368_10005988 3300006042 Bacteria 4217
341 Ga0075368_10035463 3300006042 Bacteria 1946
342 Ga0075368_10086560 3300006042 Bacteria 1278
343 Ga0075363_100008692 3300006048 Bacteria 4741
344 Ga0075363_100062743 3300006048 Bacteria 2004
345 Ga0075363_100172112 3300006048 Bacteria 1229
346 Ga0075363_100181568 3300006048 Bacteria 1198
347 Ga0075363_100244375 3300006048 Bacteria 1032
348 Ga0075363_100327703 3300006048 Bacteria 892
349 Ga0075363_100959129 3300006048 Bacteria 526
350 Ga0075364_10063799 3300006051 Bacteria 2419
351 Ga0075364_10082468 3300006051 Bacteria 2127
352 Ga0075364_10342037 3300006051 Bacteria 1019
353 Ga0075364_10371854 3300006051 Bacteria 975
354 Ga0075364_10376258 3300006051 Bacteria 969
355 Ga0075364_11029814 3300006051 Bacteria 559
356 Ga0075432_10080219 3300006058 Bacteria 1182
357 Ga0070715_10189700 3300006163 Bacteria 1037
358 Ga0070715_10466877 3300006163 Bacteria 716
359 Ga0070716_100015382 3300006173 Bacteria 3930
360 Ga0070716_100055301 3300006173 Bacteria 2270
361 Ga0070716_100144586 3300006173 Bacteria 1522
362 Ga0070716_100194933 3300006173 Bacteria 1342
363 Ga0070716_100534751 3300006173 Bacteria 871
364 Ga0070716_100600582 3300006173 Bacteria 828
365 Ga0070716_101409677 3300006173 Bacteria 567
366 Ga0070712_100011023 3300006175 Bacteria 5720
367 Ga0070712_100011606 3300006175 Bacteria 5594
368 Ga0070712_100288624 3300006175 Bacteria 1324
369 Ga0070712_100596040 3300006175 Bacteria 935
370 Ga0070712_100676877 3300006175 Bacteria 878
371 Ga0070712_100845688 3300006175 Bacteria 787
372 Ga0070712_101320167 3300006175 Bacteria 629
373 Ga0075362_10016658 3300006177 Bacteria 3013
374 Ga0075362_10073954 3300006177 Bacteria 1561
375 Ga0075362_10102185 3300006177 Bacteria 1341
376 Ga0075367_10003520 3300006178 Bacteria 7484
377 Ga0075367_10209804 3300006178 Bacteria 1218
378 Ga0075367_10428611 3300006178 Bacteria 838
379 Ga0075367_10609901 3300006178 Bacteria 694
380 Ga0075367_10703509 3300006178 Bacteria 643
381 Ga0075367_10896376 3300006178 Bacteria 565
382 Ga0075367_11054276 3300006178 Bacteria 519
383 Ga0075369_10022631 3300006186 Bacteria 2593
384 Ga0075369_10080701 3300006186 Bacteria 1442
385 Ga0075369_10095534 3300006186 Bacteria 1330
386 Ga0075369_10359588 3300006186 Bacteria 684
387 Ga0075427_10031592 3300006194 Bacteria 871
388 Ga0075366_10617034 3300006195 Bacteria 672
389 Ga0097621_100094751 3300006237 Bacteria 2503
390 Ga0097621_100315530 3300006237 Bacteria 1383
391 Ga0097621_100598404 3300006237 Bacteria 1007
392 Ga0097621_100677390 3300006237 Bacteria 948
393 Ga0097621_100748445 3300006237 Bacteria 902
394 Ga0097621_100766937 3300006237 Bacteria 892
395 Ga0097621_101293616 3300006237 Bacteria 688
396 Ga0075370_10028691 3300006353 Bacteria 3094
397 Ga0075370_10031153 3300006353 Bacteria 2977
398 Ga0075370_10050918 3300006353 Bacteria 2349
399 Ga0075370_10083074 3300006353 Bacteria 1842
400 Ga0075370_10117513 3300006353 Bacteria 1546
401 Ga0075370_10465037 3300006353 Bacteria 762
402 Ga0068871_100103747 3300006358 Bacteria 2384
403 Ga0068871_100229322 3300006358 Bacteria 1611
404 Ga0068871_100283556 3300006358 Bacteria 1450
405 Ga0068871_100510926 3300006358 Bacteria 1084
406 Ga0068871_100930402 3300006358 Bacteria 807
407 Ga0068871_101555569 3300006358 Bacteria 626
408 Ga0068871_101756820 3300006358 Bacteria 589
409 Ga0075428_100387766 3300006844 Bacteria 1498
410 Ga0075431_100613538 3300006847 Bacteria 1071
411 Ga0075434_100221135 3300006871 Bacteria 1913
412 Ga0075429_101113024 3300006880 Bacteria 690
413 Ga0068865_100054460 3300006881 Bacteria 2779
414 Ga0068865_100139983 3300006881 Bacteria 1823
415 Ga0068865_100180156 3300006881 Bacteria 1627
416 Ga0068865_101599471 3300006881 Bacteria 586
417 Ga0097620_100273821 3300006931 Bacteria 1780
418 Ga0097620_100427214 3300006931 Bacteria 1421
419 Ga0097620_101634494 3300006931 Bacteria 711
420 Ga0097620_101793827 3300006931 Bacteria 678
421 Ga0097620_102836044 3300006931 Bacteria 532
422 Ga0099825_1022298 3300006941 Bacteria 4118
423 Ga0099824_1014421 3300006942 Bacteria 7852
424 Ga0099823_1062190 3300006944 Bacteria 1901
425 Ga0075435_100232695 3300007076 Bacteria 1566
426 Ga0099794_10024762 3300007265 Bacteria 2758
427 Ga0099794_10142889 3300007265 Bacteria 1213
428 Ga0099795_10225683 3300007788 Bacteria 799
429 Ga0105251_10180686 3300009011 Bacteria 950
430 Ga0105250_10379175 3300009092 Bacteria 624
431 Ga0105240_10003692 3300009093 Bacteria 23676
432 Ga0105240_10058527 3300009093 Bacteria 4811
433 Ga0105240_10087222 3300009093 Bacteria 3822
434 Ga0105240_10090957 3300009093 Bacteria 3729
435 Ga0105240_10365822 3300009093 Bacteria 1632
436 Ga0105240_10626454 3300009093 Bacteria 1181
437 Ga0105240_11155329 3300009093 Bacteria 822
438 Ga0105240_11701939 3300009093 Bacteria 658
439 Ga0111539_10092530 3300009094 Bacteria 3553
440 Ga0111539_12001641 3300009094 Bacteria 672
441 Ga0105245_10290939 3300009098 Bacteria 1600
442 Ga0105245_10405656 3300009098 Bacteria 1363
443 Ga0105245_11178370 3300009098 Bacteria 814
444 Ga0105245_11777134 3300009098 Bacteria 669
445 Ga0105247_10020747 3300009101 Bacteria 3950
446 Ga0105247_10030704 3300009101 Bacteria 3258
447 Ga0105247_10100668 3300009101 Bacteria 1847
448 Ga0105247_10109440 3300009101 Bacteria 1776
449 Ga0105247_10253408 3300009101 Bacteria 1204
450 Ga0105247_10322519 3300009101 Bacteria 1078
451 Ga0105247_10339320 3300009101 Bacteria 1053
452 Ga0105247_10430120 3300009101 Bacteria 947
453 Ga0105247_10629446 3300009101 Bacteria 799
454 Ga0114129_10108408 3300009147 Bacteria 3834
455 Ga0105243_10184518 3300009148 Bacteria 1817
456 Ga0105243_10232184 3300009148 Bacteria 1637
457 Ga0105243_10571136 3300009148 Bacteria 1084
458 Ga0105243_10707730 3300009148 Bacteria 982
459 Ga0105243_11271034 3300009148 Bacteria 752
460 Ga0105241_10031270 3300009174 Bacteria 3986
461 Ga0105241_10033880 3300009174 Bacteria 3836
462 Ga0105241_10112589 3300009174 Bacteria 2180
463 Ga0105241_10516550 3300009174 Bacteria 1067
464 Ga0105241_10698053 3300009174 Bacteria 926
465 Ga0105241_11065376 3300009174 Bacteria 759
466 Ga0105241_12124734 3300009174 Bacteria 555
467 Ga0105241_12291247 3300009174 Bacteria 537
468 Ga0105242_10532155 3300009176 Bacteria 1123
469 Ga0105242_11281200 3300009176 Bacteria 756
470 Ga0105242_11877341 3300009176 Bacteria 639
471 Ga0105248_10145224 3300009177 Bacteria 2677
472 Ga0105248_10248209 3300009177 Bacteria 2004
473 Ga0105248_10598505 3300009177 Bacteria 1244
474 Ga0105248_10845006 3300009177 Bacteria 1033
475 Ga0105248_11006317 3300009177 Bacteria 942
476 Ga0105248_11016606 3300009177 Bacteria 936
477 Ga0105248_11036085 3300009177 Bacteria 927
478 Ga0105248_12044874 3300009177 Bacteria 651
479 Ga0105248_13244400 3300009177 Bacteria 517
480 Ga0105237_10053702 3300009545 Bacteria 4041
481 Ga0105237_10084862 3300009545 Bacteria 3157
482 Ga0105237_10111989 3300009545 Bacteria 2721
483 Ga0105237_10346749 3300009545 Bacteria 1489
484 Ga0105237_10457355 3300009545 Bacteria 1282
485 Ga0105237_10491339 3300009545 Bacteria 1234
486 Ga0105237_11231811 3300009545 Bacteria 755
487 Ga0105237_11339260 3300009545 Bacteria 722
488 Ga0105237_11615516 3300009545 Bacteria 655
489 Ga0105237_12237135 3300009545 Bacteria 556
490 Ga0105238_10135855 3300009551 Bacteria 2436
491 Ga0105238_10300919 3300009551 Bacteria 1587
492 Ga0105238_10639389 3300009551 Bacteria 1073
493 Ga0105238_11073430 3300009551 Bacteria 827
494 Ga0105238_11414719 3300009551 Bacteria 723
495 Ga0105238_11456648 3300009551 Bacteria 713
496 Ga0105238_12243856 3300009551 Bacteria 581
497 Ga0105238_13080343 3300009551 Bacteria 500
498 Ga0105249_10115141 3300009553 Bacteria 2547
499 Ga0105249_10226215 3300009553 Bacteria 1843
500 Ga0105249_10270035 3300009553 Bacteria 1694
501 Ga0105249_10809798 3300009553 Bacteria 1001
502 Ga0105249_10873525 3300009553 Bacteria 965
503 Ga0105249_11224580 3300009553 Bacteria 822
504 Ga0105249_12346085 3300009553 Bacteria 606
505 Ga0105249_12360421 3300009553 Bacteria 604
506 Ga0099796_10056805 3300010159 Bacteria 1375
507 Ga0099796_10080013 3300010159 Bacteria 1197
508 Ga0099796_10354148 3300010159 Bacteria 634
509 Ga0105239_10076115 3300010375 Bacteria 3691
510 Ga0105239_10102005 3300010375 Bacteria 3175
511 Ga0105239_10226124 3300010375 Bacteria 2099
512 Ga0105239_10337421 3300010375 Bacteria 1700
513 Ga0105239_10428279 3300010375 Bacteria 1499
514 Ga0105239_10545415 3300010375 Bacteria 1320
515 Ga0105239_10590534 3300010375 Bacteria 1266
516 Ga0105239_10597214 3300010375 Bacteria 1259
517 Ga0105239_11284783 3300010375 Bacteria 844
518 Ga0105239_11299329 3300010375 Bacteria 839
519 Ga0105239_11943433 3300010375 Bacteria 683
520 Ga0105239_13146151 3300010375 Bacteria 538
521 Ga0105239_13335206 3300010375 Bacteria 522
522 Ga0105246_10288315 3300011119 Bacteria 1320
523 Ga0105246_10403642 3300011119 Bacteria 1136
524 Ga0105246_12434565 3300011119 Bacteria 514
525 Ga0157347_1026172 3300012502 Bacteria 709
526 Ga0157313_1046659 3300012503 Bacteria 550
527 Ga0157339_1013252 3300012505 Bacteria 785
528 Ga0157338_1059926 3300012515 Bacteria 569
529 Ga0157373_10237798 3300013100 Bacteria 1287
530 Ga0157371_10553742 3300013102 Bacteria 853
531 Ga0157371_11627337 3300013102 Bacteria 506
532 Ga0157370_10036583 3300013104 Bacteria 4762
533 Ga0157370_10098672 3300013104 Bacteria 2739
534 Ga0157370_10164986 3300013104 Bacteria 2060
535 Ga0157370_10170456 3300013104 Bacteria 2023
536 Ga0157370_10187157 3300013104 Bacteria 1922
537 Ga0157369_10034718 3300013105 Bacteria 5532
538 Ga0157369_10093710 3300013105 Bacteria 3205
539 Ga0157369_10297386 3300013105 Bacteria 1680
540 Ga0157369_10360579 3300013105 Bacteria 1509
541 Ga0157369_10609221 3300013105 Bacteria 1127
542 Ga0157369_10817877 3300013105 Bacteria 957
543 Ga0157369_11166154 3300013105 Bacteria 787
544 Ga0157374_10102653 3300013296 Bacteria 2743
545 Ga0157374_11805196 3300013296 Bacteria 637
546 Ga0157378_10349381 3300013297 Bacteria 1444
547 Ga0157378_10464551 3300013297 Bacteria 1258
548 Ga0157378_10782600 3300013297 Bacteria 979
549 Ga0157378_10968806 3300013297 Bacteria 884
550 Ga0157378_11001641 3300013297 Bacteria 870
551 Ga0157378_12221626 3300013297 Bacteria 600
552 Ga0157378_13195340 3300013297 Bacteria 509
553 Ga0163162_10174053 3300013306 Bacteria 2277
554 Ga0163162_10200686 3300013306 Bacteria 2123
555 Ga0163162_10210594 3300013306 Bacteria 2073
556 Ga0163162_10241515 3300013306 Bacteria 1937
557 Ga0163162_10714482 3300013306 Bacteria 1123
558 Ga0163162_10726046 3300013306 Bacteria 1114
559 Ga0163162_10823205 3300013306 Bacteria 1045
560 Ga0157372_10023282 3300013307 Bacteria 6713
561 Ga0157372_10509028 3300013307 Bacteria 1404
562 Ga0157372_10541155 3300013307 Bacteria 1358
563 Ga0157372_10623162 3300013307 Bacteria 1257
564 Ga0157372_10660223 3300013307 Bacteria 1217
565 Ga0157372_11083085 3300013307 Bacteria 927
566 Ga0157372_11655499 3300013307 Bacteria 736
567 Ga0157372_12801460 3300013307 Bacteria 559
568 Ga0157372_13106545 3300013307 Bacteria 530
569 Ga0157375_10095723 3300013308 Bacteria 3041
570 Ga0157375_10862587 3300013308 Bacteria 1051
571 Ga0157375_10869363 3300013308 Bacteria 1047
572 Ga0157375_10889184 3300013308 Bacteria 1035
573 Ga0157375_11115695 3300013308 Bacteria 924
574 Ga0157375_11364718 3300013308 Bacteria 834
575 Ga0157375_11444242 3300013308 Bacteria 811
576 Ga0157375_11939042 3300013308 Bacteria 700
577 Ga0157375_12698116 3300013308 Bacteria 594
578 Ga0157375_13233837 3300013308 Bacteria 543
579 Ga0163163_10157293 3300014325 Bacteria 2317
580 Ga0163163_10219535 3300014325 Bacteria 1950
581 Ga0163163_10388031 3300014325 Bacteria 1454
582 Ga0163163_10525788 3300014325 Bacteria 1245
583 Ga0163163_11725131 3300014325 Bacteria 687
584 Ga0163163_12012870 3300014325 Bacteria 637
585 Ga0163163_12101265 3300014325 Bacteria 624
586 Ga0157380_10427641 3300014326 Bacteria 1265
587 Ga0157380_11144928 3300014326 Bacteria 819
588 Ga0157380_11996547 3300014326 Bacteria 642
589 Ga0157380_12964561 3300014326 Bacteria 541
590 Ga0182008_10414868 3300014497 Bacteria 726
591 Ga0157379_10567614 3300014968 Bacteria 1057
592 Ga0157379_10683597 3300014968 Bacteria 962
593 Ga0157379_11102596 3300014968 Bacteria 760
594 Ga0157379_11551560 3300014968 Bacteria 645
595 Ga0157376_10419054 3300014969 Bacteria 1299
596 Ga0157376_10591542 3300014969 Bacteria 1103
597 Ga0157376_10799245 3300014969 Bacteria 956
598 Ga0157376_11157845 3300014969 Bacteria 800
599 Ga0157376_11349308 3300014969 Bacteria 744
600 Ga0157376_11397067 3300014969 Bacteria 732
601 Ga0157376_12195994 3300014969 Bacteria 591
602 Ga0182006_1198702 3300015261 Bacteria 665
603 Ga0182006_1321656 3300015261 Bacteria 508
604 Ga0182007_10094334 3300015262 Bacteria 987
605 Ga0182005_1061529 3300015265 Bacteria 1025
606 Ga0163161_10067265 3300017792 Bacteria 2617
607 Ga0163161_10467363 3300017792 Bacteria 1022
608 Ga0163161_10557627 3300017792 Bacteria 940
609 Ga0163161_10643411 3300017792 Bacteria 878
610 Ga0163161_11133440 3300017792 Bacteria 674
611 Ga0197907_10298208 3300020069 Bacteria 500
612 Ga0154015_1048366 3300020610 Bacteria 536
613 Ga0214544_1000016 3300021320 Bacteria 204278
614 Ga0214542_1000016 3300021321 Bacteria 210332
615 Ga0214545_1000008 3300021324 Bacteria 215190
616 Ga0214543_1001466 3300021327 Bacteria 45567
617 Ga0213873_10084625 3300021358 Bacteria 893
618 Ga0213872_10044010 3300021361 Bacteria 2033
619 Ga0213872_10153672 3300021361 Bacteria 1004
620 Ga0213876_10209095 3300021384 Bacteria 1037
621 Ga0213871_10000804 3300021441 Bacteria 4686
622 Ga0224712_10587721 3300022467 Bacteria 543
623 Ga0209129_1054429 3300025258 Bacteria 604
624 Ga0209455_1016553 3300025272 Bacteria 1580
625 Ga0209673_1126882 3300025273 Bacteria 512
626 Ga0209564_1006362 3300025295 Bacteria 6400
627 Ga0209564_1016043 3300025295 Bacteria 3010
628 Ga0209758_1000069 3300025297 Bacteria 286161
629 Ga0209758_1000635 3300025297 Bacteria 53736
630 Ga0209758_1000695 3300025297 Bacteria 49852
631 Ga0209758_1003838 3300025297 Bacteria 13189
632 Ga0209758_1006620 3300025297 Bacteria 8210
633 Ga0209758_1008516 3300025297 Bacteria 6616
634 Ga0209758_1017132 3300025297 Bacteria 3631
635 Ga0209256_1010781 3300025299 Bacteria 3767
636 Ga0207426_1000826 3300025302 Bacteria 33158
637 Ga0207426_1002297 3300025302 Bacteria 12602
638 Ga0207426_1089432 3300025302 Bacteria 818
639 Ga0209051_1072799 3300025303 Bacteria 1026
640 Ga0209257_1000473 3300025304 Bacteria 73323
641 Ga0207697_10031792 3300025315 Bacteria 2159
642 Ga0207697_10200567 3300025315 Bacteria 878
643 Ga0207656_10201797 3300025321 Bacteria 961
644 Ga0207696_1065015 3300025711 Bacteria 1021
645 Ga0207682_10102602 3300025893 Bacteria 1252
646 Ga0207682_10599492 3300025893 Bacteria 519
647 Ga0207692_10028001 3300025898 Bacteria 2660
648 Ga0207692_10030050 3300025898 Bacteria 2588
649 Ga0207692_10068067 3300025898 Bacteria 1866
650 Ga0207692_10097486 3300025898 Bacteria 1607
651 Ga0207692_10817655 3300025898 Bacteria 610
652 Ga0207642_10148212 3300025899 Bacteria 1245
653 Ga0207710_10121584 3300025900 Bacteria 1247
654 Ga0207710_10267609 3300025900 Bacteria 858
655 Ga0207710_10280707 3300025900 Bacteria 838
656 Ga0207710_10376181 3300025900 Bacteria 726
657 Ga0207688_10055242 3300025901 Bacteria 2229
658 Ga0207688_10267382 3300025901 Bacteria 1039
659 Ga0207688_10511240 3300025901 Bacteria 753
660 Ga0207680_10146169 3300025903 Bacteria 1572
661 Ga0207680_10815109 3300025903 Bacteria 669
662 Ga0207680_11374181 3300025903 Bacteria 501
663 Ga0207647_10047758 3300025904 Bacteria 2661
664 Ga0207647_10060634 3300025904 Bacteria 2312
665 Ga0207647_10073175 3300025904 Bacteria 2066
666 Ga0207647_10227338 3300025904 Bacteria 1074
667 Ga0207685_10040019 3300025905 Bacteria 1744
668 Ga0207685_10486797 3300025905 Bacteria 647
669 Ga0207699_10001061 3300025906 Bacteria 12978
670 Ga0207699_10007678 3300025906 Bacteria 5281
671 Ga0207699_10283035 3300025906 Bacteria 1153
672 Ga0207645_10038584 3300025907 Bacteria 3062
673 Ga0207645_10131351 3300025907 Bacteria 1630
674 Ga0207645_10152105 3300025907 Bacteria 1511
675 Ga0207643_10047754 3300025908 Bacteria 2424
676 Ga0207643_10190848 3300025908 Bacteria 1244
677 Ga0207643_10274853 3300025908 Bacteria 1043
678 Ga0207643_10562394 3300025908 Bacteria 732
679 Ga0207705_10072241 3300025909 Bacteria 2502
680 Ga0207705_10154888 3300025909 Bacteria 1719
681 Ga0207705_10158715 3300025909 Bacteria 1698
682 Ga0207705_10942133 3300025909 Bacteria 668
683 Ga0207684_10354325 3300025910 Bacteria 1263
684 Ga0207684_10403939 3300025910 Bacteria 1174
685 Ga0207684_11095647 3300025910 Bacteria 663
686 Ga0207654_10435932 3300025911 Bacteria 917
687 Ga0207654_11026997 3300025911 Bacteria 600
688 Ga0207707_10000100 3300025912 Bacteria 85682
689 Ga0207707_10030393 3300025912 Bacteria 4726
690 Ga0207707_10206552 3300025912 Bacteria 1712
691 Ga0207707_10286635 3300025912 Bacteria 1425
692 Ga0207707_10315552 3300025912 Bacteria 1350
693 Ga0207707_10914595 3300025912 Bacteria 724
694 Ga0207695_10071426 3300025913 Bacteria 3545
695 Ga0207695_10350642 3300025913 Bacteria 1363
696 Ga0207695_10415856 3300025913 Bacteria 1229
697 Ga0207695_10641618 3300025913 Bacteria 943
698 Ga0207695_11256698 3300025913 Bacteria 621
699 Ga0207671_10028432 3300025914 Bacteria 4177
700 Ga0207671_10105880 3300025914 Bacteria 2135
701 Ga0207671_10169081 3300025914 Bacteria 1697
702 Ga0207671_10472565 3300025914 Bacteria 999
703 Ga0207671_10540688 3300025914 Bacteria 929
704 Ga0207671_10607757 3300025914 Bacteria 871
705 Ga0207671_10849021 3300025914 Bacteria 723
706 Ga0207671_10963191 3300025914 Bacteria 673
707 Ga0207693_10014072 3300025915 Bacteria 6441
708 Ga0207693_10016945 3300025915 Bacteria 5818
709 Ga0207693_10064340 3300025915 Bacteria 2873
710 Ga0207693_10086278 3300025915 Bacteria 2459
711 Ga0207693_10136566 3300025915 Bacteria 1928
712 Ga0207693_10489985 3300025915 Bacteria 960
713 Ga0207663_10007470 3300025916 Bacteria 5670
714 Ga0207663_10016344 3300025916 Bacteria 4113
715 Ga0207663_10025172 3300025916 Bacteria 3436
716 Ga0207663_11055867 3300025916 Bacteria 652
717 Ga0207660_10028561 3300025917 Bacteria 3816
718 Ga0207660_10040865 3300025917 Bacteria 3248
719 Ga0207660_10063621 3300025917 Bacteria 2661
720 Ga0207660_10077814 3300025917 Bacteria 2429
721 Ga0207660_10158466 3300025917 Bacteria 1744
722 Ga0207660_10160915 3300025917 Bacteria 1732
723 Ga0207660_10228675 3300025917 Bacteria 1462
724 Ga0207662_10154664 3300025918 Bacteria 1461
725 Ga0207657_10004438 3300025919 Bacteria 14843
726 Ga0207657_10031627 3300025919 Bacteria 4790
727 Ga0207657_10094160 3300025919 Bacteria 2494
728 Ga0207657_10120060 3300025919 Bacteria 2163
729 Ga0207657_10396058 3300025919 Bacteria 1086
730 Ga0207657_11073410 3300025919 Bacteria 616
731 Ga0207657_11185363 3300025919 Bacteria 581
732 Ga0207649_10072215 3300025920 Bacteria 2207
733 Ga0207649_10187352 3300025920 Bacteria 1453
734 Ga0207649_10853453 3300025920 Bacteria 712
735 Ga0207652_10002952 3300025921 Bacteria 14213
736 Ga0207652_10098532 3300025921 Bacteria 2578
737 Ga0207652_10312143 3300025921 Bacteria 1419
738 Ga0207646_10422000 3300025922 Bacteria 1204
739 Ga0207646_10725690 3300025922 Bacteria 888
740 Ga0207681_10109686 3300025923 Bacteria 2005
741 Ga0207681_10123968 3300025923 Bacteria 1899
742 Ga0207694_10239505 3300025924 Bacteria 1482
743 Ga0207694_10384497 3300025924 Bacteria 1165
744 Ga0207694_10503828 3300025924 Bacteria 1014
745 Ga0207694_10690716 3300025924 Bacteria 860
746 Ga0207650_10124804 3300025925 Bacteria 2008
747 Ga0207650_10583701 3300025925 Bacteria 939
748 Ga0207659_10137563 3300025926 Bacteria 1892
749 Ga0207659_10145958 3300025926 Bacteria 1842
750 Ga0207687_10039457 3300025927 Bacteria 3233
751 Ga0207687_10245841 3300025927 Bacteria 1420
752 Ga0207687_11012114 3300025927 Bacteria 713
753 Ga0207700_10001725 3300025928 Bacteria 12413
754 Ga0207700_10015395 3300025928 Bacteria 5045
755 Ga0207700_10060174 3300025928 Bacteria 2876
756 Ga0207700_10072029 3300025928 Bacteria 2663
757 Ga0207700_10125637 3300025928 Bacteria 2087
758 Ga0207700_10996929 3300025928 Bacteria 750
759 Ga0207700_11234804 3300025928 Bacteria 667
760 Ga0207664_10019486 3300025929 Bacteria 5015
761 Ga0207664_10259385 3300025929 Bacteria 1520
762 Ga0207644_10172770 3300025931 Bacteria 1688
763 Ga0207644_10954068 3300025931 Bacteria 719
764 Ga0207644_11052371 3300025931 Bacteria 683
765 Ga0207690_10407673 3300025932 Bacteria 1085
766 Ga0207690_10648231 3300025932 Bacteria 865
767 Ga0207690_11553260 3300025932 Bacteria 553
768 Ga0207706_10012728 3300025933 Bacteria 7659
769 Ga0207706_10087364 3300025933 Bacteria 2742
770 Ga0207706_10618925 3300025933 Bacteria 929
771 Ga0207706_11137184 3300025933 Bacteria 651
772 Ga0207686_10079054 3300025934 Bacteria 2140
773 Ga0207686_11038525 3300025934 Bacteria 666
774 Ga0207686_11831751 3300025934 Bacteria 502
775 Ga0207709_10010739 3300025935 Bacteria 5044
776 Ga0207709_10150229 3300025935 Bacteria 1612
777 Ga0207709_10438595 3300025935 Bacteria 1007
778 Ga0207709_10542873 3300025935 Bacteria 913
779 Ga0207709_10941784 3300025935 Bacteria 704
780 Ga0207670_10201330 3300025936 Bacteria 1513
781 Ga0207670_10700338 3300025936 Bacteria 838
782 Ga0207670_11261998 3300025936 Bacteria 626
783 Ga0207669_10033228 3300025937 Bacteria 2908
784 Ga0207669_10138740 3300025937 Bacteria 1684
785 Ga0207704_10114952 3300025938 Bacteria 1828
786 Ga0207704_10150843 3300025938 Bacteria 1640
787 Ga0207704_11076701 3300025938 Bacteria 682
788 Ga0207704_11372208 3300025938 Bacteria 605
789 Ga0207704_11785373 3300025938 Bacteria 529
790 Ga0207665_10021794 3300025939 Bacteria 4214
791 Ga0207665_10208427 3300025939 Bacteria 1427
792 Ga0207665_10418165 3300025939 Bacteria 1024
793 Ga0207665_10500334 3300025939 Bacteria 939
794 Ga0207665_10729542 3300025939 Bacteria 780
795 Ga0207665_10895836 3300025939 Bacteria 703
796 Ga0207691_10029569 3300025940 Bacteria 5125
797 Ga0207691_10031653 3300025940 Bacteria 4935
798 Ga0207691_10764603 3300025940 Bacteria 813
799 Ga0207711_10116656 3300025941 Bacteria 2380
800 Ga0207711_10123770 3300025941 Bacteria 2311
801 Ga0207711_10299630 3300025941 Bacteria 1483
802 Ga0207711_10898658 3300025941 Bacteria 823
803 Ga0207711_11025354 3300025941 Bacteria 765
804 Ga0207689_10291278 3300025942 Bacteria 1352
805 Ga0207689_10425936 3300025942 Bacteria 1108
806 Ga0207689_11801063 3300025942 Bacteria 505
807 Ga0207661_10006554 3300025944 Bacteria 8230
808 Ga0207661_10010090 3300025944 Bacteria 6787
809 Ga0207661_10283898 3300025944 Bacteria 1480
810 Ga0207661_10345859 3300025944 Bacteria 1341
811 Ga0207661_11733901 3300025944 Bacteria 570
812 Ga0207679_10138089 3300025945 Bacteria 1966
813 Ga0207679_10180692 3300025945 Bacteria 1745
814 Ga0207679_11089229 3300025945 Bacteria 733
815 Ga0207679_11366268 3300025945 Bacteria 650
816 Ga0207667_10081747 3300025949 Bacteria 3346
817 Ga0207667_10121470 3300025949 Bacteria 2692
818 Ga0207667_10257340 3300025949 Bacteria 1785
819 Ga0207667_10305365 3300025949 Bacteria 1626
820 Ga0207667_10611435 3300025949 Bacteria 1098
821 Ga0207667_10614105 3300025949 Bacteria 1095
822 Ga0207667_10810170 3300025949 Bacteria 933
823 Ga0207667_11183397 3300025949 Bacteria 745
824 Ga0207667_11270103 3300025949 Bacteria 714
825 Ga0207667_11352109 3300025949 Bacteria 687
826 Ga0207651_10215525 3300025960 Bacteria 1549
827 Ga0207651_10278409 3300025960 Bacteria 1381
828 Ga0207651_10279639 3300025960 Bacteria 1379
829 Ga0207651_10357198 3300025960 Bacteria 1232
830 Ga0207651_11183617 3300025960 Bacteria 686
831 Ga0207712_10083170 3300025961 Bacteria 2336
832 Ga0207712_10159425 3300025961 Bacteria 1752
833 Ga0207712_10416465 3300025961 Bacteria 1132
834 Ga0207712_10475681 3300025961 Bacteria 1064
835 Ga0207712_11740214 3300025961 Bacteria 559
836 Ga0207712_12113602 3300025961 Bacteria 504
837 Ga0207668_10093414 3300025972 Bacteria 2216
838 Ga0207668_10116149 3300025972 Bacteria 2017
839 Ga0207668_10154585 3300025972 Bacteria 1780
840 Ga0207668_10362159 3300025972 Bacteria 1215
841 Ga0207668_11972353 3300025972 Bacteria 526
842 Ga0207640_10027912 3300025981 Bacteria 3444
843 Ga0207640_10187768 3300025981 Bacteria 1555
844 Ga0207640_10762071 3300025981 Bacteria 835
845 Ga0207640_11317567 3300025981 Bacteria 645
846 Ga0207640_12069339 3300025981 Bacteria 516
847 Ga0207658_10414050 3300025986 Bacteria 1187
848 Ga0207658_10747098 3300025986 Bacteria 886
849 Ga0207658_10920271 3300025986 Bacteria 796
850 Ga0207658_11186276 3300025986 Bacteria 698
851 Ga0207658_11808240 3300025986 Bacteria 557
852 Ga0207658_12189700 3300025986 Bacteria 502
853 Ga0207677_10244533 3300026023 Bacteria 1453
854 Ga0207677_10263382 3300026023 Bacteria 1406
855 Ga0207677_10285247 3300026023 Bacteria 1357
856 Ga0207677_10383122 3300026023 Bacteria 1187
857 Ga0207703_10032727 3300026035 Bacteria 4116
858 Ga0207703_10314741 3300026035 Bacteria 1432
859 Ga0207703_10410093 3300026035 Bacteria 1259
860 Ga0207703_10486536 3300026035 Bacteria 1157
861 Ga0207703_11019238 3300026035 Bacteria 794
862 Ga0207639_10051535 3300026041 Bacteria 3131
863 Ga0207639_10074969 3300026041 Bacteria 2659
864 Ga0207639_10233264 3300026041 Bacteria 1596
865 Ga0207639_10402318 3300026041 Bacteria 1234
866 Ga0207639_10729221 3300026041 Bacteria 921
867 Ga0207639_10910507 3300026041 Bacteria 822
868 Ga0207639_10936459 3300026041 Bacteria 810
869 Ga0207639_11147523 3300026041 Bacteria 729
870 Ga0207678_10033544 3300026067 Bacteria 4471
871 Ga0207678_10042094 3300026067 Bacteria 3959
872 Ga0207678_10063542 3300026067 Bacteria 3173
873 Ga0207678_10087912 3300026067 Bacteria 2656
874 Ga0207678_10133616 3300026067 Bacteria 2117
875 Ga0207678_10220212 3300026067 Bacteria 1624
876 Ga0207678_10392258 3300026067 Bacteria 1201
877 Ga0207678_10473599 3300026067 Bacteria 1090
878 Ga0207678_11060748 3300026067 Bacteria 717
879 Ga0207678_11130684 3300026067 Bacteria 693
880 Ga0207708_10046668 3300026075 Bacteria 3298
881 Ga0207702_10008573 3300026078 Bacteria 8618
882 Ga0207702_10046751 3300026078 Bacteria 3644
883 Ga0207702_10155366 3300026078 Bacteria 2085
884 Ga0207702_10321068 3300026078 Bacteria 1475
885 Ga0207702_10362542 3300026078 Bacteria 1389
886 Ga0207702_10505600 3300026078 Bacteria 1178
887 Ga0207702_10835016 3300026078 Bacteria 912
888 Ga0207702_10837194 3300026078 Bacteria 910
889 Ga0207641_10568195 3300026088 Bacteria 1107
890 Ga0207641_10888190 3300026088 Bacteria 885
891 Ga0207641_11118673 3300026088 Bacteria 786
892 Ga0207641_11744686 3300026088 Bacteria 624
893 Ga0207641_11839322 3300026088 Bacteria 607
894 Ga0207648_10114889 3300026089 Bacteria 2365
895 Ga0207648_10187305 3300026089 Bacteria 1833
896 Ga0207648_11014704 3300026089 Bacteria 777
897 Ga0207648_11066960 3300026089 Bacteria 757
898 Ga0207676_10068088 3300026095 Bacteria 2846
899 Ga0207676_10303262 3300026095 Bacteria 1459
900 Ga0207676_10343264 3300026095 Bacteria 1378
901 Ga0207674_10070853 3300026116 Bacteria 3505
902 Ga0207675_100028928 3300026118 Bacteria 5162
903 Ga0207675_100471364 3300026118 Bacteria 1247
904 Ga0207675_101385192 3300026118 Bacteria 724
905 Ga0207683_10027677 3300026121 Bacteria 4898
906 Ga0207683_10030892 3300026121 Bacteria 4645
907 Ga0207683_10060100 3300026121 Bacteria 3340
908 Ga0207683_10155166 3300026121 Bacteria 2068
909 Ga0207683_10307439 3300026121 Bacteria 1451
910 Ga0207683_10322353 3300026121 Bacteria 1415
911 Ga0207683_10802738 3300026121 Bacteria 873
912 Ga0207683_12116431 3300026121 Bacteria 511
913 Ga0207698_10017851 3300026142 Bacteria 4823
914 Ga0207698_10115608 3300026142 Bacteria 2259
915 Ga0207698_10242761 3300026142 Bacteria 1643
916 Ga0207698_10831625 3300026142 Bacteria 927
917 Ga0207698_11622912 3300026142 Bacteria 662
918 Ga0209389_1000033 3300027296 Bacteria 131516
919 Ga0209389_1000182 3300027296 Bacteria 48705
920 Ga0209589_1000040 3300027357 Bacteria 126550
921 Ga0209489_100045 3300027361 Bacteria 158225
922 Ga0209489_100209 3300027361 Bacteria 96349
923 Ga0209700_100011 3300027363 Bacteria 362159
924 Ga0209179_1011067 3300027512 Bacteria 1589
925 Ga0209179_1041397 3300027512 Bacteria 971
926 Ga0209588_1047656 3300027671 Bacteria 1386
927 Ga0209813_10059524 3300027866 Bacteria 1216
928 Ga0207428_10356775 3300027907 Bacteria 1075
929 Ga0207428_10467331 3300027907 Bacteria 919
930 Ga0268266_10006104 3300028379 Bacteria 11096
931 Ga0268266_10016065 3300028379 Bacteria 6398
932 Ga0268266_10040428 3300028379 Bacteria 3974
933 Ga0268266_10064806 3300028379 Bacteria 3157
934 Ga0268266_10275686 3300028379 Bacteria 1562
935 Ga0268266_10366515 3300028379 Bacteria 1356
936 Ga0268266_10387415 3300028379 Bacteria 1319
937 Ga0268266_10675858 3300028379 Bacteria 994
938 Ga0268266_11905938 3300028379 Bacteria 568
939 Ga0268265_10028336 3300028380 Bacteria 4008
940 Ga0268265_10221207 3300028380 Bacteria 1657
941 Ga0268265_10284375 3300028380 Bacteria 1481
942 Ga0268265_10477072 3300028380 Bacteria 1170
943 Ga0268264_10296940 3300028381 Bacteria 1519
944 Ga0268264_10615997 3300028381 Bacteria 1071
945 Ga0268264_10800720 3300028381 Bacteria 941
946 Ga0265334_10194692 3300028573 Bacteria 705
947 Ga0307517_10001338 3300028786 Bacteria 41372
948 Ga0307517_10180709 3300028786 Bacteria 1363
949 Ga0307515_10036525 3300028794 Bacteria 7944
950 Ga0307511_10235259 3300030521 Bacteria 901
951 Ga0307512_10245072 3300030522 Bacteria 901
952 Ga0265330_10016402 3300031235 Bacteria 3418
953 Ga0265330_10038794 3300031235 Bacteria 2117
954 Ga0265330_10088191 3300031235 Bacteria 1333
955 Ga0265332_10002811 3300031238 Bacteria 8649
956 Ga0265332_10028193 3300031238 Bacteria 2459
957 Ga0265328_10138452 3300031239 Bacteria 913
958 Ga0265325_10053584 3300031241 Bacteria 2067
959 Ga0265340_10003064 3300031247 Bacteria 9498
960 Ga0265340_10056306 3300031247 Bacteria 1891
961 Ga0265340_10202371 3300031247 Bacteria 893
962 Ga0265339_10001062 3300031249 Bacteria 20880
963 Ga0265339_10130370 3300031249 Bacteria 1286
964 Ga0265339_10478265 3300031249 Bacteria 576
965 Ga0265331_10010008 3300031250 Bacteria 5273
966 Ga0265331_10316160 3300031250 Bacteria 699
967 Ga0265316_10241384 3300031344 Bacteria 1328
968 Ga0265316_10549220 3300031344 Bacteria 822
969 Ga0307513_10375302 3300031456 Bacteria 1163
970 Ga0307513_10446743 3300031456 Bacteria 1018
971 Ga0307513_10603829 3300031456 Bacteria 806
972 Ga0307513_10798778 3300031456 Bacteria 649
973 Ga0307513_10880270 3300031456 Bacteria 603
974 Ga0307509_10513421 3300031507 Bacteria 881
975 Ga0307408_100089338 3300031548 Bacteria 2322
976 Ga0307408_101735977 3300031548 Bacteria 595
977 Ga0265313_10032062 3300031595 Bacteria 2688
978 Ga0307508_10041680 3300031616 Bacteria 4120
979 Ga0307508_10524270 3300031616 Bacteria 781
980 Ga0265314_10007615 3300031711 Bacteria 9373
981 Ga0265314_10015101 3300031711 Bacteria 6142
982 Ga0265314_10037169 3300031711 Bacteria 3531
983 Ga0265314_10134381 3300031711 Bacteria 1538
984 Ga0265342_10027258 3300031712 Bacteria 3573
985 Ga0265342_10040588 3300031712 Bacteria 2822
986 Ga0265342_10201349 3300031712 Bacteria 1081
987 Ga0265342_10329256 3300031712 Bacteria 799
988 Ga0265342_10378683 3300031712 Bacteria 733
989 Ga0307516_10086786 3300031730 Bacteria 2964
990 Ga0307516_10134526 3300031730 Bacteria 2248
991 Ga0307516_10281644 3300031730 Bacteria 1344
992 Ga0307405_10629463 3300031731 Bacteria 879
993 Ga0307405_11012551 3300031731 Bacteria 709
994 Ga0307413_10176723 3300031824 Bacteria 1517
995 Ga0307413_10341159 3300031824 Bacteria 1152
996 Ga0307406_10335531 3300031901 Bacteria 1175
997 Ga0307406_10526277 3300031901 Bacteria 963
998 Ga0307406_11052428 3300031901 Bacteria 700
999 Ga0307407_10454913 3300031903 Bacteria 930
1000 Ga0307407_10978363 3300031903 Bacteria 653
1001 Ga0307412_10432509 3300031911 Bacteria 1079
1002 Ga0307412_10495967 3300031911 Bacteria 1016
1003 Ga0307412_11840478 3300031911 Bacteria 557
1004 Ga0307409_100831084 3300031995 Bacteria 933
1005 Ga0307409_100832600 3300031995 Bacteria 932
1006 Ga0307409_101840791 3300031995 Bacteria 634
1007 Ga0307409_102627992 3300031995 Bacteria 532
1008 Ga0307416_100346475 3300032002 Bacteria 1501
1009 Ga0307416_100761660 3300032002 Bacteria 1061
1010 Ga0307416_102839709 3300032002 Bacteria 579
1011 Ga0307414_10077804 3300032004 Bacteria 2416
1012 Ga0307414_10373837 3300032004 Bacteria 1230
1013 Ga0307414_11003345 3300032004 Bacteria 768
1014 Ga0307411_10349488 3300032005 Bacteria 1205
1015 Ga0307411_10427413 3300032005 Bacteria 1102
1016 Ga0307411_10579582 3300032005 Bacteria 961
1017 Ga0307415_100070392 3300032126 Bacteria 2456
1018 Ga0307415_102364114 3300032126 Bacteria 522
1019 Ga0307507_10294194 3300033179 Bacteria 1002
1020 Ga0307510_10001271 3300033180 Bacteria 27493
1021 Ga0307510_10047803 3300033180 Bacteria 4576
1022 Ga0307510_10396400 3300033180 Bacteria 824
1023 Ga0315911_1000008 3300033442 Bacteria 381285
1024 Ga0373930_0001937 3300034816 Bacteria 3166
1025 Ga0373950_0080260 3300034818 Bacteria 680
1026 Ga0373958_0068524 3300034819 Bacteria 783
1027 Ga0373926_0046065 3300035083 Bacteria 1564
1028 Ga0373926_0090928 3300035083 Bacteria 1135
1029 Ga0373928_0178595 3300035084 Bacteria 602
1030 Ga0373929_0083651 3300035085 Bacteria 782
1031 Ga0373934_0016343 3300035086 Bacteria 2821
1032 Ga0373940_0117675 3300035088 Bacteria 822
1033 Ga0373940_0170022 3300035088 Bacteria 704
1034 Ga0373944_0136774 3300035089 Bacteria 855
1035 Ga0373944_0185526 3300035089 Bacteria 748
1036 Ga0373951_0035188 3300035091 Bacteria 1192
1037 Ga0373951_0074543 3300035091 Bacteria 869
1038 Ga0373952_0024452 3300035092 Bacteria 1298
1039 Ga0373923_0028690 3300035111 Bacteria 2227
1040 Ga0373923_0065095 3300035111 Bacteria 1555
1041 Ga0373923_0084462 3300035111 Bacteria 1381
1042 Ga0373923_0334490 3300035111 Bacteria 721
1043 Ga0373936_0032611 3300035113 Bacteria 2061
1044 Ga0373936_0070642 3300035113 Bacteria 1438
1045 Ga0373936_0095343 3300035113 Bacteria 1251
1046 Ga0373936_0201176 3300035113 Bacteria 879
1047 Ga0373945_0060788 3300035116 Bacteria 1410
1048 Ga0373945_0078605 3300035116 Bacteria 1260
1049 Ga0373945_0263745 3300035116 Bacteria 730
1050 Ga0373953_0011511 3300035117 Bacteria 3107
1051 Ga0373953_0238715 3300035117 Bacteria 789
1052 Ga0373954_0010559 3300035118 Bacteria 4076
1053 Ga0373954_0019659 3300035118 Bacteria 3049
1054 Ga0373954_0054198 3300035118 Bacteria 1885
1055 Ga0373954_0337807 3300035118 Bacteria 744
1056 Ga0373954_0405729 3300035118 Bacteria 674
1057 Ga0373956_0116779 3300035119 Bacteria 1245
1058 Ga0373956_0244679 3300035119 Bacteria 852
1059 Ga0373957_0003256 3300035120 Bacteria 4776
1060 Ga0373943_0013206 3300035170 Bacteria 3727
1061 Ga0373943_0075540 3300035170 Bacteria 1716
1062 Ga0373943_0615322 3300035170 Bacteria 640
1063 Ga0373946_0031509 3300035171 Bacteria 2124
1064 Ga0373946_0321022 3300035171 Bacteria 769
1065 Ga0373946_0608416 3300035171 Bacteria 567
1066 Ga0373955_0072375 3300035172 Bacteria 1930
1067 Ga0373955_0328510 3300035172 Bacteria 924
1068 Ga0373955_0663657 3300035172 Bacteria 639
1069 Ga0373942_0063034 3300035207 Bacteria 1067
1070 Ga0373924_0120257 3300035410 Bacteria 1139
1071 Ga0373924_0192341 3300035410 Bacteria 899
1072 Ga0373931_0259870 3300035691 Bacteria 1059
1073 Ga0373931_0582955 3300035691 Bacteria 729
1074 Ga0373935_0004959 3300035692 Bacteria 7829
1075 Ga0373935_0168784 3300035692 Bacteria 1496
1076 Ga0373935_0718514 3300035692 Bacteria 735
1077 Ga0373935_1399104 3300035692 Bacteria 523
1078 Ga0373927_0001486 3300035695 Bacteria 17658
1079 Ga0373927_0001909 3300035695 Bacteria 15400
1080 Ga0373927_0095400 3300035695 Bacteria 1933
1081 Ga0373927_0125931 3300035695 Bacteria 1672
1082 Ga0373927_0209617 3300035695 Bacteria 1280
1083 Ga0373927_0545663 3300035695 Bacteria 766
1084 Ga0373927_0595878 3300035695 Bacteria 730
1085 Ga0373933_0000031 3300035724 Bacteria 85038
1086 Ga0373933_0027834 3300035724 Bacteria 3258
1087 Ga0373933_0108468 3300035724 Bacteria 1729
1088 Ga0373933_0312652 3300035724 Bacteria 1018
1089 Ga0373933_0455940 3300035724 Bacteria 836
1090 Ga0373947_0001274 3300035725 Bacteria 15527
1091 Ga0373947_0016858 3300035725 Bacteria 4196
1092 Ga0373947_0150029 3300035725 Bacteria 1501
1093 Ga0373937_0024272 3300036401 Bacteria 5466
1094 Ga0373937_0030861 3300036401 Bacteria 4854
1095 Ga0373937_0435623 3300036401 Bacteria 1244
1096 Ga0373937_1851361 3300036401 Bacteria 550
1097 Ga0373937_1893868 3300036401 Bacteria 543
1098 Ga0372808_041602 3300036459 Bacteria 659
1099 Ga0373925_0001594 3300037068 Bacteria 19170
1100 Ga0373925_0010880 3300037068 Bacteria 6599
1101 Ga0373925_0164313 3300037068 Bacteria 1750
1102 Ga0373925_0262322 3300037068 Bacteria 1388
1103 Ga0373925_0671865 3300037068 Bacteria 854
1104 Ga0373925_0966565 3300037068 Bacteria 702
1105 Ga0395899_0838253 3300037312 Bacteria 565
1106 Ga0395900_0010736 3300037418 Bacteria 9368
1107 Ga0395900_0170118 3300037418 Bacteria 2219
1108 Ga0395900_0407775 3300037418 Bacteria 1322
1109 Ga0395898_0030124 3300037466 Bacteria 5432
1110 Ga0395898_0051847 3300037466 Bacteria 4010
1111 Ga0395898_1574424 3300037466 Bacteria 582
1112 Ga0395905_0036106 3300037471 Bacteria 4642
1113 Ga0395905_0251635 3300037471 Bacteria 1650
1114 Ga0436364_0391637 3300037853 Bacteria 617
1115 Ga0436364_0568842 3300037853 Bacteria 1820
1116 Ga0436364_1276004 3300037853 Bacteria 9626
1117 Ga0436364_1322318 3300037853 Bacteria 1220
1118 Ga0436364_1468116 3300037853 Bacteria 643
1119 Ga0395901_0002704 3300038443 Bacteria 17874
1120 Ga0395901_0351475 3300038443 Bacteria 1521
1121 Ga0395901_0425485 3300038443 Bacteria 1361
1122 Ga0395901_1718790 3300038443 Bacteria 578
1123 Ga0436365_0742828 3300039437 Bacteria 581
1124 Ga0436365_0922495 3300039437 Bacteria 1195
1125 Ga0436365_1014733 3300039437 Bacteria 1810
1126 Ga0436365_1195005 3300039437 Bacteria 632
1127 Ga0436365_1314154 3300039437 Bacteria 735
1128 Ga0436365_1381707 3300039437 Bacteria 3213
1129 Ga0436365_1701765 3300039437 Bacteria 699
1130 Ga0436365_1803227 3300039437 Bacteria 660
1131 Ga0436365_1937071 3300039437 Bacteria 1898
1132 Ga0436360_0390894 3300039438 Bacteria 1137
1133 Ga0436360_0452855 3300039438 Bacteria 759
1134 Ga0436360_0523977 3300039438 Bacteria 1837
1135 Ga0436361_0584437 3300039447 Bacteria 2273
1136 Ga0436361_1184530 3300039447 Bacteria 2408
1137 Ga0436363_0321460 3300039450 Bacteria 840
1138 Ga0436363_0693501 3300039450 Bacteria 630
1139 Ga0436363_0998150 3300039450 Bacteria 716
1140 Ga0436363_1268948 3300039450 Bacteria 1250
1141 Ga0436363_1370145 3300039450 Bacteria 607
1142 Ga0436362_0187183 3300039453 Bacteria 885
1143 Ga0436362_0958247 3300039453 Bacteria 798
1144 Ga0439461_0067257 3300041410 Bacteria 824
1145 Ga0439465_0018997 3300041413 Bacteria 2149
1146 Ga0439465_0075697 3300041413 Bacteria 1134
1147 Ga0439465_0141599 3300041413 Bacteria 854
1148 Ga0451787_780058 3300041441 Bacteria 584
1149 Ga0451789_0888595 3300041443 Bacteria 789
1150 Ga0451791_0599775 3300041451 Bacteria 812
1151 Ga0451791_1266234 3300041451 Bacteria 511
1152 Ga0451791_1292449 3300041451 Bacteria 685
1153 Ga0451793_1125275 3300041452 Bacteria 1081
1154 Ga0451793_1229531 3300041452 Bacteria 618
1155 Ga0451793_1872073 3300041452 Bacteria 1041
1156 Ga0451797_1253056 3300041453 Bacteria 643
1157 Ga0451797_1528373 3300041453 Bacteria 843
1158 Ga0451797_1528537 3300041453 Bacteria 658
1159 Ga0451800_0230353 3300041459 Bacteria 1281
1160 Ga0451800_0533958 3300041459 Bacteria 585
1161 Ga0451807_1734003 3300041486 Bacteria 1117
1162 Ga0451807_2413021 3300041486 Bacteria 1307
1163 Ga0451833_1163545 3300041491 Bacteria 825
1164 Ga0451835_0842897 3300041492 Bacteria 723
1165 Ga0451837_1292424 3300041494 Bacteria 749
1166 Ga0451839_0106765 3300041496 Bacteria 548
1167 Ga0451839_0492820 3300041496 Bacteria 568
1168 Ga0451841_1019505 3300041498 Bacteria 542
1169 Ga0451841_1347967 3300041498 Bacteria 573
1170 Ga0451841_1402171 3300041498 Bacteria 955
1171 Ga0451845_0794558 3300041501 Bacteria 835
1172 Ga0451849_0920381 3300041505 Bacteria 1683
1173 Ga0451851_0304924 3300041507 Bacteria 1093
1174 Ga0451843_0158622 3300041509 Bacteria 922
1175 Ga0451855_1811011 3300041511 Bacteria 752
1176 Ga0451853_2545291 3300041512 Bacteria 740
1177 Ga0451853_2610219 3300041512 Bacteria 558
1178 Ga0439445_0057303 3300042004 Bacteria 1061
1179 Ga0439448_0073205 3300042005 Bacteria 1143
1180 Ga0439455_0123380 3300042012 Bacteria 727
1181 Ga0439455_0155777 3300042012 Bacteria 652
1182 Ga0439458_0207249 3300042157 Bacteria 537
1183 Ga0439459_0229562 3300042438 Bacteria 517
1184 Ga0439460_0278954 3300042461 Bacteria 582
1185 Ga0466969_0190562 3300044656 Bacteria 937
1186 Ga0466969_0219738 3300044656 Bacteria 864
1187 Ga0466969_0310401 3300044656 Bacteria 714
1188 Ga0466972_0000119 3300044658 Bacteria 66620
1189 Ga0466972_0051943 3300044658 Bacteria 1976
1190 Ga0466972_0125740 3300044658 Bacteria 1208
1191 Ga0466965_0011816 3300044683 Bacteria 4099
1192 Ga0466965_0298628 3300044683 Bacteria 873
1193 Ga0466965_0713744 3300044683 Bacteria 576
1194 Ga0466966_0923500 3300044684 Bacteria 526
1195 Ga0466961_0222959 3300044693 Bacteria 1162
1196 Ga0466961_0286931 3300044693 Bacteria 1007
1197 Ga0466963_0289098 3300044694 Bacteria 1152
1198 Ga0466971_0032657 3300044719 Bacteria 2332
1199 Ga0466968_0076008 3300044735 Bacteria 1469
1200 Ga0466968_0102535 3300044735 Bacteria 1279
1201 Ga0466968_0188917 3300044735 Bacteria 961
1202 Ga0466970_0170664 3300044765 Bacteria 1205
1203 Ga0466970_0208470 3300044765 Bacteria 1088
1204 Ga0466957_0346587 3300044842 Bacteria 1007
1205 Ga0466960_0066735 3300044901 Bacteria 1780
1206 Ga0466960_0086603 3300044901 Bacteria 1588
1207 Ga0466960_0154823 3300044901 Bacteria 1227
1208 Ga0466959_0016385 3300045049 Bacteria 5414
1209 Ga0466959_0039621 3300045049 Bacteria 3482
1210 Ga0466958_0360766 3300045836 Bacteria 936
1211 Ga0466967_0356686 3300045976 Bacteria 1416
1212 Ga0466967_0498470 3300045976 Bacteria 1195
1213 Ga0466967_0513321 3300045976 Bacteria 1177
1214 Ga0466967_1985098 3300045976 Bacteria 578
1215 Ga0495617_070988 3300046452 Bacteria 1145
1216 Ga0495617_148693 3300046452 Bacteria 745
1217 Ga0495617_188533 3300046452 Bacteria 647
1218 Ga0495627_046019 3300046453 Bacteria 1328
1219 Ga0495592_0001103 3300046454 Bacteria 18750
1220 Ga0495592_0075075 3300046454 Bacteria 2455
1221 Ga0495592_0088525 3300046454 Bacteria 2225
1222 Ga0495592_0473027 3300046454 Bacteria 782
1223 Ga0495603_0000047 3300046455 Bacteria 53081
1224 Ga0495603_0003797 3300046455 Bacteria 8993
1225 Ga0495603_0051843 3300046455 Bacteria 2437
1226 Ga0495603_0138436 3300046455 Bacteria 1416
1227 Ga0495603_0202083 3300046455 Bacteria 1148
1228 Ga0495603_0241335 3300046455 Bacteria 1041
1229 Ga0495603_0346494 3300046455 Bacteria 852
1230 Ga0495590_0206771 3300046457 Bacteria 722
1231 Ga0495629_0000320 3300046459 Bacteria 41151
1232 Ga0495629_0015701 3300046459 Bacteria 5436
1233 Ga0495629_0209858 3300046459 Bacteria 1345
1234 Ga0495629_0775306 3300046459 Bacteria 634
1235 Ga0495638_0335960 3300046460 Bacteria 802
1236 Ga0495638_0495295 3300046460 Bacteria 616
1237 Ga0495641_0003618 3300046461 Bacteria 11446
1238 Ga0495651_0003655 3300046462 Bacteria 11783
1239 Ga0495651_0044644 3300046462 Bacteria 3434
1240 Ga0495651_0357420 3300046462 Bacteria 963
1241 Ga0495651_0359286 3300046462 Bacteria 960
1242 Ga0495653_0002935 3300046463 Bacteria 13647
1243 Ga0495653_0105759 3300046463 Bacteria 2031
1244 Ga0495653_0165734 3300046463 Bacteria 1530
1245 Ga0495650_0050315 3300046471 Bacteria 1724
1246 Ga0495650_0140910 3300046471 Bacteria 872
1247 Ga0495580_0003812 3300046472 Bacteria 12769
1248 Ga0495580_0011284 3300046472 Bacteria 6914
1249 Ga0495580_0064468 3300046472 Bacteria 2568
1250 Ga0495582_0000043 3300046473 Bacteria 63647
1251 Ga0495582_0008940 3300046473 Bacteria 5529
1252 Ga0495582_0056468 3300046473 Bacteria 2164
1253 Ga0495605_0052793 3300046474 Bacteria 1974
1254 Ga0495639_0000091 3300046475 Bacteria 44027
1255 Ga0495639_0003629 3300046475 Bacteria 6655
1256 Ga0495639_0036537 3300046475 Bacteria 2201
1257 Ga0495662_0001246 3300046476 Bacteria 12549
1258 Ga0495662_0052252 3300046476 Bacteria 1973
1259 Ga0495662_0329984 3300046476 Bacteria 750
1260 Ga0495664_0007170 3300046477 Bacteria 6179
1261 Ga0495664_0029468 3300046477 Bacteria 3210
1262 Ga0495664_0084176 3300046477 Bacteria 1908
1263 Ga0495664_0582450 3300046477 Bacteria 666
1264 Ga0495584_0091573 3300046491 Bacteria 1533
1265 Ga0495584_0158439 3300046491 Bacteria 1150
1266 Ga0495584_0405997 3300046491 Bacteria 692
1267 Ga0495585_0073471 3300046492 Bacteria 1861
1268 Ga0495585_0176763 3300046492 Bacteria 1099
1269 Ga0495585_0269425 3300046492 Bacteria 844
1270 Ga0495594_0000453 3300046499 Bacteria 20836
1271 Ga0495594_0025110 3300046499 Bacteria 3202
1272 Ga0495594_0728007 3300046499 Bacteria 560
1273 Ga0495596_0101865 3300046500 Bacteria 1115
1274 Ga0495596_0244491 3300046500 Bacteria 696
1275 Ga0495596_0252522 3300046500 Bacteria 684
1276 Ga0495583_0119306 3300046506 Bacteria 1111
1277 Ga0495583_0171057 3300046506 Bacteria 893
1278 Ga0495606_0000252 3300046507 Bacteria 94511
1279 Ga0495606_0209332 3300046507 Bacteria 1105
1280 Ga0495608_0002745 3300046511 Bacteria 12639
1281 Ga0495608_0348355 3300046511 Bacteria 912
1282 Ga0495610_0166628 3300046512 Bacteria 927
1283 Ga0495616_0212840 3300046513 Bacteria 845
1284 Ga0495618_0032954 3300046514 Bacteria 3247
1285 Ga0495618_0897160 3300046514 Bacteria 512
1286 Ga0495628_0018664 3300046516 Bacteria 5741
1287 Ga0495628_0028910 3300046516 Bacteria 4499
1288 Ga0495628_0212867 3300046516 Bacteria 1453
1289 Ga0495628_0508557 3300046516 Bacteria 869
1290 Ga0495628_0782525 3300046516 Bacteria 669
1291 Ga0495628_0950306 3300046516 Bacteria 594
1292 Ga0495630_0010214 3300046517 Bacteria 6772
1293 Ga0495630_0021128 3300046517 Bacteria 4805
1294 Ga0495630_0358797 3300046517 Bacteria 1116
1295 Ga0495630_0755245 3300046517 Bacteria 743
1296 Ga0495631_0056217 3300046518 Bacteria 1713
1297 Ga0495631_0093256 3300046518 Bacteria 1296
1298 Ga0495631_0203714 3300046518 Bacteria 846
1299 Ga0495632_0131957 3300046519 Bacteria 1162
1300 Ga0495643_0210757 3300046522 Bacteria 927
1301 Ga0495644_0038506 3300046523 Bacteria 1803
1302 Ga0495648_0028481 3300046524 Bacteria 3720
1303 Ga0495663_0106637 3300046525 Bacteria 927
1304 Ga0495663_0247197 3300046525 Bacteria 632
1305 Ga0495666_0005355 3300046526 Bacteria 6469
1306 Ga0495652_0047305 3300046529 Bacteria 3689
1307 Ga0495652_0077920 3300046529 Bacteria 2745
1308 Ga0495652_0089870 3300046529 Bacteria 2514
1309 Ga0495652_0095596 3300046529 Bacteria 2421
1310 Ga0495652_1115258 3300046529 Bacteria 512
1311 Ga0495654_0398046 3300046530 Bacteria 547
1312 Ga0495665_0001445 3300046531 Bacteria 12728
1313 Ga0495665_0028842 3300046531 Bacteria 2974
1314 Ga0495665_0029068 3300046531 Bacteria 2962
1315 Ga0495640_0003340 3300046533 Bacteria 12919
1316 Ga0495640_0037580 3300046533 Bacteria 3415
1317 Ga0495640_0051596 3300046533 Bacteria 2827
1318 Ga0495640_0156349 3300046533 Bacteria 1463
1319 Ga0495586_0053587 3300046535 Bacteria 2185
1320 Ga0495587_0204981 3300046536 Bacteria 1114
1321 Ga0495587_0489924 3300046536 Bacteria 680
1322 Ga0495598_0091495 3300046537 Bacteria 993
1323 Ga0495609_0090703 3300046538 Bacteria 1329
1324 Ga0495609_0251742 3300046538 Bacteria 727
1325 Ga0495621_0034408 3300046539 Bacteria 1750
1326 Ga0495621_0228915 3300046539 Bacteria 754
1327 Ga0495597_0078336 3300046542 Bacteria 1416
1328 Ga0495597_0403800 3300046542 Bacteria 519
1329 Ga0495645_0046496 3300046543 Bacteria 3163
1330 Ga0495645_0168149 3300046543 Bacteria 1511
1331 Ga0495645_0364884 3300046543 Bacteria 927
1332 Ga0495645_0732243 3300046543 Bacteria 598
1333 Ga0495645_0747679 3300046543 Bacteria 590
1334 Ga0495645_0840706 3300046543 Bacteria 548
1335 Ga0495622_0001046 3300046557 Bacteria 14732
1336 Ga0495622_0017504 3300046557 Bacteria 3336
1337 Ga0495633_0116646 3300046558 Bacteria 1237
1338 Ga0495633_0316863 3300046558 Bacteria 708
1339 Ga0495667_0000464 3300046559 Bacteria 25814
1340 Ga0495667_0011945 3300046559 Bacteria 5884
1341 Ga0495667_0035393 3300046559 Bacteria 3337
1342 Ga0495667_0085790 3300046559 Bacteria 2043
1343 Ga0495667_0995888 3300046559 Bacteria 511
1344 Ga0495656_0009468 3300046615 Bacteria 3503
1345 Ga0495656_0015878 3300046615 Bacteria 2850
1346 Ga0495656_0022990 3300046615 Bacteria 2448
1347 Ga0495668_0088629 3300046616 Bacteria 1696
1348 Ga0495668_0149556 3300046616 Bacteria 1278
1349 Ga0495668_0317174 3300046616 Bacteria 855
1350 Ga0495634_0012021 3300046642 Bacteria 6276
1351 Ga0495634_0017936 3300046642 Bacteria 5045
1352 Ga0495634_0140337 3300046642 Bacteria 1534
1353 Ga0495634_0396213 3300046642 Bacteria 821
1354 Ga0495611_0434890 3300046648 Bacteria 598
1355 Ga0495611_0462160 3300046648 Bacteria 578
1356 Ga0495625_0335196 3300046660 Bacteria 960
1357 Ga0495625_0475914 3300046660 Bacteria 767
1358 Ga0495625_0662233 3300046660 Bacteria 620
1359 Ga0495635_0005649 3300046663 Bacteria 8710
1360 Ga0495635_0641115 3300046663 Bacteria 692
1361 Ga0495659_0147950 3300046664 Bacteria 941
1362 Ga0495661_0368938 3300046665 Bacteria 703
1363 Ga0495661_0406597 3300046665 Bacteria 661
1364 Ga0495588_0010476 3300046674 Bacteria 4311
1365 Ga0495588_0076499 3300046674 Bacteria 1744
1366 Ga0495657_0003059 3300046675 Bacteria 13843
1367 Ga0495657_0003417 3300046675 Bacteria 12959
1368 Ga0495599_0001830 3300046678 Bacteria 12331
1369 Ga0495599_0052193 3300046678 Bacteria 2561
1370 Ga0495599_0101126 3300046678 Bacteria 1797
1371 Ga0495599_0298409 3300046678 Bacteria 973
1372 Ga0495599_0888163 3300046678 Bacteria 505
1373 Ga0495623_0006142 3300046679 Bacteria 7806
1374 Ga0495623_0018620 3300046679 Bacteria 4484
1375 Ga0495646_0013771 3300046680 Bacteria 5142
1376 Ga0495646_0018667 3300046680 Bacteria 4392
1377 Ga0495646_0031356 3300046680 Bacteria 3313
1378 Ga0495646_0111341 3300046680 Bacteria 1558
1379 Ga0495646_0306055 3300046680 Bacteria 840
1380 Ga0495647_0000650 3300046681 Bacteria 10304
1381 Ga0495647_0136531 3300046681 Bacteria 1043
1382 Ga0495647_0295658 3300046681 Bacteria 729
1383 Ga0495658_0001001 3300046683 Bacteria 14927
1384 Ga0495658_0161190 3300046683 Bacteria 1383
1385 Ga0495658_0218743 3300046683 Bacteria 1192
1386 Ga0495658_0364608 3300046683 Bacteria 919
1387 Ga0495669_0002088 3300046684 Bacteria 8182
1388 Ga0495669_0092341 3300046684 Bacteria 1399
1389 Ga0495669_0265734 3300046684 Bacteria 824
1390 Ga0495669_0302882 3300046684 Bacteria 770
1391 Ga0495613_0001794 3300046689 Bacteria 16314
1392 Ga0495613_0028886 3300046689 Bacteria 4124
1393 Ga0495613_1011925 3300046689 Bacteria 533
1394 Ga0495624_0000694 3300046690 Bacteria 26424
1395 Ga0495624_0047820 3300046690 Bacteria 2717
1396 Ga0495624_0077537 3300046690 Bacteria 2061
1397 Ga0495624_0182174 3300046690 Bacteria 1280
1398 Ga0495624_0391400 3300046690 Bacteria 835
1399 Ga0495670_0189737 3300046691 Bacteria 1086
1400 Ga0495670_0371054 3300046691 Bacteria 771
1401 Ga0495671_0158995 3300046692 Bacteria 1099
1402 Ga0495671_0214928 3300046692 Bacteria 931
1403 Ga0495649_0458199 3300046694 Bacteria 636
1404 Ga0495589_0131643 3300046794 Bacteria 1200
1405 Ga0495589_0229048 3300046794 Bacteria 872
1406 Ga0495589_0333424 3300046794 Bacteria 700
1407 Ga0495589_0458572 3300046794 Bacteria 583
1408 Ga0495600_0000311 3300046809 Bacteria 25806
1409 Ga0495600_0011575 3300046809 Bacteria 5502
1410 Ga0495600_0016340 3300046809 Bacteria 4708
1411 Ga0495660_0124482 3300046810 Bacteria 1300
1412 Ga0495660_0131217 3300046810 Bacteria 1257
1413 Ga0495581_0000783 3300047315 Bacteria 16873
1414 Ga0495604_0004173 3300047317 Bacteria 11457
1415 Ga0495604_0019288 3300047317 Bacteria 5458
1416 Ga0495604_0085062 3300047317 Bacteria 2360
1417 Ga0495604_0160716 3300047317 Bacteria 1588
1418 Ga0495604_0182442 3300047317 Bacteria 1467
1419 Ga0495604_0214698 3300047317 Bacteria 1328
1420 Ga0495604_0234893 3300047317 Bacteria 1256
1421 Ga0495636_0075737 3300047318 Bacteria 1442
1422 Ga0495674_0004075 3300047319 Bacteria 14133
1423 Ga0495674_0010329 3300047319 Bacteria 8840
1424 Ga0495674_0058656 3300047319 Bacteria 3364
1425 Ga0495674_0098693 3300047319 Bacteria 2487
1426 Ga0495674_0420118 3300047319 Bacteria 1077
1427 Ga0495674_0621223 3300047319 Bacteria 854
1428 Ga0495674_0768258 3300047319 Bacteria 752
1429 Ga0495672_0013417 3300047320 Bacteria 5654
1430 Ga0495672_0153430 3300047320 Bacteria 1192
1431 Ga0495676_0028082 3300047321 Bacteria 4814
1432 Ga0495676_0307655 3300047321 Bacteria 1067
1433 Ga0495676_0870803 3300047321 Bacteria 578
1434 Ga0495680_0000689 3300047322 Bacteria 37846
1435 Ga0495680_0003027 3300047322 Bacteria 16758
1436 Ga0495680_0476549 3300047322 Bacteria 850
1437 Ga0495683_0433054 3300047323 Bacteria 542
1438 Ga0495687_082245 3300047443 Bacteria 1258
1439 Ga0495687_107873 3300047443 Bacteria 1030
1440 Ga0495675_0010733 3300047444 Bacteria 5735
1441 Ga0495675_0033526 3300047444 Bacteria 3277
1442 Ga0495677_0064391 3300047445 Bacteria 1362
1443 Ga0495679_120101 3300047446 Bacteria 719
1444 Ga0495685_118061 3300047447 Bacteria 871
1445 Ga0495673_0048919 3300047469 Bacteria 1862
1446 Ga0495673_0117736 3300047469 Bacteria 1055
1447 Ga0495673_0238976 3300047469 Bacteria 666
1448 Ga0495684_0004560 3300047471 Bacteria 10830
1449 Ga0495684_0546205 3300047471 Bacteria 790
1450 Ga0495686_0084721 3300047472 Bacteria 1931
1451 Ga0495686_0237528 3300047472 Bacteria 1029
1452 Ga0495686_0291241 3300047472 Bacteria 904
1453 Ga0495686_0340200 3300047472 Bacteria 818
1454 Ga0495686_0662115 3300047472 Bacteria 535
1455 Ga0495593_0000005 3300047673 Bacteria 93984
1456 Ga0495593_0000693 3300047673 Bacteria 19452
1457 Ga0495593_0060438 3300047673 Bacteria 1984
1458 Ga0495593_0538765 3300047673 Bacteria 585
1459 Ga0495602_0002384 3300048088 Bacteria 19072
1460 Ga0495602_0011209 3300048088 Bacteria 9270
1461 Ga0495602_0091870 3300048088 Bacteria 2516
1462 Ga0495614_0136524 3300048089 Bacteria 1088
1463 Ga0495614_0558399 3300048089 Bacteria 548
1464 Ga0495614_0600411 3300048089 Bacteria 529
1465 Ga0496100_0046202 3300048903 Bacteria 2798
1466 Ga0496100_0081119 3300048903 Bacteria 2191
1467 Ga0496100_0361728 3300048903 Bacteria 1098
1468 Ga0496100_0371282 3300048903 Bacteria 1085
1469 Ga0496100_0616748 3300048903 Bacteria 843
1470 Ga0496100_1046215 3300048903 Bacteria 643
1471 Ga0496100_1084970 3300048903 Bacteria 631
1472 Ga0496100_1238871 3300048903 Bacteria 589
1473 Ga0496101_0025652 3300048904 Bacteria 4091
1474 Ga0496101_0394316 3300048904 Bacteria 1090
1475 Ga0496101_0413479 3300048904 Bacteria 1063
1476 Ga0496101_0417264 3300048904 Bacteria 1058
1477 Ga0496101_0621207 3300048904 Bacteria 854
1478 Ga0496101_0943702 3300048904 Bacteria 679
1479 Ga0496101_1152540 3300048904 Bacteria 608
1480 Ga0496101_1433520 3300048904 Bacteria 538
1481 Ga0496102_0017911 3300048905 Bacteria 6213
1482 Ga0496102_0033921 3300048905 Bacteria 4589
1483 Ga0496102_0133958 3300048905 Bacteria 2321
1484 Ga0496102_0144712 3300048905 Bacteria 2230
1485 Ga0496102_0235865 3300048905 Bacteria 1725
1486 Ga0496102_0326158 3300048905 Bacteria 1446
1487 Ga0496102_0826651 3300048905 Bacteria 849
1488 Ga0496102_0918302 3300048905 Bacteria 797
1489 Ga0496103_0053931 3300048906 Bacteria 2492
1490 Ga0496103_0269191 3300048906 Bacteria 1096
1491 Ga0496103_0471277 3300048906 Bacteria 805
1492 Ga0496104_0025402 3300048907 Bacteria 5460
1493 Ga0496104_0045673 3300048907 Bacteria 4121
1494 Ga0496104_0097244 3300048907 Bacteria 2817
1495 Ga0496104_0347410 3300048907 Bacteria 1396
1496 Ga0496104_0550515 3300048907 Bacteria 1064
1497 Ga0496104_0619494 3300048907 Bacteria 992
1498 Ga0496105_0014175 3300048908 Bacteria 6344
1499 Ga0496105_0119142 3300048908 Bacteria 2177
1500 Ga0496105_0120853 3300048908 Bacteria 2160
1501 Ga0496105_0275815 3300048908 Bacteria 1357
1502 Ga0496105_0746137 3300048908 Bacteria 748
1503 Ga0496106_0001014 3300048909 Bacteria 20581
1504 Ga0496106_0003850 3300048909 Bacteria 11185
1505 Ga0496106_0050610 3300048909 Bacteria 3131
1506 Ga0496106_0075546 3300048909 Bacteria 2581
1507 Ga0496106_0287752 3300048909 Bacteria 1317
1508 Ga0496106_0288580 3300048909 Bacteria 1315
1509 Ga0496106_0340030 3300048909 Bacteria 1205
1510 Ga0496107_0001220 3300048910 Bacteria 15676
1511 Ga0496107_0014694 3300048910 Bacteria 5481
1512 Ga0496107_0055422 3300048910 Bacteria 2863
1513 Ga0496107_0865470 3300048910 Bacteria 660
1514 Ga0496107_1291882 3300048910 Bacteria 522
1515 Ga0496108_0000274 3300048911 Bacteria 44298
1516 Ga0496108_0074319 3300048911 Bacteria 2869
1517 Ga0496108_0084230 3300048911 Bacteria 2698
1518 Ga0496108_0251248 3300048911 Bacteria 1538
1519 Ga0496108_0473035 3300048911 Bacteria 1095
1520 Ga0496108_1674155 3300048911 Bacteria 524
1521 Ga0496109_0015843 3300048912 Bacteria 6581
1522 Ga0496109_0094433 3300048912 Bacteria 2768
1523 Ga0496109_0104306 3300048912 Bacteria 2632
1524 Ga0496109_0165348 3300048912 Bacteria 2074
1525 Ga0496109_1197104 3300048912 Bacteria 696
1526 Ga0496109_1214530 3300048912 Bacteria 690
1527 Ga0496109_1614762 3300048912 Bacteria 583
1528 Ga0496109_2028574 3300048912 Bacteria 507
1529 Ga0496110_0021100 3300048913 Bacteria 5506
1530 Ga0496110_0030873 3300048913 Bacteria 4621
1531 Ga0496110_0038340 3300048913 Bacteria 4169
1532 Ga0496110_0063774 3300048913 Bacteria 3256
1533 Ga0496110_0090607 3300048913 Bacteria 2734
1534 Ga0496110_0293749 3300048913 Bacteria 1480
1535 Ga0496111_0058877 3300048914 Bacteria 2782
1536 Ga0496111_0221307 3300048914 Bacteria 1406
1537 Ga0496111_0532449 3300048914 Bacteria 863
1538 Ga0496111_0711294 3300048914 Bacteria 730
1539 Ga0496111_1052523 3300048914 Bacteria 581
1540 Ga0496112_0005625 3300048915 Bacteria 10873
1541 Ga0496112_0031708 3300048915 Bacteria 5126
1542 Ga0496112_0102427 3300048915 Bacteria 2833
1543 Ga0496112_0130345 3300048915 Bacteria 2485
1544 Ga0496112_0136519 3300048915 Bacteria 2422
1545 Ga0496112_1637167 3300048915 Bacteria 557
1546 Ga0496113_0027822 3300048916 Bacteria 4058
1547 Ga0496113_0054366 3300048916 Bacteria 2997
1548 Ga0496113_0172515 3300048916 Bacteria 1713
1549 Ga0496114_0008301 3300048917 Bacteria 8230
1550 Ga0496114_0096582 3300048917 Bacteria 2516
1551 Ga0496114_0489468 3300048917 Bacteria 1088
1552 Ga0496114_0648325 3300048917 Bacteria 929
1553 Ga0496114_0694856 3300048917 Bacteria 892
1554 Ga0496114_1151110 3300048917 Bacteria 661
1555 Ga0496114_1510875 3300048917 Bacteria 559
1556 Ga0496114_1680237 3300048917 Bacteria 523
1557 Ga0496115_0020999 3300048918 Bacteria 5039
1558 Ga0496115_0092884 3300048918 Bacteria 2467
1559 Ga0496115_0100243 3300048918 Bacteria 2374
1560 Ga0496115_0104420 3300048918 Bacteria 2325
1561 Ga0496115_0238735 3300048918 Bacteria 1498
1562 Ga0496115_0357244 3300048918 Bacteria 1191
1563 Ga0496115_1041915 3300048918 Bacteria 623
1564 Ga0496115_1058942 3300048918 Bacteria 617
1565 Ga0496116_0266778 3300048919 Bacteria 840
1566 Ga0496117_0540171 3300048920 Bacteria 557
1567 Ga0496118_0164584 3300048921 Bacteria 1365
1568 Ga0496118_0290295 3300048921 Bacteria 904
1569 Ga0496118_0317300 3300048921 Bacteria 847
1570 Ga0496119_0068236 3300048922 Bacteria 2094
1571 Ga0496119_0236208 3300048922 Bacteria 928
1572 Ga0496119_0286458 3300048922 Bacteria 817
1573 Ga0496119_0488159 3300048922 Bacteria 575
1574 Ga0496120_0182323 3300048923 Bacteria 1030
1575 Ga0496121_0000270 3300048924 Bacteria 108787
1576 Ga0496121_0037967 3300048924 Bacteria 4272
1577 Ga0496121_0071477 3300048924 Bacteria 2790
1578 Ga0496121_0077872 3300048924 Bacteria 2638
1579 Ga0496121_0078410 3300048924 Bacteria 2626
1580 Ga0496121_0079313 3300048924 Bacteria 2607
1581 Ga0496121_0109967 3300048924 Bacteria 2104
1582 Ga0496121_0153113 3300048924 Bacteria 1694
1583 Ga0496121_0433451 3300048924 Bacteria 852
1584 Ga0496121_0503544 3300048924 Bacteria 768
1585 Ga0496121_0625849 3300048924 Bacteria 660
1586 Ga0496121_0784425 3300048924 Bacteria 562
1587 Ga0496124_0302820 3300048927 Bacteria 1153
1588 Ga0496124_0330174 3300048927 Bacteria 1088
1589 Ga0496125_0000328 3300048928 Bacteria 91806
1590 Ga0496125_0042674 3300048928 Bacteria 3860
1591 Ga0496126_0002460 3300048929 Bacteria 24974
1592 Ga0496126_0021716 3300048929 Bacteria 6263
1593 Ga0496126_0024597 3300048929 Bacteria 5811
1594 Ga0496126_0033680 3300048929 Bacteria 4818
1595 Ga0496126_0077456 3300048929 Bacteria 2947
1596 Ga0496126_0116947 3300048929 Bacteria 2317
1597 Ga0496126_0138139 3300048929 Bacteria 2100
1598 Ga0496126_0218863 3300048929 Bacteria 1600
1599 Ga0496126_0295878 3300048929 Bacteria 1337
1600 Ga0496126_0360048 3300048929 Bacteria 1188
1601 Ga0496126_0378869 3300048929 Bacteria 1152
1602 Ga0496126_0395286 3300048929 Bacteria 1122
1603 Ga0496126_0449476 3300048929 Bacteria 1037
1604 Ga0496126_0527481 3300048929 Bacteria 940
1605 Ga0496126_0546930 3300048929 Bacteria 919
1606 Ga0496126_0706589 3300048929 Bacteria 783
1607 Ga0496126_0725418 3300048929 Bacteria 770
1608 Ga0495678_067963 3300049459 Bacteria 1315
1609 Ga0495682_0082711 3300049460 Bacteria 1155
1610 Ga0495682_0113707 3300049460 Bacteria 970
1611 Ga0495682_0170058 3300049460 Bacteria 775
1612 Ga0501031_0006285 3300049568 Bacteria 7741
1613 Ga0501031_0025878 3300049568 Bacteria 3828
1614 Ga0501031_0244855 3300049568 Bacteria 1165
1615 Ga0501032_0000320 3300049569 Bacteria 40199
1616 Ga0501032_0005395 3300049569 Bacteria 9512
1617 Ga0501032_0029580 3300049569 Bacteria 3758
1618 Ga0501032_0111465 3300049569 Bacteria 1810
1619 Ga0501032_0270554 3300049569 Bacteria 1101
1620 Ga0501032_0724994 3300049569 Bacteria 629
1621 Ga0501033_0000440 3300049570 Bacteria 39822
1622 Ga0501033_0004363 3300049570 Bacteria 11336
1623 Ga0501033_0560848 3300049570 Bacteria 786
1624 Ga0501033_0769270 3300049570 Bacteria 652
1625 Ga0501034_0000250 3300049571 Bacteria 99407
1626 Ga0501034_0175296 3300049571 Bacteria 2110
1627 Ga0501034_0364154 3300049571 Bacteria 1372
1628 Ga0501034_0908754 3300049571 Bacteria 768
1629 Ga0501034_0933331 3300049571 Bacteria 754
1630 Ga0501036_0000956 3300049572 Bacteria 21753
1631 Ga0501036_0060965 3300049572 Bacteria 3195
1632 Ga0501036_0419024 3300049572 Bacteria 1116
1633 Ga0501036_0713306 3300049572 Bacteria 828
1634 Ga0501037_0000092 3300049573 Bacteria 83924
1635 Ga0501037_0005763 3300049573 Bacteria 9042
1636 Ga0501037_0355753 3300049573 Bacteria 1009
1637 Ga0501037_0530055 3300049573 Bacteria 796
1638 Ga0501038_0000059 3300049574 Bacteria 92319
1639 Ga0501038_0005534 3300049574 Bacteria 11731
1640 Ga0501038_0008403 3300049574 Bacteria 9494
1641 Ga0501038_0079408 3300049574 Bacteria 2767
1642 Ga0501038_0086948 3300049574 Bacteria 2625
1643 Ga0501038_0851833 3300049574 Bacteria 675
1644 Ga0501039_0000547 3300049575 Bacteria 27186
1645 Ga0501039_0011559 3300049575 Bacteria 6720
1646 Ga0501040_0485546 3300049576 Bacteria 890
1647 Ga0501040_0799197 3300049576 Bacteria 682
1648 Ga0501041_0243047 3300049577 Bacteria 1131
1649 Ga0501042_0003037 3300049578 Bacteria 10439
1650 Ga0501042_0031771 3300049578 Bacteria 3736
1651 Ga0501042_0568941 3300049578 Bacteria 824
1652 Ga0501043_0001889 3300049579 Bacteria 17947
1653 Ga0501043_0003262 3300049579 Bacteria 13373
1654 Ga0501043_0390481 3300049579 Bacteria 1052
1655 Ga0501043_0864630 3300049579 Bacteria 650
1656 Ga0501046_0000483 3300049580 Bacteria 39806
1657 Ga0501046_0017797 3300049580 Bacteria 5928
1658 Ga0501046_0029784 3300049580 Bacteria 4436
1659 Ga0501046_0285350 3300049580 Bacteria 1208
1660 Ga0501046_0622725 3300049580 Bacteria 764
1661 Ga0501047_0000022 3300049581 Bacteria 249062
1662 Ga0501047_0143329 3300049581 Bacteria 2267
1663 Ga0501047_0737276 3300049581 Bacteria 802
1664 Ga0501047_0776831 3300049581 Bacteria 773
1665 Ga0501048_0000821 3300049582 Bacteria 22904
1666 Ga0501048_0347182 3300049582 Bacteria 1058
1667 Ga0501048_0797131 3300049582 Bacteria 679
1668 Ga0501067_0000510 3300049583 Bacteria 21249
1669 Ga0501067_0197783 3300049583 Bacteria 1119
1670 Ga0501067_0293972 3300049583 Bacteria 904
1671 Ga0501068_0034701 3300049584 Bacteria 3010
1672 Ga0501068_0079894 3300049584 Bacteria 2005
1673 Ga0501068_0248611 3300049584 Bacteria 1133
1674 Ga0501069_0031616 3300049585 Bacteria 2912
1675 Ga0501070_0002047 3300049586 Bacteria 17725
1676 Ga0501070_0155649 3300049586 Bacteria 1885
1677 Ga0501070_0403066 3300049586 Bacteria 1106
1678 Ga0501070_0447420 3300049586 Bacteria 1042
1679 Ga0501070_0759950 3300049586 Bacteria 763
1680 Ga0501071_0049592 3300049587 Bacteria 3023
1681 Ga0501071_0084911 3300049587 Bacteria 2321
1682 Ga0501071_0340612 3300049587 Bacteria 1140
1683 Ga0501071_0807074 3300049587 Bacteria 723
1684 Ga0501072_0001893 3300049588 Bacteria 15593
1685 Ga0501072_1566473 3300049588 Bacteria 508
1686 Ga0501073_0000955 3300049589 Bacteria 20800
1687 Ga0501073_0448625 3300049589 Bacteria 892
1688 Ga0501074_0000680 3300049590 Bacteria 21267
1689 Ga0501074_0888054 3300049590 Bacteria 627
1690 Ga0501075_0548228 3300049591 Bacteria 883
1691 Ga0501076_0071221 3300049592 Bacteria 2781
1692 Ga0501076_0503089 3300049592 Bacteria 999
1693 Ga0501079_0026340 3300049741 Bacteria 4459
1694 Ga0501079_0224781 3300049741 Bacteria 1467
1695 Ga0501079_1417338 3300049741 Bacteria 547
1696 Ga0501080_0005687 3300049742 Bacteria 11148
1697 Ga0501080_0812140 3300049742 Bacteria 820
1698 Ga0501081_0699717 3300049743 Bacteria 761
1699 Ga0501083_0000808 3300049744 Bacteria 20535
1700 Ga0501083_0634501 3300049744 Bacteria 695
1701 Ga0501035_0000240 3300049822 Bacteria 65635
1702 Ga0501035_0006394 3300049822 Bacteria 11080
1703 Ga0501035_0121273 3300049822 Bacteria 2285
1704 Ga0501035_1368406 3300049822 Bacteria 543
1705 Ga0501044_0000072 3300049823 Bacteria 124143
1706 Ga0501044_0006535 3300049823 Bacteria 12874
1707 Ga0501044_0592866 3300049823 Bacteria 1002
1708 Ga0501044_0682676 3300049823 Bacteria 914
1709 Ga0501044_1295468 3300049823 Bacteria 595
1710 Ga0501045_0086458 3300049824 Bacteria 2314
1711 Ga0501045_0386297 3300049824 Bacteria 1042
1712 Ga0501045_0565141 3300049824 Bacteria 843
1713 Ga0501045_0842104 3300049824 Bacteria 675
1714 nmdc:mga03683_206255_c1 3300050489 Bacteria 903
1715 nmdc:mga03n38_17121_c1 3300050490 Bacteria 2832
1716 nmdc:mga03n38_320514_c1 3300050490 Bacteria 837
1717 nmdc:mga03n38_328337_c1 3300050490 Bacteria 828
1718 nmdc:mga03n38_983_c1 3300050490 Bacteria 7778
1719 nmdc:mga00v17_100274_c1 3300050491 Bacteria 1827
1720 nmdc:mga00v17_391262_c1 3300050491 Bacteria 904
1721 nmdc:mga00v17_59908_c1 3300050491 Bacteria 2337
1722 nmdc:mga00v17_876347_c1 3300050491 Bacteria 569
1723 nmdc:mga0yw44_109855_c1 3300050492 Bacteria 1766
1724 nmdc:mga0yw44_170723_c1 3300050492 Bacteria 1428
1725 nmdc:mga0yw44_328887_c1 3300050492 Bacteria 1027
1726 nmdc:mga0yw44_341228_c1 3300050492 Bacteria 1008
1727 nmdc:mga0yw44_494609_c1 3300050492 Bacteria 830
1728 nmdc:mga0yw44_551583_c1 3300050492 Bacteria 783
1729 nmdc:mga0k408_63942_c1 3300050493 Bacteria 2141
1730 nmdc:mga06z11_11930_c1 3300050494 Bacteria 3764
1731 nmdc:mga06z11_155605_c1 3300050494 Bacteria 1303
1732 nmdc:mga06z11_256645_c1 3300050494 Bacteria 1031
1733 nmdc:mga06z11_490235_c1 3300050494 Bacteria 744
1734 nmdc:mga06z11_522562_c1 3300050494 Bacteria 720
1735 nmdc:mga06z11_784210_c1 3300050494 Bacteria 581
1736 nmdc:mga06z11_836904_c1 3300050494 Bacteria 561
1737 nmdc:mga04h51_70985_c1 3300050495 Bacteria 1216
1738 nmdc:mga04h51_89255_c1 3300050495 Bacteria 1107
1739 nmdc:mga07m45_294497_c1 3300050496 Bacteria 944
1740 nmdc:mga07m45_31222_c1 3300050496 Bacteria 2244
1741 nmdc:mga07m45_34453_c1 3300050496 Bacteria 2814
1742 nmdc:mga07m45_62214_c1 3300050496 Bacteria 2115
1743 nmdc:mga05p37_1036781_c1 3300050507 Bacteria 867
1744 nmdc:mga05p37_241836_c1 3300050507 Bacteria 2170
1745 nmdc:mga09592_543088_c1 3300050508 Bacteria 998
1746 nmdc:mga08y16_1081850_c1 3300050511 Bacteria 778
1747 nmdc:mga08y16_496491_c1 3300050511 Bacteria 1240
1748 nmdc:mga0n895_24914_c1 3300050512 Bacteria 5645
1749 nmdc:mga0rr50_208515_c1 3300050513 Bacteria 1609
1750 nmdc:mga0sz30_20943_c1 3300050516 Bacteria 2642
1751 nmdc:mga0sz30_69079_c1 3300050516 Bacteria 1519
1752 nmdc:mga0sz30_7938_c1 3300050516 Bacteria 3994
1753 Ga0495601_0011749 3300053077 Bacteria 5250
1754 Ga0495601_0021106 3300053077 Bacteria 3985
1755 Ga0495601_0163249 3300053077 Bacteria 1456
1756 Ga0495601_0280686 3300053077 Bacteria 1086
1757 Ga0495601_0746229 3300053077 Bacteria 623
1758 Ga0495612_0108327 3300053078 Bacteria 1187
1759 Ga0495612_0187503 3300053078 Bacteria 910
1760 Ga0495612_0376459 3300053078 Bacteria 643
1761 Ga0500610_0167213 3300053079 Bacteria 1089
1762 Ga0500610_0171154 3300053079 Bacteria 1072
1763 Ga0500610_0263035 3300053079 Bacteria 786
1764 Ga0500635_0085700 3300053080 Bacteria 1138
1765 Ga0500635_0300343 3300053080 Bacteria 634
1766 Ga0495655_0032404 3300053083 Bacteria 1278
1767 Ga0495655_0055050 3300053083 Bacteria 1066
1768 Ga0495655_0116987 3300053083 Bacteria 807
1769 Ga0495595_0007066 3300053084 Bacteria 4587
1770 Ga0495595_0212423 3300053084 Bacteria 965
1771 Ga0495595_0226318 3300053084 Bacteria 934
1772 Ga0495595_0310414 3300053084 Bacteria 794
1773 Ga0495595_0451990 3300053084 Bacteria 653
1774 Ga0495619_0000330 3300053085 Bacteria 33168
1775 Ga0495619_0039505 3300053085 Bacteria 3081
1776 Ga0495619_0076369 3300053085 Bacteria 2249
1777 Ga0495619_0345896 3300053085 Bacteria 1029
1778 Ga0495619_0953921 3300053085 Bacteria 575
1779 Ga0495619_1170899 3300053085 Bacteria 510
1780 Ga0500578_0163800 3300053086 Bacteria 1378
1781 Ga0500578_0303396 3300053086 Bacteria 946
1782 Ga0500578_0396746 3300053086 Bacteria 796
1783 Ga0500578_0725592 3300053086 Bacteria 532
1784 Ga0500643_096383 3300053087 Bacteria 804
1785 Ga0500644_0204528 3300053088 Bacteria 818
1786 Ga0500646_0040366 3300053090 Bacteria 1312
1787 Ga0500647_0024752 3300053091 Bacteria 2825
1788 Ga0500647_0038499 3300053091 Bacteria 2290
1789 Ga0500583_0157051 3300053092 Bacteria 1133
1790 Ga0500651_0208839 3300053093 Bacteria 1149
1791 Ga0500651_0233431 3300053093 Bacteria 1075
1792 Ga0500566_0000151 3300053094 Bacteria 35674
1793 Ga0500566_0000236 3300053094 Bacteria 29461
1794 Ga0500566_0115922 3300053094 Bacteria 1450
1795 Ga0500640_093752 3300053095 Bacteria 1252
1796 Ga0500641_0007070 3300053096 Bacteria 3996
1797 Ga0500641_0079681 3300053096 Bacteria 1388
1798 Ga0500641_0154087 3300053096 Bacteria 991
1799 Ga0500648_365634 3300053097 Bacteria 576
1800 Ga0500650_0489119 3300053098 Bacteria 524
1801 Ga0500555_092982 3300053103 Bacteria 773
1802 Ga0500555_094404 3300053103 Bacteria 765
1803 Ga0500562_023343 3300053108 Bacteria 1614
1804 Ga0500569_001904 3300053109 Bacteria 4027
1805 Ga0500572_004100 3300053111 Bacteria 3309
1806 Ga0500594_0118598 3300053118 Bacteria 829
1807 Ga0500595_001612 3300053119 Bacteria 11886
1808 Ga0500595_011064 3300053119 Bacteria 3552
1809 Ga0500595_014944 3300053119 Bacteria 2929
1810 Ga0500595_053895 3300053119 Bacteria 1236
1811 Ga0500597_055128 3300053120 Bacteria 1700
1812 Ga0500607_019113 3300053121 Bacteria 3882
1813 Ga0500608_029113 3300053122 Bacteria 2611
1814 Ga0500608_109802 3300053122 Bacteria 1266
1815 Ga0500614_014155 3300053123 Bacteria 1762
1816 Ga0500614_019715 3300053123 Bacteria 1548
1817 Ga0500617_095330 3300053124 Bacteria 1266
1818 Ga0500621_031297 3300053126 Bacteria 2114
1819 Ga0500621_268406 3300053126 Bacteria 563
1820 Ga0500628_148696 3300053129 Bacteria 654
1821 Ga0500642_0000062 3300053130 Bacteria 58970
1822 Ga0500642_0403902 3300053130 Bacteria 595
1823 Ga0500655_060730 3300053133 Bacteria 761
1824 Ga0500658_0041496 3300053134 Bacteria 1846
1825 Ga0500658_0112952 3300053134 Bacteria 1197
1826 Ga0500658_0196857 3300053134 Bacteria 921
1827 Ga0500658_0420295 3300053134 Bacteria 611
1828 Ga0500559_0041843 3300053136 Bacteria 1997
1829 Ga0500559_0140307 3300053136 Bacteria 1131
1830 Ga0500564_249242 3300053138 Bacteria 704
1831 Ga0500568_0038973 3300053139 Bacteria 1921
1832 Ga0500568_0057840 3300053139 Bacteria 1508
1833 Ga0500568_0101460 3300053139 Bacteria 1079
1834 Ga0500577_0004895 3300053142 Bacteria 3567
1835 Ga0500577_0171763 3300053142 Bacteria 927
1836 Ga0500577_0248281 3300053142 Bacteria 773
1837 Ga0500579_202394 3300053143 Bacteria 731
1838 Ga0500588_0014119 3300053146 Bacteria 2017
1839 Ga0500588_0184185 3300053146 Bacteria 768
1840 Ga0500589_084895 3300053147 Bacteria 1407
1841 Ga0500589_158992 3300053147 Bacteria 910
1842 Ga0500590_050834 3300053148 Bacteria 2107
1843 Ga0500590_134232 3300053148 Bacteria 1141
1844 Ga0500603_014952 3300053150 Bacteria 1819
1845 Ga0500603_124663 3300053150 Bacteria 783
1846 Ga0500619_082511 3300053154 Bacteria 1080
1847 Ga0500619_216905 3300053154 Bacteria 638
1848 Ga0500620_019306 3300053155 Bacteria 2001
1849 Ga0500622_0174713 3300053156 Bacteria 997
1850 Ga0500624_051485 3300053157 Bacteria 767
1851 Ga0500627_0089888 3300053158 Bacteria 1374
1852 Ga0500634_0268119 3300053161 Bacteria 697
1853 Ga0500638_013587 3300053162 Bacteria 3689
1854 Ga0500638_057856 3300053162 Bacteria 1866
1855 Ga0500638_121946 3300053162 Bacteria 1192
1856 Ga0500636_0009392 3300053177 Bacteria 5682
1857 Ga0500636_0210699 3300053177 Bacteria 1020
1858 Ga0500637_0105831 3300053178 Bacteria 1631
1859 Ga0500637_0341176 3300053178 Bacteria 801
1860 Ga0500637_0540826 3300053178 Bacteria 566
1861 Ga0500637_0610219 3300053178 Bacteria 515
1862 Ga0500576_130793 3300053725 Bacteria 972
1863 Ga0500611_037017 3300053727 Bacteria 1048
1864 Ga0500611_173831 3300053727 Bacteria 601
1865 Ga0500625_012606 3300053729 Bacteria 3867
1866 Ga0500645_027197 3300053730 Bacteria 1735
1867 Ga0500645_028443 3300053730 Bacteria 1691
1868 Ga0500609_002131 3300053731 Bacteria 2835
1869 Ga0500656_004887 3300053732 Bacteria 1307
1870 Ga0500596_003468 3300053735 Bacteria 2993
1871 Ga0500601_000544 3300053737 Bacteria 5588
1872 Ga0500587_026587 3300053739 Bacteria 777
1873 Ga0501084_0003295 3300054114 Bacteria 13068
1874 Ga0501084_0603257 3300054114 Bacteria 928
1875 Ga0501082_0001185 3300060353 Bacteria 22911
1876 Ga0501082_0295227 3300060353 Bacteria 1411
1877 Ga0466962_0088033 3300061719 Bacteria 1487
1878 Ga0530510_0179764 3300061734 Bacteria 1569
1879 Ga0530510_1598571 3300061734 Bacteria 501

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300001904 JGI24736J21556_1024079 JGI24736J21556_10240792 106
2 3300001989 JGI24739J22299_10117614 JGI24739J22299_101176142 106
3 3300001989 JGI24739J22299_10264068 JGI24739J22299_102640681 106
4 3300001990 JGI24737J22298_10187533 JGI24737J22298_101875331 106
5 3300003215 JGI25153J46596_10019717 JGI25153J46596_100197172 106
6 3300003354 JGI25160J50197_1006536 JGI25160J50197_10065362 106
7 3300003752 Ga0055539_1014059 Ga0055539_10140592 106
8 3300003762 Ga0055542_1015953 Ga0055542_10159532 106
9 3300005262 Ga0065165_1026366 Ga0065165_10263662 106
10 3300005328 Ga0070676_10825100 Ga0070676_108251002 106
11 3300005331 Ga0070670_100124293 Ga0070670_1001242933 106
12 3300005335 Ga0070666_10084658 Ga0070666_100846582 106
13 3300005335 Ga0070666_10224326 Ga0070666_102243262 106
14 3300005338 Ga0068868_100521005 Ga0068868_1005210052 106
15 3300005339 Ga0070660_100997233 Ga0070660_1009972331 106
16 3300005347 Ga0070668_100181981 Ga0070668_1001819812 106
17 3300005347 Ga0070668_100234097 Ga0070668_1002340972 106
18 3300005347 Ga0070668_101721529 Ga0070668_1017215291 106
19 3300005353 Ga0070669_100619312 Ga0070669_1006193122 106
20 3300005353 Ga0070669_100720093 Ga0070669_1007200932 106
21 3300005355 Ga0070671_100325327 Ga0070671_1003253272 106
22 3300005367 Ga0070667_100151700 Ga0070667_1001517002 106
23 3300005367 Ga0070667_102175287 Ga0070667_1021752871 106
24 3300005434 Ga0070709_10771506 Ga0070709_107715062 106
25 3300005435 Ga0070714_101833280 Ga0070714_1018332801 106
26 3300005455 Ga0070663_100210427 Ga0070663_1002104272 106
27 3300005455 Ga0070663_100532632 Ga0070663_1005326322 106
28 3300005457 Ga0070662_100604614 Ga0070662_1006046141 106
29 3300005459 Ga0068867_101318992 Ga0068867_1013189921 106
30 3300005539 Ga0068853_100888270 Ga0068853_1008882702 106
31 3300005548 Ga0070665_100315093 Ga0070665_1003150932 106
32 3300005578 Ga0068854_100968116 Ga0068854_1009681161 106
33 3300005614 Ga0068856_100560752 Ga0068856_1005607522 106
34 3300005616 Ga0068852_101478324 Ga0068852_1014783242 106
35 3300005617 Ga0068859_101793874 Ga0068859_1017938742 106
36 3300005719 Ga0068861_100410806 Ga0068861_1004108062 106
37 3300005834 Ga0068851_11019605 Ga0068851_110196051 106
38 3300005840 Ga0068870_10499468 Ga0068870_104994682 106
39 3300005841 Ga0068863_100762772 Ga0068863_1007627722 106
40 3300005842 Ga0068858_100157005 Ga0068858_1001570053 106
41 3300005842 Ga0068858_100547893 Ga0068858_1005478932 106
42 3300005843 Ga0068860_100582875 Ga0068860_1005828752 106
43 3300005844 Ga0068862_100887281 Ga0068862_1008872812 106
44 3300005983 Ga0081540_1038652 Ga0081540_10386523 106
45 3300006038 Ga0075365_10362132 Ga0075365_103621322 106
46 3300006038 Ga0075365_10440310 Ga0075365_104403102 106
47 3300006042 Ga0075368_10005988 Ga0075368_100059886 106
48 3300006048 Ga0075363_100062743 Ga0075363_1000627434 106
49 3300006048 Ga0075363_100181568 Ga0075363_1001815682 106
50 3300006051 Ga0075364_10082468 Ga0075364_100824683 106
51 3300006173 Ga0070716_101409677 Ga0070716_1014096771 106
52 3300006178 Ga0075367_10428611 Ga0075367_104286111 106
53 3300006178 Ga0075367_10896376 Ga0075367_108963761 106
54 3300006237 Ga0097621_100766937 Ga0097621_1007669371 106
55 3300006353 Ga0075370_10031153 Ga0075370_100311532 106
56 3300006358 Ga0068871_100930402 Ga0068871_1009304022 106
57 3300006358 Ga0068871_101555569 Ga0068871_1015555692 106
58 3300006358 Ga0068871_101756820 Ga0068871_1017568201 106
59 3300006931 Ga0097620_101793827 Ga0097620_1017938272 106
60 3300009093 Ga0105240_10003692 Ga0105240_100036927 106
61 3300009093 Ga0105240_11155329 Ga0105240_111553291 106
62 3300009098 Ga0105245_10290939 Ga0105245_102909392 106
63 3300009098 Ga0105245_11178370 Ga0105245_111783702 106
64 3300009098 Ga0105245_11777134 Ga0105245_117771341 106
65 3300009101 Ga0105247_10100668 Ga0105247_101006682 106
66 3300009101 Ga0105247_10109440 Ga0105247_101094403 106
67 3300009101 Ga0105247_10253408 Ga0105247_102534082 106
68 3300009148 Ga0105243_10571136 Ga0105243_105711362 106
69 3300009174 Ga0105241_10033880 Ga0105241_100338803 106
70 3300009174 Ga0105241_10112589 Ga0105241_101125892 106
71 3300009174 Ga0105241_10516550 Ga0105241_105165502 106
72 3300009174 Ga0105241_10698053 Ga0105241_106980532 106
73 3300009177 Ga0105248_10248209 Ga0105248_102482093 106
74 3300009177 Ga0105248_10845006 Ga0105248_108450061 106
75 3300009177 Ga0105248_11006317 Ga0105248_110063172 106
76 3300009177 Ga0105248_11016606 Ga0105248_110166062 106
77 3300009545 Ga0105237_10053702 Ga0105237_100537023 106
78 3300009551 Ga0105238_10639389 Ga0105238_106393892 106
79 3300009551 Ga0105238_11073430 Ga0105238_110734301 106
80 3300009551 Ga0105238_13080343 Ga0105238_130803431 106
81 3300010375 Ga0105239_10076115 Ga0105239_100761152 106
82 3300010375 Ga0105239_11299329 Ga0105239_112993292 106
83 3300013105 Ga0157369_11166154 Ga0157369_111661541 106
84 3300013296 Ga0157374_10102653 Ga0157374_101026532 106
85 3300013297 Ga0157378_10349381 Ga0157378_103493812 106
86 3300013297 Ga0157378_10968806 Ga0157378_109688061 106
87 3300013297 Ga0157378_13195340 Ga0157378_131953402 106
88 3300013306 Ga0163162_10200686 Ga0163162_102006862 106
89 3300013308 Ga0157375_10869363 Ga0157375_108693632 106
90 3300014325 Ga0163163_10388031 Ga0163163_103880312 106
91 3300014325 Ga0163163_10525788 Ga0163163_105257882 106
92 3300014326 Ga0157380_10427641 Ga0157380_104276412 106
93 3300014497 Ga0182008_10414868 Ga0182008_104148682 106
94 3300014968 Ga0157379_10683597 Ga0157379_106835972 106
95 3300014968 Ga0157379_11551560 Ga0157379_115515602 106
96 3300014969 Ga0157376_10419054 Ga0157376_104190542 106
97 3300025900 Ga0207710_10376181 Ga0207710_103761812 106
98 3300025908 Ga0207643_10190848 Ga0207643_101908482 106
99 3300025914 Ga0207671_10472565 Ga0207671_104725652 106
100 3300025927 Ga0207687_11012114 Ga0207687_110121141 106
101 3300025941 Ga0207711_10898658 Ga0207711_108986582 106
102 3300025960 Ga0207651_10279639 Ga0207651_102796392 106
103 3300025986 Ga0207658_10414050 Ga0207658_104140502 106
104 3300026067 Ga0207678_10133616 Ga0207678_101336163 106
105 3300026088 Ga0207641_11744686 Ga0207641_117446862 106
106 3300026089 Ga0207648_11014704 Ga0207648_110147042 106
107 iso_pu_bacteria 2929624759 2929628740 106
108 iso_pu_bacteria 2932784394 2932792897 106
109 iso_pu_bacteria 2932809354 2932812192 106
110 iso_pu_bacteria 2932818245 2932823182 106
111 iso_pu_bacteria 2932828146 2932836098 106
112 iso_pu_bacteria 2933577622 2933580713 106
113 iso_pu_bacteria 2935616580 2935618495 106
114 iso_pu_bacteria 2935638405 2935641104 106
115 iso_pu_bacteria 2935665750 2935670020 106
116 iso_pu_bacteria 2935684952 2935689996 106
117 iso_pu_bacteria 2935694250 2935698518 106
118 iso_pu_bacteria 2935703347 2935711454 106
119 iso_pu_bacteria 2935713505 2935717515 106
120 iso_pu_bacteria 2935722832 2935723815 106
121 iso_pu_bacteria 2935732158 2935740024 106
122 iso_pu_bacteria 2935741537 2935749287 106
123 iso_pu_bacteria 2935750917 2935757350 106
124 iso_pu_bacteria 2935760218 2935763562 106
125 iso_pu_bacteria 2935801545 2935809984 106
126 iso_pu_bacteria 2935827899 2935835683 106
127 iso_pu_bacteria 2935837841 2935844634 106
128 iso_pu_bacteria 2935855204 2935862920 106
129 iso_pu_bacteria 2935864058 2935866662 106
130 iso_pu_bacteria 2935873716 2935874969 106
131 iso_pu_bacteria 2935992306 2935999755 106
132 iso_pu_bacteria 2936002035 2936010547 106
133 iso_pu_bacteria 2940556831 2940563263 106
134 iso_pu_bacteria 2941538514 2941543181 106
135 iso_pu_bacteria 8016511872 8016518210 106
136 iso_pu_bacteria 8017057580 8017058439 106
137 iso_pu_bacteria 8019576017 8019577258 106
138 iso_pu_bacteria 8019586578 8019595338 106
139 iso_pu_bacteria 8019597564 8019606421 106
140 iso_pu_bacteria 8019608314 8019612107 106
141 iso_pu_bacteria 8055742211 8055742425 106
142 3300000531 CNBas_1002966 CNBas_10029662 107
143 3300000532 CNAas_1012198 CNAas_10121981 107
144 3300001990 JGI24737J22298_10211218 JGI24737J22298_102112181 107
145 3300002067 JGI24735J21928_10063713 JGI24735J21928_100637132 107
146 3300002070 JGI24750J21931_1013141 JGI24750J21931_10131411 107
147 3300002074 JGI24748J21848_1032288 JGI24748J21848_10322882 107
148 3300002077 JGI24744J21845_10036124 JGI24744J21845_100361242 107
149 3300002155 JGI24033J26618_1047418 JGI24033J26618_10474181 107
150 3300002244 JGI24742J22300_10021885 JGI24742J22300_100218852 107
151 3300003215 JGI25153J46596_10000221 JGI25153J46596_100002214 107
152 3300003215 JGI25153J46596_10001035 JGI25153J46596_100010358 107
153 3300003215 JGI25153J46596_10005832 JGI25153J46596_100058326 107
154 3300003215 JGI25153J46596_10054684 JGI25153J46596_100546842 107
155 3300003354 JGI25160J50197_1001121 JGI25160J50197_10011216 107
156 3300003354 JGI25160J50197_1018359 JGI25160J50197_10183592 107
157 3300003659 JGI25404J52841_10009687 JGI25404J52841_100096873 107
158 3300003659 JGI25404J52841_10109270 JGI25404J52841_101092702 107
159 3300003771 Ga0055526_1031307 Ga0055526_10313072 107
160 3300003775 Ga0055524_1024613 Ga0055524_10246132 107
161 3300003794 Ga0055531_10016379 Ga0055531_100163793 107
162 3300004625 Ga0055543_1007248 Ga0055543_10072483 107
163 3300004800 Ga0058861_11389720 Ga0058861_113897201 107
164 3300005262 Ga0065165_1001316 Ga0065165_10013162 107
165 3300005262 Ga0065165_1003932 Ga0065165_10039327 107
166 3300005262 Ga0065165_1027065 Ga0065165_10270653 107
167 3300005295 Ga0065707_10035201 Ga0065707_100352012 107
168 3300005327 Ga0070658_10246411 Ga0070658_102464112 107
169 3300005327 Ga0070658_10253980 Ga0070658_102539802 107
170 3300005327 Ga0070658_10396160 Ga0070658_103961602 107
171 3300005327 Ga0070658_10426702 Ga0070658_104267022 107
172 3300005328 Ga0070676_10165502 Ga0070676_101655022 107
173 3300005328 Ga0070676_10565386 Ga0070676_105653862 107
174 3300005329 Ga0070683_100012115 Ga0070683_1000121155 107
175 3300005329 Ga0070683_100032899 Ga0070683_1000328996 107
176 3300005329 Ga0070683_100296902 Ga0070683_1002969022 107
177 3300005329 Ga0070683_101332988 Ga0070683_1013329881 107
178 3300005330 Ga0070690_100107265 Ga0070690_1001072652 107
179 3300005330 Ga0070690_100200909 Ga0070690_1002009091 107
180 3300005330 Ga0070690_100659830 Ga0070690_1006598301 107
181 3300005333 Ga0070677_10125740 Ga0070677_101257401 107
182 3300005334 Ga0068869_100200481 Ga0068869_1002004813 107
183 3300005334 Ga0068869_100654083 Ga0068869_1006540832 107
184 3300005334 Ga0068869_100779365 Ga0068869_1007793651 107
185 3300005334 Ga0068869_101312554 Ga0068869_1013125541 107
186 3300005334 Ga0068869_101679646 Ga0068869_1016796461 107
187 3300005335 Ga0070666_10412595 Ga0070666_104125952 107
188 3300005335 Ga0070666_10938083 Ga0070666_109380832 107
189 3300005336 Ga0070680_100021893 Ga0070680_1000218936 107
190 3300005336 Ga0070680_100041333 Ga0070680_1000413333 107
191 3300005336 Ga0070680_100061088 Ga0070680_1000610882 107
192 3300005336 Ga0070680_100081735 Ga0070680_1000817353 107
193 3300005336 Ga0070680_100081948 Ga0070680_1000819483 107
194 3300005336 Ga0070680_100397562 Ga0070680_1003975621 107
195 3300005336 Ga0070680_101151084 Ga0070680_1011510842 107
196 3300005336 Ga0070680_101406289 Ga0070680_1014062891 107
197 3300005337 Ga0070682_100548039 Ga0070682_1005480392 107
198 3300005337 Ga0070682_100857770 Ga0070682_1008577701 107
199 3300005337 Ga0070682_101905023 Ga0070682_1019050231 107
200 3300005338 Ga0068868_100036523 Ga0068868_1000365233 107
201 3300005338 Ga0068868_100112352 Ga0068868_1001123523 107
202 3300005338 Ga0068868_100248452 Ga0068868_1002484522 107
203 3300005338 Ga0068868_100966144 Ga0068868_1009661442 107
204 3300005339 Ga0070660_100522676 Ga0070660_1005226762 107
205 3300005339 Ga0070660_100537287 Ga0070660_1005372872 107
206 3300005339 Ga0070660_100555828 Ga0070660_1005558281 107
207 3300005340 Ga0070689_101092291 Ga0070689_1010922911 107
208 3300005341 Ga0070691_10125712 Ga0070691_101257121 107
209 3300005341 Ga0070691_10501061 Ga0070691_105010612 107
210 3300005343 Ga0070687_100559040 Ga0070687_1005590401 107
211 3300005344 Ga0070661_100407786 Ga0070661_1004077862 107
212 3300005344 Ga0070661_100511131 Ga0070661_1005111311 107
213 3300005344 Ga0070661_100519782 Ga0070661_1005197822 107
214 3300005344 Ga0070661_100843811 Ga0070661_1008438111 107
215 3300005345 Ga0070692_10453986 Ga0070692_104539861 107
216 3300005345 Ga0070692_10540729 Ga0070692_105407292 107
217 3300005345 Ga0070692_10654704 Ga0070692_106547042 107
218 3300005347 Ga0070668_100139683 Ga0070668_1001396832 107
219 3300005347 Ga0070668_100208285 Ga0070668_1002082852 107
220 3300005347 Ga0070668_100248638 Ga0070668_1002486382 107
221 3300005347 Ga0070668_100654400 Ga0070668_1006544002 107
222 3300005347 Ga0070668_100921811 Ga0070668_1009218112 107
223 3300005353 Ga0070669_100162026 Ga0070669_1001620261 107
224 3300005354 Ga0070675_100258468 Ga0070675_1002584682 107
225 3300005354 Ga0070675_100306301 Ga0070675_1003063012 107
226 3300005354 Ga0070675_101686990 Ga0070675_1016869901 107
227 3300005355 Ga0070671_100286033 Ga0070671_1002860332 107
228 3300005355 Ga0070671_100912382 Ga0070671_1009123821 107
229 3300005355 Ga0070671_101076625 Ga0070671_1010766252 107
230 3300005355 Ga0070671_101286845 Ga0070671_1012868451 107
231 3300005355 Ga0070671_101294891 Ga0070671_1012948911 107
232 3300005356 Ga0070674_100025078 Ga0070674_1000250783 107
233 3300005356 Ga0070674_100053579 Ga0070674_1000535792 107
234 3300005356 Ga0070674_101009521 Ga0070674_1010095212 107
235 3300005356 Ga0070674_101751632 Ga0070674_1017516321 107
236 3300005364 Ga0070673_100658993 Ga0070673_1006589932 107
237 3300005364 Ga0070673_102054431 Ga0070673_1020544311 107
238 3300005365 Ga0070688_100556269 Ga0070688_1005562692 107
239 3300005365 Ga0070688_100702043 Ga0070688_1007020432 107
240 3300005366 Ga0070659_100312812 Ga0070659_1003128122 107
241 3300005366 Ga0070659_100349311 Ga0070659_1003493111 107
242 3300005366 Ga0070659_101197785 Ga0070659_1011977852 107
243 3300005366 Ga0070659_101351673 Ga0070659_1013516732 107
244 3300005367 Ga0070667_100379127 Ga0070667_1003791272 107
245 3300005367 Ga0070667_101039530 Ga0070667_1010395301 107
246 3300005406 Ga0070703_10060921 Ga0070703_100609212 107
247 3300005434 Ga0070709_10001093 Ga0070709_100010933 107
248 3300005434 Ga0070709_10002047 Ga0070709_100020475 107
249 3300005434 Ga0070709_10060399 Ga0070709_100603992 107
250 3300005435 Ga0070714_100024145 Ga0070714_1000241453 107
251 3300005435 Ga0070714_100151553 Ga0070714_1001515533 107
252 3300005435 Ga0070714_100307662 Ga0070714_1003076622 107
253 3300005435 Ga0070714_100480845 Ga0070714_1004808451 107
254 3300005436 Ga0070713_100002424 Ga0070713_1000024242 107
255 3300005436 Ga0070713_100010687 Ga0070713_1000106875 107
256 3300005436 Ga0070713_100018563 Ga0070713_1000185633 107
257 3300005436 Ga0070713_100289988 Ga0070713_1002899882 107
258 3300005436 Ga0070713_102056293 Ga0070713_1020562931 107
259 3300005436 Ga0070713_102127381 Ga0070713_1021273811 107
260 3300005437 Ga0070710_10001602 Ga0070710_100016025 107
261 3300005437 Ga0070710_10027306 Ga0070710_100273063 107
262 3300005437 Ga0070710_10078656 Ga0070710_100786563 107
263 3300005437 Ga0070710_10738529 Ga0070710_107385292 107
264 3300005437 Ga0070710_11171342 Ga0070710_111713421 107
265 3300005438 Ga0070701_10127778 Ga0070701_101277782 107
266 3300005439 Ga0070711_100004532 Ga0070711_1000045326 107
267 3300005439 Ga0070711_100027072 Ga0070711_1000270723 107
268 3300005439 Ga0070711_100037077 Ga0070711_1000370773 107
269 3300005439 Ga0070711_100243523 Ga0070711_1002435231 107
270 3300005439 Ga0070711_100309990 Ga0070711_1003099902 107
271 3300005440 Ga0070705_100180782 Ga0070705_1001807821 107
272 3300005441 Ga0070700_100204092 Ga0070700_1002040922 107
273 3300005441 Ga0070700_100309410 Ga0070700_1003094102 107
274 3300005444 Ga0070694_100292553 Ga0070694_1002925532 107
275 3300005444 Ga0070694_101740893 Ga0070694_1017408932 107
276 3300005445 Ga0070708_100985474 Ga0070708_1009854741 107
277 3300005445 Ga0070708_102220742 Ga0070708_1022207421 107
278 3300005455 Ga0070663_100026919 Ga0070663_1000269194 107
279 3300005455 Ga0070663_100041057 Ga0070663_1000410573 107
280 3300005455 Ga0070663_100129420 Ga0070663_1001294203 107
281 3300005455 Ga0070663_100229402 Ga0070663_1002294022 107
282 3300005455 Ga0070663_100296680 Ga0070663_1002966802 107
283 3300005455 Ga0070663_100677573 Ga0070663_1006775732 107
284 3300005456 Ga0070678_100102458 Ga0070678_1001024582 107
285 3300005456 Ga0070678_100273513 Ga0070678_1002735132 107
286 3300005456 Ga0070678_100371813 Ga0070678_1003718132 107
287 3300005456 Ga0070678_100774182 Ga0070678_1007741822 107
288 3300005457 Ga0070662_100532736 Ga0070662_1005327362 107
289 3300005457 Ga0070662_100838270 Ga0070662_1008382702 107
290 3300005457 Ga0070662_101119770 Ga0070662_1011197702 107
291 3300005458 Ga0070681_10006927 Ga0070681_1000692710 107
292 3300005458 Ga0070681_10039716 Ga0070681_100397166 107
293 3300005458 Ga0070681_10292228 Ga0070681_102922282 107
294 3300005458 Ga0070681_10419257 Ga0070681_104192572 107
295 3300005459 Ga0068867_100150313 Ga0068867_1001503132 107
296 3300005459 Ga0068867_100486950 Ga0068867_1004869502 107
297 3300005459 Ga0068867_100555072 Ga0068867_1005550722 107
298 3300005459 Ga0068867_101712036 Ga0068867_1017120361 107
299 3300005459 Ga0068867_101755964 Ga0068867_1017559641 107
300 3300005459 Ga0068867_102382347 Ga0068867_1023823471 107
301 3300005466 Ga0070685_10113689 Ga0070685_101136892 107
302 3300005467 Ga0070706_100394146 Ga0070706_1003941462 107
303 3300005467 Ga0070706_100497850 Ga0070706_1004978502 107
304 3300005467 Ga0070706_101366872 Ga0070706_1013668722 107
305 3300005467 Ga0070706_101777937 Ga0070706_1017779371 107
306 3300005518 Ga0070699_100092503 Ga0070699_1000925032 107
307 3300005530 Ga0070679_100024870 Ga0070679_1000248703 107
308 3300005530 Ga0070679_100039539 Ga0070679_1000395396 107
309 3300005530 Ga0070679_100043536 Ga0070679_1000435366 107
310 3300005530 Ga0070679_100065012 Ga0070679_1000650122 107
311 3300005535 Ga0070684_100030415 Ga0070684_1000304152 107
312 3300005535 Ga0070684_100078765 Ga0070684_1000787652 107
313 3300005535 Ga0070684_100666325 Ga0070684_1006663252 107
314 3300005535 Ga0070684_101038211 Ga0070684_1010382112 107
315 3300005535 Ga0070684_101359640 Ga0070684_1013596402 107
316 3300005536 Ga0070697_100334614 Ga0070697_1003346142 107
317 3300005536 Ga0070697_100337494 Ga0070697_1003374942 107
318 3300005539 Ga0068853_100143372 Ga0068853_1001433723 107
319 3300005539 Ga0068853_100354768 Ga0068853_1003547682 107
320 3300005539 Ga0068853_100520442 Ga0068853_1005204422 107
321 3300005539 Ga0068853_100709847 Ga0068853_1007098471 107
322 3300005539 Ga0068853_101410841 Ga0068853_1014108412 107
323 3300005543 Ga0070672_100111128 Ga0070672_1001111281 107
324 3300005543 Ga0070672_100118941 Ga0070672_1001189412 107
325 3300005543 Ga0070672_100201667 Ga0070672_1002016672 107
326 3300005543 Ga0070672_100795956 Ga0070672_1007959562 107
327 3300005544 Ga0070686_100131755 Ga0070686_1001317552 107
328 3300005544 Ga0070686_100871560 Ga0070686_1008715602 107
329 3300005546 Ga0070696_100329256 Ga0070696_1003292562 107
330 3300005547 Ga0070693_100079188 Ga0070693_1000791883 107
331 3300005547 Ga0070693_100243608 Ga0070693_1002436082 107
332 3300005547 Ga0070693_100498195 Ga0070693_1004981952 107
333 3300005547 Ga0070693_100512522 Ga0070693_1005125222 107
334 3300005548 Ga0070665_100009471 Ga0070665_1000094713 107
335 3300005548 Ga0070665_100061030 Ga0070665_1000610302 107
336 3300005548 Ga0070665_100104790 Ga0070665_1001047903 107
337 3300005548 Ga0070665_100110787 Ga0070665_1001107871 107
338 3300005548 Ga0070665_100227219 Ga0070665_1002272193 107
339 3300005548 Ga0070665_100547230 Ga0070665_1005472302 107
340 3300005548 Ga0070665_100622349 Ga0070665_1006223492 107
341 3300005548 Ga0070665_100944618 Ga0070665_1009446182 107
342 3300005548 Ga0070665_101927303 Ga0070665_1019273032 107
343 3300005549 Ga0070704_100269665 Ga0070704_1002696652 107
344 3300005549 Ga0070704_102158983 Ga0070704_1021589831 107
345 3300005563 Ga0068855_100084885 Ga0068855_1000848853 107
346 3300005563 Ga0068855_100151304 Ga0068855_1001513043 107
347 3300005563 Ga0068855_100161333 Ga0068855_1001613333 107
348 3300005563 Ga0068855_100427183 Ga0068855_1004271832 107
349 3300005563 Ga0068855_100792747 Ga0068855_1007927472 107
350 3300005563 Ga0068855_101198613 Ga0068855_1011986132 107
351 3300005564 Ga0070664_100155773 Ga0070664_1001557732 107
352 3300005564 Ga0070664_100192653 Ga0070664_1001926532 107
353 3300005564 Ga0070664_100976107 Ga0070664_1009761072 107
354 3300005577 Ga0068857_100096869 Ga0068857_1000968693 107
355 3300005577 Ga0068857_100522431 Ga0068857_1005224312 107
356 3300005578 Ga0068854_100472931 Ga0068854_1004729312 107
357 3300005578 Ga0068854_100543199 Ga0068854_1005431992 107
358 3300005578 Ga0068854_100728123 Ga0068854_1007281231 107
359 3300005614 Ga0068856_100006298 Ga0068856_1000062984 107
360 3300005614 Ga0068856_100199112 Ga0068856_1001991121 107
361 3300005614 Ga0068856_100308614 Ga0068856_1003086142 107
362 3300005614 Ga0068856_100596687 Ga0068856_1005966872 107
363 3300005614 Ga0068856_100693739 Ga0068856_1006937391 107
364 3300005614 Ga0068856_101028802 Ga0068856_1010288022 107
365 3300005614 Ga0068856_101224351 Ga0068856_1012243512 107
366 3300005614 Ga0068856_101851719 Ga0068856_1018517192 107
367 3300005615 Ga0070702_100135495 Ga0070702_1001354952 107
368 3300005615 Ga0070702_100194365 Ga0070702_1001943652 107
369 3300005615 Ga0070702_100446817 Ga0070702_1004468172 107
370 3300005615 Ga0070702_101315052 Ga0070702_1013150522 107
371 3300005616 Ga0068852_100059448 Ga0068852_1000594484 107
372 3300005616 Ga0068852_100060314 Ga0068852_1000603142 107
373 3300005616 Ga0068852_100169060 Ga0068852_1001690602 107
374 3300005616 Ga0068852_100357009 Ga0068852_1003570093 107
375 3300005616 Ga0068852_100578541 Ga0068852_1005785412 107
376 3300005616 Ga0068852_102004022 Ga0068852_1020040221 107
377 3300005616 Ga0068852_102534216 Ga0068852_1025342161 107
378 3300005616 Ga0068852_102631012 Ga0068852_1026310121 107
379 3300005617 Ga0068859_100273826 Ga0068859_1002738262 107
380 3300005617 Ga0068859_100427224 Ga0068859_1004272242 107
381 3300005617 Ga0068859_101634509 Ga0068859_1016345091 107
382 3300005617 Ga0068859_102836019 Ga0068859_1028360191 107
383 3300005718 Ga0068866_10010313 Ga0068866_100103133 107
384 3300005718 Ga0068866_10083946 Ga0068866_100839462 107
385 3300005719 Ga0068861_100046609 Ga0068861_1000466092 107
386 3300005719 Ga0068861_100340921 Ga0068861_1003409211 107
387 3300005719 Ga0068861_100839046 Ga0068861_1008390461 107
388 3300005719 Ga0068861_101135696 Ga0068861_1011356961 107
389 3300005719 Ga0068861_102423037 Ga0068861_1024230371 107
390 3300005834 Ga0068851_10292949 Ga0068851_102929492 107
391 3300005834 Ga0068851_10645094 Ga0068851_106450941 107
392 3300005840 Ga0068870_10069899 Ga0068870_100698992 107
393 3300005840 Ga0068870_10277824 Ga0068870_102778242 107
394 3300005840 Ga0068870_11143007 Ga0068870_111430071 107
395 3300005841 Ga0068863_100346564 Ga0068863_1003465642 107
396 3300005841 Ga0068863_100563547 Ga0068863_1005635472 107
397 3300005841 Ga0068863_101209785 Ga0068863_1012097851 107
398 3300005841 Ga0068863_101929299 Ga0068863_1019292991 107
399 3300005842 Ga0068858_100051837 Ga0068858_1000518373 107
400 3300005842 Ga0068858_100563276 Ga0068858_1005632762 107
401 3300005842 Ga0068858_100570231 Ga0068858_1005702312 107
402 3300005842 Ga0068858_100611555 Ga0068858_1006115552 107
403 3300005842 Ga0068858_102225217 Ga0068858_1022252171 107
404 3300005843 Ga0068860_100606364 Ga0068860_1006063642 107
405 3300005843 Ga0068860_100888958 Ga0068860_1008889582 107
406 3300005843 Ga0068860_101344306 Ga0068860_1013443061 107
407 3300005844 Ga0068862_100358579 Ga0068862_1003585791 107
408 3300005844 Ga0068862_100372674 Ga0068862_1003726741 107
409 3300005844 Ga0068862_101274493 Ga0068862_1012744932 107
410 3300005844 Ga0068862_102096722 Ga0068862_1020967221 107
411 3300005937 Ga0081455_10034429 Ga0081455_100344295 107
412 3300005937 Ga0081455_10117581 Ga0081455_101175811 107
413 3300005937 Ga0081455_10159746 Ga0081455_101597462 107
414 3300005983 Ga0081540_1003522 Ga0081540_10035227 107
415 3300005983 Ga0081540_1015783 Ga0081540_10157832 107
416 3300005983 Ga0081540_1026167 Ga0081540_10261674 107
417 3300005983 Ga0081540_1062218 Ga0081540_10622182 107
418 3300005983 Ga0081540_1076436 Ga0081540_10764362 107
419 3300005985 Ga0081539_10000064 Ga0081539_1000006476 107
420 3300005985 Ga0081539_10163800 Ga0081539_101638002 107
421 3300006028 Ga0070717_10000598 Ga0070717_1000059822 107
422 3300006028 Ga0070717_10092551 Ga0070717_100925513 107
423 3300006028 Ga0070717_10389258 Ga0070717_103892582 107
424 3300006028 Ga0070717_10812284 Ga0070717_108122841 107
425 3300006028 Ga0070717_11811540 Ga0070717_118115402 107
426 3300006028 Ga0070717_12090698 Ga0070717_120906981 107
427 3300006038 Ga0075365_10018847 Ga0075365_100188475 107
428 3300006038 Ga0075365_10038824 Ga0075365_100388242 107
429 3300006038 Ga0075365_10059779 Ga0075365_100597792 107
430 3300006038 Ga0075365_10127145 Ga0075365_101271451 107
431 3300006038 Ga0075365_10164646 Ga0075365_101646462 107
432 3300006038 Ga0075365_10297590 Ga0075365_102975902 107
433 3300006038 Ga0075365_10336643 Ga0075365_103366432 107
434 3300006038 Ga0075365_10457444 Ga0075365_104574441 107
435 3300006042 Ga0075368_10035463 Ga0075368_100354633 107
436 3300006042 Ga0075368_10086560 Ga0075368_100865602 107
437 3300006048 Ga0075363_100008692 Ga0075363_1000086923 107
438 3300006048 Ga0075363_100172112 Ga0075363_1001721122 107
439 3300006048 Ga0075363_100244375 Ga0075363_1002443752 107
440 3300006048 Ga0075363_100327703 Ga0075363_1003277032 107
441 3300006048 Ga0075363_100959129 Ga0075363_1009591291 107
442 3300006051 Ga0075364_10063799 Ga0075364_100637993 107
443 3300006051 Ga0075364_10342037 Ga0075364_103420371 107
444 3300006051 Ga0075364_10371854 Ga0075364_103718542 107
445 3300006051 Ga0075364_10376258 Ga0075364_103762582 107
446 3300006051 Ga0075364_11029814 Ga0075364_110298141 107
447 3300006058 Ga0075432_10080219 Ga0075432_100802193 107
448 3300006163 Ga0070715_10189700 Ga0070715_101897002 107
449 3300006163 Ga0070715_10466877 Ga0070715_104668772 107
450 3300006173 Ga0070716_100015382 Ga0070716_1000153823 107
451 3300006173 Ga0070716_100055301 Ga0070716_1000553013 107
452 3300006173 Ga0070716_100144586 Ga0070716_1001445862 107
453 3300006173 Ga0070716_100194933 Ga0070716_1001949332 107
454 3300006173 Ga0070716_100534751 Ga0070716_1005347512 107
455 3300006173 Ga0070716_100600582 Ga0070716_1006005822 107
456 3300006175 Ga0070712_100011023 Ga0070712_1000110233 107
457 3300006175 Ga0070712_100011606 Ga0070712_1000116065 107
458 3300006175 Ga0070712_100288624 Ga0070712_1002886242 107
459 3300006175 Ga0070712_100596040 Ga0070712_1005960402 107
460 3300006175 Ga0070712_100676877 Ga0070712_1006768772 107
461 3300006175 Ga0070712_100845688 Ga0070712_1008456882 107
462 3300006175 Ga0070712_101320167 Ga0070712_1013201672 107
463 3300006177 Ga0075362_10016658 Ga0075362_100166584 107
464 3300006177 Ga0075362_10073954 Ga0075362_100739542 107
465 3300006177 Ga0075362_10102185 Ga0075362_101021852 107
466 3300006178 Ga0075367_10003520 Ga0075367_100035204 107
467 3300006178 Ga0075367_10209804 Ga0075367_102098042 107
468 3300006178 Ga0075367_10609901 Ga0075367_106099011 107
469 3300006178 Ga0075367_10703509 Ga0075367_107035092 107
470 3300006178 Ga0075367_11054276 Ga0075367_110542761 107
471 3300006186 Ga0075369_10022631 Ga0075369_100226312 107
472 3300006186 Ga0075369_10080701 Ga0075369_100807012 107
473 3300006186 Ga0075369_10095534 Ga0075369_100955342 107
474 3300006186 Ga0075369_10359588 Ga0075369_103595882 107
475 3300006194 Ga0075427_10031592 Ga0075427_100315922 107
476 3300006195 Ga0075366_10617034 Ga0075366_106170342 107
477 3300006237 Ga0097621_100094751 Ga0097621_1000947513 107
478 3300006237 Ga0097621_100315530 Ga0097621_1003155302 107
479 3300006237 Ga0097621_100598404 Ga0097621_1005984042 107
480 3300006237 Ga0097621_100677390 Ga0097621_1006773901 107
481 3300006237 Ga0097621_100748445 Ga0097621_1007484452 107
482 3300006237 Ga0097621_101293616 Ga0097621_1012936162 107
483 3300006353 Ga0075370_10028691 Ga0075370_100286914 107
484 3300006353 Ga0075370_10050918 Ga0075370_100509183 107
485 3300006353 Ga0075370_10083074 Ga0075370_100830742 107
486 3300006353 Ga0075370_10117513 Ga0075370_101175132 107
487 3300006353 Ga0075370_10465037 Ga0075370_104650372 107
488 3300006358 Ga0068871_100103747 Ga0068871_1001037473 107
489 3300006358 Ga0068871_100229322 Ga0068871_1002293222 107
490 3300006358 Ga0068871_100283556 Ga0068871_1002835561 107
491 3300006358 Ga0068871_100510926 Ga0068871_1005109262 107
492 3300006844 Ga0075428_100387766 Ga0075428_1003877662 107
493 3300006847 Ga0075431_100613538 Ga0075431_1006135382 107
494 3300006871 Ga0075434_100221135 Ga0075434_1002211352 107
495 3300006880 Ga0075429_101113024 Ga0075429_1011130242 107
496 3300006881 Ga0068865_100054460 Ga0068865_1000544603 107
497 3300006881 Ga0068865_100139983 Ga0068865_1001399833 107
498 3300006881 Ga0068865_100180156 Ga0068865_1001801562 107
499 3300006881 Ga0068865_101599471 Ga0068865_1015994711 107
500 3300006931 Ga0097620_100273821 Ga0097620_1002738212 107
501 3300006931 Ga0097620_100427214 Ga0097620_1004272142 107
502 3300006931 Ga0097620_101634494 Ga0097620_1016344941 107
503 3300006931 Ga0097620_102836044 Ga0097620_1028360441 107
504 3300006941 Ga0099825_1022298 Ga0099825_10222983 107
505 3300006942 Ga0099824_1014421 Ga0099824_101442110 107
506 3300006944 Ga0099823_1062190 Ga0099823_10621903 107
507 3300007076 Ga0075435_100232695 Ga0075435_1002326952 107
508 3300007265 Ga0099794_10024762 Ga0099794_100247621 107
509 3300007265 Ga0099794_10142889 Ga0099794_101428892 107
510 3300007788 Ga0099795_10225683 Ga0099795_102256832 107
511 3300009011 Ga0105251_10180686 Ga0105251_101806862 107
512 3300009092 Ga0105250_10379175 Ga0105250_103791752 107
513 3300009093 Ga0105240_10058527 Ga0105240_100585276 107
514 3300009093 Ga0105240_10087222 Ga0105240_100872221 107
515 3300009093 Ga0105240_10090957 Ga0105240_100909573 107
516 3300009093 Ga0105240_10365822 Ga0105240_103658223 107
517 3300009093 Ga0105240_10626454 Ga0105240_106264542 107
518 3300009093 Ga0105240_11701939 Ga0105240_117019392 107
519 3300009094 Ga0111539_10092530 Ga0111539_100925302 107
520 3300009094 Ga0111539_12001641 Ga0111539_120016412 107
521 3300009098 Ga0105245_10405656 Ga0105245_104056562 107
522 3300009101 Ga0105247_10020747 Ga0105247_100207473 107
523 3300009101 Ga0105247_10030704 Ga0105247_100307043 107
524 3300009101 Ga0105247_10322519 Ga0105247_103225192 107
525 3300009101 Ga0105247_10339320 Ga0105247_103393202 107
526 3300009101 Ga0105247_10430120 Ga0105247_104301202 107
527 3300009101 Ga0105247_10629446 Ga0105247_106294462 107
528 3300009147 Ga0114129_10108408 Ga0114129_101084083 107
529 3300009148 Ga0105243_10184518 Ga0105243_101845182 107
530 3300009148 Ga0105243_10232184 Ga0105243_102321842 107
531 3300009148 Ga0105243_10707730 Ga0105243_107077302 107
532 3300009148 Ga0105243_11271034 Ga0105243_112710342 107
533 3300009174 Ga0105241_10031270 Ga0105241_100312706 107
534 3300009174 Ga0105241_11065376 Ga0105241_110653761 107
535 3300009174 Ga0105241_12124734 Ga0105241_121247342 107
536 3300009174 Ga0105241_12291247 Ga0105241_122912472 107
537 3300009176 Ga0105242_10532155 Ga0105242_105321552 107
538 3300009176 Ga0105242_11281200 Ga0105242_112812002 107
539 3300009176 Ga0105242_11877341 Ga0105242_118773412 107
540 3300009177 Ga0105248_10145224 Ga0105248_101452242 107
541 3300009177 Ga0105248_10598505 Ga0105248_105985052 107
542 3300009177 Ga0105248_11036085 Ga0105248_110360852 107
543 3300009177 Ga0105248_12044874 Ga0105248_120448741 107
544 3300009177 Ga0105248_13244400 Ga0105248_132444001 107
545 3300009545 Ga0105237_10084862 Ga0105237_100848623 107
546 3300009545 Ga0105237_10111989 Ga0105237_101119894 107
547 3300009545 Ga0105237_10346749 Ga0105237_103467492 107
548 3300009545 Ga0105237_10457355 Ga0105237_104573551 107
549 3300009545 Ga0105237_10491339 Ga0105237_104913392 107
550 3300009545 Ga0105237_11231811 Ga0105237_112318112 107
551 3300009545 Ga0105237_11339260 Ga0105237_113392602 107
552 3300009545 Ga0105237_11615516 Ga0105237_116155162 107
553 3300009545 Ga0105237_12237135 Ga0105237_122371351 107
554 3300009551 Ga0105238_10135855 Ga0105238_101358553 107
555 3300009551 Ga0105238_10300919 Ga0105238_103009193 107
556 3300009551 Ga0105238_11414719 Ga0105238_114147192 107
557 3300009551 Ga0105238_11456648 Ga0105238_114566482 107
558 3300009551 Ga0105238_12243856 Ga0105238_122438562 107
559 3300009553 Ga0105249_10115141 Ga0105249_101151412 107
560 3300009553 Ga0105249_10226215 Ga0105249_102262152 107
561 3300009553 Ga0105249_10270035 Ga0105249_102700352 107
562 3300009553 Ga0105249_10809798 Ga0105249_108097982 107
563 3300009553 Ga0105249_10873525 Ga0105249_108735252 107
564 3300009553 Ga0105249_11224580 Ga0105249_112245801 107
565 3300009553 Ga0105249_12346085 Ga0105249_123460852 107
566 3300009553 Ga0105249_12360421 Ga0105249_123604212 107
567 3300010159 Ga0099796_10056805 Ga0099796_100568052 107
568 3300010159 Ga0099796_10080013 Ga0099796_100800132 107
569 3300010159 Ga0099796_10354148 Ga0099796_103541482 107
570 3300010375 Ga0105239_10102005 Ga0105239_101020052 107
571 3300010375 Ga0105239_10226124 Ga0105239_102261242 107
572 3300010375 Ga0105239_10337421 Ga0105239_103374212 107
573 3300010375 Ga0105239_10428279 Ga0105239_104282792 107
574 3300010375 Ga0105239_10545415 Ga0105239_105454152 107
575 3300010375 Ga0105239_10590534 Ga0105239_105905342 107
576 3300010375 Ga0105239_10597214 Ga0105239_105972141 107
577 3300010375 Ga0105239_11284783 Ga0105239_112847832 107
578 3300010375 Ga0105239_11943433 Ga0105239_119434332 107
579 3300010375 Ga0105239_13146151 Ga0105239_131461511 107
580 3300010375 Ga0105239_13335206 Ga0105239_133352061 107
581 3300011119 Ga0105246_10288315 Ga0105246_102883152 107
582 3300011119 Ga0105246_10403642 Ga0105246_104036422 107
583 3300011119 Ga0105246_12434565 Ga0105246_124345651 107
584 3300012502 Ga0157347_1026172 Ga0157347_10261722 107
585 3300012503 Ga0157313_1046659 Ga0157313_10466592 107
586 3300012505 Ga0157339_1013252 Ga0157339_10132522 107
587 3300012515 Ga0157338_1059926 Ga0157338_10599261 107
588 3300013100 Ga0157373_10237798 Ga0157373_102377982 107
589 3300013102 Ga0157371_10553742 Ga0157371_105537422 107
590 3300013102 Ga0157371_11627337 Ga0157371_116273371 107
591 3300013104 Ga0157370_10036583 Ga0157370_100365832 107
592 3300013104 Ga0157370_10098672 Ga0157370_100986722 107
593 3300013104 Ga0157370_10164986 Ga0157370_101649862 107
594 3300013104 Ga0157370_10170456 Ga0157370_101704562 107
595 3300013104 Ga0157370_10187157 Ga0157370_101871573 107
596 3300013105 Ga0157369_10034718 Ga0157369_100347182 107
597 3300013105 Ga0157369_10093710 Ga0157369_100937103 107
598 3300013105 Ga0157369_10297386 Ga0157369_102973862 107
599 3300013105 Ga0157369_10360579 Ga0157369_103605792 107
600 3300013105 Ga0157369_10609221 Ga0157369_106092212 107
601 3300013105 Ga0157369_10817877 Ga0157369_108178772 107
602 3300013296 Ga0157374_11805196 Ga0157374_118051962 107
603 3300013297 Ga0157378_10464551 Ga0157378_104645512 107
604 3300013297 Ga0157378_10782600 Ga0157378_107826001 107
605 3300013297 Ga0157378_11001641 Ga0157378_110016412 107
606 3300013297 Ga0157378_12221626 Ga0157378_122216262 107
607 3300013306 Ga0163162_10174053 Ga0163162_101740532 107
608 3300013306 Ga0163162_10210594 Ga0163162_102105943 107
609 3300013306 Ga0163162_10241515 Ga0163162_102415152 107
610 3300013306 Ga0163162_10714482 Ga0163162_107144822 107
611 3300013306 Ga0163162_10726046 Ga0163162_107260462 107
612 3300013306 Ga0163162_10823205 Ga0163162_108232052 107
613 3300013307 Ga0157372_10023282 Ga0157372_100232824 107
614 3300013307 Ga0157372_10509028 Ga0157372_105090282 107
615 3300013307 Ga0157372_10541155 Ga0157372_105411552 107
616 3300013307 Ga0157372_10623162 Ga0157372_106231622 107
617 3300013307 Ga0157372_10660223 Ga0157372_106602232 107
618 3300013307 Ga0157372_11083085 Ga0157372_110830853 107
619 3300013307 Ga0157372_11655499 Ga0157372_116554992 107
620 3300013307 Ga0157372_12801460 Ga0157372_128014601 107
621 3300013307 Ga0157372_13106545 Ga0157372_131065451 107
622 3300013308 Ga0157375_10095723 Ga0157375_100957232 107
623 3300013308 Ga0157375_10862587 Ga0157375_108625872 107
624 3300013308 Ga0157375_10889184 Ga0157375_108891842 107
625 3300013308 Ga0157375_11115695 Ga0157375_111156952 107
626 3300013308 Ga0157375_11364718 Ga0157375_113647182 107
627 3300013308 Ga0157375_11444242 Ga0157375_114442422 107
628 3300013308 Ga0157375_11939042 Ga0157375_119390422 107
629 3300013308 Ga0157375_12698116 Ga0157375_126981162 107
630 3300013308 Ga0157375_13233837 Ga0157375_132338372 107
631 3300014325 Ga0163163_10157293 Ga0163163_101572932 107
632 3300014325 Ga0163163_10219535 Ga0163163_102195353 107
633 3300014325 Ga0163163_11725131 Ga0163163_117251312 107
634 3300014325 Ga0163163_12012870 Ga0163163_120128702 107
635 3300014325 Ga0163163_12101265 Ga0163163_121012652 107
636 3300014326 Ga0157380_11144928 Ga0157380_111449282 107
637 3300014326 Ga0157380_11996547 Ga0157380_119965471 107
638 3300014326 Ga0157380_12964561 Ga0157380_129645612 107
639 3300014968 Ga0157379_10567614 Ga0157379_105676142 107
640 3300014968 Ga0157379_11102596 Ga0157379_111025961 107
641 3300014969 Ga0157376_10591542 Ga0157376_105915422 107
642 3300014969 Ga0157376_10799245 Ga0157376_107992452 107
643 3300014969 Ga0157376_11157845 Ga0157376_111578452 107
644 3300014969 Ga0157376_11349308 Ga0157376_113493082 107
645 3300014969 Ga0157376_11397067 Ga0157376_113970672 107
646 3300014969 Ga0157376_12195994 Ga0157376_121959942 107
647 3300015261 Ga0182006_1198702 Ga0182006_11987022 107
648 3300015261 Ga0182006_1321656 Ga0182006_13216561 107
649 3300015262 Ga0182007_10094334 Ga0182007_100943341 107
650 3300015265 Ga0182005_1061529 Ga0182005_10615293 107
651 3300017792 Ga0163161_10067265 Ga0163161_100672652 107
652 3300017792 Ga0163161_10467363 Ga0163161_104673632 107
653 3300017792 Ga0163161_10557627 Ga0163161_105576272 107
654 3300017792 Ga0163161_10643411 Ga0163161_106434111 107
655 3300017792 Ga0163161_11133440 Ga0163161_111334402 107
656 3300020069 Ga0197907_10298208 Ga0197907_102982081 107
657 3300020610 Ga0154015_1048366 Ga0154015_10483661 107
658 3300021320 Ga0214544_1000016 Ga0214544_1000016194 107
659 3300021321 Ga0214542_1000016 Ga0214542_10000168 107
660 3300021324 Ga0214545_1000008 Ga0214545_100000814 107
661 3300021327 Ga0214543_1001466 Ga0214543_10014668 107
662 3300021358 Ga0213873_10084625 Ga0213873_100846251 107
663 3300021361 Ga0213872_10044010 Ga0213872_100440101 107
664 3300021361 Ga0213872_10153672 Ga0213872_101536722 107
665 3300021384 Ga0213876_10209095 Ga0213876_102090952 107
666 3300021441 Ga0213871_10000804 Ga0213871_100008041 107
667 3300022467 Ga0224712_10587721 Ga0224712_105877211 107
668 3300025258 Ga0209129_1054429 Ga0209129_10544291 107
669 3300025272 Ga0209455_1016553 Ga0209455_10165532 107
670 3300025273 Ga0209673_1126882 Ga0209673_11268822 107
671 3300025295 Ga0209564_1006362 Ga0209564_10063625 107
672 3300025295 Ga0209564_1016043 Ga0209564_10160434 107
673 3300025297 Ga0209758_1000069 Ga0209758_100006928 107
674 3300025297 Ga0209758_1000635 Ga0209758_100063516 107
675 3300025297 Ga0209758_1000695 Ga0209758_100069544 107
676 3300025297 Ga0209758_1003838 Ga0209758_10038383 107
677 3300025297 Ga0209758_1006620 Ga0209758_10066204 107
678 3300025297 Ga0209758_1008516 Ga0209758_10085164 107
679 3300025297 Ga0209758_1017132 Ga0209758_10171324 107
680 3300025299 Ga0209256_1010781 Ga0209256_10107812 107
681 3300025302 Ga0207426_1000826 Ga0207426_100082616 107
682 3300025302 Ga0207426_1002297 Ga0207426_10022976 107
683 3300025302 Ga0207426_1089432 Ga0207426_10894322 107
684 3300025303 Ga0209051_1072799 Ga0209051_10727992 107
685 3300025304 Ga0209257_1000473 Ga0209257_100047317 107
686 3300025315 Ga0207697_10031792 Ga0207697_100317923 107
687 3300025315 Ga0207697_10200567 Ga0207697_102005672 107
688 3300025321 Ga0207656_10201797 Ga0207656_102017972 107
689 3300025711 Ga0207696_1065015 Ga0207696_10650152 107
690 3300025893 Ga0207682_10102602 Ga0207682_101026022 107
691 3300025893 Ga0207682_10599492 Ga0207682_105994921 107
692 3300025898 Ga0207692_10028001 Ga0207692_100280012 107
693 3300025898 Ga0207692_10030050 Ga0207692_100300503 107
694 3300025898 Ga0207692_10068067 Ga0207692_100680673 107
695 3300025898 Ga0207692_10097486 Ga0207692_100974862 107
696 3300025898 Ga0207692_10817655 Ga0207692_108176551 107
697 3300025899 Ga0207642_10148212 Ga0207642_101482122 107
698 3300025900 Ga0207710_10121584 Ga0207710_101215842 107
699 3300025900 Ga0207710_10267609 Ga0207710_102676092 107
700 3300025900 Ga0207710_10280707 Ga0207710_102807072 107
701 3300025901 Ga0207688_10055242 Ga0207688_100552422 107
702 3300025901 Ga0207688_10267382 Ga0207688_102673822 107
703 3300025901 Ga0207688_10511240 Ga0207688_105112402 107
704 3300025903 Ga0207680_10146169 Ga0207680_101461692 107
705 3300025903 Ga0207680_10815109 Ga0207680_108151092 107
706 3300025903 Ga0207680_11374181 Ga0207680_113741811 107
707 3300025904 Ga0207647_10047758 Ga0207647_100477584 107
708 3300025904 Ga0207647_10060634 Ga0207647_100606342 107
709 3300025904 Ga0207647_10073175 Ga0207647_100731752 107
710 3300025904 Ga0207647_10227338 Ga0207647_102273382 107
711 3300025905 Ga0207685_10040019 Ga0207685_100400192 107
712 3300025905 Ga0207685_10486797 Ga0207685_104867971 107
713 3300025906 Ga0207699_10001061 Ga0207699_100010616 107
714 3300025906 Ga0207699_10007678 Ga0207699_100076783 107
715 3300025906 Ga0207699_10283035 Ga0207699_102830351 107
716 3300025907 Ga0207645_10038584 Ga0207645_100385842 107
717 3300025907 Ga0207645_10131351 Ga0207645_101313513 107
718 3300025907 Ga0207645_10152105 Ga0207645_101521052 107
719 3300025908 Ga0207643_10047754 Ga0207643_100477542 107
720 3300025908 Ga0207643_10274853 Ga0207643_102748532 107
721 3300025908 Ga0207643_10562394 Ga0207643_105623942 107
722 3300025909 Ga0207705_10072241 Ga0207705_100722412 107
723 3300025909 Ga0207705_10154888 Ga0207705_101548883 107
724 3300025909 Ga0207705_10158715 Ga0207705_101587153 107
725 3300025909 Ga0207705_10942133 Ga0207705_109421332 107
726 3300025910 Ga0207684_10354325 Ga0207684_103543252 107
727 3300025910 Ga0207684_10403939 Ga0207684_104039392 107
728 3300025910 Ga0207684_11095647 Ga0207684_110956471 107
729 3300025911 Ga0207654_10435932 Ga0207654_104359322 107
730 3300025911 Ga0207654_11026997 Ga0207654_110269972 107
731 3300025912 Ga0207707_10000100 Ga0207707_1000010019 107
732 3300025912 Ga0207707_10030393 Ga0207707_100303932 107
733 3300025912 Ga0207707_10206552 Ga0207707_102065522 107
734 3300025912 Ga0207707_10286635 Ga0207707_102866352 107
735 3300025912 Ga0207707_10315552 Ga0207707_103155522 107
736 3300025912 Ga0207707_10914595 Ga0207707_109145952 107
737 3300025913 Ga0207695_10071426 Ga0207695_100714263 107
738 3300025913 Ga0207695_10350642 Ga0207695_103506422 107
739 3300025913 Ga0207695_10415856 Ga0207695_104158562 107
740 3300025913 Ga0207695_10641618 Ga0207695_106416182 107
741 3300025913 Ga0207695_11256698 Ga0207695_112566981 107
742 3300025914 Ga0207671_10028432 Ga0207671_100284322 107
743 3300025914 Ga0207671_10105880 Ga0207671_101058802 107
744 3300025914 Ga0207671_10169081 Ga0207671_101690812 107
745 3300025914 Ga0207671_10540688 Ga0207671_105406882 107
746 3300025914 Ga0207671_10607757 Ga0207671_106077571 107
747 3300025914 Ga0207671_10849021 Ga0207671_108490212 107
748 3300025914 Ga0207671_10963191 Ga0207671_109631912 107
749 3300025915 Ga0207693_10014072 Ga0207693_100140723 107
750 3300025915 Ga0207693_10016945 Ga0207693_100169453 107
751 3300025915 Ga0207693_10064340 Ga0207693_100643404 107
752 3300025915 Ga0207693_10086278 Ga0207693_100862782 107
753 3300025915 Ga0207693_10136566 Ga0207693_101365662 107
754 3300025915 Ga0207693_10489985 Ga0207693_104899852 107
755 3300025916 Ga0207663_10007470 Ga0207663_100074706 107
756 3300025916 Ga0207663_10016344 Ga0207663_100163443 107
757 3300025916 Ga0207663_10025172 Ga0207663_100251723 107
758 3300025916 Ga0207663_11055867 Ga0207663_110558672 107
759 3300025917 Ga0207660_10028561 Ga0207660_100285613 107
760 3300025917 Ga0207660_10040865 Ga0207660_100408652 107
761 3300025917 Ga0207660_10063621 Ga0207660_100636211 107
762 3300025917 Ga0207660_10077814 Ga0207660_100778143 107
763 3300025917 Ga0207660_10158466 Ga0207660_101584663 107
764 3300025917 Ga0207660_10160915 Ga0207660_101609152 107
765 3300025917 Ga0207660_10228675 Ga0207660_102286752 107
766 3300025918 Ga0207662_10154664 Ga0207662_101546642 107
767 3300025919 Ga0207657_10004438 Ga0207657_100044389 107
768 3300025919 Ga0207657_10031627 Ga0207657_100316273 107
769 3300025919 Ga0207657_10094160 Ga0207657_100941602 107
770 3300025919 Ga0207657_10120060 Ga0207657_101200604 107
771 3300025919 Ga0207657_10396058 Ga0207657_103960581 107
772 3300025919 Ga0207657_11073410 Ga0207657_110734101 107
773 3300025919 Ga0207657_11185363 Ga0207657_111853631 107
774 3300025920 Ga0207649_10072215 Ga0207649_100722153 107
775 3300025920 Ga0207649_10187352 Ga0207649_101873522 107
776 3300025920 Ga0207649_10853453 Ga0207649_108534531 107
777 3300025921 Ga0207652_10002952 Ga0207652_1000295214 107
778 3300025921 Ga0207652_10098532 Ga0207652_100985324 107
779 3300025921 Ga0207652_10312143 Ga0207652_103121432 107
780 3300025922 Ga0207646_10422000 Ga0207646_104220001 107
781 3300025922 Ga0207646_10725690 Ga0207646_107256902 107
782 3300025923 Ga0207681_10109686 Ga0207681_101096863 107
783 3300025923 Ga0207681_10123968 Ga0207681_101239682 107
784 3300025924 Ga0207694_10239505 Ga0207694_102395052 107
785 3300025924 Ga0207694_10384497 Ga0207694_103844972 107
786 3300025924 Ga0207694_10503828 Ga0207694_105038282 107
787 3300025924 Ga0207694_10690716 Ga0207694_106907162 107
788 3300025925 Ga0207650_10124804 Ga0207650_101248042 107
789 3300025925 Ga0207650_10583701 Ga0207650_105837011 107
790 3300025926 Ga0207659_10137563 Ga0207659_101375633 107
791 3300025926 Ga0207659_10145958 Ga0207659_101459582 107
792 3300025927 Ga0207687_10039457 Ga0207687_100394572 107
793 3300025927 Ga0207687_10245841 Ga0207687_102458412 107
794 3300025928 Ga0207700_10001725 Ga0207700_1000172513 107
795 3300025928 Ga0207700_10015395 Ga0207700_100153953 107
796 3300025928 Ga0207700_10060174 Ga0207700_100601743 107
797 3300025928 Ga0207700_10072029 Ga0207700_100720293 107
798 3300025928 Ga0207700_10125637 Ga0207700_101256372 107
799 3300025928 Ga0207700_10996929 Ga0207700_109969292 107
800 3300025928 Ga0207700_11234804 Ga0207700_112348042 107
801 3300025929 Ga0207664_10019486 Ga0207664_100194863 107
802 3300025929 Ga0207664_10259385 Ga0207664_102593853 107
803 3300025931 Ga0207644_10172770 Ga0207644_101727702 107
804 3300025931 Ga0207644_10954068 Ga0207644_109540682 107
805 3300025931 Ga0207644_11052371 Ga0207644_110523712 107
806 3300025932 Ga0207690_10407673 Ga0207690_104076732 107
807 3300025932 Ga0207690_10648231 Ga0207690_106482312 107
808 3300025932 Ga0207690_11553260 Ga0207690_115532602 107
809 3300025933 Ga0207706_10012728 Ga0207706_1001272810 107
810 3300025933 Ga0207706_10087364 Ga0207706_100873643 107
811 3300025933 Ga0207706_10618925 Ga0207706_106189252 107
812 3300025933 Ga0207706_11137184 Ga0207706_111371842 107
813 3300025934 Ga0207686_10079054 Ga0207686_100790541 107
814 3300025934 Ga0207686_11038525 Ga0207686_110385251 107
815 3300025934 Ga0207686_11831751 Ga0207686_118317511 107
816 3300025935 Ga0207709_10010739 Ga0207709_100107394 107
817 3300025935 Ga0207709_10150229 Ga0207709_101502292 107
818 3300025935 Ga0207709_10438595 Ga0207709_104385951 107
819 3300025935 Ga0207709_10542873 Ga0207709_105428731 107
820 3300025935 Ga0207709_10941784 Ga0207709_109417842 107
821 3300025936 Ga0207670_10201330 Ga0207670_102013302 107
822 3300025936 Ga0207670_10700338 Ga0207670_107003382 107
823 3300025936 Ga0207670_11261998 Ga0207670_112619982 107
824 3300025937 Ga0207669_10033228 Ga0207669_100332283 107
825 3300025937 Ga0207669_10138740 Ga0207669_101387402 107
826 3300025938 Ga0207704_10114952 Ga0207704_101149523 107
827 3300025938 Ga0207704_10150843 Ga0207704_101508433 107
828 3300025938 Ga0207704_11076701 Ga0207704_110767012 107
829 3300025938 Ga0207704_11372208 Ga0207704_113722082 107
830 3300025938 Ga0207704_11785373 Ga0207704_117853731 107
831 3300025939 Ga0207665_10021794 Ga0207665_100217944 107
832 3300025939 Ga0207665_10208427 Ga0207665_102084272 107
833 3300025939 Ga0207665_10418165 Ga0207665_104181652 107
834 3300025939 Ga0207665_10500334 Ga0207665_105003342 107
835 3300025939 Ga0207665_10729542 Ga0207665_107295422 107
836 3300025939 Ga0207665_10895836 Ga0207665_108958362 107
837 3300025940 Ga0207691_10029569 Ga0207691_100295693 107
838 3300025940 Ga0207691_10031653 Ga0207691_100316533 107
839 3300025940 Ga0207691_10764603 Ga0207691_107646032 107
840 3300025941 Ga0207711_10116656 Ga0207711_101166562 107
841 3300025941 Ga0207711_10123770 Ga0207711_101237702 107
842 3300025941 Ga0207711_10299630 Ga0207711_102996302 107
843 3300025941 Ga0207711_11025354 Ga0207711_110253542 107
844 3300025942 Ga0207689_10291278 Ga0207689_102912782 107
845 3300025942 Ga0207689_10425936 Ga0207689_104259361 107
846 3300025942 Ga0207689_11801063 Ga0207689_118010631 107
847 3300025944 Ga0207661_10006554 Ga0207661_1000655411 107
848 3300025944 Ga0207661_10010090 Ga0207661_100100905 107
849 3300025944 Ga0207661_10283898 Ga0207661_102838982 107
850 3300025944 Ga0207661_10345859 Ga0207661_103458591 107
851 3300025944 Ga0207661_11733901 Ga0207661_117339011 107
852 3300025945 Ga0207679_10138089 Ga0207679_101380892 107
853 3300025945 Ga0207679_10180692 Ga0207679_101806923 107
854 3300025945 Ga0207679_11089229 Ga0207679_110892291 107
855 3300025945 Ga0207679_11366268 Ga0207679_113662682 107
856 3300025949 Ga0207667_10081747 Ga0207667_100817473 107
857 3300025949 Ga0207667_10121470 Ga0207667_101214702 107
858 3300025949 Ga0207667_10257340 Ga0207667_102573403 107
859 3300025949 Ga0207667_10305365 Ga0207667_103053653 107
860 3300025949 Ga0207667_10611435 Ga0207667_106114351 107
861 3300025949 Ga0207667_10614105 Ga0207667_106141052 107
862 3300025949 Ga0207667_10810170 Ga0207667_108101702 107
863 3300025949 Ga0207667_11183397 Ga0207667_111833971 107
864 3300025949 Ga0207667_11270103 Ga0207667_112701031 107
865 3300025949 Ga0207667_11352109 Ga0207667_113521092 107
866 3300025960 Ga0207651_10215525 Ga0207651_102155251 107
867 3300025960 Ga0207651_10278409 Ga0207651_102784092 107
868 3300025960 Ga0207651_10357198 Ga0207651_103571982 107
869 3300025960 Ga0207651_11183617 Ga0207651_111836171 107
870 3300025961 Ga0207712_10083170 Ga0207712_100831703 107
871 3300025961 Ga0207712_10159425 Ga0207712_101594252 107
872 3300025961 Ga0207712_10416465 Ga0207712_104164652 107
873 3300025961 Ga0207712_10475681 Ga0207712_104756812 107
874 3300025961 Ga0207712_11740214 Ga0207712_117402141 107
875 3300025961 Ga0207712_12113602 Ga0207712_121136022 107
876 3300025972 Ga0207668_10093414 Ga0207668_100934142 107
877 3300025972 Ga0207668_10116149 Ga0207668_101161491 107
878 3300025972 Ga0207668_10154585 Ga0207668_101545852 107
879 3300025972 Ga0207668_10362159 Ga0207668_103621592 107
880 3300025972 Ga0207668_11972353 Ga0207668_119723531 107
881 3300025981 Ga0207640_10027912 Ga0207640_100279123 107
882 3300025981 Ga0207640_10187768 Ga0207640_101877683 107
883 3300025981 Ga0207640_10762071 Ga0207640_107620712 107
884 3300025981 Ga0207640_11317567 Ga0207640_113175672 107
885 3300025981 Ga0207640_12069339 Ga0207640_120693391 107
886 3300025986 Ga0207658_10747098 Ga0207658_107470982 107
887 3300025986 Ga0207658_10920271 Ga0207658_109202712 107
888 3300025986 Ga0207658_11186276 Ga0207658_111862762 107
889 3300025986 Ga0207658_11808240 Ga0207658_118082401 107
890 3300025986 Ga0207658_12189700 Ga0207658_121897001 107
891 3300026023 Ga0207677_10244533 Ga0207677_102445331 107
892 3300026023 Ga0207677_10263382 Ga0207677_102633822 107
893 3300026023 Ga0207677_10285247 Ga0207677_102852472 107
894 3300026023 Ga0207677_10383122 Ga0207677_103831222 107
895 3300026035 Ga0207703_10032727 Ga0207703_100327273 107
896 3300026035 Ga0207703_10314741 Ga0207703_103147412 107
897 3300026035 Ga0207703_10410093 Ga0207703_104100932 107
898 3300026035 Ga0207703_10486536 Ga0207703_104865362 107
899 3300026035 Ga0207703_11019238 Ga0207703_110192382 107
900 3300026041 Ga0207639_10051535 Ga0207639_100515353 107
901 3300026041 Ga0207639_10074969 Ga0207639_100749692 107
902 3300026041 Ga0207639_10233264 Ga0207639_102332642 107
903 3300026041 Ga0207639_10402318 Ga0207639_104023182 107
904 3300026041 Ga0207639_10729221 Ga0207639_107292212 107
905 3300026041 Ga0207639_10910507 Ga0207639_109105072 107
906 3300026041 Ga0207639_10936459 Ga0207639_109364592 107
907 3300026041 Ga0207639_11147523 Ga0207639_111475232 107
908 3300026067 Ga0207678_10033544 Ga0207678_100335443 107
909 3300026067 Ga0207678_10042094 Ga0207678_100420944 107
910 3300026067 Ga0207678_10063542 Ga0207678_100635422 107
911 3300026067 Ga0207678_10087912 Ga0207678_100879123 107
912 3300026067 Ga0207678_10220212 Ga0207678_102202122 107
913 3300026067 Ga0207678_10392258 Ga0207678_103922582 107
914 3300026067 Ga0207678_10473599 Ga0207678_104735992 107
915 3300026067 Ga0207678_11060748 Ga0207678_110607482 107
916 3300026067 Ga0207678_11130684 Ga0207678_111306841 107
917 3300026075 Ga0207708_10046668 Ga0207708_100466683 107
918 3300026078 Ga0207702_10008573 Ga0207702_100085734 107
919 3300026078 Ga0207702_10046751 Ga0207702_100467515 107
920 3300026078 Ga0207702_10155366 Ga0207702_101553661 107
921 3300026078 Ga0207702_10321068 Ga0207702_103210682 107
922 3300026078 Ga0207702_10362542 Ga0207702_103625422 107
923 3300026078 Ga0207702_10505600 Ga0207702_105056002 107
924 3300026078 Ga0207702_10835016 Ga0207702_108350162 107
925 3300026078 Ga0207702_10837194 Ga0207702_108371942 107
926 3300026088 Ga0207641_10568195 Ga0207641_105681952 107
927 3300026088 Ga0207641_10888190 Ga0207641_108881902 107
928 3300026088 Ga0207641_11118673 Ga0207641_111186732 107
929 3300026088 Ga0207641_11839322 Ga0207641_118393222 107
930 3300026089 Ga0207648_10114889 Ga0207648_101148892 107
931 3300026089 Ga0207648_10187305 Ga0207648_101873052 107
932 3300026089 Ga0207648_11066960 Ga0207648_110669602 107
933 3300026095 Ga0207676_10068088 Ga0207676_100680882 107
934 3300026095 Ga0207676_10303262 Ga0207676_103032622 107
935 3300026095 Ga0207676_10343264 Ga0207676_103432642 107
936 3300026116 Ga0207674_10070853 Ga0207674_100708533 107
937 3300026118 Ga0207675_100028928 Ga0207675_1000289282 107
938 3300026118 Ga0207675_100471364 Ga0207675_1004713641 107
939 3300026118 Ga0207675_101385192 Ga0207675_1013851922 107
940 3300026121 Ga0207683_10027677 Ga0207683_100276772 107
941 3300026121 Ga0207683_10030892 Ga0207683_100308924 107
942 3300026121 Ga0207683_10060100 Ga0207683_100601002 107
943 3300026121 Ga0207683_10155166 Ga0207683_101551662 107
944 3300026121 Ga0207683_10307439 Ga0207683_103074392 107
945 3300026121 Ga0207683_10322353 Ga0207683_103223532 107
946 3300026121 Ga0207683_10802738 Ga0207683_108027382 107
947 3300026121 Ga0207683_12116431 Ga0207683_121164311 107
948 3300026142 Ga0207698_10017851 Ga0207698_100178516 107
949 3300026142 Ga0207698_10115608 Ga0207698_101156083 107
950 3300026142 Ga0207698_10242761 Ga0207698_102427612 107
951 3300026142 Ga0207698_10831625 Ga0207698_108316252 107
952 3300026142 Ga0207698_11622912 Ga0207698_116229122 107
953 3300027296 Ga0209389_1000033 Ga0209389_10000336 107
954 3300027296 Ga0209389_1000182 Ga0209389_100018220 107
955 3300027357 Ga0209589_1000040 Ga0209589_10000406 107
956 3300027361 Ga0209489_100045 Ga0209489_10004518 107
957 3300027361 Ga0209489_100209 Ga0209489_10020920 107
958 3300027363 Ga0209700_100011 Ga0209700_100011173 107
959 3300027512 Ga0209179_1011067 Ga0209179_10110673 107
960 3300027512 Ga0209179_1041397 Ga0209179_10413972 107
961 3300027671 Ga0209588_1047656 Ga0209588_10476562 107
962 3300027866 Ga0209813_10059524 Ga0209813_100595242 107
963 3300027907 Ga0207428_10356775 Ga0207428_103567752 107
964 3300027907 Ga0207428_10467331 Ga0207428_104673312 107
965 3300028379 Ga0268266_10006104 Ga0268266_100061046 107
966 3300028379 Ga0268266_10016065 Ga0268266_100160654 107
967 3300028379 Ga0268266_10040428 Ga0268266_100404286 107
968 3300028379 Ga0268266_10064806 Ga0268266_100648063 107
969 3300028379 Ga0268266_10275686 Ga0268266_102756862 107
970 3300028379 Ga0268266_10366515 Ga0268266_103665152 107
971 3300028379 Ga0268266_10387415 Ga0268266_103874152 107
972 3300028379 Ga0268266_10675858 Ga0268266_106758581 107
973 3300028379 Ga0268266_11905938 Ga0268266_119059381 107
974 3300028380 Ga0268265_10028336 Ga0268265_100283362 107
975 3300028380 Ga0268265_10221207 Ga0268265_102212072 107
976 3300028380 Ga0268265_10284375 Ga0268265_102843752 107
977 3300028380 Ga0268265_10477072 Ga0268265_104770722 107
978 3300028381 Ga0268264_10296940 Ga0268264_102969402 107
979 3300028381 Ga0268264_10615997 Ga0268264_106159972 107
980 3300028381 Ga0268264_10800720 Ga0268264_108007202 107
981 3300028573 Ga0265334_10194692 Ga0265334_101946921 107
982 3300028786 Ga0307517_10001338 Ga0307517_1000133810 107
983 3300028786 Ga0307517_10180709 Ga0307517_101807092 107
984 3300028794 Ga0307515_10036525 Ga0307515_100365256 107
985 3300030521 Ga0307511_10235259 Ga0307511_102352592 107
986 3300030522 Ga0307512_10245072 Ga0307512_102450722 107
987 3300031235 Ga0265330_10016402 Ga0265330_100164026 107
988 3300031235 Ga0265330_10038794 Ga0265330_100387943 107
989 3300031235 Ga0265330_10088191 Ga0265330_100881911 107
990 3300031238 Ga0265332_10002811 Ga0265332_1000281110 107
991 3300031238 Ga0265332_10028193 Ga0265332_100281932 107
992 3300031239 Ga0265328_10138452 Ga0265328_101384522 107
993 3300031241 Ga0265325_10053584 Ga0265325_100535842 107
994 3300031247 Ga0265340_10003064 Ga0265340_1000306410 107
995 3300031247 Ga0265340_10056306 Ga0265340_100563063 107
996 3300031247 Ga0265340_10202371 Ga0265340_102023712 107
997 3300031249 Ga0265339_10001062 Ga0265339_1000106219 107
998 3300031249 Ga0265339_10130370 Ga0265339_101303702 107
999 3300031249 Ga0265339_10478265 Ga0265339_104782651 107
1000 3300031250 Ga0265331_10010008 Ga0265331_100100083 107
1001 3300031250 Ga0265331_10316160 Ga0265331_103161602 107
1002 3300031344 Ga0265316_10241384 Ga0265316_102413842 107
1003 3300031344 Ga0265316_10549220 Ga0265316_105492202 107
1004 3300031456 Ga0307513_10375302 Ga0307513_103753021 107
1005 3300031456 Ga0307513_10446743 Ga0307513_104467432 107
1006 3300031456 Ga0307513_10603829 Ga0307513_106038292 107
1007 3300031456 Ga0307513_10798778 Ga0307513_107987781 107
1008 3300031456 Ga0307513_10880270 Ga0307513_108802702 107
1009 3300031507 Ga0307509_10513421 Ga0307509_105134211 107
1010 3300031548 Ga0307408_100089338 Ga0307408_1000893382 107
1011 3300031548 Ga0307408_101735977 Ga0307408_1017359772 107
1012 3300031595 Ga0265313_10032062 Ga0265313_100320622 107
1013 3300031616 Ga0307508_10041680 Ga0307508_100416804 107
1014 3300031616 Ga0307508_10524270 Ga0307508_105242702 107
1015 3300031711 Ga0265314_10007615 Ga0265314_1000761510 107
1016 3300031711 Ga0265314_10015101 Ga0265314_100151019 107
1017 3300031711 Ga0265314_10037169 Ga0265314_100371691 107
1018 3300031711 Ga0265314_10134381 Ga0265314_101343812 107
1019 3300031712 Ga0265342_10027258 Ga0265342_100272584 107
1020 3300031712 Ga0265342_10040588 Ga0265342_100405882 107
1021 3300031712 Ga0265342_10201349 Ga0265342_102013492 107
1022 3300031712 Ga0265342_10329256 Ga0265342_103292561 107
1023 3300031712 Ga0265342_10378683 Ga0265342_103786832 107
1024 3300031730 Ga0307516_10086786 Ga0307516_100867863 107
1025 3300031730 Ga0307516_10134526 Ga0307516_101345262 107
1026 3300031730 Ga0307516_10281644 Ga0307516_102816442 107
1027 3300031731 Ga0307405_10629463 Ga0307405_106294631 107
1028 3300031731 Ga0307405_11012551 Ga0307405_110125512 107
1029 3300031824 Ga0307413_10176723 Ga0307413_101767232 107
1030 3300031824 Ga0307413_10341159 Ga0307413_103411592 107
1031 3300031901 Ga0307406_10335531 Ga0307406_103355312 107
1032 3300031901 Ga0307406_10526277 Ga0307406_105262772 107
1033 3300031901 Ga0307406_11052428 Ga0307406_110524282 107
1034 3300031903 Ga0307407_10454913 Ga0307407_104549131 107
1035 3300031903 Ga0307407_10978363 Ga0307407_109783631 107
1036 3300031911 Ga0307412_10432509 Ga0307412_104325092 107
1037 3300031911 Ga0307412_10495967 Ga0307412_104959672 107
1038 3300031911 Ga0307412_11840478 Ga0307412_118404782 107
1039 3300031995 Ga0307409_100831084 Ga0307409_1008310842 107
1040 3300031995 Ga0307409_100832600 Ga0307409_1008326002 107
1041 3300031995 Ga0307409_101840791 Ga0307409_1018407912 107
1042 3300031995 Ga0307409_102627992 Ga0307409_1026279921 107
1043 3300032002 Ga0307416_100346475 Ga0307416_1003464752 107
1044 3300032002 Ga0307416_100761660 Ga0307416_1007616602 107
1045 3300032002 Ga0307416_102839709 Ga0307416_1028397092 107
1046 3300032004 Ga0307414_10077804 Ga0307414_100778042 107
1047 3300032004 Ga0307414_10373837 Ga0307414_103738372 107
1048 3300032004 Ga0307414_11003345 Ga0307414_110033451 107
1049 3300032005 Ga0307411_10349488 Ga0307411_103494881 107
1050 3300032005 Ga0307411_10427413 Ga0307411_104274131 107
1051 3300032005 Ga0307411_10579582 Ga0307411_105795822 107
1052 3300032126 Ga0307415_100070392 Ga0307415_1000703922 107
1053 3300032126 Ga0307415_102364114 Ga0307415_1023641141 107
1054 3300033179 Ga0307507_10294194 Ga0307507_102941942 107
1055 3300033180 Ga0307510_10001271 Ga0307510_1000127120 107
1056 3300033180 Ga0307510_10047803 Ga0307510_100478033 107
1057 3300033180 Ga0307510_10396400 Ga0307510_103964002 107
1058 3300033442 Ga0315911_1000008 Ga0315911_1000008334 107
1059 3300034816 Ga0373930_0001937 Ga0373930_0001937_93_416 107
1060 3300034818 Ga0373950_0080260 Ga0373950_0080260_285_614 107
1061 3300034819 Ga0373958_0068524 Ga0373958_0068524_220_543 107
1062 3300035083 Ga0373926_0046065 Ga0373926_0046065_409_732 107
1063 3300035083 Ga0373926_0090928 Ga0373926_0090928_202_528 107
1064 3300035084 Ga0373928_0178595 Ga0373928_0178595_207_530 107
1065 3300035085 Ga0373929_0083651 Ga0373929_0083651_270_593 107
1066 3300035086 Ga0373934_0016343 Ga0373934_0016343_2129_2452 107
1067 3300035088 Ga0373940_0117675 Ga0373940_0117675_375_698 107
1068 3300035088 Ga0373940_0170022 Ga0373940_0170022_276_599 107
1069 3300035089 Ga0373944_0136774 Ga0373944_0136774_236_562 107
1070 3300035089 Ga0373944_0185526 Ga0373944_0185526_277_600 107
1071 3300035091 Ga0373951_0035188 Ga0373951_0035188_706_1029 107
1072 3300035091 Ga0373951_0074543 Ga0373951_0074543_344_670 107
1073 3300035092 Ga0373952_0024452 Ga0373952_0024452_185_508 107
1074 3300035111 Ga0373923_0028690 Ga0373923_0028690_460_786 107
1075 3300035111 Ga0373923_0065095 Ga0373923_0065095_508_831 107
1076 3300035111 Ga0373923_0084462 Ga0373923_0084462_274_597 107
1077 3300035111 Ga0373923_0334490 Ga0373923_0334490_126_452 107
1078 3300035113 Ga0373936_0032611 Ga0373936_0032611_1048_1371 107
1079 3300035113 Ga0373936_0070642 Ga0373936_0070642_327_650 107
1080 3300035113 Ga0373936_0095343 Ga0373936_0095343_151_474 107
1081 3300035113 Ga0373936_0201176 Ga0373936_0201176_104_427 107
1082 3300035116 Ga0373945_0060788 Ga0373945_0060788_73_396 107
1083 3300035116 Ga0373945_0078605 Ga0373945_0078605_575_901 107
1084 3300035116 Ga0373945_0263745 Ga0373945_0263745_17_343 107
1085 3300035117 Ga0373953_0011511 Ga0373953_0011511_1629_1952 107
1086 3300035117 Ga0373953_0238715 Ga0373953_0238715_172_498 107
1087 3300035118 Ga0373954_0010559 Ga0373954_0010559_1855_2178 107
1088 3300035118 Ga0373954_0019659 Ga0373954_0019659_2045_2371 107
1089 3300035118 Ga0373954_0054198 Ga0373954_0054198_486_809 107
1090 3300035118 Ga0373954_0337807 Ga0373954_0337807_404_727 107
1091 3300035118 Ga0373954_0405729 Ga0373954_0405729_59_382 107
1092 3300035119 Ga0373956_0116779 Ga0373956_0116779_352_678 107
1093 3300035119 Ga0373956_0244679 Ga0373956_0244679_19_342 107
1094 3300035120 Ga0373957_0003256 Ga0373957_0003256_4031_4354 107
1095 3300035170 Ga0373943_0013206 Ga0373943_0013206_3273_3599 107
1096 3300035170 Ga0373943_0075540 Ga0373943_0075540_697_1020 107
1097 3300035170 Ga0373943_0615322 Ga0373943_0615322_167_493 107
1098 3300035171 Ga0373946_0031509 Ga0373946_0031509_1759_2082 107
1099 3300035171 Ga0373946_0321022 Ga0373946_0321022_348_674 107
1100 3300035171 Ga0373946_0608416 Ga0373946_0608416_164_490 107
1101 3300035172 Ga0373955_0072375 Ga0373955_0072375_586_909 107
1102 3300035172 Ga0373955_0328510 Ga0373955_0328510_134_460 107
1103 3300035172 Ga0373955_0663657 Ga0373955_0663657_120_443 107
1104 3300035207 Ga0373942_0063034 Ga0373942_0063034_392_715 107
1105 3300035410 Ga0373924_0120257 Ga0373924_0120257_359_685 107
1106 3300035410 Ga0373924_0192341 Ga0373924_0192341_488_814 107
1107 3300035691 Ga0373931_0259870 Ga0373931_0259870_332_655 107
1108 3300035691 Ga0373931_0582955 Ga0373931_0582955_347_673 107
1109 3300035692 Ga0373935_0004959 Ga0373935_0004959_3943_4269 107
1110 3300035692 Ga0373935_0168784 Ga0373935_0168784_1015_1338 107
1111 3300035692 Ga0373935_0718514 Ga0373935_0718514_237_569 107
1112 3300035692 Ga0373935_1399104 Ga0373935_1399104_104_427 107
1113 3300035695 Ga0373927_0001486 Ga0373927_0001486_1069_1395 107
1114 3300035695 Ga0373927_0001909 Ga0373927_0001909_8130_8456 107
1115 3300035695 Ga0373927_0095400 Ga0373927_0095400_824_1147 107
1116 3300035695 Ga0373927_0125931 Ga0373927_0125931_697_1029 107
1117 3300035695 Ga0373927_0209617 Ga0373927_0209617_417_740 107
1118 3300035695 Ga0373927_0545663 Ga0373927_0545663_393_716 107
1119 3300035695 Ga0373927_0595878 Ga0373927_0595878_208_531 107
1120 3300035724 Ga0373933_0000031 Ga0373933_0000031_25842_26165 107
1121 3300035724 Ga0373933_0027834 Ga0373933_0027834_2563_2886 107
1122 3300035724 Ga0373933_0108468 Ga0373933_0108468_439_762 107
1123 3300035724 Ga0373933_0312652 Ga0373933_0312652_628_951 107
1124 3300035724 Ga0373933_0455940 Ga0373933_0455940_48_374 107
1125 3300035725 Ga0373947_0001274 Ga0373947_0001274_7828_8154 107
1126 3300035725 Ga0373947_0016858 Ga0373947_0016858_3148_3474 107
1127 3300035725 Ga0373947_0150029 Ga0373947_0150029_151_474 107
1128 3300036401 Ga0373937_0024272 Ga0373937_0024272_1189_1512 107
1129 3300036401 Ga0373937_0030861 Ga0373937_0030861_1187_1513 107
1130 3300036401 Ga0373937_0435623 Ga0373937_0435623_83_406 107
1131 3300036401 Ga0373937_1851361 Ga0373937_1851361_78_401 107
1132 3300036401 Ga0373937_1893868 Ga0373937_1893868_164_490 107
1133 3300036459 Ga0372808_041602 Ga0372808_041602_156_479 107
1134 3300037068 Ga0373925_0001594 Ga0373925_0001594_13591_13917 107
1135 3300037068 Ga0373925_0010880 Ga0373925_0010880_4677_5000 107
1136 3300037068 Ga0373925_0164313 Ga0373925_0164313_365_691 107
1137 3300037068 Ga0373925_0262322 Ga0373925_0262322_672_995 107
1138 3300037068 Ga0373925_0671865 Ga0373925_0671865_95_418 107
1139 3300037068 Ga0373925_0966565 Ga0373925_0966565_50_373 107
1140 3300037312 Ga0395899_0838253 Ga0395899_0838253_79_405 107
1141 3300037418 Ga0395900_0010736 Ga0395900_0010736_6339_6662 107
1142 3300037418 Ga0395900_0170118 Ga0395900_0170118_1810_2133 107
1143 3300037418 Ga0395900_0407775 Ga0395900_0407775_921_1244 107
1144 3300037466 Ga0395898_0030124 Ga0395898_0030124_3935_4258 107
1145 3300037466 Ga0395898_0051847 Ga0395898_0051847_1620_1943 107
1146 3300037466 Ga0395898_1574424 Ga0395898_1574424_90_413 107
1147 3300037471 Ga0395905_0036106 Ga0395905_0036106_3113_3436 107
1148 3300037471 Ga0395905_0251635 Ga0395905_0251635_1011_1334 107
1149 3300037853 Ga0436364_0391637 Ga0436364_0391637_101_427 107
1150 3300037853 Ga0436364_0568842 Ga0436364_0568842_1337_1660 107
1151 3300037853 Ga0436364_1276004 Ga0436364_1276004_4285_4608 107
1152 3300037853 Ga0436364_1322318 Ga0436364_1322318_34_357 107
1153 3300037853 Ga0436364_1468116 Ga0436364_1468116_184_507 107
1154 3300038443 Ga0395901_0002704 Ga0395901_0002704_11558_11881 107
1155 3300038443 Ga0395901_0351475 Ga0395901_0351475_889_1212 107
1156 3300038443 Ga0395901_0425485 Ga0395901_0425485_78_401 107
1157 3300038443 Ga0395901_1718790 Ga0395901_1718790_76_399 107
1158 3300039437 Ga0436365_0742828 Ga0436365_0742828_41_364 107
1159 3300039437 Ga0436365_0922495 Ga0436365_0922495_523_852 107
1160 3300039437 Ga0436365_1014733 Ga0436365_1014733_843_1169 107
1161 3300039437 Ga0436365_1195005 Ga0436365_1195005_246_569 107
1162 3300039437 Ga0436365_1314154 Ga0436365_1314154_313_636 107
1163 3300039437 Ga0436365_1381707 Ga0436365_1381707_2236_2613 107
1164 3300039437 Ga0436365_1701765 Ga0436365_1701765_249_572 107
1165 3300039437 Ga0436365_1803227 Ga0436365_1803227_89_412 107
1166 3300039437 Ga0436365_1937071 Ga0436365_1937071_564_887 107
1167 3300039438 Ga0436360_0390894 Ga0436360_0390894_567_890 107
1168 3300039438 Ga0436360_0452855 Ga0436360_0452855_367_696 107
1169 3300039438 Ga0436360_0523977 Ga0436360_0523977_1085_1411 107
1170 3300039447 Ga0436361_0584437 Ga0436361_0584437_129_527 107
1171 3300039447 Ga0436361_1184530 Ga0436361_1184530_1223_1546 107
1172 3300039450 Ga0436363_0321460 Ga0436363_0321460_218_541 107
1173 3300039450 Ga0436363_0693501 Ga0436363_0693501_183_509 107
1174 3300039450 Ga0436363_0998150 Ga0436363_0998150_137_463 107
1175 3300039450 Ga0436363_1268948 Ga0436363_1268948_606_983 107
1176 3300039450 Ga0436363_1370145 Ga0436363_1370145_85_408 107
1177 3300039453 Ga0436362_0187183 Ga0436362_0187183_297_623 107
1178 3300039453 Ga0436362_0958247 Ga0436362_0958247_377_703 107
1179 3300041410 Ga0439461_0067257 Ga0439461_0067257_483_806 107
1180 3300041413 Ga0439465_0018997 Ga0439465_0018997_611_934 107
1181 3300041413 Ga0439465_0075697 Ga0439465_0075697_201_527 107
1182 3300041413 Ga0439465_0141599 Ga0439465_0141599_334_657 107
1183 3300041441 Ga0451787_780058 Ga0451787_780058_115_438 107
1184 3300041443 Ga0451789_0888595 Ga0451789_0888595_113_436 107
1185 3300041451 Ga0451791_0599775 Ga0451791_0599775_95_496 107
1186 3300041451 Ga0451791_1266234 Ga0451791_1266234_37_360 107
1187 3300041451 Ga0451791_1292449 Ga0451791_1292449_323_646 107
1188 3300041452 Ga0451793_1125275 Ga0451793_1125275_295_621 107
1189 3300041452 Ga0451793_1229531 Ga0451793_1229531_12_335 107
1190 3300041452 Ga0451793_1872073 Ga0451793_1872073_229_552 107
1191 3300041453 Ga0451797_1253056 Ga0451797_1253056_86_412 107
1192 3300041453 Ga0451797_1528373 Ga0451797_1528373_137_460 107
1193 3300041453 Ga0451797_1528537 Ga0451797_1528537_300_623 107
1194 3300041459 Ga0451800_0230353 Ga0451800_0230353_585_911 107
1195 3300041459 Ga0451800_0533958 Ga0451800_0533958_218_541 107
1196 3300041486 Ga0451807_1734003 Ga0451807_1734003_617_940 107
1197 3300041486 Ga0451807_2413021 Ga0451807_2413021_320_646 107
1198 3300041491 Ga0451833_1163545 Ga0451833_1163545_372_698 107
1199 3300041492 Ga0451835_0842897 Ga0451835_0842897_342_668 107
1200 3300041494 Ga0451837_1292424 Ga0451837_1292424_333_656 107
1201 3300041496 Ga0451839_0106765 Ga0451839_0106765_125_448 107
1202 3300041496 Ga0451839_0492820 Ga0451839_0492820_124_447 107
1203 3300041498 Ga0451841_1019505 Ga0451841_1019505_18_350 107
1204 3300041498 Ga0451841_1347967 Ga0451841_1347967_133_456 107
1205 3300041498 Ga0451841_1402171 Ga0451841_1402171_365_691 107
1206 3300041501 Ga0451845_0794558 Ga0451845_0794558_218_541 107
1207 3300041505 Ga0451849_0920381 Ga0451849_0920381_1126_1452 107
1208 3300041507 Ga0451851_0304924 Ga0451851_0304924_308_634 107
1209 3300041509 Ga0451843_0158622 Ga0451843_0158622_22_348 107
1210 3300041511 Ga0451855_1811011 Ga0451855_1811011_289_612 107
1211 3300041512 Ga0451853_2545291 Ga0451853_2545291_328_651 107
1212 3300041512 Ga0451853_2610219 Ga0451853_2610219_145_468 107
1213 3300042004 Ga0439445_0057303 Ga0439445_0057303_387_710 107
1214 3300042005 Ga0439448_0073205 Ga0439448_0073205_101_424 107
1215 3300042012 Ga0439455_0123380 Ga0439455_0123380_139_462 107
1216 3300042012 Ga0439455_0155777 Ga0439455_0155777_65_391 107
1217 3300042157 Ga0439458_0207249 Ga0439458_0207249_16_339 107
1218 3300042438 Ga0439459_0229562 Ga0439459_0229562_180_503 107
1219 3300042461 Ga0439460_0278954 Ga0439460_0278954_202_525 107
1220 3300044656 Ga0466969_0190562 Ga0466969_0190562_516_839 107
1221 3300044656 Ga0466969_0219738 Ga0466969_0219738_154_483 107
1222 3300044656 Ga0466969_0310401 Ga0466969_0310401_81_407 107
1223 3300044658 Ga0466972_0000119 Ga0466972_0000119_25517_25843 107
1224 3300044658 Ga0466972_0051943 Ga0466972_0051943_644_970 107
1225 3300044658 Ga0466972_0125740 Ga0466972_0125740_719_1045 107
1226 3300044683 Ga0466965_0011816 Ga0466965_0011816_502_828 107
1227 3300044683 Ga0466965_0298628 Ga0466965_0298628_459_782 107
1228 3300044683 Ga0466965_0713744 Ga0466965_0713744_41_364 107
1229 3300044684 Ga0466966_0923500 Ga0466966_0923500_55_378 107
1230 3300044693 Ga0466961_0222959 Ga0466961_0222959_293_619 107
1231 3300044693 Ga0466961_0286931 Ga0466961_0286931_654_983 107
1232 3300044694 Ga0466963_0289098 Ga0466963_0289098_707_1030 107
1233 3300044719 Ga0466971_0032657 Ga0466971_0032657_384_707 107
1234 3300044735 Ga0466968_0076008 Ga0466968_0076008_1024_1350 107
1235 3300044735 Ga0466968_0102535 Ga0466968_0102535_719_1045 107
1236 3300044735 Ga0466968_0188917 Ga0466968_0188917_439_762 107
1237 3300044765 Ga0466970_0170664 Ga0466970_0170664_813_1139 107
1238 3300044765 Ga0466970_0208470 Ga0466970_0208470_28_351 107
1239 3300044842 Ga0466957_0346587 Ga0466957_0346587_161_490 107
1240 3300044901 Ga0466960_0066735 Ga0466960_0066735_1141_1467 107
1241 3300044901 Ga0466960_0086603 Ga0466960_0086603_297_623 107
1242 3300044901 Ga0466960_0154823 Ga0466960_0154823_453_776 107
1243 3300045049 Ga0466959_0016385 Ga0466959_0016385_1765_2088 107
1244 3300045049 Ga0466959_0039621 Ga0466959_0039621_605_934 107
1245 3300045836 Ga0466958_0360766 Ga0466958_0360766_134_457 107
1246 3300045976 Ga0466967_0356686 Ga0466967_0356686_752_1075 107
1247 3300045976 Ga0466967_0498470 Ga0466967_0498470_417_740 107
1248 3300045976 Ga0466967_0513321 Ga0466967_0513321_692_1021 107
1249 3300045976 Ga0466967_1985098 Ga0466967_1985098_193_516 107
1250 3300046452 Ga0495617_070988 Ga0495617_070988_417_740 107
1251 3300046452 Ga0495617_148693 Ga0495617_148693_215_538 107
1252 3300046452 Ga0495617_188533 Ga0495617_188533_86_409 107
1253 3300046453 Ga0495627_046019 Ga0495627_046019_612_935 107
1254 3300046454 Ga0495592_0001103 Ga0495592_0001103_5679_6002 107
1255 3300046454 Ga0495592_0075075 Ga0495592_0075075_1585_1908 107
1256 3300046454 Ga0495592_0088525 Ga0495592_0088525_875_1201 107
1257 3300046454 Ga0495592_0473027 Ga0495592_0473027_298_621 107
1258 3300046455 Ga0495603_0000047 Ga0495603_0000047_13626_13952 107
1259 3300046455 Ga0495603_0003797 Ga0495603_0003797_2705_3031 107
1260 3300046455 Ga0495603_0051843 Ga0495603_0051843_1257_1583 107
1261 3300046455 Ga0495603_0138436 Ga0495603_0138436_237_560 107
1262 3300046455 Ga0495603_0202083 Ga0495603_0202083_811_1134 107
1263 3300046455 Ga0495603_0241335 Ga0495603_0241335_113_436 107
1264 3300046455 Ga0495603_0346494 Ga0495603_0346494_27_350 107
1265 3300046457 Ga0495590_0206771 Ga0495590_0206771_173_496 107
1266 3300046459 Ga0495629_0000320 Ga0495629_0000320_13601_13927 107
1267 3300046459 Ga0495629_0015701 Ga0495629_0015701_4714_5037 107
1268 3300046459 Ga0495629_0209858 Ga0495629_0209858_775_1098 107
1269 3300046459 Ga0495629_0775306 Ga0495629_0775306_167_490 107
1270 3300046460 Ga0495638_0335960 Ga0495638_0335960_108_431 107
1271 3300046460 Ga0495638_0495295 Ga0495638_0495295_117_440 107
1272 3300046461 Ga0495641_0003618 Ga0495641_0003618_1026_1352 107
1273 3300046462 Ga0495651_0003655 Ga0495651_0003655_11001_11324 107
1274 3300046462 Ga0495651_0044644 Ga0495651_0044644_1907_2230 107
1275 3300046462 Ga0495651_0357420 Ga0495651_0357420_155_520 107
1276 3300046462 Ga0495651_0359286 Ga0495651_0359286_397_720 107
1277 3300046463 Ga0495653_0002935 Ga0495653_0002935_576_899 107
1278 3300046463 Ga0495653_0105759 Ga0495653_0105759_1577_1900 107
1279 3300046463 Ga0495653_0165734 Ga0495653_0165734_786_1109 107
1280 3300046471 Ga0495650_0050315 Ga0495650_0050315_283_609 107
1281 3300046471 Ga0495650_0140910 Ga0495650_0140910_128_451 107
1282 3300046472 Ga0495580_0003812 Ga0495580_0003812_976_1302 107
1283 3300046472 Ga0495580_0011284 Ga0495580_0011284_1610_1933 107
1284 3300046472 Ga0495580_0064468 Ga0495580_0064468_1666_1992 107
1285 3300046473 Ga0495582_0000043 Ga0495582_0000043_62457_62783 107
1286 3300046473 Ga0495582_0008940 Ga0495582_0008940_1856_2179 107
1287 3300046473 Ga0495582_0056468 Ga0495582_0056468_383_706 107
1288 3300046474 Ga0495605_0052793 Ga0495605_0052793_1319_1645 107
1289 3300046475 Ga0495639_0000091 Ga0495639_0000091_38049_38375 107
1290 3300046475 Ga0495639_0003629 Ga0495639_0003629_2921_3244 107
1291 3300046475 Ga0495639_0036537 Ga0495639_0036537_1238_1561 107
1292 3300046476 Ga0495662_0001246 Ga0495662_0001246_8378_8704 107
1293 3300046476 Ga0495662_0052252 Ga0495662_0052252_206_529 107
1294 3300046476 Ga0495662_0329984 Ga0495662_0329984_391_714 107
1295 3300046477 Ga0495664_0007170 Ga0495664_0007170_2620_2943 107
1296 3300046477 Ga0495664_0029468 Ga0495664_0029468_2078_2404 107
1297 3300046477 Ga0495664_0084176 Ga0495664_0084176_413_736 107
1298 3300046477 Ga0495664_0582450 Ga0495664_0582450_44_370 107
1299 3300046491 Ga0495584_0091573 Ga0495584_0091573_667_990 107
1300 3300046491 Ga0495584_0158439 Ga0495584_0158439_523_846 107
1301 3300046491 Ga0495584_0405997 Ga0495584_0405997_111_434 107
1302 3300046492 Ga0495585_0073471 Ga0495585_0073471_1525_1848 107
1303 3300046492 Ga0495585_0176763 Ga0495585_0176763_425_748 107
1304 3300046492 Ga0495585_0269425 Ga0495585_0269425_203_526 107
1305 3300046499 Ga0495594_0000453 Ga0495594_0000453_3459_3785 107
1306 3300046499 Ga0495594_0025110 Ga0495594_0025110_316_639 107
1307 3300046499 Ga0495594_0728007 Ga0495594_0728007_93_416 107
1308 3300046500 Ga0495596_0101865 Ga0495596_0101865_98_421 107
1309 3300046500 Ga0495596_0244491 Ga0495596_0244491_173_499 107
1310 3300046500 Ga0495596_0252522 Ga0495596_0252522_197_520 107
1311 3300046506 Ga0495583_0119306 Ga0495583_0119306_742_1065 107
1312 3300046506 Ga0495583_0171057 Ga0495583_0171057_548_874 107
1313 3300046507 Ga0495606_0000252 Ga0495606_0000252_50828_51151 107
1314 3300046507 Ga0495606_0209332 Ga0495606_0209332_690_1016 107
1315 3300046511 Ga0495608_0002745 Ga0495608_0002745_480_803 107
1316 3300046511 Ga0495608_0348355 Ga0495608_0348355_405_728 107
1317 3300046512 Ga0495610_0166628 Ga0495610_0166628_16_339 107
1318 3300046513 Ga0495616_0212840 Ga0495616_0212840_436_759 107
1319 3300046514 Ga0495618_0032954 Ga0495618_0032954_228_551 107
1320 3300046514 Ga0495618_0897160 Ga0495618_0897160_17_340 107
1321 3300046516 Ga0495628_0018664 Ga0495628_0018664_2474_2797 107
1322 3300046516 Ga0495628_0028910 Ga0495628_0028910_505_828 107
1323 3300046516 Ga0495628_0212867 Ga0495628_0212867_427_753 107
1324 3300046516 Ga0495628_0508557 Ga0495628_0508557_333_656 107
1325 3300046516 Ga0495628_0782525 Ga0495628_0782525_144_467 107
1326 3300046516 Ga0495628_0950306 Ga0495628_0950306_164_487 107
1327 3300046517 Ga0495630_0010214 Ga0495630_0010214_1088_1414 107
1328 3300046517 Ga0495630_0021128 Ga0495630_0021128_4421_4744 107
1329 3300046517 Ga0495630_0358797 Ga0495630_0358797_334_657 107
1330 3300046517 Ga0495630_0755245 Ga0495630_0755245_344_667 107
1331 3300046518 Ga0495631_0056217 Ga0495631_0056217_893_1216 107
1332 3300046518 Ga0495631_0093256 Ga0495631_0093256_855_1181 107
1333 3300046518 Ga0495631_0203714 Ga0495631_0203714_426_749 107
1334 3300046519 Ga0495632_0131957 Ga0495632_0131957_662_985 107
1335 3300046522 Ga0495643_0210757 Ga0495643_0210757_581_904 107
1336 3300046523 Ga0495644_0038506 Ga0495644_0038506_893_1216 107
1337 3300046524 Ga0495648_0028481 Ga0495648_0028481_541_864 107
1338 3300046525 Ga0495663_0106637 Ga0495663_0106637_249_572 107
1339 3300046525 Ga0495663_0247197 Ga0495663_0247197_117_440 107
1340 3300046526 Ga0495666_0005355 Ga0495666_0005355_2992_3318 107
1341 3300046529 Ga0495652_0047305 Ga0495652_0047305_880_1203 107
1342 3300046529 Ga0495652_0077920 Ga0495652_0077920_415_738 107
1343 3300046529 Ga0495652_0089870 Ga0495652_0089870_1343_1666 107
1344 3300046529 Ga0495652_0095596 Ga0495652_0095596_2027_2353 107
1345 3300046529 Ga0495652_1115258 Ga0495652_1115258_86_412 107
1346 3300046530 Ga0495654_0398046 Ga0495654_0398046_197_520 107
1347 3300046531 Ga0495665_0001445 Ga0495665_0001445_8658_8984 107
1348 3300046531 Ga0495665_0028842 Ga0495665_0028842_642_968 107
1349 3300046531 Ga0495665_0029068 Ga0495665_0029068_1927_2250 107
1350 3300046533 Ga0495640_0003340 Ga0495640_0003340_8788_9114 107
1351 3300046533 Ga0495640_0037580 Ga0495640_0037580_2429_2752 107
1352 3300046533 Ga0495640_0051596 Ga0495640_0051596_786_1109 107
1353 3300046533 Ga0495640_0156349 Ga0495640_0156349_432_755 107
1354 3300046535 Ga0495586_0053587 Ga0495586_0053587_1748_2071 107
1355 3300046536 Ga0495587_0204981 Ga0495587_0204981_216_539 107
1356 3300046536 Ga0495587_0489924 Ga0495587_0489924_246_572 107
1357 3300046537 Ga0495598_0091495 Ga0495598_0091495_27_350 107
1358 3300046538 Ga0495609_0090703 Ga0495609_0090703_938_1261 107
1359 3300046538 Ga0495609_0251742 Ga0495609_0251742_74_400 107
1360 3300046539 Ga0495621_0034408 Ga0495621_0034408_1118_1441 107
1361 3300046539 Ga0495621_0228915 Ga0495621_0228915_347_670 107
1362 3300046542 Ga0495597_0078336 Ga0495597_0078336_332_655 107
1363 3300046542 Ga0495597_0403800 Ga0495597_0403800_42_365 107
1364 3300046543 Ga0495645_0046496 Ga0495645_0046496_2426_2749 107
1365 3300046543 Ga0495645_0168149 Ga0495645_0168149_173_499 107
1366 3300046543 Ga0495645_0364884 Ga0495645_0364884_368_691 107
1367 3300046543 Ga0495645_0732243 Ga0495645_0732243_15_338 107
1368 3300046543 Ga0495645_0747679 Ga0495645_0747679_199_522 107
1369 3300046543 Ga0495645_0840706 Ga0495645_0840706_106_429 107
1370 3300046557 Ga0495622_0001046 Ga0495622_0001046_10862_11188 107
1371 3300046557 Ga0495622_0017504 Ga0495622_0017504_222_545 107
1372 3300046558 Ga0495633_0116646 Ga0495633_0116646_520_843 107
1373 3300046558 Ga0495633_0316863 Ga0495633_0316863_149_475 107
1374 3300046559 Ga0495667_0000464 Ga0495667_0000464_19685_20008 107
1375 3300046559 Ga0495667_0011945 Ga0495667_0011945_5227_5553 107
1376 3300046559 Ga0495667_0035393 Ga0495667_0035393_94_417 107
1377 3300046559 Ga0495667_0085790 Ga0495667_0085790_550_873 107
1378 3300046559 Ga0495667_0995888 Ga0495667_0995888_32_355 107
1379 3300046615 Ga0495656_0009468 Ga0495656_0009468_1682_2005 107
1380 3300046615 Ga0495656_0015878 Ga0495656_0015878_393_716 107
1381 3300046615 Ga0495656_0022990 Ga0495656_0022990_1427_1750 107
1382 3300046616 Ga0495668_0088629 Ga0495668_0088629_52_375 107
1383 3300046616 Ga0495668_0149556 Ga0495668_0149556_532_855 107
1384 3300046616 Ga0495668_0317174 Ga0495668_0317174_229_555 107
1385 3300046642 Ga0495634_0012021 Ga0495634_0012021_2078_2404 107
1386 3300046642 Ga0495634_0017936 Ga0495634_0017936_4222_4545 107
1387 3300046642 Ga0495634_0140337 Ga0495634_0140337_1018_1341 107
1388 3300046642 Ga0495634_0396213 Ga0495634_0396213_62_385 107
1389 3300046648 Ga0495611_0434890 Ga0495611_0434890_159_482 107
1390 3300046648 Ga0495611_0462160 Ga0495611_0462160_31_354 107
1391 3300046660 Ga0495625_0335196 Ga0495625_0335196_200_523 107
1392 3300046660 Ga0495625_0475914 Ga0495625_0475914_280_603 107
1393 3300046660 Ga0495625_0662233 Ga0495625_0662233_287_610 107
1394 3300046663 Ga0495635_0005649 Ga0495635_0005649_7935_8261 107
1395 3300046663 Ga0495635_0641115 Ga0495635_0641115_164_487 107
1396 3300046664 Ga0495659_0147950 Ga0495659_0147950_267_590 107
1397 3300046665 Ga0495661_0368938 Ga0495661_0368938_61_384 107
1398 3300046665 Ga0495661_0406597 Ga0495661_0406597_24_350 107
1399 3300046674 Ga0495588_0010476 Ga0495588_0010476_1175_1501 107
1400 3300046674 Ga0495588_0076499 Ga0495588_0076499_1016_1339 107
1401 3300046675 Ga0495657_0003059 Ga0495657_0003059_4682_5005 107
1402 3300046675 Ga0495657_0003417 Ga0495657_0003417_1585_1908 107
1403 3300046678 Ga0495599_0001830 Ga0495599_0001830_11554_11877 107
1404 3300046678 Ga0495599_0052193 Ga0495599_0052193_1697_2020 107
1405 3300046678 Ga0495599_0101126 Ga0495599_0101126_880_1206 107
1406 3300046678 Ga0495599_0298409 Ga0495599_0298409_29_352 107
1407 3300046678 Ga0495599_0888163 Ga0495599_0888163_125_451 107
1408 3300046679 Ga0495623_0006142 Ga0495623_0006142_5362_5685 107
1409 3300046679 Ga0495623_0018620 Ga0495623_0018620_2591_2914 107
1410 3300046680 Ga0495646_0013771 Ga0495646_0013771_2761_3087 107
1411 3300046680 Ga0495646_0018667 Ga0495646_0018667_3388_3711 107
1412 3300046680 Ga0495646_0031356 Ga0495646_0031356_91_414 107
1413 3300046680 Ga0495646_0111341 Ga0495646_0111341_729_1052 107
1414 3300046680 Ga0495646_0306055 Ga0495646_0306055_320_643 107
1415 3300046681 Ga0495647_0000650 Ga0495647_0000650_5356_5682 107
1416 3300046681 Ga0495647_0136531 Ga0495647_0136531_513_836 107
1417 3300046681 Ga0495647_0295658 Ga0495647_0295658_225_548 107
1418 3300046683 Ga0495658_0001001 Ga0495658_0001001_13625_13951 107
1419 3300046683 Ga0495658_0161190 Ga0495658_0161190_854_1177 107
1420 3300046683 Ga0495658_0218743 Ga0495658_0218743_645_968 107
1421 3300046683 Ga0495658_0364608 Ga0495658_0364608_376_699 107
1422 3300046684 Ga0495669_0002088 Ga0495669_0002088_2879_3202 107
1423 3300046684 Ga0495669_0092341 Ga0495669_0092341_601_924 107
1424 3300046684 Ga0495669_0265734 Ga0495669_0265734_459_782 107
1425 3300046684 Ga0495669_0302882 Ga0495669_0302882_147_470 107
1426 3300046689 Ga0495613_0001794 Ga0495613_0001794_15691_16017 107
1427 3300046689 Ga0495613_0028886 Ga0495613_0028886_372_695 107
1428 3300046689 Ga0495613_1011925 Ga0495613_1011925_194_517 107
1429 3300046690 Ga0495624_0000694 Ga0495624_0000694_9179_9505 107
1430 3300046690 Ga0495624_0047820 Ga0495624_0047820_1087_1413 107
1431 3300046690 Ga0495624_0077537 Ga0495624_0077537_669_992 107
1432 3300046690 Ga0495624_0182174 Ga0495624_0182174_54_380 107
1433 3300046690 Ga0495624_0391400 Ga0495624_0391400_133_456 107
1434 3300046691 Ga0495670_0189737 Ga0495670_0189737_297_620 107
1435 3300046691 Ga0495670_0371054 Ga0495670_0371054_55_378 107
1436 3300046692 Ga0495671_0158995 Ga0495671_0158995_637_960 107
1437 3300046692 Ga0495671_0214928 Ga0495671_0214928_459_782 107
1438 3300046694 Ga0495649_0458199 Ga0495649_0458199_259_582 107
1439 3300046794 Ga0495589_0131643 Ga0495589_0131643_301_624 107
1440 3300046794 Ga0495589_0229048 Ga0495589_0229048_491_814 107
1441 3300046794 Ga0495589_0333424 Ga0495589_0333424_71_397 107
1442 3300046794 Ga0495589_0458572 Ga0495589_0458572_130_453 107
1443 3300046809 Ga0495600_0000311 Ga0495600_0000311_13544_13867 107
1444 3300046809 Ga0495600_0011575 Ga0495600_0011575_3066_3389 107
1445 3300046809 Ga0495600_0016340 Ga0495600_0016340_1026_1349 107
1446 3300046810 Ga0495660_0124482 Ga0495660_0124482_556_879 107
1447 3300046810 Ga0495660_0131217 Ga0495660_0131217_412_735 107
1448 3300047315 Ga0495581_0000783 Ga0495581_0000783_3873_4199 107
1449 3300047317 Ga0495604_0004173 Ga0495604_0004173_11068_11391 107
1450 3300047317 Ga0495604_0019288 Ga0495604_0019288_2038_2361 107
1451 3300047317 Ga0495604_0085062 Ga0495604_0085062_576_899 107
1452 3300047317 Ga0495604_0160716 Ga0495604_0160716_860_1183 107
1453 3300047317 Ga0495604_0182442 Ga0495604_0182442_463_789 107
1454 3300047317 Ga0495604_0214698 Ga0495604_0214698_71_397 107
1455 3300047317 Ga0495604_0234893 Ga0495604_0234893_115_438 107
1456 3300047318 Ga0495636_0075737 Ga0495636_0075737_244_567 107
1457 3300047319 Ga0495674_0004075 Ga0495674_0004075_9528_9851 107
1458 3300047319 Ga0495674_0010329 Ga0495674_0010329_4642_4968 107
1459 3300047319 Ga0495674_0058656 Ga0495674_0058656_256_579 107
1460 3300047319 Ga0495674_0098693 Ga0495674_0098693_1827_2150 107
1461 3300047319 Ga0495674_0420118 Ga0495674_0420118_106_465 107
1462 3300047319 Ga0495674_0621223 Ga0495674_0621223_473_799 107
1463 3300047319 Ga0495674_0768258 Ga0495674_0768258_314_637 107
1464 3300047320 Ga0495672_0013417 Ga0495672_0013417_78_401 107
1465 3300047320 Ga0495672_0153430 Ga0495672_0153430_574_900 107
1466 3300047321 Ga0495676_0028082 Ga0495676_0028082_3676_4002 107
1467 3300047321 Ga0495676_0307655 Ga0495676_0307655_437_760 107
1468 3300047321 Ga0495676_0870803 Ga0495676_0870803_227_550 107
1469 3300047322 Ga0495680_0000689 Ga0495680_0000689_34363_34686 107
1470 3300047322 Ga0495680_0003027 Ga0495680_0003027_2326_2649 107
1471 3300047322 Ga0495680_0476549 Ga0495680_0476549_109_435 107
1472 3300047323 Ga0495683_0433054 Ga0495683_0433054_168_491 107
1473 3300047443 Ga0495687_082245 Ga0495687_082245_274_597 107
1474 3300047443 Ga0495687_107873 Ga0495687_107873_333_659 107
1475 3300047444 Ga0495675_0010733 Ga0495675_0010733_2351_2674 107
1476 3300047444 Ga0495675_0033526 Ga0495675_0033526_2472_2795 107
1477 3300047445 Ga0495677_0064391 Ga0495677_0064391_196_519 107
1478 3300047446 Ga0495679_120101 Ga0495679_120101_20_343 107
1479 3300047447 Ga0495685_118061 Ga0495685_118061_45_371 107
1480 3300047469 Ga0495673_0048919 Ga0495673_0048919_1451_1774 107
1481 3300047469 Ga0495673_0117736 Ga0495673_0117736_632_955 107
1482 3300047469 Ga0495673_0238976 Ga0495673_0238976_259_582 107
1483 3300047471 Ga0495684_0004560 Ga0495684_0004560_3477_3800 107
1484 3300047471 Ga0495684_0546205 Ga0495684_0546205_102_461 107
1485 3300047472 Ga0495686_0084721 Ga0495686_0084721_711_1034 107
1486 3300047472 Ga0495686_0237528 Ga0495686_0237528_499_822 107
1487 3300047472 Ga0495686_0291241 Ga0495686_0291241_475_798 107
1488 3300047472 Ga0495686_0340200 Ga0495686_0340200_127_453 107
1489 3300047472 Ga0495686_0662115 Ga0495686_0662115_183_506 107
1490 3300047673 Ga0495593_0000005 Ga0495593_0000005_26001_26327 107
1491 3300047673 Ga0495593_0000693 Ga0495593_0000693_4147_4470 107
1492 3300047673 Ga0495593_0060438 Ga0495593_0060438_1642_1965 107
1493 3300047673 Ga0495593_0538765 Ga0495593_0538765_93_416 107
1494 3300048088 Ga0495602_0002384 Ga0495602_0002384_16484_16807 107
1495 3300048088 Ga0495602_0011209 Ga0495602_0011209_8216_8539 107
1496 3300048088 Ga0495602_0091870 Ga0495602_0091870_658_1023 107
1497 3300048089 Ga0495614_0136524 Ga0495614_0136524_83_409 107
1498 3300048089 Ga0495614_0558399 Ga0495614_0558399_78_401 107
1499 3300048089 Ga0495614_0600411 Ga0495614_0600411_107_430 107
1500 3300048903 Ga0496100_0046202 Ga0496100_0046202_2454_2777 107
1501 3300048903 Ga0496100_0081119 Ga0496100_0081119_1108_1431 107
1502 3300048903 Ga0496100_0361728 Ga0496100_0361728_215_538 107
1503 3300048903 Ga0496100_0371282 Ga0496100_0371282_252_575 107
1504 3300048903 Ga0496100_0616748 Ga0496100_0616748_177_500 107
1505 3300048903 Ga0496100_1046215 Ga0496100_1046215_85_408 107
1506 3300048903 Ga0496100_1084970 Ga0496100_1084970_243_566 107
1507 3300048903 Ga0496100_1238871 Ga0496100_1238871_23_346 107
1508 3300048904 Ga0496101_0025652 Ga0496101_0025652_2321_2644 107
1509 3300048904 Ga0496101_0394316 Ga0496101_0394316_748_1071 107
1510 3300048904 Ga0496101_0413479 Ga0496101_0413479_335_658 107
1511 3300048904 Ga0496101_0417264 Ga0496101_0417264_417_740 107
1512 3300048904 Ga0496101_0621207 Ga0496101_0621207_202_525 107
1513 3300048904 Ga0496101_0943702 Ga0496101_0943702_193_516 107
1514 3300048904 Ga0496101_1152540 Ga0496101_1152540_117_440 107
1515 3300048904 Ga0496101_1433520 Ga0496101_1433520_84_407 107
1516 3300048905 Ga0496102_0017911 Ga0496102_0017911_410_733 107
1517 3300048905 Ga0496102_0033921 Ga0496102_0033921_4055_4378 107
1518 3300048905 Ga0496102_0133958 Ga0496102_0133958_1829_2152 107
1519 3300048905 Ga0496102_0144712 Ga0496102_0144712_1558_1881 107
1520 3300048905 Ga0496102_0235865 Ga0496102_0235865_238_561 107
1521 3300048905 Ga0496102_0326158 Ga0496102_0326158_713_1036 107
1522 3300048905 Ga0496102_0826651 Ga0496102_0826651_61_384 107
1523 3300048905 Ga0496102_0918302 Ga0496102_0918302_127_450 107
1524 3300048906 Ga0496103_0053931 Ga0496103_0053931_626_949 107
1525 3300048906 Ga0496103_0269191 Ga0496103_0269191_634_957 107
1526 3300048906 Ga0496103_0471277 Ga0496103_0471277_176_499 107
1527 3300048907 Ga0496104_0025402 Ga0496104_0025402_3008_3331 107
1528 3300048907 Ga0496104_0045673 Ga0496104_0045673_2871_3194 107
1529 3300048907 Ga0496104_0097244 Ga0496104_0097244_683_1006 107
1530 3300048907 Ga0496104_0347410 Ga0496104_0347410_288_611 107
1531 3300048907 Ga0496104_0550515 Ga0496104_0550515_403_726 107
1532 3300048907 Ga0496104_0619494 Ga0496104_0619494_20_343 107
1533 3300048908 Ga0496105_0014175 Ga0496105_0014175_232_555 107
1534 3300048908 Ga0496105_0119142 Ga0496105_0119142_1702_2025 107
1535 3300048908 Ga0496105_0120853 Ga0496105_0120853_1476_1799 107
1536 3300048908 Ga0496105_0275815 Ga0496105_0275815_314_637 107
1537 3300048908 Ga0496105_0746137 Ga0496105_0746137_152_475 107
1538 3300048909 Ga0496106_0001014 Ga0496106_0001014_4371_4694 107
1539 3300048909 Ga0496106_0003850 Ga0496106_0003850_5993_6316 107
1540 3300048909 Ga0496106_0050610 Ga0496106_0050610_2784_3107 107
1541 3300048909 Ga0496106_0075546 Ga0496106_0075546_47_370 107
1542 3300048909 Ga0496106_0287752 Ga0496106_0287752_82_405 107
1543 3300048909 Ga0496106_0288580 Ga0496106_0288580_462_785 107
1544 3300048909 Ga0496106_0340030 Ga0496106_0340030_623_946 107
1545 3300048910 Ga0496107_0001220 Ga0496107_0001220_3713_4036 107
1546 3300048910 Ga0496107_0014694 Ga0496107_0014694_3839_4162 107
1547 3300048910 Ga0496107_0055422 Ga0496107_0055422_371_694 107
1548 3300048910 Ga0496107_0865470 Ga0496107_0865470_172_495 107
1549 3300048910 Ga0496107_1291882 Ga0496107_1291882_143_466 107
1550 3300048911 Ga0496108_0000274 Ga0496108_0000274_40426_40749 107
1551 3300048911 Ga0496108_0074319 Ga0496108_0074319_1964_2287 107
1552 3300048911 Ga0496108_0084230 Ga0496108_0084230_1381_1704 107
1553 3300048911 Ga0496108_0251248 Ga0496108_0251248_195_521 107
1554 3300048911 Ga0496108_0473035 Ga0496108_0473035_503_826 107
1555 3300048911 Ga0496108_1674155 Ga0496108_1674155_64_387 107
1556 3300048912 Ga0496109_0015843 Ga0496109_0015843_1553_1876 107
1557 3300048912 Ga0496109_0094433 Ga0496109_0094433_1067_1390 107
1558 3300048912 Ga0496109_0104306 Ga0496109_0104306_427_750 107
1559 3300048912 Ga0496109_0165348 Ga0496109_0165348_1636_1959 107
1560 3300048912 Ga0496109_1197104 Ga0496109_1197104_29_352 107
1561 3300048912 Ga0496109_1214530 Ga0496109_1214530_46_369 107
1562 3300048912 Ga0496109_1614762 Ga0496109_1614762_72_395 107
1563 3300048912 Ga0496109_2028574 Ga0496109_2028574_14_337 107
1564 3300048913 Ga0496110_0021100 Ga0496110_0021100_5044_5367 107
1565 3300048913 Ga0496110_0030873 Ga0496110_0030873_3249_3572 107
1566 3300048913 Ga0496110_0038340 Ga0496110_0038340_3829_4152 107
1567 3300048913 Ga0496110_0063774 Ga0496110_0063774_1024_1347 107
1568 3300048913 Ga0496110_0090607 Ga0496110_0090607_1085_1408 107
1569 3300048913 Ga0496110_0293749 Ga0496110_0293749_618_941 107
1570 3300048914 Ga0496111_0058877 Ga0496111_0058877_2201_2524 107
1571 3300048914 Ga0496111_0221307 Ga0496111_0221307_457_780 107
1572 3300048914 Ga0496111_0532449 Ga0496111_0532449_526_849 107
1573 3300048914 Ga0496111_0711294 Ga0496111_0711294_300_623 107
1574 3300048914 Ga0496111_1052523 Ga0496111_1052523_201_524 107
1575 3300048915 Ga0496112_0005625 Ga0496112_0005625_4076_4399 107
1576 3300048915 Ga0496112_0031708 Ga0496112_0031708_454_777 107
1577 3300048915 Ga0496112_0102427 Ga0496112_0102427_1616_1939 107
1578 3300048915 Ga0496112_0130345 Ga0496112_0130345_33_356 107
1579 3300048915 Ga0496112_0136519 Ga0496112_0136519_295_618 107
1580 3300048915 Ga0496112_1637167 Ga0496112_1637167_30_356 107
1581 3300048916 Ga0496113_0027822 Ga0496113_0027822_2221_2544 107
1582 3300048916 Ga0496113_0054366 Ga0496113_0054366_1208_1531 107
1583 3300048916 Ga0496113_0172515 Ga0496113_0172515_539_862 107
1584 3300048917 Ga0496114_0008301 Ga0496114_0008301_2957_3280 107
1585 3300048917 Ga0496114_0096582 Ga0496114_0096582_1040_1363 107
1586 3300048917 Ga0496114_0489468 Ga0496114_0489468_305_628 107
1587 3300048917 Ga0496114_0648325 Ga0496114_0648325_161_484 107
1588 3300048917 Ga0496114_0694856 Ga0496114_0694856_189_512 107
1589 3300048917 Ga0496114_1151110 Ga0496114_1151110_69_452 107
1590 3300048917 Ga0496114_1510875 Ga0496114_1510875_168_491 107
1591 3300048917 Ga0496114_1680237 Ga0496114_1680237_179_502 107
1592 3300048918 Ga0496115_0020999 Ga0496115_0020999_3269_3592 107
1593 3300048918 Ga0496115_0092884 Ga0496115_0092884_1632_1955 107
1594 3300048918 Ga0496115_0100243 Ga0496115_0100243_1802_2125 107
1595 3300048918 Ga0496115_0104420 Ga0496115_0104420_841_1164 107
1596 3300048918 Ga0496115_0238735 Ga0496115_0238735_199_522 107
1597 3300048918 Ga0496115_0357244 Ga0496115_0357244_123_446 107
1598 3300048918 Ga0496115_1041915 Ga0496115_1041915_61_387 107
1599 3300048918 Ga0496115_1058942 Ga0496115_1058942_260_583 107
1600 3300048919 Ga0496116_0266778 Ga0496116_0266778_238_561 107
1601 3300048920 Ga0496117_0540171 Ga0496117_0540171_29_352 107
1602 3300048921 Ga0496118_0164584 Ga0496118_0164584_852_1175 107
1603 3300048921 Ga0496118_0290295 Ga0496118_0290295_147_470 107
1604 3300048921 Ga0496118_0317300 Ga0496118_0317300_43_366 107
1605 3300048922 Ga0496119_0068236 Ga0496119_0068236_1708_2031 107
1606 3300048922 Ga0496119_0236208 Ga0496119_0236208_211_537 107
1607 3300048922 Ga0496119_0286458 Ga0496119_0286458_448_771 107
1608 3300048922 Ga0496119_0488159 Ga0496119_0488159_94_417 107
1609 3300048923 Ga0496120_0182323 Ga0496120_0182323_238_561 107
1610 3300048924 Ga0496121_0000270 Ga0496121_0000270_23708_24034 107
1611 3300048924 Ga0496121_0037967 Ga0496121_0037967_1450_1773 107
1612 3300048924 Ga0496121_0071477 Ga0496121_0071477_676_999 107
1613 3300048924 Ga0496121_0077872 Ga0496121_0077872_195_521 107
1614 3300048924 Ga0496121_0078410 Ga0496121_0078410_1664_1987 107
1615 3300048924 Ga0496121_0079313 Ga0496121_0079313_1599_1922 107
1616 3300048924 Ga0496121_0109967 Ga0496121_0109967_528_851 107
1617 3300048924 Ga0496121_0153113 Ga0496121_0153113_833_1156 107
1618 3300048924 Ga0496121_0433451 Ga0496121_0433451_51_374 107
1619 3300048924 Ga0496121_0503544 Ga0496121_0503544_352_675 107
1620 3300048924 Ga0496121_0625849 Ga0496121_0625849_83_406 107
1621 3300048924 Ga0496121_0784425 Ga0496121_0784425_50_373 107
1622 3300048927 Ga0496124_0302820 Ga0496124_0302820_250_573 107
1623 3300048927 Ga0496124_0330174 Ga0496124_0330174_280_603 107
1624 3300048928 Ga0496125_0000328 Ga0496125_0000328_23351_23674 107
1625 3300048928 Ga0496125_0042674 Ga0496125_0042674_3190_3516 107
1626 3300048929 Ga0496126_0002460 Ga0496126_0002460_12419_12742 107
1627 3300048929 Ga0496126_0021716 Ga0496126_0021716_17_340 107
1628 3300048929 Ga0496126_0024597 Ga0496126_0024597_4254_4604 107
1629 3300048929 Ga0496126_0033680 Ga0496126_0033680_3355_3678 107
1630 3300048929 Ga0496126_0077456 Ga0496126_0077456_522_845 107
1631 3300048929 Ga0496126_0116947 Ga0496126_0116947_546_872 107
1632 3300048929 Ga0496126_0138139 Ga0496126_0138139_975_1298 107
1633 3300048929 Ga0496126_0218863 Ga0496126_0218863_704_1027 107
1634 3300048929 Ga0496126_0295878 Ga0496126_0295878_864_1187 107
1635 3300048929 Ga0496126_0360048 Ga0496126_0360048_195_518 107
1636 3300048929 Ga0496126_0378869 Ga0496126_0378869_288_611 107
1637 3300048929 Ga0496126_0395286 Ga0496126_0395286_719_1042 107
1638 3300048929 Ga0496126_0449476 Ga0496126_0449476_584_907 107
1639 3300048929 Ga0496126_0527481 Ga0496126_0527481_284_607 107
1640 3300048929 Ga0496126_0546930 Ga0496126_0546930_535_858 107
1641 3300048929 Ga0496126_0706589 Ga0496126_0706589_283_606 107
1642 3300048929 Ga0496126_0725418 Ga0496126_0725418_300_623 107
1643 3300049459 Ga0495678_067963 Ga0495678_067963_244_567 107
1644 3300049460 Ga0495682_0082711 Ga0495682_0082711_621_947 107
1645 3300049460 Ga0495682_0113707 Ga0495682_0113707_399_725 107
1646 3300049460 Ga0495682_0170058 Ga0495682_0170058_44_367 107
1647 3300049568 Ga0501031_0006285 Ga0501031_0006285_1231_1554 107
1648 3300049568 Ga0501031_0025878 Ga0501031_0025878_351_674 107
1649 3300049568 Ga0501031_0244855 Ga0501031_0244855_448_771 107
1650 3300049569 Ga0501032_0000320 Ga0501032_0000320_38589_38912 107
1651 3300049569 Ga0501032_0005395 Ga0501032_0005395_5522_5845 107
1652 3300049569 Ga0501032_0029580 Ga0501032_0029580_1753_2076 107
1653 3300049569 Ga0501032_0111465 Ga0501032_0111465_1331_1654 107
1654 3300049569 Ga0501032_0270554 Ga0501032_0270554_340_663 107
1655 3300049569 Ga0501032_0724994 Ga0501032_0724994_197_520 107
1656 3300049570 Ga0501033_0000440 Ga0501033_0000440_977_1300 107
1657 3300049570 Ga0501033_0004363 Ga0501033_0004363_3813_4136 107
1658 3300049570 Ga0501033_0560848 Ga0501033_0560848_83_406 107
1659 3300049570 Ga0501033_0769270 Ga0501033_0769270_152_475 107
1660 3300049571 Ga0501034_0000250 Ga0501034_0000250_21005_21328 107
1661 3300049571 Ga0501034_0175296 Ga0501034_0175296_104_427 107
1662 3300049571 Ga0501034_0364154 Ga0501034_0364154_551_874 107
1663 3300049571 Ga0501034_0908754 Ga0501034_0908754_151_474 107
1664 3300049571 Ga0501034_0933331 Ga0501034_0933331_13_336 107
1665 3300049572 Ga0501036_0000956 Ga0501036_0000956_434_757 107
1666 3300049572 Ga0501036_0060965 Ga0501036_0060965_428_751 107
1667 3300049572 Ga0501036_0419024 Ga0501036_0419024_245_568 107
1668 3300049572 Ga0501036_0713306 Ga0501036_0713306_150_473 107
1669 3300049573 Ga0501037_0000092 Ga0501037_0000092_74309_74632 107
1670 3300049573 Ga0501037_0005763 Ga0501037_0005763_6146_6469 107
1671 3300049573 Ga0501037_0355753 Ga0501037_0355753_126_449 107
1672 3300049573 Ga0501037_0530055 Ga0501037_0530055_428_751 107
1673 3300049574 Ga0501038_0000059 Ga0501038_0000059_45345_45668 107
1674 3300049574 Ga0501038_0005534 Ga0501038_0005534_5844_6167 107
1675 3300049574 Ga0501038_0008403 Ga0501038_0008403_7209_7532 107
1676 3300049574 Ga0501038_0079408 Ga0501038_0079408_1103_1426 107
1677 3300049574 Ga0501038_0086948 Ga0501038_0086948_668_991 107
1678 3300049574 Ga0501038_0851833 Ga0501038_0851833_53_376 107
1679 3300049575 Ga0501039_0000547 Ga0501039_0000547_5859_6182 107
1680 3300049575 Ga0501039_0011559 Ga0501039_0011559_3685_4008 107
1681 3300049576 Ga0501040_0485546 Ga0501040_0485546_52_375 107
1682 3300049576 Ga0501040_0799197 Ga0501040_0799197_212_535 107
1683 3300049577 Ga0501041_0243047 Ga0501041_0243047_682_1005 107
1684 3300049578 Ga0501042_0003037 Ga0501042_0003037_5220_5543 107
1685 3300049578 Ga0501042_0031771 Ga0501042_0031771_936_1259 107
1686 3300049578 Ga0501042_0568941 Ga0501042_0568941_327_650 107
1687 3300049579 Ga0501043_0001889 Ga0501043_0001889_12976_13299 107
1688 3300049579 Ga0501043_0003262 Ga0501043_0003262_9885_10208 107
1689 3300049579 Ga0501043_0390481 Ga0501043_0390481_455_778 107
1690 3300049579 Ga0501043_0864630 Ga0501043_0864630_77_400 107
1691 3300049580 Ga0501046_0000483 Ga0501046_0000483_5899_6222 107
1692 3300049580 Ga0501046_0017797 Ga0501046_0017797_3751_4074 107
1693 3300049580 Ga0501046_0029784 Ga0501046_0029784_1033_1356 107
1694 3300049580 Ga0501046_0285350 Ga0501046_0285350_77_400 107
1695 3300049580 Ga0501046_0622725 Ga0501046_0622725_269_592 107
1696 3300049581 Ga0501047_0000022 Ga0501047_0000022_127038_127361 107
1697 3300049581 Ga0501047_0143329 Ga0501047_0143329_927_1250 107
1698 3300049581 Ga0501047_0737276 Ga0501047_0737276_328_651 107
1699 3300049581 Ga0501047_0776831 Ga0501047_0776831_103_426 107
1700 3300049582 Ga0501048_0000821 Ga0501048_0000821_13978_14301 107
1701 3300049582 Ga0501048_0347182 Ga0501048_0347182_631_954 107
1702 3300049582 Ga0501048_0797131 Ga0501048_0797131_216_539 107
1703 3300049583 Ga0501067_0000510 Ga0501067_0000510_15957_16280 107
1704 3300049583 Ga0501067_0197783 Ga0501067_0197783_644_967 107
1705 3300049583 Ga0501067_0293972 Ga0501067_0293972_222_545 107
1706 3300049584 Ga0501068_0034701 Ga0501068_0034701_2372_2695 107
1707 3300049584 Ga0501068_0079894 Ga0501068_0079894_564_887 107
1708 3300049584 Ga0501068_0248611 Ga0501068_0248611_155_478 107
1709 3300049585 Ga0501069_0031616 Ga0501069_0031616_667_990 107
1710 3300049586 Ga0501070_0002047 Ga0501070_0002047_7352_7675 107
1711 3300049586 Ga0501070_0155649 Ga0501070_0155649_1517_1840 107
1712 3300049586 Ga0501070_0403066 Ga0501070_0403066_504_827 107
1713 3300049586 Ga0501070_0447420 Ga0501070_0447420_340_663 107
1714 3300049586 Ga0501070_0759950 Ga0501070_0759950_337_660 107
1715 3300049587 Ga0501071_0049592 Ga0501071_0049592_1704_2027 107
1716 3300049587 Ga0501071_0084911 Ga0501071_0084911_1827_2150 107
1717 3300049587 Ga0501071_0340612 Ga0501071_0340612_217_540 107
1718 3300049587 Ga0501071_0807074 Ga0501071_0807074_134_457 107
1719 3300049588 Ga0501072_0001893 Ga0501072_0001893_8147_8470 107
1720 3300049588 Ga0501072_1566473 Ga0501072_1566473_113_436 107
1721 3300049589 Ga0501073_0000955 Ga0501073_0000955_18768_19091 107
1722 3300049589 Ga0501073_0448625 Ga0501073_0448625_19_342 107
1723 3300049590 Ga0501074_0000680 Ga0501074_0000680_20903_21226 107
1724 3300049590 Ga0501074_0888054 Ga0501074_0888054_34_357 107
1725 3300049591 Ga0501075_0548228 Ga0501075_0548228_115_438 107
1726 3300049592 Ga0501076_0071221 Ga0501076_0071221_2193_2516 107
1727 3300049592 Ga0501076_0503089 Ga0501076_0503089_636_959 107
1728 3300049741 Ga0501079_0026340 Ga0501079_0026340_897_1220 107
1729 3300049741 Ga0501079_0224781 Ga0501079_0224781_332_655 107
1730 3300049741 Ga0501079_1417338 Ga0501079_1417338_126_449 107
1731 3300049742 Ga0501080_0005687 Ga0501080_0005687_7013_7336 107
1732 3300049742 Ga0501080_0812140 Ga0501080_0812140_307_630 107
1733 3300049743 Ga0501081_0699717 Ga0501081_0699717_186_509 107
1734 3300049744 Ga0501083_0000808 Ga0501083_0000808_13986_14309 107
1735 3300049744 Ga0501083_0634501 Ga0501083_0634501_28_351 107
1736 3300049822 Ga0501035_0000240 Ga0501035_0000240_18977_19300 107
1737 3300049822 Ga0501035_0006394 Ga0501035_0006394_1430_1753 107
1738 3300049822 Ga0501035_0121273 Ga0501035_0121273_99_422 107
1739 3300049822 Ga0501035_1368406 Ga0501035_1368406_144_467 107
1740 3300049823 Ga0501044_0000072 Ga0501044_0000072_13635_13958 107
1741 3300049823 Ga0501044_0006535 Ga0501044_0006535_9119_9442 107
1742 3300049823 Ga0501044_0592866 Ga0501044_0592866_583_906 107
1743 3300049823 Ga0501044_0682676 Ga0501044_0682676_74_397 107
1744 3300049823 Ga0501044_1295468 Ga0501044_1295468_255_578 107
1745 3300049824 Ga0501045_0086458 Ga0501045_0086458_1682_2005 107
1746 3300049824 Ga0501045_0386297 Ga0501045_0386297_473_796 107
1747 3300049824 Ga0501045_0565141 Ga0501045_0565141_309_632 107
1748 3300049824 Ga0501045_0842104 Ga0501045_0842104_267_590 107
1749 3300050489 nmdc:mga03683_206255_c1 nmdc:mga03683_206255_c1_529_852 107
1750 3300050490 nmdc:mga03n38_17121_c1 nmdc:mga03n38_17121_c1_829_1152 107
1751 3300050490 nmdc:mga03n38_320514_c1 nmdc:mga03n38_320514_c1_248_571 107
1752 3300050490 nmdc:mga03n38_328337_c1 nmdc:mga03n38_328337_c1_61_387 107
1753 3300050490 nmdc:mga03n38_983_c1 nmdc:mga03n38_983_c1_102_425 107
1754 3300050491 nmdc:mga00v17_100274_c1 nmdc:mga00v17_100274_c1_496_822 107
1755 3300050491 nmdc:mga00v17_391262_c1 nmdc:mga00v17_391262_c1_524_847 107
1756 3300050491 nmdc:mga00v17_59908_c1 nmdc:mga00v17_59908_c1_58_381 107
1757 3300050491 nmdc:mga00v17_876347_c1 nmdc:mga00v17_876347_c1_157_483 107
1758 3300050492 nmdc:mga0yw44_109855_c1 nmdc:mga0yw44_109855_c1_1316_1642 107
1759 3300050492 nmdc:mga0yw44_170723_c1 nmdc:mga0yw44_170723_c1_382_708 107
1760 3300050492 nmdc:mga0yw44_328887_c1 nmdc:mga0yw44_328887_c1_389_712 107
1761 3300050492 nmdc:mga0yw44_341228_c1 nmdc:mga0yw44_341228_c1_648_971 107
1762 3300050492 nmdc:mga0yw44_494609_c1 nmdc:mga0yw44_494609_c1_86_409 107
1763 3300050492 nmdc:mga0yw44_551583_c1 nmdc:mga0yw44_551583_c1_149_472 107
1764 3300050493 nmdc:mga0k408_63942_c1 nmdc:mga0k408_63942_c1_50_376 107
1765 3300050494 nmdc:mga06z11_11930_c1 nmdc:mga06z11_11930_c1_569_892 107
1766 3300050494 nmdc:mga06z11_155605_c1 nmdc:mga06z11_155605_c1_736_1062 107
1767 3300050494 nmdc:mga06z11_256645_c1 nmdc:mga06z11_256645_c1_185_508 107
1768 3300050494 nmdc:mga06z11_490235_c1 nmdc:mga06z11_490235_c1_96_419 107
1769 3300050494 nmdc:mga06z11_522562_c1 nmdc:mga06z11_522562_c1_65_388 107
1770 3300050494 nmdc:mga06z11_784210_c1 nmdc:mga06z11_784210_c1_239_562 107
1771 3300050494 nmdc:mga06z11_836904_c1 nmdc:mga06z11_836904_c1_132_455 107
1772 3300050495 nmdc:mga04h51_70985_c1 nmdc:mga04h51_70985_c1_305_628 107
1773 3300050495 nmdc:mga04h51_89255_c1 nmdc:mga04h51_89255_c1_419_742 107
1774 3300050496 nmdc:mga07m45_294497_c1 nmdc:mga07m45_294497_c1_422_748 107
1775 3300050496 nmdc:mga07m45_31222_c1 nmdc:mga07m45_31222_c1_239_562 107
1776 3300050496 nmdc:mga07m45_34453_c1 nmdc:mga07m45_34453_c1_1460_1786 107
1777 3300050496 nmdc:mga07m45_62214_c1 nmdc:mga07m45_62214_c1_1190_1516 107
1778 3300050507 nmdc:mga05p37_1036781_c1 nmdc:mga05p37_1036781_c1_506_829 107
1779 3300050507 nmdc:mga05p37_241836_c1 nmdc:mga05p37_241836_c1_325_648 107
1780 3300050508 nmdc:mga09592_543088_c1 nmdc:mga09592_543088_c1_557_880 107
1781 3300050511 nmdc:mga08y16_1081850_c1 nmdc:mga08y16_1081850_c1_38_361 107
1782 3300050511 nmdc:mga08y16_496491_c1 nmdc:mga08y16_496491_c1_411_734 107
1783 3300050512 nmdc:mga0n895_24914_c1 nmdc:mga0n895_24914_c1_3023_3346 107
1784 3300050513 nmdc:mga0rr50_208515_c1 nmdc:mga0rr50_208515_c1_949_1272 107
1785 3300050516 nmdc:mga0sz30_20943_c1 nmdc:mga0sz30_20943_c1_1633_1959 107
1786 3300050516 nmdc:mga0sz30_69079_c1 nmdc:mga0sz30_69079_c1_378_704 107
1787 3300050516 nmdc:mga0sz30_7938_c1 nmdc:mga0sz30_7938_c1_2622_2945 107
1788 3300053077 Ga0495601_0011749 Ga0495601_0011749_541_864 107
1789 3300053077 Ga0495601_0021106 Ga0495601_0021106_2549_2872 107
1790 3300053077 Ga0495601_0163249 Ga0495601_0163249_407_730 107
1791 3300053077 Ga0495601_0280686 Ga0495601_0280686_262_585 107
1792 3300053077 Ga0495601_0746229 Ga0495601_0746229_154_477 107
1793 3300053078 Ga0495612_0108327 Ga0495612_0108327_763_1086 107
1794 3300053078 Ga0495612_0187503 Ga0495612_0187503_527_853 107
1795 3300053078 Ga0495612_0376459 Ga0495612_0376459_178_504 107
1796 3300053079 Ga0500610_0167213 Ga0500610_0167213_422_754 107
1797 3300053079 Ga0500610_0171154 Ga0500610_0171154_249_575 107
1798 3300053079 Ga0500610_0263035 Ga0500610_0263035_59_385 107
1799 3300053080 Ga0500635_0085700 Ga0500635_0085700_74_400 107
1800 3300053080 Ga0500635_0300343 Ga0500635_0300343_126_449 107
1801 3300053083 Ga0495655_0032404 Ga0495655_0032404_355_738 107
1802 3300053083 Ga0495655_0055050 Ga0495655_0055050_725_1048 107
1803 3300053083 Ga0495655_0116987 Ga0495655_0116987_262_585 107
1804 3300053084 Ga0495595_0007066 Ga0495595_0007066_3728_4051 107
1805 3300053084 Ga0495595_0212423 Ga0495595_0212423_391_714 107
1806 3300053084 Ga0495595_0226318 Ga0495595_0226318_147_470 107
1807 3300053084 Ga0495595_0310414 Ga0495595_0310414_220_543 107
1808 3300053084 Ga0495595_0451990 Ga0495595_0451990_149_508 107
1809 3300053085 Ga0495619_0000330 Ga0495619_0000330_23925_24248 107
1810 3300053085 Ga0495619_0039505 Ga0495619_0039505_2498_2821 107
1811 3300053085 Ga0495619_0076369 Ga0495619_0076369_213_539 107
1812 3300053085 Ga0495619_0345896 Ga0495619_0345896_214_537 107
1813 3300053085 Ga0495619_0953921 Ga0495619_0953921_17_340 107
1814 3300053085 Ga0495619_1170899 Ga0495619_1170899_14_340 107
1815 3300053086 Ga0500578_0163800 Ga0500578_0163800_564_887 107
1816 3300053086 Ga0500578_0303396 Ga0500578_0303396_300_623 107
1817 3300053086 Ga0500578_0396746 Ga0500578_0396746_166_492 107
1818 3300053086 Ga0500578_0725592 Ga0500578_0725592_43_366 107
1819 3300053087 Ga0500643_096383 Ga0500643_096383_124_447 107
1820 3300053088 Ga0500644_0204528 Ga0500644_0204528_292_615 107
1821 3300053090 Ga0500646_0040366 Ga0500646_0040366_34_357 107
1822 3300053091 Ga0500647_0024752 Ga0500647_0024752_1651_1977 107
1823 3300053091 Ga0500647_0038499 Ga0500647_0038499_994_1317 107
1824 3300053092 Ga0500583_0157051 Ga0500583_0157051_449_775 107
1825 3300053093 Ga0500651_0208839 Ga0500651_0208839_391_717 107
1826 3300053093 Ga0500651_0233431 Ga0500651_0233431_456_779 107
1827 3300053094 Ga0500566_0000151 Ga0500566_0000151_19042_19365 107
1828 3300053094 Ga0500566_0000236 Ga0500566_0000236_15907_16233 107
1829 3300053094 Ga0500566_0115922 Ga0500566_0115922_604_930 107
1830 3300053095 Ga0500640_093752 Ga0500640_093752_874_1197 107
1831 3300053096 Ga0500641_0007070 Ga0500641_0007070_678_1001 107
1832 3300053096 Ga0500641_0079681 Ga0500641_0079681_462_785 107
1833 3300053096 Ga0500641_0154087 Ga0500641_0154087_200_523 107
1834 3300053097 Ga0500648_365634 Ga0500648_365634_119_445 107
1835 3300053098 Ga0500650_0489119 Ga0500650_0489119_124_447 107
1836 3300053103 Ga0500555_092982 Ga0500555_092982_262_588 107
1837 3300053103 Ga0500555_094404 Ga0500555_094404_428_751 107
1838 3300053108 Ga0500562_023343 Ga0500562_023343_958_1281 107
1839 3300053109 Ga0500569_001904 Ga0500569_001904_1072_1398 107
1840 3300053111 Ga0500572_004100 Ga0500572_004100_2337_2660 107
1841 3300053118 Ga0500594_0118598 Ga0500594_0118598_475_798 107
1842 3300053119 Ga0500595_001612 Ga0500595_001612_6681_7007 107
1843 3300053119 Ga0500595_011064 Ga0500595_011064_828_1151 107
1844 3300053119 Ga0500595_014944 Ga0500595_014944_1413_1736 107
1845 3300053119 Ga0500595_053895 Ga0500595_053895_295_621 107
1846 3300053120 Ga0500597_055128 Ga0500597_055128_711_1037 107
1847 3300053121 Ga0500607_019113 Ga0500607_019113_294_620 107
1848 3300053122 Ga0500608_029113 Ga0500608_029113_1760_2086 107
1849 3300053122 Ga0500608_109802 Ga0500608_109802_883_1206 107
1850 3300053123 Ga0500614_014155 Ga0500614_014155_448_771 107
1851 3300053123 Ga0500614_019715 Ga0500614_019715_485_811 107
1852 3300053124 Ga0500617_095330 Ga0500617_095330_271_594 107
1853 3300053126 Ga0500621_031297 Ga0500621_031297_538_861 107
1854 3300053126 Ga0500621_268406 Ga0500621_268406_217_543 107
1855 3300053129 Ga0500628_148696 Ga0500628_148696_289_612 107
1856 3300053130 Ga0500642_0000062 Ga0500642_0000062_24850_25176 107
1857 3300053130 Ga0500642_0403902 Ga0500642_0403902_173_496 107
1858 3300053133 Ga0500655_060730 Ga0500655_060730_252_575 107
1859 3300053134 Ga0500658_0041496 Ga0500658_0041496_666_992 107
1860 3300053134 Ga0500658_0112952 Ga0500658_0112952_41_364 107
1861 3300053134 Ga0500658_0196857 Ga0500658_0196857_428_754 107
1862 3300053134 Ga0500658_0420295 Ga0500658_0420295_243_566 107
1863 3300053136 Ga0500559_0041843 Ga0500559_0041843_915_1238 107
1864 3300053136 Ga0500559_0140307 Ga0500559_0140307_662_988 107
1865 3300053138 Ga0500564_249242 Ga0500564_249242_171_497 107
1866 3300053139 Ga0500568_0038973 Ga0500568_0038973_1285_1611 107
1867 3300053139 Ga0500568_0057840 Ga0500568_0057840_383_709 107
1868 3300053139 Ga0500568_0101460 Ga0500568_0101460_248_571 107
1869 3300053142 Ga0500577_0004895 Ga0500577_0004895_1526_1849 107
1870 3300053142 Ga0500577_0171763 Ga0500577_0171763_303_629 107
1871 3300053142 Ga0500577_0248281 Ga0500577_0248281_300_623 107
1872 3300053143 Ga0500579_202394 Ga0500579_202394_78_401 107
1873 3300053146 Ga0500588_0014119 Ga0500588_0014119_1436_1762 107
1874 3300053146 Ga0500588_0184185 Ga0500588_0184185_86_409 107
1875 3300053147 Ga0500589_084895 Ga0500589_084895_1019_1342 107
1876 3300053147 Ga0500589_158992 Ga0500589_158992_337_660 107
1877 3300053148 Ga0500590_050834 Ga0500590_050834_810_1133 107
1878 3300053148 Ga0500590_134232 Ga0500590_134232_80_403 107
1879 3300053150 Ga0500603_014952 Ga0500603_014952_1070_1393 107
1880 3300053150 Ga0500603_124663 Ga0500603_124663_347_670 107
1881 3300053154 Ga0500619_082511 Ga0500619_082511_379_705 107
1882 3300053154 Ga0500619_216905 Ga0500619_216905_67_390 107
1883 3300053155 Ga0500620_019306 Ga0500620_019306_328_654 107
1884 3300053156 Ga0500622_0174713 Ga0500622_0174713_124_447 107
1885 3300053157 Ga0500624_051485 Ga0500624_051485_18_344 107
1886 3300053158 Ga0500627_0089888 Ga0500627_0089888_1001_1324 107
1887 3300053161 Ga0500634_0268119 Ga0500634_0268119_288_611 107
1888 3300053162 Ga0500638_013587 Ga0500638_013587_314_637 107
1889 3300053162 Ga0500638_057856 Ga0500638_057856_957_1283 107
1890 3300053162 Ga0500638_121946 Ga0500638_121946_474_797 107
1891 3300053177 Ga0500636_0009392 Ga0500636_0009392_2082_2408 107
1892 3300053177 Ga0500636_0210699 Ga0500636_0210699_619_942 107
1893 3300053178 Ga0500637_0105831 Ga0500637_0105831_1061_1384 107
1894 3300053178 Ga0500637_0341176 Ga0500637_0341176_376_702 107
1895 3300053178 Ga0500637_0540826 Ga0500637_0540826_230_553 107
1896 3300053178 Ga0500637_0610219 Ga0500637_0610219_165_488 107
1897 3300053725 Ga0500576_130793 Ga0500576_130793_204_527 107
1898 3300053727 Ga0500611_037017 Ga0500611_037017_370_693 107
1899 3300053727 Ga0500611_173831 Ga0500611_173831_186_512 107
1900 3300053729 Ga0500625_012606 Ga0500625_012606_2312_2638 107
1901 3300053730 Ga0500645_027197 Ga0500645_027197_1101_1424 107
1902 3300053730 Ga0500645_028443 Ga0500645_028443_89_412 107
1903 3300053731 Ga0500609_002131 Ga0500609_002131_1683_2009 107
1904 3300053732 Ga0500656_004887 Ga0500656_004887_168_491 107
1905 3300053735 Ga0500596_003468 Ga0500596_003468_1850_2173 107
1906 3300053737 Ga0500601_000544 Ga0500601_000544_4260_4586 107
1907 3300053739 Ga0500587_026587 Ga0500587_026587_227_550 107
1908 3300054114 Ga0501084_0003295 Ga0501084_0003295_5841_6164 107
1909 3300054114 Ga0501084_0603257 Ga0501084_0603257_594_917 107
1910 3300060353 Ga0501082_0001185 Ga0501082_0001185_932_1255 107
1911 3300060353 Ga0501082_0295227 Ga0501082_0295227_297_620 107
1912 3300061719 Ga0466962_0088033 Ga0466962_0088033_449_772 107
1913 3300061734 Ga0530510_0179764 Ga0530510_0179764_168_491 107
1914 3300061734 Ga0530510_1598571 Ga0530510_1598571_56_379 107
1915 iso_pu_bacteria 3005587118 3005592236 107

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01503

PRA-PH

Phosphoribosyl-ATP pyrophosphohydrolase

31

118

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3c90-assembly1.cif.gz_X the 1.25 a resolution structure of phosphoribosyl-atp pyrophosphohydrolase from mycobacterium tuberculosis, crystal form ii 0.9462 3 87
1yvw-assembly1.cif.gz_A crystal structure of phosphoribosyl-atp pyrophosphohydrolase from bacillus cereus. nesgc target bcr13. 0.9372 5 93
6j22-assembly1.cif.gz_B crystal structure of bi-functional enzyme 0.9362 6 90
6j2l-assembly1.cif.gz_A crystal structure of bi-functional enzyme 0.9173 6 90
6j2l-assembly1.cif.gz_B crystal structure of bi-functional enzyme 0.9151 6 90
ID Description Score Start End Superfamily
af_Q2FUU3_358_449_1.10.287.1080 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;MazG-like 0.9653 5 92 1.10.287.1080
3c90A00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;MazG-like 0.9457 3 87 1.10.287.1080
3c90C00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;MazG-like 0.9402 3 86 1.10.287.1080
1y6xA00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;MazG-like 0.9243 3 87 1.10.287.1080
af_P06989_113_203_1.10.287.1080 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;MazG-like 0.9208 6 92 1.10.287.1080
ID Description Score Start End GO Terms
AF-A0A2S6T9L3-F1-model_v4 Phosphoribosyl-ATP pyrophosphatase (PRA-PH) (EC 3.6.1.31) 0.9715 6 93 GO:0000105
GO:0004636
GO:0005524
GO:0005737
AF-A0A7Z7YT89-F1-model_v4 Histidine biosynthesis bifunctional protein HisIE (EC 3.5.4.19) (EC 3.6.1.31) 0.9673 3 96 GO:0000105
GO:0004635
GO:0004636
GO:0005524
AF-A0A151A2P8-F1-model_v4 Histidine biosynthesis bifunctional protein HisIE [Includes: Phosphoribosyl-AMP cyclohydrolase (PRA-CH) (EC 3.5.4.19); Phosphoribosyl-ATP pyrophosphatase (PRA-PH) (EC 3.6.1.31)] 0.9648 3 96 GO:0000105
GO:0004635
GO:0004636
GO:0005524
GO:0005737
AF-A0A1H1YYK5-F1-model_v4 Phosphoribosyl-ATP pyrophosphatase (PRA-PH) (EC 3.6.1.31) 0.9617 5 87 GO:0000105
GO:0004636
GO:0005524
GO:0005737
AF-A0A3T0Y521-F1-model_v4 Phosphoribosyl-ATP pyrophosphatase (PRA-PH) (EC 3.6.1.31) 0.9613 3 87 GO:0000105
GO:0004636
GO:0005524
GO:0005737

Feature Viewer

pLDDT pTM Quality
91.11 0.8 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map