F495856
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1839 | 762 | 1597 | 267 |
Family's Representative Sequence
| Representative Sequence | 3300005455|Ga0070663_100415887|Ga0070663_1004158871 |
| Length | 271 |
| Sequence | MYEFKYHRPTTVRQAANLLAKHSEAKLLAGGHSLIPVMKLRLAKPSDLVDLSQIEGLNTIELKGRSIVIGAMAKHGEVANSKVVQEALPVLAEVPGSIGDPAVRHLGTIGGSVANNDPAADYPAAVMALAATVHTNKRQLAADQYFTGLYTTALGEGEIVTKIAFKVPAQSGYAKFRNPASHYPMAGVFVAKHKDGSVRVAVTGAGNGGVFRWSAAESALGGNFSADALKGLSVDKNGMMGDIHGSAEYRANLVAVMARRALENLGKLTMT |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 2 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 3 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 4 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 5 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 6 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 7 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 8 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 9 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 10 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 11 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 12 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 13 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 14 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 15 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 16 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 17 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 18 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 19 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 20 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 21 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 22 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 23 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 24 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 25 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 26 | 2545555834 | Methylobacterium sp. WSM2598 | Isolate | Nodule |
| 27 | 2602042107 | Bradyrhizobium sp. NFR13 | Isolate | Rhizoplane |
| 28 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 29 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 30 | 2643221651 | Afipia sp. Root123D2 | Isolate | Unclassified |
| 31 | 2643221733 | Bosea sp. Root381 | Isolate | Unclassified |
| 32 | 2643221736 | Bosea sp. Root483D1 | Isolate | Unclassified |
| 33 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 34 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 35 | 2738543013 | Variovorax sp. BT01 | Isolate | Unclassified |
| 36 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 37 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 38 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 39 | 2791355199 | |||
| 40 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 41 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 42 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 43 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 44 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 45 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 46 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 47 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 48 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 49 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 50 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 51 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 52 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 53 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 54 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 55 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 56 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 57 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 58 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 59 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 60 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 61 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 62 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 63 | 2841760612 | Bosea sp. Tri-49 | Isolate | Nodule |
| 64 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 65 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 66 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 67 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 68 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 69 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 70 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 71 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 72 | 2844104063 | Bosea sp. Tri-39 | Isolate | Nodule |
| 73 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 74 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 75 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 76 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 77 | 2851246043 | Bosea sp. Tri-54 | Isolate | Nodule |
| 78 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 79 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 80 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 81 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 82 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 83 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 84 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 85 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 86 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 87 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 88 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 89 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 90 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 91 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 92 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 93 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 94 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 95 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 96 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 97 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 98 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 99 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 100 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 101 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 102 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 103 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 104 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 105 | 2893066018 | Tardiphaga sp. P9-11 | Isolate | Unclassified |
| 106 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 107 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 108 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 109 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 110 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 111 | 2904699407 | |||
| 112 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 113 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 114 | 2906610324 | |||
| 115 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 116 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 117 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 118 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 119 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 120 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 121 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 122 | 2917699015 | Bosea sp. F3-2 | Isolate | Rhizosphere |
| 123 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 124 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 125 | 2922368715 | |||
| 126 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 127 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 128 | 2922425934 | |||
| 129 | 2928115317 | Pseudacidovorax sp. 1753 | Isolate | Rhizosphere |
| 130 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 131 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 132 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 133 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 134 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 135 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 136 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 137 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 138 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 139 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 140 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 141 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 142 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 143 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 144 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 145 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 146 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 147 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 148 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 149 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 150 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 151 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 152 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 153 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 154 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 155 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 156 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 157 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 158 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 159 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 160 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 161 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 162 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 163 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 164 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 165 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 166 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 167 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 168 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 169 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 170 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 171 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 172 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 173 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 174 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 175 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 176 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 177 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 178 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 179 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 180 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 181 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 182 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 183 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 184 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 185 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 186 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 187 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 188 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 189 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 190 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 191 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 192 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 193 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 194 | 3003665799 | Methylobacterium aquaticum BG2 | Isolate | Unclassified |
| 195 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 196 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 197 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 198 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 199 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 200 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 201 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 202 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 203 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 204 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 205 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 206 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 207 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 208 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 209 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 210 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 211 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 212 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 213 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 214 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 215 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 216 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 217 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 218 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 219 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 220 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 221 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 222 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 223 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 224 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 225 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 226 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 227 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 228 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 229 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 230 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 231 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 232 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 233 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 234 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 235 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 236 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 237 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 238 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 239 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 240 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 241 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 242 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 243 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 244 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 245 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 246 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 247 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 248 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 249 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 250 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 251 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 252 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 253 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 254 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 255 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 256 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 257 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 258 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 259 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 260 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 261 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 262 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 263 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 264 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 265 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 266 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 267 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 268 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 269 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 270 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 271 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 272 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 273 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 274 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 275 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 276 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 277 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 278 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 279 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 280 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 281 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 282 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 283 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 284 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 285 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 286 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 287 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 288 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 289 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 290 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 291 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 292 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 293 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 294 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 295 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 296 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 297 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 298 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 299 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 300 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 301 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 302 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 303 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 304 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 305 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 306 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 307 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 308 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 309 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 310 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 311 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 312 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 313 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 314 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 315 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 316 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 317 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 318 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 319 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 320 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 321 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 322 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 323 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 324 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 325 | 3300013250 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 | Metagenome | Rhizosphere |
| 326 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 327 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 328 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 329 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 330 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 331 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 332 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 333 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 334 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 335 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 336 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 337 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 338 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 339 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 340 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 341 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 342 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 343 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 344 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 345 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 346 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 347 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 348 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 349 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 350 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 351 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 352 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 353 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 354 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 355 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 356 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 357 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 358 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 359 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 360 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 361 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 362 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 363 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 364 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 365 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 366 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 367 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 368 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 369 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 370 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 371 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 372 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 373 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 374 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 375 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 376 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 377 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 378 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 379 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 380 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 381 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 382 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 383 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 384 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 385 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 386 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 387 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 388 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 389 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 390 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 391 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 392 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 393 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 394 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 395 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 396 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 397 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 398 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 399 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 400 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 401 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 402 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 403 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 404 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 405 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 406 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 407 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 408 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 409 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 410 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 411 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 412 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 413 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 414 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 415 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 416 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 417 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 418 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 419 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 420 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 421 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 422 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 423 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 424 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 425 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 426 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 427 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 428 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 429 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 430 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 431 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 432 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 433 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 434 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 435 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 436 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 437 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 438 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 439 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 440 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 441 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 442 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 443 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 444 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 445 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 446 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 447 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 448 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 449 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 450 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 451 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 452 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 453 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 454 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 455 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 456 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 457 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 458 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 459 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 460 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 461 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 462 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 463 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 464 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 465 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 466 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 467 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 468 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 469 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 470 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 471 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 472 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 473 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 474 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 475 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 476 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 477 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 478 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 479 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 480 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 481 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 482 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 483 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 484 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 485 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 486 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 487 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 488 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 489 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 490 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 491 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 492 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 493 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 494 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 495 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 496 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 497 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 498 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 499 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 500 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 501 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 502 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 503 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 504 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 505 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 506 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 507 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 508 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 509 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 510 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 511 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 512 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 513 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 514 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 515 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 516 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 517 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 518 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 519 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 520 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 521 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 522 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 523 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 524 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 525 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 526 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 527 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 528 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 529 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 530 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 531 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 532 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 533 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 534 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 535 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 536 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 537 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 538 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 539 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 540 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 541 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 542 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 543 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 544 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 545 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 546 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 547 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 548 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 549 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 550 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 551 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 552 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 553 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 554 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 555 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 556 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 557 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 558 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 559 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 560 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 561 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 562 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 563 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 564 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 565 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 566 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 567 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 568 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 569 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 570 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 571 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 572 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 573 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 574 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 575 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 576 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 577 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 578 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 579 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 580 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 581 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 582 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 583 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 584 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 585 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 586 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 587 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 588 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 589 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 590 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 591 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 592 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 593 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 594 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 595 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 596 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 597 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 598 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 599 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 600 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 601 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 602 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 603 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 604 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 605 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 606 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 607 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 608 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 609 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 610 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 611 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 612 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 613 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 614 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 615 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 616 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 617 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 618 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 619 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 620 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 621 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 622 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 623 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 624 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 625 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 626 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 627 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 628 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 629 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 630 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 631 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 632 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 633 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 634 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 635 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 636 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 637 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 638 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 639 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 640 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 641 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 642 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 643 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 644 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 645 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 646 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 647 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 648 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 649 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 650 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 651 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 652 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 653 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 654 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 655 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 656 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 657 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 658 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 659 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 660 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 661 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 662 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 663 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 664 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 665 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 666 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 667 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 668 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 669 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 670 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 671 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 672 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 673 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 674 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 675 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 676 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 677 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 678 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 679 | 3300053097 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere | Metagenome | Endosphere |
| 680 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 681 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 682 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 683 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 684 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 685 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 686 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 687 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 688 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 689 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 690 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 691 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 692 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 693 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 694 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 695 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 696 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 697 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 698 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 699 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 700 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 701 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 702 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 703 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 704 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 705 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 706 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 707 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 708 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 709 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 710 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 711 | 3300053725 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere | Metagenome | Endosphere |
| 712 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 713 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 714 | 3300053733 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere | Metagenome | Endosphere |
| 715 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 716 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 717 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 718 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 719 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 720 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 721 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 722 | 641522639 | Methylobacterium sp. 4-46 | Isolate | Nodule |
| 723 | 643348564 | Methylobacterium nodulans ORS 2060 | Isolate | Nodule |
| 724 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 725 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 726 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 727 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 728 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 729 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 730 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 731 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 732 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 733 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 734 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 735 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 736 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 737 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 738 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 739 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 740 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 741 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 742 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 743 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 744 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 745 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 746 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 747 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 748 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 749 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 750 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 751 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 752 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 753 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 754 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 755 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 756 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 757 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 758 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 759 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
| 760 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
| 761 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
| 762 | 8057529695 | Bosea vestrisii A18/4-2 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 86.91 |
| Metatranscriptomes | 0.16 |
| Isolates | 12.92 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 10.01 |
| Nodule | 10.11 |
| Rhizoplane | 6.2 |
| Rhizosphere | 64.11 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 9.57 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10005106 | 3300001979 | Bacteria | 5573 |
| 2 | JGI24737J22298_10003117 | 3300001990 | Bacteria | 5879 |
| 3 | JGI24750J21931_1002415 | 3300002070 | Bacteria | 2252 |
| 4 | JGI25151J46595_10056929 | 3300003187 | Bacteria | 1278 |
| 5 | JGI25406J46586_10000101 | 3300003203 | Bacteria | 38086 |
| 6 | JGI25153J46596_10000451 | 3300003215 | Bacteria | 26293 |
| 7 | JGI25153J46596_10001314 | 3300003215 | Bacteria | 14880 |
| 8 | JGI25153J46596_10003659 | 3300003215 | Bacteria | 8514 |
| 9 | JGI25153J46596_10004014 | 3300003215 | Bacteria | 8026 |
| 10 | rootL2_10089904 | 3300003322 | Bacteria | 1114 |
| 11 | JGI25160J50197_1000504 | 3300003354 | Bacteria | 23228 |
| 12 | JGI25160J50197_1017216 | 3300003354 | Bacteria | 2299 |
| 13 | JGI25404J52841_10015895 | 3300003659 | Bacteria | 1632 |
| 14 | Ga0055526_1000667 | 3300003771 | Bacteria | 26378 |
| 15 | Ga0055524_1000035 | 3300003775 | Bacteria | 174636 |
| 16 | Ga0055531_10015335 | 3300003794 | Bacteria | 3384 |
| 17 | Ga0065165_1000306 | 3300005262 | Bacteria | 81181 |
| 18 | Ga0065165_1002349 | 3300005262 | Bacteria | 16429 |
| 19 | Ga0065165_1020357 | 3300005262 | Bacteria | 2336 |
| 20 | Ga0065165_1054102 | 3300005262 | Bacteria | 1126 |
| 21 | Ga0065704_10171119 | 3300005289 | Bacteria | 1291 |
| 22 | Ga0065712_10240790 | 3300005290 | Bacteria | 985 |
| 23 | Ga0065707_10283443 | 3300005295 | Bacteria | 1042 |
| 24 | Ga0070658_10062248 | 3300005327 | Bacteria | 3041 |
| 25 | Ga0070658_10173002 | 3300005327 | Bacteria | 1814 |
| 26 | Ga0070658_10193839 | 3300005327 | Bacteria | 1713 |
| 27 | Ga0070676_10100238 | 3300005328 | Bacteria | 1788 |
| 28 | Ga0070683_100011953 | 3300005329 | Bacteria | 7531 |
| 29 | Ga0070670_100030128 | 3300005331 | Bacteria | 4672 |
| 30 | Ga0070670_100292991 | 3300005331 | Bacteria | 1422 |
| 31 | Ga0070670_100299103 | 3300005331 | Bacteria | 1407 |
| 32 | Ga0070677_10018814 | 3300005333 | Bacteria | 2493 |
| 33 | Ga0068869_100086296 | 3300005334 | Bacteria | 2352 |
| 34 | Ga0068869_100233447 | 3300005334 | Bacteria | 1462 |
| 35 | Ga0070666_10112350 | 3300005335 | Bacteria | 1885 |
| 36 | Ga0070680_100003412 | 3300005336 | Bacteria | 11858 |
| 37 | Ga0070680_100006770 | 3300005336 | Bacteria | 8733 |
| 38 | Ga0070680_100545413 | 3300005336 | Bacteria | 994 |
| 39 | Ga0070682_100026108 | 3300005337 | Bacteria | 3492 |
| 40 | Ga0070682_100174397 | 3300005337 | Bacteria | 1497 |
| 41 | Ga0070660_100007738 | 3300005339 | Bacteria | 7493 |
| 42 | Ga0070660_100238149 | 3300005339 | Bacteria | 1482 |
| 43 | Ga0070660_100346964 | 3300005339 | Bacteria | 1222 |
| 44 | Ga0070689_100491701 | 3300005340 | Bacteria | 1050 |
| 45 | Ga0070687_100179316 | 3300005343 | Bacteria | 1268 |
| 46 | Ga0070661_100141923 | 3300005344 | Bacteria | 1810 |
| 47 | Ga0070661_100518765 | 3300005344 | Bacteria | 956 |
| 48 | Ga0070668_100071133 | 3300005347 | Bacteria | 2710 |
| 49 | Ga0070668_100147708 | 3300005347 | Bacteria | 1898 |
| 50 | Ga0070669_100061596 | 3300005353 | Bacteria | 2757 |
| 51 | Ga0070675_100043504 | 3300005354 | Bacteria | 3670 |
| 52 | Ga0070675_100470781 | 3300005354 | Bacteria | 1129 |
| 53 | Ga0070671_100034075 | 3300005355 | Bacteria | 4214 |
| 54 | Ga0070671_100069367 | 3300005355 | Bacteria | 2940 |
| 55 | Ga0070674_100129168 | 3300005356 | Bacteria | 1881 |
| 56 | Ga0070674_100199981 | 3300005356 | Bacteria | 1542 |
| 57 | Ga0070673_100333760 | 3300005364 | Bacteria | 1342 |
| 58 | Ga0070673_100619091 | 3300005364 | Bacteria | 989 |
| 59 | Ga0070688_100131714 | 3300005365 | Bacteria | 1688 |
| 60 | Ga0070688_100167771 | 3300005365 | Bacteria | 1512 |
| 61 | Ga0070659_100145081 | 3300005366 | Bacteria | 1934 |
| 62 | Ga0070659_100195065 | 3300005366 | Bacteria | 1665 |
| 63 | Ga0070667_100070329 | 3300005367 | Bacteria | 2979 |
| 64 | Ga0070667_100232897 | 3300005367 | Bacteria | 1643 |
| 65 | Ga0070709_10000431 | 3300005434 | Bacteria | 25383 |
| 66 | Ga0070709_10074240 | 3300005434 | Bacteria | 2203 |
| 67 | Ga0070709_10122190 | 3300005434 | Bacteria | 1766 |
| 68 | Ga0070714_100063453 | 3300005435 | Bacteria | 3178 |
| 69 | Ga0070714_100066906 | 3300005435 | Bacteria | 3097 |
| 70 | Ga0070714_100143656 | 3300005435 | Bacteria | 2144 |
| 71 | Ga0070714_100324888 | 3300005435 | Bacteria | 1440 |
| 72 | Ga0070714_100330228 | 3300005435 | Bacteria | 1428 |
| 73 | Ga0070714_100333169 | 3300005435 | Bacteria | 1422 |
| 74 | Ga0070713_100017738 | 3300005436 | Bacteria | 5395 |
| 75 | Ga0070713_100019948 | 3300005436 | Bacteria | 5131 |
| 76 | Ga0070713_100117707 | 3300005436 | Bacteria | 2325 |
| 77 | Ga0070713_100277497 | 3300005436 | Bacteria | 1536 |
| 78 | Ga0070713_100452735 | 3300005436 | Bacteria | 1206 |
| 79 | Ga0070710_10002535 | 3300005437 | Bacteria | 8668 |
| 80 | Ga0070710_10002728 | 3300005437 | Bacteria | 8404 |
| 81 | Ga0070710_10008750 | 3300005437 | Bacteria | 4937 |
| 82 | Ga0070710_10012830 | 3300005437 | Bacteria | 4174 |
| 83 | Ga0070710_10172965 | 3300005437 | Bacteria | 1347 |
| 84 | Ga0070710_10365363 | 3300005437 | Bacteria | 959 |
| 85 | Ga0070711_100011415 | 3300005439 | Bacteria | 5516 |
| 86 | Ga0070711_100022339 | 3300005439 | Bacteria | 4099 |
| 87 | Ga0070711_100028158 | 3300005439 | Bacteria | 3694 |
| 88 | Ga0070711_100079765 | 3300005439 | Bacteria | 2329 |
| 89 | Ga0070711_100181255 | 3300005439 | Bacteria | 1612 |
| 90 | Ga0070711_100241900 | 3300005439 | Bacteria | 1411 |
| 91 | Ga0070700_100141293 | 3300005441 | Bacteria | 1636 |
| 92 | Ga0070708_100302659 | 3300005445 | Bacteria | 1505 |
| 93 | Ga0070708_100415282 | 3300005445 | Bacteria | 1269 |
| 94 | Ga0070663_100048048 | 3300005455 | Bacteria | 3025 |
| 95 | Ga0070663_100068566 | 3300005455 | Bacteria | 2575 |
| 96 | Ga0070663_100130667 | 3300005455 | Bacteria | 1906 |
| 97 | Ga0070663_100204539 | 3300005455 | Bacteria | 1542 |
| 98 | Ga0070663_100299024 | 3300005455 | Bacteria | 1288 |
| 99 | Ga0070663_100321443 | 3300005455 | Bacteria | 1244 |
| 100 | Ga0070663_100415887 | 3300005455 | Bacteria | 1102 |
| 101 | Ga0070663_100510562 | 3300005455 | Bacteria | 999 |
| 102 | Ga0070678_100014099 | 3300005456 | Bacteria | 5031 |
| 103 | Ga0070678_100241529 | 3300005456 | Bacteria | 1510 |
| 104 | Ga0070678_100619204 | 3300005456 | Bacteria | 968 |
| 105 | Ga0070662_100042264 | 3300005457 | Bacteria | 3256 |
| 106 | Ga0070662_100054481 | 3300005457 | Bacteria | 2898 |
| 107 | Ga0070662_100203127 | 3300005457 | Bacteria | 1573 |
| 108 | Ga0070662_100258663 | 3300005457 | Bacteria | 1402 |
| 109 | Ga0070662_100260946 | 3300005457 | Bacteria | 1396 |
| 110 | Ga0070662_100543505 | 3300005457 | Bacteria | 973 |
| 111 | Ga0070681_10008629 | 3300005458 | Bacteria | 9990 |
| 112 | Ga0070681_10032089 | 3300005458 | Bacteria | 5271 |
| 113 | Ga0070681_10043838 | 3300005458 | Bacteria | 4478 |
| 114 | Ga0070681_10117782 | 3300005458 | Bacteria | 2593 |
| 115 | Ga0070681_10334263 | 3300005458 | Bacteria | 1424 |
| 116 | Ga0070681_10515695 | 3300005458 | Bacteria | 1109 |
| 117 | Ga0068867_100172363 | 3300005459 | Bacteria | 1715 |
| 118 | Ga0070706_100522136 | 3300005467 | Bacteria | 1105 |
| 119 | Ga0070698_100159943 | 3300005471 | Bacteria | 2196 |
| 120 | Ga0070698_100309092 | 3300005471 | Bacteria | 1511 |
| 121 | Ga0070698_100424004 | 3300005471 | Bacteria | 1265 |
| 122 | Ga0070698_100570947 | 3300005471 | Bacteria | 1071 |
| 123 | Ga0070679_100099489 | 3300005530 | Bacteria | 2895 |
| 124 | Ga0070679_100111220 | 3300005530 | Bacteria | 2725 |
| 125 | Ga0070679_100182713 | 3300005530 | Bacteria | 2069 |
| 126 | Ga0070679_100590828 | 3300005530 | Bacteria | 1054 |
| 127 | Ga0070684_100011508 | 3300005535 | Bacteria | 7046 |
| 128 | Ga0070684_100028786 | 3300005535 | Bacteria | 4701 |
| 129 | Ga0070684_100265824 | 3300005535 | Bacteria | 1570 |
| 130 | Ga0070684_100521141 | 3300005535 | Bacteria | 1102 |
| 131 | Ga0068853_100014459 | 3300005539 | Bacteria | 6463 |
| 132 | Ga0068853_100024273 | 3300005539 | Bacteria | 5081 |
| 133 | Ga0068853_100118118 | 3300005539 | Bacteria | 2363 |
| 134 | Ga0070672_100191761 | 3300005543 | Bacteria | 1706 |
| 135 | Ga0070672_100309074 | 3300005543 | Bacteria | 1341 |
| 136 | Ga0070672_100405772 | 3300005543 | Bacteria | 1169 |
| 137 | Ga0070686_100057152 | 3300005544 | Bacteria | 2505 |
| 138 | Ga0070686_100211106 | 3300005544 | Bacteria | 1397 |
| 139 | Ga0070693_100182205 | 3300005547 | Bacteria | 1353 |
| 140 | Ga0070693_100260830 | 3300005547 | Bacteria | 1152 |
| 141 | Ga0070665_100038170 | 3300005548 | Bacteria | 4828 |
| 142 | Ga0070665_100054191 | 3300005548 | Bacteria | 4022 |
| 143 | Ga0070665_100056786 | 3300005548 | Bacteria | 3925 |
| 144 | Ga0070665_100116399 | 3300005548 | Bacteria | 2676 |
| 145 | Ga0070665_100162325 | 3300005548 | Bacteria | 2236 |
| 146 | Ga0070665_100230416 | 3300005548 | Bacteria | 1852 |
| 147 | Ga0070665_100334175 | 3300005548 | Bacteria | 1520 |
| 148 | Ga0070704_100277690 | 3300005549 | Bacteria | 1386 |
| 149 | Ga0070704_100518595 | 3300005549 | Bacteria | 1037 |
| 150 | Ga0068855_100010086 | 3300005563 | Bacteria | 11386 |
| 151 | Ga0068855_100042976 | 3300005563 | Bacteria | 5355 |
| 152 | Ga0068855_100044387 | 3300005563 | Bacteria | 5260 |
| 153 | Ga0068855_100150826 | 3300005563 | Bacteria | 2643 |
| 154 | Ga0068855_100360150 | 3300005563 | Bacteria | 1600 |
| 155 | Ga0068855_100646840 | 3300005563 | Bacteria | 1136 |
| 156 | Ga0070664_100312398 | 3300005564 | Bacteria | 1422 |
| 157 | Ga0068857_100057644 | 3300005577 | Bacteria | 3447 |
| 158 | Ga0068857_100082849 | 3300005577 | Bacteria | 2865 |
| 159 | Ga0068857_100106763 | 3300005577 | Bacteria | 2514 |
| 160 | Ga0068857_100368470 | 3300005577 | Bacteria | 1332 |
| 161 | Ga0068857_100392973 | 3300005577 | Bacteria | 1289 |
| 162 | Ga0068854_100003033 | 3300005578 | Bacteria | 10440 |
| 163 | Ga0068854_100021673 | 3300005578 | Bacteria | 4363 |
| 164 | Ga0068854_100097072 | 3300005578 | Bacteria | 2203 |
| 165 | Ga0068856_100001174 | 3300005614 | Bacteria | 27573 |
| 166 | Ga0068856_100013112 | 3300005614 | Bacteria | 8029 |
| 167 | Ga0068856_100043927 | 3300005614 | Bacteria | 4396 |
| 168 | Ga0068856_100114989 | 3300005614 | Bacteria | 2690 |
| 169 | Ga0068856_100204031 | 3300005614 | Bacteria | 1991 |
| 170 | Ga0068856_100386714 | 3300005614 | Bacteria | 1419 |
| 171 | Ga0068856_100570697 | 3300005614 | Bacteria | 1153 |
| 172 | Ga0070702_100102198 | 3300005615 | Bacteria | 1760 |
| 173 | Ga0070702_100224231 | 3300005615 | Bacteria | 1259 |
| 174 | Ga0068852_100010566 | 3300005616 | Bacteria | 6905 |
| 175 | Ga0068852_100015107 | 3300005616 | Bacteria | 5973 |
| 176 | Ga0068852_100596518 | 3300005616 | Bacteria | 1108 |
| 177 | Ga0068859_100340691 | 3300005617 | Bacteria | 1594 |
| 178 | Ga0068859_100810597 | 3300005617 | Bacteria | 1023 |
| 179 | Ga0068864_100012541 | 3300005618 | Bacteria | 7008 |
| 180 | Ga0068864_100042677 | 3300005618 | Bacteria | 3881 |
| 181 | Ga0068864_100162229 | 3300005618 | Bacteria | 2032 |
| 182 | Ga0068864_100469065 | 3300005618 | Bacteria | 1207 |
| 183 | Ga0068866_10071071 | 3300005718 | Bacteria | 1839 |
| 184 | Ga0068861_100231480 | 3300005719 | Bacteria | 1567 |
| 185 | Ga0068851_10077559 | 3300005834 | Bacteria | 1730 |
| 186 | Ga0068851_10229199 | 3300005834 | Bacteria | 1047 |
| 187 | Ga0068870_10050577 | 3300005840 | Bacteria | 2196 |
| 188 | Ga0068863_100215897 | 3300005841 | Bacteria | 1847 |
| 189 | Ga0068863_100454207 | 3300005841 | Bacteria | 1258 |
| 190 | Ga0068863_100479862 | 3300005841 | Bacteria | 1222 |
| 191 | Ga0068858_100075435 | 3300005842 | Bacteria | 3132 |
| 192 | Ga0068858_100263891 | 3300005842 | Bacteria | 1637 |
| 193 | Ga0068858_100443971 | 3300005842 | Bacteria | 1250 |
| 194 | Ga0068858_100829660 | 3300005842 | Bacteria | 902 |
| 195 | Ga0068860_100000240 | 3300005843 | Bacteria | 83866 |
| 196 | Ga0068860_100332997 | 3300005843 | Bacteria | 1491 |
| 197 | Ga0068860_100376457 | 3300005843 | Bacteria | 1401 |
| 198 | Ga0068862_100131593 | 3300005844 | Bacteria | 2213 |
| 199 | Ga0068862_100412615 | 3300005844 | Bacteria | 1265 |
| 200 | Ga0081455_10000678 | 3300005937 | Bacteria | 44138 |
| 201 | Ga0081455_10019291 | 3300005937 | Bacteria | 6455 |
| 202 | Ga0081455_10025536 | 3300005937 | Bacteria | 5450 |
| 203 | Ga0081455_10046347 | 3300005937 | Bacteria | 3773 |
| 204 | Ga0081455_10116694 | 3300005937 | Bacteria | 2111 |
| 205 | Ga0081538_10104598 | 3300005981 | Bacteria | 1412 |
| 206 | Ga0081538_10179576 | 3300005981 | Bacteria | 908 |
| 207 | Ga0081540_1001756 | 3300005983 | Bacteria | 18228 |
| 208 | Ga0081540_1003232 | 3300005983 | Bacteria | 12983 |
| 209 | Ga0081540_1006848 | 3300005983 | Bacteria | 8226 |
| 210 | Ga0081540_1007290 | 3300005983 | Bacteria | 7915 |
| 211 | Ga0081540_1007411 | 3300005983 | Bacteria | 7824 |
| 212 | Ga0081540_1008929 | 3300005983 | Bacteria | 6943 |
| 213 | Ga0081540_1010587 | 3300005983 | Bacteria | 6231 |
| 214 | Ga0081540_1029265 | 3300005983 | Bacteria | 3073 |
| 215 | Ga0081540_1034455 | 3300005983 | Bacteria | 2730 |
| 216 | Ga0081540_1071304 | 3300005983 | Bacteria | 1606 |
| 217 | Ga0081539_10000008 | 3300005985 | Bacteria | 525071 |
| 218 | Ga0081539_10001983 | 3300005985 | Bacteria | 31149 |
| 219 | Ga0081539_10002340 | 3300005985 | Bacteria | 27248 |
| 220 | Ga0081539_10011589 | 3300005985 | Bacteria | 6948 |
| 221 | Ga0081539_10064104 | 3300005985 | Bacteria | 2002 |
| 222 | Ga0070717_10040025 | 3300006028 | Bacteria | 3816 |
| 223 | Ga0070717_10127304 | 3300006028 | Bacteria | 2187 |
| 224 | Ga0070717_10163639 | 3300006028 | Bacteria | 1931 |
| 225 | Ga0075365_10139832 | 3300006038 | Bacteria | 1680 |
| 226 | Ga0075368_10006624 | 3300006042 | Bacteria | 4061 |
| 227 | Ga0075368_10031490 | 3300006042 | Bacteria | 2057 |
| 228 | Ga0075368_10045649 | 3300006042 | Bacteria | 1731 |
| 229 | Ga0075368_10060099 | 3300006042 | Bacteria | 1521 |
| 230 | Ga0075363_100215185 | 3300006048 | Bacteria | 1100 |
| 231 | Ga0075363_100240243 | 3300006048 | Bacteria | 1041 |
| 232 | Ga0075363_100292228 | 3300006048 | Bacteria | 944 |
| 233 | Ga0075364_10008620 | 3300006051 | Bacteria | 6098 |
| 234 | Ga0075364_10012727 | 3300006051 | Bacteria | 5158 |
| 235 | Ga0075364_10053317 | 3300006051 | Bacteria | 2644 |
| 236 | Ga0075364_10259654 | 3300006051 | Bacteria | 1181 |
| 237 | Ga0070715_10000340 | 3300006163 | Bacteria | 11630 |
| 238 | Ga0070716_100035327 | 3300006173 | Bacteria | 2747 |
| 239 | Ga0070716_100037143 | 3300006173 | Bacteria | 2690 |
| 240 | Ga0070716_100071754 | 3300006173 | Bacteria | 2037 |
| 241 | Ga0070716_100297177 | 3300006173 | Bacteria | 1121 |
| 242 | Ga0070712_100005879 | 3300006175 | Bacteria | 7596 |
| 243 | Ga0070712_100009110 | 3300006175 | Bacteria | 6248 |
| 244 | Ga0075362_10006576 | 3300006177 | Bacteria | 4340 |
| 245 | Ga0075362_10033955 | 3300006177 | Bacteria | 2221 |
| 246 | Ga0075367_10055262 | 3300006178 | Bacteria | 2356 |
| 247 | Ga0075367_10126538 | 3300006178 | Bacteria | 1577 |
| 248 | Ga0075367_10201515 | 3300006178 | Bacteria | 1243 |
| 249 | Ga0075369_10074078 | 3300006186 | Bacteria | 1502 |
| 250 | Ga0075369_10112938 | 3300006186 | Bacteria | 1225 |
| 251 | Ga0075366_10085262 | 3300006195 | Bacteria | 1889 |
| 252 | Ga0075366_10169989 | 3300006195 | Bacteria | 1322 |
| 253 | Ga0097621_100267399 | 3300006237 | Bacteria | 1501 |
| 254 | Ga0075370_10132548 | 3300006353 | Bacteria | 1454 |
| 255 | Ga0068871_100228097 | 3300006358 | Bacteria | 1616 |
| 256 | Ga0075428_100202828 | 3300006844 | Bacteria | 2144 |
| 257 | Ga0075434_100185974 | 3300006871 | Bacteria | 2098 |
| 258 | Ga0075434_100297533 | 3300006871 | Bacteria | 1634 |
| 259 | Ga0075429_100083790 | 3300006880 | Bacteria | 2779 |
| 260 | Ga0068865_100380731 | 3300006881 | Bacteria | 1151 |
| 261 | Ga0068865_100458786 | 3300006881 | Bacteria | 1055 |
| 262 | Ga0097620_100340662 | 3300006931 | Bacteria | 1594 |
| 263 | Ga0097620_100810557 | 3300006931 | Bacteria | 1023 |
| 264 | Ga0099824_1012954 | 3300006942 | Bacteria | 8860 |
| 265 | Ga0099822_1001015 | 3300006943 | Bacteria | 30678 |
| 266 | Ga0099823_1008372 | 3300006944 | Bacteria | 10525 |
| 267 | Ga0075435_100184445 | 3300007076 | Bacteria | 1764 |
| 268 | Ga0075435_100344557 | 3300007076 | Bacteria | 1277 |
| 269 | Ga0099794_10039754 | 3300007265 | Bacteria | 2234 |
| 270 | Ga0099795_10000907 | 3300007788 | Bacteria | 5971 |
| 271 | Ga0099795_10017799 | 3300007788 | Bacteria | 2271 |
| 272 | Ga0105250_10052817 | 3300009092 | Bacteria | 1631 |
| 273 | Ga0105240_10008997 | 3300009093 | Bacteria | 14190 |
| 274 | Ga0105240_10010555 | 3300009093 | Bacteria | 12972 |
| 275 | Ga0105240_10013639 | 3300009093 | Bacteria | 11145 |
| 276 | Ga0105240_10088949 | 3300009093 | Bacteria | 3778 |
| 277 | Ga0105240_10094736 | 3300009093 | Bacteria | 3641 |
| 278 | Ga0105240_10198300 | 3300009093 | Bacteria | 2354 |
| 279 | Ga0105240_10204687 | 3300009093 | Bacteria | 2311 |
| 280 | Ga0105245_10071540 | 3300009098 | Bacteria | 3150 |
| 281 | Ga0105245_10121853 | 3300009098 | Bacteria | 2437 |
| 282 | Ga0105245_10242078 | 3300009098 | Bacteria | 1749 |
| 283 | Ga0105245_10324387 | 3300009098 | Bacteria | 1518 |
| 284 | Ga0105245_10622222 | 3300009098 | Bacteria | 1108 |
| 285 | Ga0105247_10037019 | 3300009101 | Bacteria | 2976 |
| 286 | Ga0105247_10091152 | 3300009101 | Bacteria | 1935 |
| 287 | Ga0105247_10142577 | 3300009101 | Bacteria | 1571 |
| 288 | Ga0105247_10524524 | 3300009101 | Bacteria | 867 |
| 289 | Ga0114129_10563371 | 3300009147 | Bacteria | 1480 |
| 290 | Ga0105243_10366575 | 3300009148 | Bacteria | 1328 |
| 291 | Ga0105241_10004508 | 3300009174 | Bacteria | 10305 |
| 292 | Ga0105241_10041098 | 3300009174 | Bacteria | 3492 |
| 293 | Ga0105241_10129917 | 3300009174 | Bacteria | 2038 |
| 294 | Ga0105241_10191561 | 3300009174 | Bacteria | 1703 |
| 295 | Ga0105248_10140847 | 3300009177 | Bacteria | 2721 |
| 296 | Ga0105248_10340195 | 3300009177 | Bacteria | 1689 |
| 297 | Ga0105248_10364148 | 3300009177 | Bacteria | 1628 |
| 298 | Ga0105248_10843798 | 3300009177 | Bacteria | 1034 |
| 299 | Ga0105237_10001564 | 3300009545 | Bacteria | 29835 |
| 300 | Ga0105237_10012234 | 3300009545 | Bacteria | 9045 |
| 301 | Ga0105237_10021242 | 3300009545 | Bacteria | 6677 |
| 302 | Ga0105237_10022559 | 3300009545 | Bacteria | 6458 |
| 303 | Ga0105237_10034753 | 3300009545 | Bacteria | 5101 |
| 304 | Ga0105237_10134999 | 3300009545 | Bacteria | 2462 |
| 305 | Ga0105237_10141911 | 3300009545 | Bacteria | 2396 |
| 306 | Ga0105238_10006286 | 3300009551 | Bacteria | 11807 |
| 307 | Ga0105238_10006661 | 3300009551 | Bacteria | 11520 |
| 308 | Ga0105238_10011390 | 3300009551 | Bacteria | 8955 |
| 309 | Ga0105238_10121170 | 3300009551 | Bacteria | 2595 |
| 310 | Ga0105238_10278536 | 3300009551 | Bacteria | 1653 |
| 311 | Ga0105238_10375144 | 3300009551 | Bacteria | 1413 |
| 312 | Ga0105238_10439022 | 3300009551 | Bacteria | 1301 |
| 313 | Ga0105249_10089260 | 3300009553 | Bacteria | 2880 |
| 314 | Ga0105249_10241487 | 3300009553 | Bacteria | 1786 |
| 315 | Ga0105249_10517832 | 3300009553 | Bacteria | 1240 |
| 316 | Ga0099796_10042904 | 3300010159 | Bacteria | 1539 |
| 317 | Ga0099796_10046241 | 3300010159 | Bacteria | 1493 |
| 318 | Ga0105239_10012332 | 3300010375 | Bacteria | 9519 |
| 319 | Ga0105239_10022799 | 3300010375 | Bacteria | 6902 |
| 320 | Ga0105239_10025169 | 3300010375 | Bacteria | 6555 |
| 321 | Ga0105239_10067521 | 3300010375 | Bacteria | 3928 |
| 322 | Ga0105239_10076462 | 3300010375 | Bacteria | 3682 |
| 323 | Ga0105239_10111037 | 3300010375 | Bacteria | 3039 |
| 324 | Ga0105239_10116579 | 3300010375 | Bacteria | 2964 |
| 325 | Ga0105239_10284342 | 3300010375 | Bacteria | 1862 |
| 326 | Ga0105246_10126402 | 3300011119 | Bacteria | 1902 |
| 327 | Ga0105246_10276173 | 3300011119 | Bacteria | 1346 |
| 328 | Ga0157370_10036903 | 3300013104 | Bacteria | 4741 |
| 329 | Ga0157370_10167235 | 3300013104 | Bacteria | 2045 |
| 330 | Ga0157369_10017344 | 3300013105 | Bacteria | 8094 |
| 331 | Ga0157369_10029148 | 3300013105 | Bacteria | 6102 |
| 332 | Ga0157369_10237904 | 3300013105 | Bacteria | 1902 |
| 333 | Ga0157369_10656488 | 3300013105 | Bacteria | 1081 |
| 334 | Ga0157369_10823051 | 3300013105 | Bacteria | 953 |
| 335 | Ga0171462_1022 | 3300013250 | Bacteria | 141292 |
| 336 | Ga0157374_10026672 | 3300013296 | Bacteria | 5201 |
| 337 | Ga0157378_10102074 | 3300013297 | Bacteria | 2620 |
| 338 | Ga0157378_10301578 | 3300013297 | Bacteria | 1551 |
| 339 | Ga0157378_10789490 | 3300013297 | Bacteria | 975 |
| 340 | Ga0163162_10144314 | 3300013306 | Bacteria | 2495 |
| 341 | Ga0163162_10221407 | 3300013306 | Bacteria | 2022 |
| 342 | Ga0157372_10184738 | 3300013307 | Bacteria | 2414 |
| 343 | Ga0157375_10033676 | 3300013308 | Bacteria | 4872 |
| 344 | Ga0157375_10349593 | 3300013308 | Bacteria | 1644 |
| 345 | Ga0163163_10014045 | 3300014325 | Bacteria | 7350 |
| 346 | Ga0163163_10052168 | 3300014325 | Bacteria | 4034 |
| 347 | Ga0163163_10138625 | 3300014325 | Bacteria | 2474 |
| 348 | Ga0163163_10351886 | 3300014325 | Bacteria | 1529 |
| 349 | Ga0163163_10482258 | 3300014325 | Bacteria | 1301 |
| 350 | Ga0157380_10080678 | 3300014326 | Bacteria | 2659 |
| 351 | Ga0157380_10161273 | 3300014326 | Bacteria | 1949 |
| 352 | Ga0157380_10162004 | 3300014326 | Bacteria | 1945 |
| 353 | Ga0182008_10054337 | 3300014497 | Bacteria | 1982 |
| 354 | Ga0182008_10111167 | 3300014497 | Bacteria | 1358 |
| 355 | Ga0157379_10126823 | 3300014968 | Bacteria | 2296 |
| 356 | Ga0206356_10877305 | 3300020070 | Bacteria | 1019 |
| 357 | Ga0206354_10571467 | 3300020081 | Bacteria | 1570 |
| 358 | Ga0214544_1000020 | 3300021320 | Bacteria | 178560 |
| 359 | Ga0214542_1000024 | 3300021321 | Bacteria | 191218 |
| 360 | Ga0214545_1000011 | 3300021324 | Bacteria | 190550 |
| 361 | Ga0214543_1000033 | 3300021327 | Bacteria | 190419 |
| 362 | Ga0213873_10026144 | 3300021358 | Bacteria | 1415 |
| 363 | Ga0213876_10009084 | 3300021384 | Bacteria | 5351 |
| 364 | Ga0213876_10184671 | 3300021384 | Bacteria | 1109 |
| 365 | Ga0213876_10187411 | 3300021384 | Bacteria | 1100 |
| 366 | Ga0224712_10031926 | 3300022467 | Bacteria | 1915 |
| 367 | Ga0228598_1004399 | 3300024227 | Bacteria | 2983 |
| 368 | Ga0209148_1000574 | 3300025254 | Bacteria | 34124 |
| 369 | Ga0209233_1005617 | 3300025261 | Bacteria | 4145 |
| 370 | Ga0209455_1009617 | 3300025272 | Bacteria | 2525 |
| 371 | Ga0209455_1032789 | 3300025272 | Bacteria | 859 |
| 372 | Ga0209673_1021249 | 3300025273 | Bacteria | 2276 |
| 373 | Ga0209130_1000111 | 3300025284 | Bacteria | 131855 |
| 374 | Ga0209130_1041286 | 3300025284 | Bacteria | 888 |
| 375 | Ga0209675_1001135 | 3300025291 | Bacteria | 16248 |
| 376 | Ga0209025_1001992 | 3300025294 | Bacteria | 23425 |
| 377 | Ga0209564_1000049 | 3300025295 | Bacteria | 362075 |
| 378 | Ga0209564_1000747 | 3300025295 | Bacteria | 46025 |
| 379 | Ga0209564_1004509 | 3300025295 | Bacteria | 8477 |
| 380 | Ga0209564_1007973 | 3300025295 | Bacteria | 5327 |
| 381 | Ga0209564_1034172 | 3300025295 | Bacteria | 1496 |
| 382 | Ga0209758_1000065 | 3300025297 | Bacteria | 306288 |
| 383 | Ga0209758_1000128 | 3300025297 | Bacteria | 186771 |
| 384 | Ga0209758_1000498 | 3300025297 | Bacteria | 64011 |
| 385 | Ga0209758_1000560 | 3300025297 | Bacteria | 58586 |
| 386 | Ga0209758_1003961 | 3300025297 | Bacteria | 12845 |
| 387 | Ga0209758_1003962 | 3300025297 | Bacteria | 12844 |
| 388 | Ga0209758_1004726 | 3300025297 | Bacteria | 11098 |
| 389 | Ga0209758_1006640 | 3300025297 | Bacteria | 8187 |
| 390 | Ga0209256_1000014 | 3300025299 | Bacteria | 687409 |
| 391 | Ga0209256_1003626 | 3300025299 | Bacteria | 10573 |
| 392 | Ga0207426_1000721 | 3300025302 | Bacteria | 38161 |
| 393 | Ga0207426_1000728 | 3300025302 | Bacteria | 37754 |
| 394 | Ga0207426_1002233 | 3300025302 | Bacteria | 12914 |
| 395 | Ga0207426_1008460 | 3300025302 | Bacteria | 4152 |
| 396 | Ga0207697_10041595 | 3300025315 | Bacteria | 1887 |
| 397 | Ga0207656_10005979 | 3300025321 | Bacteria | 4347 |
| 398 | Ga0207656_10021824 | 3300025321 | Bacteria | 2562 |
| 399 | Ga0207656_10145017 | 3300025321 | Bacteria | 1121 |
| 400 | Ga0207696_1041429 | 3300025711 | Bacteria | 1345 |
| 401 | Ga0207653_10019287 | 3300025885 | Bacteria | 2150 |
| 402 | Ga0207682_10011232 | 3300025893 | Bacteria | 3500 |
| 403 | Ga0207692_10008253 | 3300025898 | Bacteria | 4307 |
| 404 | Ga0207692_10049519 | 3300025898 | Bacteria | 2120 |
| 405 | Ga0207692_10268504 | 3300025898 | Bacteria | 1028 |
| 406 | Ga0207710_10031699 | 3300025900 | Bacteria | 2313 |
| 407 | Ga0207710_10036630 | 3300025900 | Bacteria | 2164 |
| 408 | Ga0207688_10084405 | 3300025901 | Bacteria | 1818 |
| 409 | Ga0207688_10105611 | 3300025901 | Bacteria | 1630 |
| 410 | Ga0207680_10083837 | 3300025903 | Bacteria | 2010 |
| 411 | Ga0207680_10247984 | 3300025903 | Bacteria | 1229 |
| 412 | Ga0207680_10361987 | 3300025903 | Bacteria | 1020 |
| 413 | Ga0207647_10001242 | 3300025904 | Bacteria | 19628 |
| 414 | Ga0207699_10005571 | 3300025906 | Bacteria | 6039 |
| 415 | Ga0207699_10006508 | 3300025906 | Bacteria | 5663 |
| 416 | Ga0207699_10075044 | 3300025906 | Bacteria | 2079 |
| 417 | Ga0207645_10043430 | 3300025907 | Bacteria | 2877 |
| 418 | Ga0207645_10096827 | 3300025907 | Bacteria | 1901 |
| 419 | Ga0207645_10161605 | 3300025907 | Bacteria | 1466 |
| 420 | Ga0207705_10074905 | 3300025909 | Bacteria | 2458 |
| 421 | Ga0207705_10248728 | 3300025909 | Bacteria | 1355 |
| 422 | Ga0207684_10342671 | 3300025910 | Bacteria | 1287 |
| 423 | Ga0207654_10004074 | 3300025911 | Bacteria | 7362 |
| 424 | Ga0207654_10110844 | 3300025911 | Bacteria | 1707 |
| 425 | Ga0207654_10131957 | 3300025911 | Bacteria | 1582 |
| 426 | Ga0207654_10323018 | 3300025911 | Bacteria | 1055 |
| 427 | Ga0207707_10000466 | 3300025912 | Bacteria | 41992 |
| 428 | Ga0207707_10011284 | 3300025912 | Bacteria | 7776 |
| 429 | Ga0207707_10032070 | 3300025912 | Bacteria | 4599 |
| 430 | Ga0207707_10098339 | 3300025912 | Bacteria | 2558 |
| 431 | Ga0207707_10163811 | 3300025912 | Bacteria | 1943 |
| 432 | Ga0207707_10306116 | 3300025912 | Bacteria | 1373 |
| 433 | Ga0207695_10000029 | 3300025913 | Bacteria | 548364 |
| 434 | Ga0207695_10001179 | 3300025913 | Bacteria | 45082 |
| 435 | Ga0207695_10024619 | 3300025913 | Bacteria | 6764 |
| 436 | Ga0207695_10448321 | 3300025913 | Bacteria | 1174 |
| 437 | Ga0207695_10450081 | 3300025913 | Bacteria | 1171 |
| 438 | Ga0207671_10003068 | 3300025914 | Bacteria | 17080 |
| 439 | Ga0207671_10043451 | 3300025914 | Bacteria | 3323 |
| 440 | Ga0207671_10067289 | 3300025914 | Bacteria | 2668 |
| 441 | Ga0207671_10093493 | 3300025914 | Bacteria | 2268 |
| 442 | Ga0207671_10124855 | 3300025914 | Bacteria | 1970 |
| 443 | Ga0207671_10393534 | 3300025914 | Bacteria | 1102 |
| 444 | Ga0207693_10000723 | 3300025915 | Bacteria | 29753 |
| 445 | Ga0207693_10068591 | 3300025915 | Bacteria | 2776 |
| 446 | Ga0207663_10000219 | 3300025916 | Bacteria | 25504 |
| 447 | Ga0207663_10025741 | 3300025916 | Bacteria | 3407 |
| 448 | Ga0207663_10071271 | 3300025916 | Bacteria | 2242 |
| 449 | Ga0207663_10072844 | 3300025916 | Bacteria | 2221 |
| 450 | Ga0207663_10133224 | 3300025916 | Bacteria | 1720 |
| 451 | Ga0207663_10198666 | 3300025916 | Bacteria | 1445 |
| 452 | Ga0207660_10022499 | 3300025917 | Bacteria | 4247 |
| 453 | Ga0207660_10344569 | 3300025917 | Bacteria | 1193 |
| 454 | Ga0207660_10351812 | 3300025917 | Bacteria | 1181 |
| 455 | Ga0207662_10065461 | 3300025918 | Bacteria | 2189 |
| 456 | Ga0207657_10006956 | 3300025919 | Bacteria | 11651 |
| 457 | Ga0207657_10022202 | 3300025919 | Bacteria | 5951 |
| 458 | Ga0207657_10174839 | 3300025919 | Bacteria | 1738 |
| 459 | Ga0207657_10179944 | 3300025919 | Bacteria | 1709 |
| 460 | Ga0207649_10031830 | 3300025920 | Bacteria | 3139 |
| 461 | Ga0207649_10432275 | 3300025920 | Bacteria | 990 |
| 462 | Ga0207652_10001798 | 3300025921 | Bacteria | 18633 |
| 463 | Ga0207652_10014679 | 3300025921 | Bacteria | 6348 |
| 464 | Ga0207652_10059169 | 3300025921 | Bacteria | 3302 |
| 465 | Ga0207652_10156850 | 3300025921 | Bacteria | 2039 |
| 466 | Ga0207652_10209704 | 3300025921 | Bacteria | 1754 |
| 467 | Ga0207652_10466364 | 3300025921 | Bacteria | 1138 |
| 468 | Ga0207652_10563702 | 3300025921 | Bacteria | 1023 |
| 469 | Ga0207681_10456414 | 3300025923 | Bacteria | 1040 |
| 470 | Ga0207694_10000131 | 3300025924 | Bacteria | 76343 |
| 471 | Ga0207694_10011244 | 3300025924 | Bacteria | 6760 |
| 472 | Ga0207694_10021078 | 3300025924 | Bacteria | 4935 |
| 473 | Ga0207694_10043180 | 3300025924 | Bacteria | 3479 |
| 474 | Ga0207694_10337701 | 3300025924 | Bacteria | 1245 |
| 475 | Ga0207650_10034857 | 3300025925 | Bacteria | 3652 |
| 476 | Ga0207650_10591916 | 3300025925 | Bacteria | 932 |
| 477 | Ga0207659_10199388 | 3300025926 | Bacteria | 1597 |
| 478 | Ga0207659_10353767 | 3300025926 | Bacteria | 1219 |
| 479 | Ga0207700_10015585 | 3300025928 | Bacteria | 5019 |
| 480 | Ga0207700_10089106 | 3300025928 | Bacteria | 2431 |
| 481 | Ga0207700_10128654 | 3300025928 | Bacteria | 2064 |
| 482 | Ga0207700_10220213 | 3300025928 | Bacteria | 1608 |
| 483 | Ga0207700_10236063 | 3300025928 | Bacteria | 1557 |
| 484 | Ga0207700_10332026 | 3300025928 | Bacteria | 1320 |
| 485 | Ga0207664_10006314 | 3300025929 | Bacteria | 8147 |
| 486 | Ga0207664_10065207 | 3300025929 | Bacteria | 2915 |
| 487 | Ga0207664_10103453 | 3300025929 | Bacteria | 2357 |
| 488 | Ga0207664_10274516 | 3300025929 | Bacteria | 1478 |
| 489 | Ga0207664_10297432 | 3300025929 | Bacteria | 1419 |
| 490 | Ga0207664_10348548 | 3300025929 | Bacteria | 1310 |
| 491 | Ga0207664_10430608 | 3300025929 | Bacteria | 1176 |
| 492 | Ga0207664_10540934 | 3300025929 | Bacteria | 1045 |
| 493 | Ga0207664_10584569 | 3300025929 | Bacteria | 1003 |
| 494 | Ga0207644_10033426 | 3300025931 | Bacteria | 3593 |
| 495 | Ga0207644_10066881 | 3300025931 | Bacteria | 2618 |
| 496 | Ga0207644_10129401 | 3300025931 | Bacteria | 1931 |
| 497 | Ga0207644_10135999 | 3300025931 | Bacteria | 1887 |
| 498 | Ga0207644_10261314 | 3300025931 | Bacteria | 1384 |
| 499 | Ga0207644_10548414 | 3300025931 | Bacteria | 957 |
| 500 | Ga0207690_10068618 | 3300025932 | Bacteria | 2437 |
| 501 | Ga0207690_10177974 | 3300025932 | Bacteria | 1599 |
| 502 | Ga0207706_10062871 | 3300025933 | Bacteria | 3269 |
| 503 | Ga0207706_10146667 | 3300025933 | Bacteria | 2076 |
| 504 | Ga0207706_10157516 | 3300025933 | Bacteria | 1997 |
| 505 | Ga0207706_10198008 | 3300025933 | Bacteria | 1762 |
| 506 | Ga0207686_10167846 | 3300025934 | Bacteria | 1545 |
| 507 | Ga0207709_10015434 | 3300025935 | Bacteria | 4235 |
| 508 | Ga0207670_10074378 | 3300025936 | Bacteria | 2358 |
| 509 | Ga0207670_10496035 | 3300025936 | Bacteria | 991 |
| 510 | Ga0207669_10066264 | 3300025937 | Bacteria | 2244 |
| 511 | Ga0207704_10041836 | 3300025938 | Bacteria | 2691 |
| 512 | Ga0207665_10000064 | 3300025939 | Bacteria | 68931 |
| 513 | Ga0207665_10033157 | 3300025939 | Bacteria | 3421 |
| 514 | Ga0207665_10080284 | 3300025939 | Bacteria | 2243 |
| 515 | Ga0207665_10260141 | 3300025939 | Bacteria | 1285 |
| 516 | Ga0207691_10281127 | 3300025940 | Bacteria | 1432 |
| 517 | Ga0207711_10198112 | 3300025941 | Bacteria | 1832 |
| 518 | Ga0207711_10315053 | 3300025941 | Bacteria | 1445 |
| 519 | Ga0207711_10386148 | 3300025941 | Bacteria | 1300 |
| 520 | Ga0207711_10405465 | 3300025941 | Bacteria | 1267 |
| 521 | Ga0207711_10796551 | 3300025941 | Bacteria | 880 |
| 522 | Ga0207689_10236505 | 3300025942 | Bacteria | 1510 |
| 523 | Ga0207689_10297516 | 3300025942 | Bacteria | 1337 |
| 524 | Ga0207689_10308384 | 3300025942 | Bacteria | 1312 |
| 525 | Ga0207661_10008345 | 3300025944 | Bacteria | 7396 |
| 526 | Ga0207661_10011091 | 3300025944 | Bacteria | 6513 |
| 527 | Ga0207661_10044116 | 3300025944 | Bacteria | 3522 |
| 528 | Ga0207679_10242062 | 3300025945 | Bacteria | 1529 |
| 529 | Ga0207679_10261362 | 3300025945 | Bacteria | 1476 |
| 530 | Ga0207679_10348379 | 3300025945 | Bacteria | 1290 |
| 531 | Ga0207679_10463096 | 3300025945 | Bacteria | 1126 |
| 532 | Ga0207667_10003470 | 3300025949 | Bacteria | 19454 |
| 533 | Ga0207667_10040486 | 3300025949 | Bacteria | 4962 |
| 534 | Ga0207667_10048507 | 3300025949 | Bacteria | 4490 |
| 535 | Ga0207667_10085254 | 3300025949 | Bacteria | 3270 |
| 536 | Ga0207667_10186518 | 3300025949 | Bacteria | 2129 |
| 537 | Ga0207651_10382584 | 3300025960 | Bacteria | 1193 |
| 538 | Ga0207668_10022803 | 3300025972 | Bacteria | 4012 |
| 539 | Ga0207668_10330808 | 3300025972 | Bacteria | 1267 |
| 540 | Ga0207640_10005349 | 3300025981 | Bacteria | 6998 |
| 541 | Ga0207640_10076070 | 3300025981 | Bacteria | 2277 |
| 542 | Ga0207640_10443649 | 3300025981 | Bacteria | 1068 |
| 543 | Ga0207658_10036941 | 3300025986 | Bacteria | 3505 |
| 544 | Ga0207658_10074230 | 3300025986 | Bacteria | 2584 |
| 545 | Ga0207677_10111859 | 3300026023 | Bacteria | 2035 |
| 546 | Ga0207677_10148197 | 3300026023 | Bacteria | 1806 |
| 547 | Ga0207677_10264620 | 3300026023 | Bacteria | 1403 |
| 548 | Ga0207703_10510029 | 3300026035 | Bacteria | 1130 |
| 549 | Ga0207703_10614475 | 3300026035 | Bacteria | 1029 |
| 550 | Ga0207639_10009549 | 3300026041 | Bacteria | 6696 |
| 551 | Ga0207639_10028981 | 3300026041 | Bacteria | 4048 |
| 552 | Ga0207639_10120808 | 3300026041 | Bacteria | 2152 |
| 553 | Ga0207639_10401149 | 3300026041 | Bacteria | 1235 |
| 554 | Ga0207678_10032223 | 3300026067 | Bacteria | 4568 |
| 555 | Ga0207678_10093586 | 3300026067 | Bacteria | 2568 |
| 556 | Ga0207678_10098593 | 3300026067 | Bacteria | 2497 |
| 557 | Ga0207678_10213321 | 3300026067 | Bacteria | 1652 |
| 558 | Ga0207678_10336056 | 3300026067 | Bacteria | 1301 |
| 559 | Ga0207678_10446167 | 3300026067 | Bacteria | 1124 |
| 560 | Ga0207678_10515079 | 3300026067 | Bacteria | 1044 |
| 561 | Ga0207678_10605570 | 3300026067 | Bacteria | 961 |
| 562 | Ga0207708_10035182 | 3300026075 | Bacteria | 3812 |
| 563 | Ga0207708_10249397 | 3300026075 | Bacteria | 1430 |
| 564 | Ga0207702_10000005 | 3300026078 | Bacteria | 420296 |
| 565 | Ga0207702_10000403 | 3300026078 | Bacteria | 49280 |
| 566 | Ga0207702_10009529 | 3300026078 | Bacteria | 8154 |
| 567 | Ga0207702_10081007 | 3300026078 | Bacteria | 2818 |
| 568 | Ga0207702_10317682 | 3300026078 | Bacteria | 1482 |
| 569 | Ga0207702_10337291 | 3300026078 | Bacteria | 1439 |
| 570 | Ga0207702_10403703 | 3300026078 | Bacteria | 1318 |
| 571 | Ga0207648_10085170 | 3300026089 | Bacteria | 2757 |
| 572 | Ga0207648_10306793 | 3300026089 | Bacteria | 1424 |
| 573 | Ga0207676_10032218 | 3300026095 | Bacteria | 3948 |
| 574 | Ga0207676_10220839 | 3300026095 | Bacteria | 1687 |
| 575 | Ga0207676_10507403 | 3300026095 | Bacteria | 1146 |
| 576 | Ga0207676_10626629 | 3300026095 | Bacteria | 1035 |
| 577 | Ga0207674_10001872 | 3300026116 | Bacteria | 26801 |
| 578 | Ga0207674_10007160 | 3300026116 | Bacteria | 13032 |
| 579 | Ga0207674_10037998 | 3300026116 | Bacteria | 5001 |
| 580 | Ga0207674_10047446 | 3300026116 | Bacteria | 4403 |
| 581 | Ga0207674_10093731 | 3300026116 | Bacteria | 2991 |
| 582 | Ga0207674_10094233 | 3300026116 | Bacteria | 2981 |
| 583 | Ga0207674_10243826 | 3300026116 | Bacteria | 1744 |
| 584 | Ga0207675_100069147 | 3300026118 | Bacteria | 3300 |
| 585 | Ga0207675_100456912 | 3300026118 | Bacteria | 1266 |
| 586 | Ga0207675_100688860 | 3300026118 | Bacteria | 1030 |
| 587 | Ga0207683_10007983 | 3300026121 | Bacteria | 9051 |
| 588 | Ga0207683_10065519 | 3300026121 | Bacteria | 3203 |
| 589 | Ga0207683_10134588 | 3300026121 | Bacteria | 2225 |
| 590 | Ga0207683_10173418 | 3300026121 | Bacteria | 1954 |
| 591 | Ga0207683_10347901 | 3300026121 | Bacteria | 1360 |
| 592 | Ga0207683_10553342 | 3300026121 | Bacteria | 1064 |
| 593 | Ga0207698_10008935 | 3300026142 | Bacteria | 6356 |
| 594 | Ga0207698_10013158 | 3300026142 | Bacteria | 5447 |
| 595 | Ga0207698_10407391 | 3300026142 | Bacteria | 1301 |
| 596 | Ga0209389_1000011 | 3300027296 | Bacteria | 223265 |
| 597 | Ga0209389_1000025 | 3300027296 | Bacteria | 149588 |
| 598 | Ga0209589_1000018 | 3300027357 | Bacteria | 192614 |
| 599 | Ga0209589_1000066 | 3300027357 | Bacteria | 100795 |
| 600 | Ga0209489_100017 | 3300027361 | Bacteria | 223265 |
| 601 | Ga0209489_100026 | 3300027361 | Bacteria | 192614 |
| 602 | Ga0209489_100030 | 3300027361 | Bacteria | 185999 |
| 603 | Ga0209700_100027 | 3300027363 | Bacteria | 223462 |
| 604 | Ga0209700_100035 | 3300027363 | Bacteria | 192614 |
| 605 | Ga0209179_1020322 | 3300027512 | Bacteria | 1287 |
| 606 | Ga0209813_10026656 | 3300027866 | Bacteria | 1673 |
| 607 | Ga0207428_10078549 | 3300027907 | Bacteria | 2582 |
| 608 | Ga0268266_10000827 | 3300028379 | Bacteria | 40488 |
| 609 | Ga0268266_10014484 | 3300028379 | Bacteria | 6778 |
| 610 | Ga0268266_10034469 | 3300028379 | Bacteria | 4306 |
| 611 | Ga0268266_10056743 | 3300028379 | Bacteria | 3369 |
| 612 | Ga0268266_10157939 | 3300028379 | Bacteria | 2050 |
| 613 | Ga0268266_10191297 | 3300028379 | Bacteria | 1868 |
| 614 | Ga0268266_10193349 | 3300028379 | Bacteria | 1858 |
| 615 | Ga0268265_10087622 | 3300028380 | Bacteria | 2477 |
| 616 | Ga0268265_10425050 | 3300028380 | Bacteria | 1234 |
| 617 | Ga0268264_10000035 | 3300028381 | Bacteria | 398196 |
| 618 | Ga0268264_10168042 | 3300028381 | Bacteria | 1982 |
| 619 | Ga0268264_10348258 | 3300028381 | Bacteria | 1409 |
| 620 | Ga0265319_1044084 | 3300028563 | Bacteria | 1496 |
| 621 | Ga0265334_10013193 | 3300028573 | Bacteria | 3462 |
| 622 | Ga0265323_10007879 | 3300028653 | Bacteria | 4404 |
| 623 | Ga0265336_10009229 | 3300028666 | Bacteria | 3416 |
| 624 | Ga0307517_10001329 | 3300028786 | Bacteria | 41544 |
| 625 | Ga0307515_10024241 | 3300028794 | Bacteria | 10582 |
| 626 | Ga0307515_10052509 | 3300028794 | Bacteria | 6044 |
| 627 | Ga0307515_10261866 | 3300028794 | Bacteria | 1464 |
| 628 | Ga0265338_10000065 | 3300028800 | Bacteria | 188966 |
| 629 | Ga0265330_10025998 | 3300031235 | Bacteria | 2652 |
| 630 | Ga0265330_10043704 | 3300031235 | Bacteria | 1981 |
| 631 | Ga0265332_10019006 | 3300031238 | Bacteria | 3034 |
| 632 | Ga0265320_10039080 | 3300031240 | Bacteria | 2374 |
| 633 | Ga0265325_10000522 | 3300031241 | Bacteria | 27711 |
| 634 | Ga0265325_10044758 | 3300031241 | Bacteria | 2303 |
| 635 | Ga0265329_10017951 | 3300031242 | Bacteria | 2426 |
| 636 | Ga0265340_10003867 | 3300031247 | Bacteria | 8432 |
| 637 | Ga0265340_10032067 | 3300031247 | Bacteria | 2624 |
| 638 | Ga0265339_10001453 | 3300031249 | Bacteria | 17549 |
| 639 | Ga0265339_10061245 | 3300031249 | Bacteria | 2026 |
| 640 | Ga0265327_10000748 | 3300031251 | Bacteria | 50556 |
| 641 | Ga0265316_10055197 | 3300031344 | Bacteria | 3108 |
| 642 | Ga0307513_10123243 | 3300031456 | Bacteria | 2554 |
| 643 | Ga0307509_10099481 | 3300031507 | Bacteria | 2949 |
| 644 | Ga0307408_100243159 | 3300031548 | Bacteria | 1480 |
| 645 | Ga0307408_100271022 | 3300031548 | Bacteria | 1409 |
| 646 | Ga0307408_100545175 | 3300031548 | Bacteria | 1023 |
| 647 | Ga0265313_10029608 | 3300031595 | Bacteria | 2830 |
| 648 | Ga0265313_10046465 | 3300031595 | Bacteria | 2108 |
| 649 | Ga0307508_10000521 | 3300031616 | Bacteria | 45797 |
| 650 | Ga0307508_10112649 | 3300031616 | Bacteria | 2321 |
| 651 | Ga0307508_10239466 | 3300031616 | Bacteria | 1412 |
| 652 | Ga0265314_10022547 | 3300031711 | Bacteria | 4823 |
| 653 | Ga0265314_10059109 | 3300031711 | Bacteria | 2624 |
| 654 | Ga0265342_10002787 | 3300031712 | Bacteria | 14791 |
| 655 | Ga0265342_10010202 | 3300031712 | Bacteria | 6540 |
| 656 | Ga0265342_10030155 | 3300031712 | Bacteria | 3363 |
| 657 | Ga0265342_10214189 | 3300031712 | Bacteria | 1040 |
| 658 | Ga0307516_10006057 | 3300031730 | Bacteria | 14287 |
| 659 | Ga0307516_10013764 | 3300031730 | Bacteria | 8592 |
| 660 | Ga0307516_10016792 | 3300031730 | Bacteria | 7644 |
| 661 | Ga0307516_10146305 | 3300031730 | Bacteria | 2128 |
| 662 | Ga0307406_10276044 | 3300031901 | Bacteria | 1279 |
| 663 | Ga0307407_10292490 | 3300031903 | Bacteria | 1133 |
| 664 | Ga0307407_10308938 | 3300031903 | Bacteria | 1105 |
| 665 | Ga0307407_10433353 | 3300031903 | Bacteria | 950 |
| 666 | Ga0307412_10406351 | 3300031911 | Bacteria | 1110 |
| 667 | Ga0307412_10607082 | 3300031911 | Bacteria | 927 |
| 668 | Ga0307409_100021265 | 3300031995 | Bacteria | 4444 |
| 669 | Ga0307409_100675185 | 3300031995 | Bacteria | 1030 |
| 670 | Ga0307416_100127917 | 3300032002 | Bacteria | 2279 |
| 671 | Ga0307416_100487924 | 3300032002 | Bacteria | 1293 |
| 672 | Ga0307416_100653719 | 3300032002 | Bacteria | 1136 |
| 673 | Ga0307414_10265283 | 3300032004 | Bacteria | 1435 |
| 674 | Ga0307411_10529524 | 3300032005 | Bacteria | 1002 |
| 675 | Ga0307411_10708050 | 3300032005 | Bacteria | 878 |
| 676 | Ga0307415_100258189 | 3300032126 | Bacteria | 1420 |
| 677 | Ga0307507_10111917 | 3300033179 | Bacteria | 2226 |
| 678 | Ga0307507_10114834 | 3300033179 | Bacteria | 2182 |
| 679 | Ga0307510_10008237 | 3300033180 | Bacteria | 12419 |
| 680 | Ga0307510_10010792 | 3300033180 | Bacteria | 10863 |
| 681 | Ga0307510_10023218 | 3300033180 | Bacteria | 7193 |
| 682 | Ga0307510_10134601 | 3300033180 | Bacteria | 2133 |
| 683 | Ga0307510_10136026 | 3300033180 | Bacteria | 2115 |
| 684 | Ga0315911_1000011 | 3300033442 | Bacteria | 264678 |
| 685 | Ga0373930_0009726 | 3300034816 | Bacteria | 1707 |
| 686 | Ga0373934_0018268 | 3300035086 | Bacteria | 2682 |
| 687 | Ga0373934_0050750 | 3300035086 | Bacteria | 1644 |
| 688 | Ga0373934_0079984 | 3300035086 | Bacteria | 1313 |
| 689 | Ga0373934_0132785 | 3300035086 | Bacteria | 1016 |
| 690 | Ga0373944_0008158 | 3300035089 | Bacteria | 2825 |
| 691 | Ga0373944_0008625 | 3300035089 | Bacteria | 2753 |
| 692 | Ga0373949_0059932 | 3300035090 | Bacteria | 977 |
| 693 | Ga0373923_0007808 | 3300035111 | Bacteria | 3779 |
| 694 | Ga0373923_0009562 | 3300035111 | Bacteria | 3503 |
| 695 | Ga0373923_0011876 | 3300035111 | Bacteria | 3207 |
| 696 | Ga0373923_0012570 | 3300035111 | Bacteria | 3134 |
| 697 | Ga0373923_0040959 | 3300035111 | Bacteria | 1908 |
| 698 | Ga0373923_0264790 | 3300035111 | Bacteria | 807 |
| 699 | Ga0373936_0005534 | 3300035113 | Bacteria | 4769 |
| 700 | Ga0373936_0026481 | 3300035113 | Bacteria | 2271 |
| 701 | Ga0373936_0065892 | 3300035113 | Bacteria | 1486 |
| 702 | Ga0373941_0060016 | 3300035115 | Bacteria | 1235 |
| 703 | Ga0373945_0041758 | 3300035116 | Bacteria | 1659 |
| 704 | Ga0373953_0004604 | 3300035117 | Bacteria | 4405 |
| 705 | Ga0373953_0018376 | 3300035117 | Bacteria | 2586 |
| 706 | Ga0373953_0021341 | 3300035117 | Bacteria | 2428 |
| 707 | Ga0373953_0032120 | 3300035117 | Bacteria | 2045 |
| 708 | Ga0373954_0001728 | 3300035118 | Bacteria | 8947 |
| 709 | Ga0373954_0024119 | 3300035118 | Bacteria | 2772 |
| 710 | Ga0373954_0032251 | 3300035118 | Bacteria | 2421 |
| 711 | Ga0373954_0069666 | 3300035118 | Bacteria | 1670 |
| 712 | Ga0373956_0000275 | 3300035119 | Bacteria | 20650 |
| 713 | Ga0373956_0013116 | 3300035119 | Bacteria | 3445 |
| 714 | Ga0373956_0027086 | 3300035119 | Bacteria | 2486 |
| 715 | Ga0373956_0083356 | 3300035119 | Bacteria | 1469 |
| 716 | Ga0373956_0131516 | 3300035119 | Bacteria | 1172 |
| 717 | Ga0373957_0004250 | 3300035120 | Bacteria | 4343 |
| 718 | Ga0373957_0008902 | 3300035120 | Bacteria | 3270 |
| 719 | Ga0373957_0024316 | 3300035120 | Bacteria | 2175 |
| 720 | Ga0373960_0037420 | 3300035121 | Bacteria | 1387 |
| 721 | Ga0373943_0000038 | 3300035170 | Bacteria | 44091 |
| 722 | Ga0373943_0010166 | 3300035170 | Bacteria | 4220 |
| 723 | Ga0373943_0012935 | 3300035170 | Bacteria | 3763 |
| 724 | Ga0373943_0042188 | 3300035170 | Bacteria | 2210 |
| 725 | Ga0373946_0001215 | 3300035171 | Bacteria | 8907 |
| 726 | Ga0373955_0000324 | 3300035172 | Bacteria | 19834 |
| 727 | Ga0373955_0023312 | 3300035172 | Bacteria | 3151 |
| 728 | Ga0373955_0106666 | 3300035172 | Bacteria | 1615 |
| 729 | Ga0373955_0119720 | 3300035172 | Bacteria | 1529 |
| 730 | Ga0373924_0019316 | 3300035410 | Bacteria | 2639 |
| 731 | Ga0373924_0079202 | 3300035410 | Bacteria | 1395 |
| 732 | Ga0373931_0017129 | 3300035691 | Bacteria | 3577 |
| 733 | Ga0373931_0222613 | 3300035691 | Bacteria | 1137 |
| 734 | Ga0373935_0001897 | 3300035692 | Bacteria | 11740 |
| 735 | Ga0373935_0022533 | 3300035692 | Bacteria | 3864 |
| 736 | Ga0373935_0031933 | 3300035692 | Bacteria | 3270 |
| 737 | Ga0373935_0206967 | 3300035692 | Bacteria | 1358 |
| 738 | Ga0373927_0000665 | 3300035695 | Bacteria | 26133 |
| 739 | Ga0373927_0000759 | 3300035695 | Bacteria | 24667 |
| 740 | Ga0373927_0004910 | 3300035695 | Bacteria | 9285 |
| 741 | Ga0373927_0016732 | 3300035695 | Bacteria | 4837 |
| 742 | Ga0373927_0057701 | 3300035695 | Bacteria | 2510 |
| 743 | Ga0373927_0080765 | 3300035695 | Bacteria | 2107 |
| 744 | Ga0373927_0113416 | 3300035695 | Bacteria | 1766 |
| 745 | Ga0373927_0116489 | 3300035695 | Bacteria | 1742 |
| 746 | Ga0373927_0172677 | 3300035695 | Bacteria | 1417 |
| 747 | Ga0373927_0180085 | 3300035695 | Bacteria | 1386 |
| 748 | Ga0373927_0251582 | 3300035695 | Bacteria | 1161 |
| 749 | Ga0373933_0000405 | 3300035724 | Bacteria | 27323 |
| 750 | Ga0373933_0002641 | 3300035724 | Bacteria | 10039 |
| 751 | Ga0373933_0021114 | 3300035724 | Bacteria | 3695 |
| 752 | Ga0373933_0115209 | 3300035724 | Bacteria | 1679 |
| 753 | Ga0373933_0196709 | 3300035724 | Bacteria | 1289 |
| 754 | Ga0373947_0000024 | 3300035725 | Bacteria | 87027 |
| 755 | Ga0373947_0000555 | 3300035725 | Bacteria | 21800 |
| 756 | Ga0373947_0011853 | 3300035725 | Bacteria | 4996 |
| 757 | Ga0373947_0013984 | 3300035725 | Bacteria | 4600 |
| 758 | Ga0373947_0025304 | 3300035725 | Bacteria | 3461 |
| 759 | Ga0373947_0040313 | 3300035725 | Bacteria | 2781 |
| 760 | Ga0373947_0074470 | 3300035725 | Bacteria | 2089 |
| 761 | Ga0373947_0595055 | 3300035725 | Bacteria | 754 |
| 762 | Ga0373937_0014181 | 3300036401 | Bacteria | 7030 |
| 763 | Ga0373937_0048872 | 3300036401 | Bacteria | 3873 |
| 764 | Ga0373937_0101198 | 3300036401 | Bacteria | 2674 |
| 765 | Ga0373937_0322653 | 3300036401 | Bacteria | 1461 |
| 766 | Ga0373937_0370823 | 3300036401 | Bacteria | 1357 |
| 767 | Ga0373925_0002500 | 3300037068 | Bacteria | 14688 |
| 768 | Ga0373925_0008692 | 3300037068 | Bacteria | 7398 |
| 769 | Ga0373925_0012894 | 3300037068 | Bacteria | 6054 |
| 770 | Ga0373925_0048657 | 3300037068 | Bacteria | 3160 |
| 771 | Ga0373925_0049358 | 3300037068 | Bacteria | 3137 |
| 772 | Ga0373925_0122327 | 3300037068 | Bacteria | 2021 |
| 773 | Ga0373925_0212796 | 3300037068 | Bacteria | 1540 |
| 774 | Ga0373925_0350555 | 3300037068 | Bacteria | 1198 |
| 775 | Ga0373925_0402658 | 3300037068 | Bacteria | 1116 |
| 776 | Ga0395900_0001369 | 3300037418 | Bacteria | 29330 |
| 777 | Ga0395900_0100239 | 3300037418 | Bacteria | 2975 |
| 778 | Ga0395898_0008318 | 3300037466 | Bacteria | 10970 |
| 779 | Ga0395898_0108847 | 3300037466 | Bacteria | 2657 |
| 780 | Ga0395898_0120355 | 3300037466 | Bacteria | 2515 |
| 781 | Ga0395898_0132490 | 3300037466 | Bacteria | 2387 |
| 782 | Ga0395898_0177776 | 3300037466 | Bacteria | 2034 |
| 783 | Ga0395905_0007242 | 3300037471 | Bacteria | 11053 |
| 784 | Ga0395905_0206371 | 3300037471 | Bacteria | 1841 |
| 785 | Ga0395905_0773174 | 3300037471 | Bacteria | 863 |
| 786 | Ga0436364_0278082 | 3300037853 | Bacteria | 1108 |
| 787 | Ga0436364_0507131 | 3300037853 | Bacteria | 4255 |
| 788 | Ga0436364_0685489 | 3300037853 | Bacteria | 982 |
| 789 | Ga0436364_0901535 | 3300037853 | Bacteria | 2437 |
| 790 | Ga0395901_0004623 | 3300038443 | Bacteria | 13893 |
| 791 | Ga0395901_0319175 | 3300038443 | Bacteria | 1608 |
| 792 | Ga0395901_0543609 | 3300038443 | Bacteria | 1178 |
| 793 | Ga0395901_0794120 | 3300038443 | Bacteria | 936 |
| 794 | Ga0237819_08620 | 3300038705 | Bacteria | 1404 |
| 795 | Ga0436365_0051700 | 3300039437 | Bacteria | 1716 |
| 796 | Ga0436365_0171887 | 3300039437 | Bacteria | 9138 |
| 797 | Ga0436365_1002842 | 3300039437 | Bacteria | 1071 |
| 798 | Ga0436365_1022455 | 3300039437 | Bacteria | 2158 |
| 799 | Ga0436365_1339456 | 3300039437 | Bacteria | 3791 |
| 800 | Ga0436365_1677794 | 3300039437 | Bacteria | 1011 |
| 801 | Ga0436365_1681542 | 3300039437 | Bacteria | 895 |
| 802 | Ga0436360_0109705 | 3300039438 | Bacteria | 966 |
| 803 | Ga0436360_0818757 | 3300039438 | Bacteria | 1572 |
| 804 | Ga0436361_0127548 | 3300039447 | Bacteria | 12919 |
| 805 | Ga0436361_0505235 | 3300039447 | Bacteria | 1575 |
| 806 | Ga0436361_1071097 | 3300039447 | Bacteria | 784 |
| 807 | Ga0436361_1139687 | 3300039447 | Bacteria | 1384 |
| 808 | Ga0436363_0068219 | 3300039450 | Bacteria | 1241 |
| 809 | Ga0436363_0665307 | 3300039450 | Bacteria | 1015 |
| 810 | Ga0436363_0892697 | 3300039450 | Bacteria | 1253 |
| 811 | Ga0436362_0437287 | 3300039453 | Bacteria | 3404 |
| 812 | Ga0439453_0004295 | 3300041408 | Bacteria | 2112 |
| 813 | Ga0439465_0038204 | 3300041413 | Bacteria | 1546 |
| 814 | Ga0439459_0016906 | 3300042438 | Bacteria | 1353 |
| 815 | Ga0466969_0073334 | 3300044656 | Bacteria | 1643 |
| 816 | Ga0466972_0000807 | 3300044658 | Bacteria | 14916 |
| 817 | Ga0466972_0023955 | 3300044658 | Bacteria | 3032 |
| 818 | Ga0466966_0001348 | 3300044684 | Bacteria | 15776 |
| 819 | Ga0466966_0102112 | 3300044684 | Bacteria | 1773 |
| 820 | Ga0466966_0164270 | 3300044684 | Bacteria | 1351 |
| 821 | Ga0466961_0000120 | 3300044693 | Bacteria | 52569 |
| 822 | Ga0466963_0023333 | 3300044694 | Bacteria | 3927 |
| 823 | Ga0466963_0036289 | 3300044694 | Bacteria | 3214 |
| 824 | Ga0466963_0081815 | 3300044694 | Bacteria | 2188 |
| 825 | Ga0466968_0004393 | 3300044735 | Bacteria | 5266 |
| 826 | Ga0466970_0033580 | 3300044765 | Bacteria | 2712 |
| 827 | Ga0466970_0069577 | 3300044765 | Bacteria | 1892 |
| 828 | Ga0466970_0239222 | 3300044765 | Bacteria | 1016 |
| 829 | Ga0466957_0049432 | 3300044842 | Bacteria | 2557 |
| 830 | Ga0466959_0040985 | 3300045049 | Bacteria | 3420 |
| 831 | Ga0466958_0020966 | 3300045836 | Bacteria | 3815 |
| 832 | Ga0466958_0059700 | 3300045836 | Bacteria | 2321 |
| 833 | Ga0466967_0023485 | 3300045976 | Bacteria | 5054 |
| 834 | Ga0466967_0324153 | 3300045976 | Bacteria | 1486 |
| 835 | Ga0466967_0411364 | 3300045976 | Bacteria | 1317 |
| 836 | Ga0495617_035336 | 3300046452 | Bacteria | 1678 |
| 837 | Ga0495617_085269 | 3300046452 | Bacteria | 1033 |
| 838 | Ga0495592_0005358 | 3300046454 | Bacteria | 9468 |
| 839 | Ga0495592_0006102 | 3300046454 | Bacteria | 8959 |
| 840 | Ga0495592_0022161 | 3300046454 | Bacteria | 4832 |
| 841 | Ga0495592_0030976 | 3300046454 | Bacteria | 4045 |
| 842 | Ga0495592_0031459 | 3300046454 | Bacteria | 4011 |
| 843 | Ga0495592_0152464 | 3300046454 | Bacteria | 1597 |
| 844 | Ga0495603_0000094 | 3300046455 | Bacteria | 40636 |
| 845 | Ga0495603_0003073 | 3300046455 | Bacteria | 9911 |
| 846 | Ga0495603_0013013 | 3300046455 | Bacteria | 5030 |
| 847 | Ga0495603_0084278 | 3300046455 | Bacteria | 1861 |
| 848 | Ga0495603_0110295 | 3300046455 | Bacteria | 1605 |
| 849 | Ga0495629_0000612 | 3300046459 | Bacteria | 29083 |
| 850 | Ga0495629_0000790 | 3300046459 | Bacteria | 25537 |
| 851 | Ga0495629_0004905 | 3300046459 | Bacteria | 10042 |
| 852 | Ga0495629_0016352 | 3300046459 | Bacteria | 5325 |
| 853 | Ga0495629_0074959 | 3300046459 | Bacteria | 2362 |
| 854 | Ga0495629_0110276 | 3300046459 | Bacteria | 1918 |
| 855 | Ga0495638_0008217 | 3300046460 | Bacteria | 7417 |
| 856 | Ga0495638_0140439 | 3300046460 | Bacteria | 1411 |
| 857 | Ga0495638_0217480 | 3300046460 | Bacteria | 1070 |
| 858 | Ga0495641_0094556 | 3300046461 | Bacteria | 1335 |
| 859 | Ga0495651_0000889 | 3300046462 | Bacteria | 23256 |
| 860 | Ga0495651_0002077 | 3300046462 | Bacteria | 15442 |
| 861 | Ga0495651_0014948 | 3300046462 | Bacteria | 5999 |
| 862 | Ga0495651_0019475 | 3300046462 | Bacteria | 5261 |
| 863 | Ga0495651_0039224 | 3300046462 | Bacteria | 3688 |
| 864 | Ga0495651_0075184 | 3300046462 | Bacteria | 2562 |
| 865 | Ga0495651_0080993 | 3300046462 | Bacteria | 2451 |
| 866 | Ga0495651_0116962 | 3300046462 | Bacteria | 1963 |
| 867 | Ga0495651_0224275 | 3300046462 | Bacteria | 1299 |
| 868 | Ga0495653_0000399 | 3300046463 | Bacteria | 34847 |
| 869 | Ga0495653_0120059 | 3300046463 | Bacteria | 1875 |
| 870 | Ga0495653_0254744 | 3300046463 | Bacteria | 1163 |
| 871 | Ga0495650_0113297 | 3300046471 | Bacteria | 1005 |
| 872 | Ga0495580_0002084 | 3300046472 | Bacteria | 17548 |
| 873 | Ga0495580_0023565 | 3300046472 | Bacteria | 4518 |
| 874 | Ga0495580_0049181 | 3300046472 | Bacteria | 2983 |
| 875 | Ga0495580_0305529 | 3300046472 | Bacteria | 1083 |
| 876 | Ga0495580_0311695 | 3300046472 | Bacteria | 1070 |
| 877 | Ga0495582_0000256 | 3300046473 | Bacteria | 29694 |
| 878 | Ga0495582_0007746 | 3300046473 | Bacteria | 5938 |
| 879 | Ga0495582_0038554 | 3300046473 | Bacteria | 2630 |
| 880 | Ga0495582_0043278 | 3300046473 | Bacteria | 2480 |
| 881 | Ga0495582_0138572 | 3300046473 | Bacteria | 1378 |
| 882 | Ga0495605_0054465 | 3300046474 | Bacteria | 1937 |
| 883 | Ga0495605_0123195 | 3300046474 | Bacteria | 1174 |
| 884 | Ga0495639_0000114 | 3300046475 | Bacteria | 40307 |
| 885 | Ga0495639_0026219 | 3300046475 | Bacteria | 2575 |
| 886 | Ga0495639_0031366 | 3300046475 | Bacteria | 2365 |
| 887 | Ga0495639_0034202 | 3300046475 | Bacteria | 2273 |
| 888 | Ga0495639_0055459 | 3300046475 | Bacteria | 1808 |
| 889 | Ga0495639_0249424 | 3300046475 | Bacteria | 877 |
| 890 | Ga0495662_0003142 | 3300046476 | Bacteria | 8329 |
| 891 | Ga0495662_0009981 | 3300046476 | Bacteria | 4662 |
| 892 | Ga0495662_0020029 | 3300046476 | Bacteria | 3237 |
| 893 | Ga0495662_0048590 | 3300046476 | Bacteria | 2049 |
| 894 | Ga0495664_0001473 | 3300046477 | Bacteria | 12457 |
| 895 | Ga0495664_0003375 | 3300046477 | Bacteria | 8681 |
| 896 | Ga0495585_0106124 | 3300046492 | Bacteria | 1498 |
| 897 | Ga0495585_0156045 | 3300046492 | Bacteria | 1187 |
| 898 | Ga0495585_0184888 | 3300046492 | Bacteria | 1069 |
| 899 | Ga0495594_0012709 | 3300046499 | Bacteria | 4392 |
| 900 | Ga0495594_0091672 | 3300046499 | Bacteria | 1703 |
| 901 | Ga0495594_0226994 | 3300046499 | Bacteria | 1065 |
| 902 | Ga0495607_0050252 | 3300046501 | Bacteria | 2428 |
| 903 | Ga0495583_0139118 | 3300046506 | Bacteria | 1012 |
| 904 | Ga0495606_0007875 | 3300046507 | Bacteria | 9402 |
| 905 | Ga0495606_0035535 | 3300046507 | Bacteria | 3404 |
| 906 | Ga0495606_0041553 | 3300046507 | Bacteria | 3083 |
| 907 | Ga0495606_0085587 | 3300046507 | Bacteria | 1950 |
| 908 | Ga0495608_0002695 | 3300046511 | Bacteria | 12755 |
| 909 | Ga0495608_0010086 | 3300046511 | Bacteria | 6588 |
| 910 | Ga0495608_0048208 | 3300046511 | Bacteria | 2831 |
| 911 | Ga0495608_0101917 | 3300046511 | Bacteria | 1850 |
| 912 | Ga0495610_0099619 | 3300046512 | Bacteria | 1304 |
| 913 | Ga0495616_0175248 | 3300046513 | Bacteria | 956 |
| 914 | Ga0495618_0003477 | 3300046514 | Bacteria | 9782 |
| 915 | Ga0495618_0009727 | 3300046514 | Bacteria | 5807 |
| 916 | Ga0495618_0019706 | 3300046514 | Bacteria | 4151 |
| 917 | Ga0495618_0042423 | 3300046514 | Bacteria | 2868 |
| 918 | Ga0495618_0049423 | 3300046514 | Bacteria | 2656 |
| 919 | Ga0495618_0321043 | 3300046514 | Bacteria | 959 |
| 920 | Ga0495620_0034250 | 3300046515 | Bacteria | 2297 |
| 921 | Ga0495628_0002883 | 3300046516 | Bacteria | 15398 |
| 922 | Ga0495628_0050791 | 3300046516 | Bacteria | 3279 |
| 923 | Ga0495628_0064360 | 3300046516 | Bacteria | 2871 |
| 924 | Ga0495628_0138751 | 3300046516 | Bacteria | 1856 |
| 925 | Ga0495628_0140873 | 3300046516 | Bacteria | 1840 |
| 926 | Ga0495628_0233538 | 3300046516 | Bacteria | 1378 |
| 927 | Ga0495628_0315233 | 3300046516 | Bacteria | 1155 |
| 928 | Ga0495630_0001933 | 3300046517 | Bacteria | 14435 |
| 929 | Ga0495630_0019620 | 3300046517 | Bacteria | 4972 |
| 930 | Ga0495630_0030387 | 3300046517 | Bacteria | 4018 |
| 931 | Ga0495630_0116795 | 3300046517 | Bacteria | 2022 |
| 932 | Ga0495630_0133199 | 3300046517 | Bacteria | 1888 |
| 933 | Ga0495631_0023589 | 3300046518 | Bacteria | 2850 |
| 934 | Ga0495632_0117776 | 3300046519 | Bacteria | 1243 |
| 935 | Ga0495643_0007496 | 3300046522 | Bacteria | 7020 |
| 936 | Ga0495643_0115681 | 3300046522 | Bacteria | 1359 |
| 937 | Ga0495648_0001784 | 3300046524 | Bacteria | 20695 |
| 938 | Ga0495648_0031577 | 3300046524 | Bacteria | 3485 |
| 939 | Ga0495648_0042607 | 3300046524 | Bacteria | 2854 |
| 940 | Ga0495648_0081196 | 3300046524 | Bacteria | 1845 |
| 941 | Ga0495648_0081694 | 3300046524 | Bacteria | 1837 |
| 942 | Ga0495663_0016825 | 3300046525 | Bacteria | 2069 |
| 943 | Ga0495666_0035671 | 3300046526 | Bacteria | 2423 |
| 944 | Ga0495666_0130988 | 3300046526 | Bacteria | 1172 |
| 945 | Ga0495652_0004272 | 3300046529 | Bacteria | 13713 |
| 946 | Ga0495652_0005705 | 3300046529 | Bacteria | 11659 |
| 947 | Ga0495652_0041756 | 3300046529 | Bacteria | 3957 |
| 948 | Ga0495652_0083645 | 3300046529 | Bacteria | 2626 |
| 949 | Ga0495652_0085466 | 3300046529 | Bacteria | 2592 |
| 950 | Ga0495652_0246980 | 3300046529 | Bacteria | 1324 |
| 951 | Ga0495652_0263865 | 3300046529 | Bacteria | 1270 |
| 952 | Ga0495654_0071667 | 3300046530 | Bacteria | 1641 |
| 953 | Ga0495665_0000130 | 3300046531 | Bacteria | 35880 |
| 954 | Ga0495665_0006644 | 3300046531 | Bacteria | 6242 |
| 955 | Ga0495640_0003045 | 3300046533 | Bacteria | 13491 |
| 956 | Ga0495640_0004006 | 3300046533 | Bacteria | 11789 |
| 957 | Ga0495640_0004971 | 3300046533 | Bacteria | 10565 |
| 958 | Ga0495640_0011709 | 3300046533 | Bacteria | 6735 |
| 959 | Ga0495640_0020751 | 3300046533 | Bacteria | 4831 |
| 960 | Ga0495640_0071384 | 3300046533 | Bacteria | 2330 |
| 961 | Ga0495640_0095035 | 3300046533 | Bacteria | 1962 |
| 962 | Ga0495640_0115050 | 3300046533 | Bacteria | 1753 |
| 963 | Ga0495586_0020363 | 3300046535 | Bacteria | 3533 |
| 964 | Ga0495586_0042890 | 3300046535 | Bacteria | 2436 |
| 965 | Ga0495586_0142899 | 3300046535 | Bacteria | 1344 |
| 966 | Ga0495587_0001433 | 3300046536 | Bacteria | 15868 |
| 967 | Ga0495587_0007554 | 3300046536 | Bacteria | 7038 |
| 968 | Ga0495587_0021435 | 3300046536 | Bacteria | 3985 |
| 969 | Ga0495587_0060104 | 3300046536 | Bacteria | 2229 |
| 970 | Ga0495587_0068435 | 3300046536 | Bacteria | 2068 |
| 971 | Ga0495587_0167947 | 3300046536 | Bacteria | 1247 |
| 972 | Ga0495587_0352838 | 3300046536 | Bacteria | 820 |
| 973 | Ga0495598_0013195 | 3300046537 | Bacteria | 2043 |
| 974 | Ga0495609_0065443 | 3300046538 | Bacteria | 1602 |
| 975 | Ga0495621_0030725 | 3300046539 | Bacteria | 1838 |
| 976 | Ga0495597_0016508 | 3300046542 | Bacteria | 3485 |
| 977 | Ga0495597_0026607 | 3300046542 | Bacteria | 2657 |
| 978 | Ga0495645_0023705 | 3300046543 | Bacteria | 4446 |
| 979 | Ga0495645_0035960 | 3300046543 | Bacteria | 3611 |
| 980 | Ga0495645_0060457 | 3300046543 | Bacteria | 2746 |
| 981 | Ga0495645_0124602 | 3300046543 | Bacteria | 1811 |
| 982 | Ga0495645_0222402 | 3300046543 | Bacteria | 1269 |
| 983 | Ga0495645_0223217 | 3300046543 | Bacteria | 1266 |
| 984 | Ga0495622_0006054 | 3300046557 | Bacteria | 5621 |
| 985 | Ga0495622_0101008 | 3300046557 | Bacteria | 1322 |
| 986 | Ga0495667_0000140 | 3300046559 | Bacteria | 49325 |
| 987 | Ga0495667_0006538 | 3300046559 | Bacteria | 7912 |
| 988 | Ga0495667_0013337 | 3300046559 | Bacteria | 5563 |
| 989 | Ga0495667_0019409 | 3300046559 | Bacteria | 4586 |
| 990 | Ga0495667_0168974 | 3300046559 | Bacteria | 1405 |
| 991 | Ga0495656_0011865 | 3300046615 | Bacteria | 3205 |
| 992 | Ga0495656_0059206 | 3300046615 | Bacteria | 1665 |
| 993 | Ga0495656_0062247 | 3300046615 | Bacteria | 1631 |
| 994 | Ga0495656_0068262 | 3300046615 | Bacteria | 1571 |
| 995 | Ga0495656_0104892 | 3300046615 | Bacteria | 1313 |
| 996 | Ga0495656_0198283 | 3300046615 | Bacteria | 995 |
| 997 | Ga0495668_0058812 | 3300046616 | Bacteria | 2121 |
| 998 | Ga0495668_0068180 | 3300046616 | Bacteria | 1956 |
| 999 | Ga0495634_0002801 | 3300046642 | Bacteria | 14322 |
| 1000 | Ga0495634_0004122 | 3300046642 | Bacteria | 11510 |
| 1001 | Ga0495634_0014766 | 3300046642 | Bacteria | 5619 |
| 1002 | Ga0495634_0036929 | 3300046642 | Bacteria | 3339 |
| 1003 | Ga0495634_0037734 | 3300046642 | Bacteria | 3299 |
| 1004 | Ga0495634_0072032 | 3300046642 | Bacteria | 2273 |
| 1005 | Ga0495611_0048653 | 3300046648 | Bacteria | 1906 |
| 1006 | Ga0495625_0052701 | 3300046660 | Bacteria | 2912 |
| 1007 | Ga0495635_0000088 | 3300046663 | Bacteria | 54355 |
| 1008 | Ga0495635_0002155 | 3300046663 | Bacteria | 13367 |
| 1009 | Ga0495635_0003834 | 3300046663 | Bacteria | 10442 |
| 1010 | Ga0495635_0006262 | 3300046663 | Bacteria | 8288 |
| 1011 | Ga0495635_0014805 | 3300046663 | Bacteria | 5456 |
| 1012 | Ga0495635_0049496 | 3300046663 | Bacteria | 2896 |
| 1013 | Ga0495635_0188807 | 3300046663 | Bacteria | 1399 |
| 1014 | Ga0495635_0228812 | 3300046663 | Bacteria | 1256 |
| 1015 | Ga0495659_0049160 | 3300046664 | Bacteria | 1530 |
| 1016 | Ga0495659_0072969 | 3300046664 | Bacteria | 1289 |
| 1017 | Ga0495661_0026825 | 3300046665 | Bacteria | 3705 |
| 1018 | Ga0495588_0002627 | 3300046674 | Bacteria | 7696 |
| 1019 | Ga0495657_0006632 | 3300046675 | Bacteria | 9039 |
| 1020 | Ga0495657_0010076 | 3300046675 | Bacteria | 7123 |
| 1021 | Ga0495657_0025289 | 3300046675 | Bacteria | 4219 |
| 1022 | Ga0495657_0045493 | 3300046675 | Bacteria | 2978 |
| 1023 | Ga0495599_0008020 | 3300046678 | Bacteria | 6410 |
| 1024 | Ga0495599_0011303 | 3300046678 | Bacteria | 5483 |
| 1025 | Ga0495599_0019518 | 3300046678 | Bacteria | 4225 |
| 1026 | Ga0495599_0036813 | 3300046678 | Bacteria | 3074 |
| 1027 | Ga0495599_0053396 | 3300046678 | Bacteria | 2531 |
| 1028 | Ga0495599_0088351 | 3300046678 | Bacteria | 1935 |
| 1029 | Ga0495623_0005061 | 3300046679 | Bacteria | 8649 |
| 1030 | Ga0495623_0008985 | 3300046679 | Bacteria | 6488 |
| 1031 | Ga0495623_0072455 | 3300046679 | Bacteria | 2142 |
| 1032 | Ga0495623_0086458 | 3300046679 | Bacteria | 1932 |
| 1033 | Ga0495646_0003222 | 3300046680 | Bacteria | 10148 |
| 1034 | Ga0495646_0008201 | 3300046680 | Bacteria | 6640 |
| 1035 | Ga0495646_0016220 | 3300046680 | Bacteria | 4729 |
| 1036 | Ga0495646_0041957 | 3300046680 | Bacteria | 2810 |
| 1037 | Ga0495646_0048886 | 3300046680 | Bacteria | 2568 |
| 1038 | Ga0495646_0200630 | 3300046680 | Bacteria | 1086 |
| 1039 | Ga0495647_0031473 | 3300046681 | Bacteria | 1973 |
| 1040 | Ga0495658_0000295 | 3300046683 | Bacteria | 28329 |
| 1041 | Ga0495658_0066283 | 3300046683 | Bacteria | 2085 |
| 1042 | Ga0495658_0125011 | 3300046683 | Bacteria | 1560 |
| 1043 | Ga0495613_0001707 | 3300046689 | Bacteria | 16723 |
| 1044 | Ga0495613_0012740 | 3300046689 | Bacteria | 6252 |
| 1045 | Ga0495613_0022225 | 3300046689 | Bacteria | 4727 |
| 1046 | Ga0495613_0051374 | 3300046689 | Bacteria | 3038 |
| 1047 | Ga0495613_0217683 | 3300046689 | Bacteria | 1341 |
| 1048 | Ga0495613_0371317 | 3300046689 | Bacteria | 979 |
| 1049 | Ga0495624_0000079 | 3300046690 | Bacteria | 63196 |
| 1050 | Ga0495624_0007161 | 3300046690 | Bacteria | 7852 |
| 1051 | Ga0495624_0076668 | 3300046690 | Bacteria | 2074 |
| 1052 | Ga0495624_0173351 | 3300046690 | Bacteria | 1316 |
| 1053 | Ga0495670_0007514 | 3300046691 | Bacteria | 5357 |
| 1054 | Ga0495670_0179861 | 3300046691 | Bacteria | 1116 |
| 1055 | Ga0495671_0102611 | 3300046692 | Bacteria | 1397 |
| 1056 | Ga0495671_0169141 | 3300046692 | Bacteria | 1063 |
| 1057 | Ga0495589_0171033 | 3300046794 | Bacteria | 1033 |
| 1058 | Ga0495600_0000715 | 3300046809 | Bacteria | 17456 |
| 1059 | Ga0495600_0001507 | 3300046809 | Bacteria | 12922 |
| 1060 | Ga0495600_0003313 | 3300046809 | Bacteria | 9452 |
| 1061 | Ga0495600_0016414 | 3300046809 | Bacteria | 4698 |
| 1062 | Ga0495600_0045331 | 3300046809 | Bacteria | 2869 |
| 1063 | Ga0495600_0206043 | 3300046809 | Bacteria | 1261 |
| 1064 | Ga0495600_0311750 | 3300046809 | Bacteria | 991 |
| 1065 | Ga0495581_0000813 | 3300047315 | Bacteria | 16574 |
| 1066 | Ga0495581_0023086 | 3300047315 | Bacteria | 3605 |
| 1067 | Ga0495581_0030786 | 3300047315 | Bacteria | 3109 |
| 1068 | Ga0495581_0034914 | 3300047315 | Bacteria | 2910 |
| 1069 | Ga0495581_0136040 | 3300047315 | Bacteria | 1432 |
| 1070 | Ga0495581_0173687 | 3300047315 | Bacteria | 1260 |
| 1071 | Ga0495604_0001087 | 3300047317 | Bacteria | 22562 |
| 1072 | Ga0495604_0001221 | 3300047317 | Bacteria | 21092 |
| 1073 | Ga0495604_0008665 | 3300047317 | Bacteria | 8037 |
| 1074 | Ga0495604_0075269 | 3300047317 | Bacteria | 2542 |
| 1075 | Ga0495604_0081814 | 3300047317 | Bacteria | 2416 |
| 1076 | Ga0495604_0108302 | 3300047317 | Bacteria | 2030 |
| 1077 | Ga0495604_0313690 | 3300047317 | Bacteria | 1050 |
| 1078 | Ga0495604_0534814 | 3300047317 | Bacteria | 757 |
| 1079 | Ga0495674_0001729 | 3300047319 | Bacteria | 21443 |
| 1080 | Ga0495674_0009348 | 3300047319 | Bacteria | 9318 |
| 1081 | Ga0495674_0027713 | 3300047319 | Bacteria | 5173 |
| 1082 | Ga0495674_0037672 | 3300047319 | Bacteria | 4345 |
| 1083 | Ga0495674_0038076 | 3300047319 | Bacteria | 4319 |
| 1084 | Ga0495674_0271468 | 3300047319 | Bacteria | 1391 |
| 1085 | Ga0495672_0030134 | 3300047320 | Bacteria | 3408 |
| 1086 | Ga0495672_0032478 | 3300047320 | Bacteria | 3246 |
| 1087 | Ga0495672_0092787 | 3300047320 | Bacteria | 1655 |
| 1088 | Ga0495672_0097888 | 3300047320 | Bacteria | 1596 |
| 1089 | Ga0495672_0244629 | 3300047320 | Bacteria | 874 |
| 1090 | Ga0495676_0026719 | 3300047321 | Bacteria | 4964 |
| 1091 | Ga0495676_0120138 | 3300047321 | Bacteria | 1913 |
| 1092 | Ga0495676_0134409 | 3300047321 | Bacteria | 1781 |
| 1093 | Ga0495676_0186419 | 3300047321 | Bacteria | 1450 |
| 1094 | Ga0495680_0003010 | 3300047322 | Bacteria | 16808 |
| 1095 | Ga0495680_0004956 | 3300047322 | Bacteria | 12596 |
| 1096 | Ga0495680_0044392 | 3300047322 | Bacteria | 3515 |
| 1097 | Ga0495680_0056905 | 3300047322 | Bacteria | 3026 |
| 1098 | Ga0495680_0154852 | 3300047322 | Bacteria | 1668 |
| 1099 | Ga0495683_0075200 | 3300047323 | Bacteria | 1654 |
| 1100 | Ga0495683_0151039 | 3300047323 | Bacteria | 1081 |
| 1101 | Ga0495683_0163074 | 3300047323 | Bacteria | 1029 |
| 1102 | Ga0495675_0001246 | 3300047444 | Bacteria | 15421 |
| 1103 | Ga0495675_0008090 | 3300047444 | Bacteria | 6507 |
| 1104 | Ga0495675_0088852 | 3300047444 | Bacteria | 1940 |
| 1105 | Ga0495673_0013336 | 3300047469 | Bacteria | 4322 |
| 1106 | Ga0495684_0001916 | 3300047471 | Bacteria | 16683 |
| 1107 | Ga0495684_0002318 | 3300047471 | Bacteria | 15233 |
| 1108 | Ga0495684_0003908 | 3300047471 | Bacteria | 11612 |
| 1109 | Ga0495684_0018409 | 3300047471 | Bacteria | 5381 |
| 1110 | Ga0495684_0027736 | 3300047471 | Bacteria | 4349 |
| 1111 | Ga0495684_0059076 | 3300047471 | Bacteria | 2920 |
| 1112 | Ga0495684_0077854 | 3300047471 | Bacteria | 2516 |
| 1113 | Ga0495684_0132344 | 3300047471 | Bacteria | 1872 |
| 1114 | Ga0495686_0038077 | 3300047472 | Bacteria | 3077 |
| 1115 | Ga0495686_0048116 | 3300047472 | Bacteria | 2690 |
| 1116 | Ga0495686_0083636 | 3300047472 | Bacteria | 1946 |
| 1117 | Ga0495686_0098662 | 3300047472 | Bacteria | 1765 |
| 1118 | Ga0495686_0153803 | 3300047472 | Bacteria | 1349 |
| 1119 | Ga0495686_0161489 | 3300047472 | Bacteria | 1309 |
| 1120 | Ga0495686_0228039 | 3300047472 | Bacteria | 1056 |
| 1121 | Ga0495593_0000566 | 3300047673 | Bacteria | 21032 |
| 1122 | Ga0495593_0015457 | 3300047673 | Bacteria | 4322 |
| 1123 | Ga0495593_0019520 | 3300047673 | Bacteria | 3799 |
| 1124 | Ga0495593_0020602 | 3300047673 | Bacteria | 3692 |
| 1125 | Ga0495593_0020975 | 3300047673 | Bacteria | 3653 |
| 1126 | Ga0495593_0021001 | 3300047673 | Bacteria | 3650 |
| 1127 | Ga0495593_0077249 | 3300047673 | Bacteria | 1725 |
| 1128 | Ga0495602_0004696 | 3300048088 | Bacteria | 14277 |
| 1129 | Ga0495602_0016336 | 3300048088 | Bacteria | 7468 |
| 1130 | Ga0495602_0040667 | 3300048088 | Bacteria | 4258 |
| 1131 | Ga0495602_0044907 | 3300048088 | Bacteria | 4003 |
| 1132 | Ga0495602_0060397 | 3300048088 | Bacteria | 3303 |
| 1133 | Ga0495602_0216727 | 3300048088 | Bacteria | 1448 |
| 1134 | Ga0495614_0019838 | 3300048089 | Bacteria | 2908 |
| 1135 | Ga0496100_0064505 | 3300048903 | Bacteria | 2424 |
| 1136 | Ga0496100_0164111 | 3300048903 | Bacteria | 1594 |
| 1137 | Ga0496100_0182248 | 3300048903 | Bacteria | 1519 |
| 1138 | Ga0496100_0205322 | 3300048903 | Bacteria | 1438 |
| 1139 | Ga0496100_0248372 | 3300048903 | Bacteria | 1315 |
| 1140 | Ga0496101_0009451 | 3300048904 | Bacteria | 6409 |
| 1141 | Ga0496101_0083482 | 3300048904 | Bacteria | 2365 |
| 1142 | Ga0496101_0150986 | 3300048904 | Bacteria | 1777 |
| 1143 | Ga0496101_0193837 | 3300048904 | Bacteria | 1569 |
| 1144 | Ga0496101_0239824 | 3300048904 | Bacteria | 1411 |
| 1145 | Ga0496101_0262613 | 3300048904 | Bacteria | 1347 |
| 1146 | Ga0496101_0317155 | 3300048904 | Bacteria | 1223 |
| 1147 | Ga0496102_0024292 | 3300048905 | Bacteria | 5386 |
| 1148 | Ga0496102_0031372 | 3300048905 | Bacteria | 4766 |
| 1149 | Ga0496102_0072784 | 3300048905 | Bacteria | 3159 |
| 1150 | Ga0496102_0283199 | 3300048905 | Bacteria | 1562 |
| 1151 | Ga0496102_0372167 | 3300048905 | Bacteria | 1344 |
| 1152 | Ga0496102_0494059 | 3300048905 | Bacteria | 1145 |
| 1153 | Ga0496103_0004130 | 3300048906 | Bacteria | 8815 |
| 1154 | Ga0496103_0019927 | 3300048906 | Bacteria | 4028 |
| 1155 | Ga0496103_0111218 | 3300048906 | Bacteria | 1740 |
| 1156 | Ga0496103_0335066 | 3300048906 | Bacteria | 973 |
| 1157 | Ga0496104_0006339 | 3300048907 | Bacteria | 10404 |
| 1158 | Ga0496104_0008465 | 3300048907 | Bacteria | 9146 |
| 1159 | Ga0496104_0012053 | 3300048907 | Bacteria | 7760 |
| 1160 | Ga0496104_0021422 | 3300048907 | Bacteria | 5934 |
| 1161 | Ga0496104_0029317 | 3300048907 | Bacteria | 5104 |
| 1162 | Ga0496104_0030986 | 3300048907 | Bacteria | 4971 |
| 1163 | Ga0496104_0079108 | 3300048907 | Bacteria | 3133 |
| 1164 | Ga0496105_0009668 | 3300048908 | Bacteria | 7549 |
| 1165 | Ga0496105_0027210 | 3300048908 | Bacteria | 4669 |
| 1166 | Ga0496105_0032798 | 3300048908 | Bacteria | 4263 |
| 1167 | Ga0496105_0074989 | 3300048908 | Bacteria | 2794 |
| 1168 | Ga0496105_0092579 | 3300048908 | Bacteria | 2496 |
| 1169 | Ga0496105_0211701 | 3300048908 | Bacteria | 1580 |
| 1170 | Ga0496105_0261563 | 3300048908 | Bacteria | 1399 |
| 1171 | Ga0496106_0000116 | 3300048909 | Bacteria | 61237 |
| 1172 | Ga0496106_0022726 | 3300048909 | Bacteria | 4661 |
| 1173 | Ga0496106_0024317 | 3300048909 | Bacteria | 4502 |
| 1174 | Ga0496106_0062719 | 3300048909 | Bacteria | 2823 |
| 1175 | Ga0496106_0066200 | 3300048909 | Bacteria | 2751 |
| 1176 | Ga0496106_0114384 | 3300048909 | Bacteria | 2104 |
| 1177 | Ga0496106_0128967 | 3300048909 | Bacteria | 1982 |
| 1178 | Ga0496106_0239901 | 3300048909 | Bacteria | 1448 |
| 1179 | Ga0496106_0254815 | 3300048909 | Bacteria | 1404 |
| 1180 | Ga0496106_0329650 | 3300048909 | Bacteria | 1225 |
| 1181 | Ga0496107_0021741 | 3300048910 | Bacteria | 4533 |
| 1182 | Ga0496107_0070931 | 3300048910 | Bacteria | 2530 |
| 1183 | Ga0496107_0094510 | 3300048910 | Bacteria | 2187 |
| 1184 | Ga0496107_0136798 | 3300048910 | Bacteria | 1810 |
| 1185 | Ga0496107_0195916 | 3300048910 | Bacteria | 1501 |
| 1186 | Ga0496107_0294035 | 3300048910 | Bacteria | 1209 |
| 1187 | Ga0496108_0005887 | 3300048911 | Bacteria | 9941 |
| 1188 | Ga0496108_0037082 | 3300048911 | Bacteria | 4059 |
| 1189 | Ga0496108_0071572 | 3300048911 | Bacteria | 2926 |
| 1190 | Ga0496108_0154633 | 3300048911 | Bacteria | 1980 |
| 1191 | Ga0496108_0242174 | 3300048911 | Bacteria | 1569 |
| 1192 | Ga0496108_0315679 | 3300048911 | Bacteria | 1362 |
| 1193 | Ga0496108_0391171 | 3300048911 | Bacteria | 1214 |
| 1194 | Ga0496108_0429678 | 3300048911 | Bacteria | 1154 |
| 1195 | Ga0496108_0451193 | 3300048911 | Bacteria | 1123 |
| 1196 | Ga0496109_0000767 | 3300048912 | Bacteria | 26714 |
| 1197 | Ga0496109_0001670 | 3300048912 | Bacteria | 18492 |
| 1198 | Ga0496109_0031408 | 3300048912 | Bacteria | 4766 |
| 1199 | Ga0496109_0041185 | 3300048912 | Bacteria | 4185 |
| 1200 | Ga0496109_0254244 | 3300048912 | Bacteria | 1655 |
| 1201 | Ga0496109_0305290 | 3300048912 | Bacteria | 1501 |
| 1202 | Ga0496109_0389691 | 3300048912 | Bacteria | 1316 |
| 1203 | Ga0496110_0005923 | 3300048913 | Bacteria | 9621 |
| 1204 | Ga0496110_0007781 | 3300048913 | Bacteria | 8585 |
| 1205 | Ga0496110_0024667 | 3300048913 | Bacteria | 5128 |
| 1206 | Ga0496110_0123068 | 3300048913 | Bacteria | 2339 |
| 1207 | Ga0496110_0138070 | 3300048913 | Bacteria | 2204 |
| 1208 | Ga0496110_0225784 | 3300048913 | Bacteria | 1703 |
| 1209 | Ga0496110_0264610 | 3300048913 | Bacteria | 1565 |
| 1210 | Ga0496110_0339412 | 3300048913 | Bacteria | 1369 |
| 1211 | Ga0496111_0024351 | 3300048914 | Bacteria | 4261 |
| 1212 | Ga0496111_0029482 | 3300048914 | Bacteria | 3897 |
| 1213 | Ga0496111_0192000 | 3300048914 | Bacteria | 1518 |
| 1214 | Ga0496111_0220107 | 3300048914 | Bacteria | 1410 |
| 1215 | Ga0496111_0366367 | 3300048914 | Bacteria | 1066 |
| 1216 | Ga0496112_0000016 | 3300048915 | Bacteria | 194634 |
| 1217 | Ga0496112_0014881 | 3300048915 | Bacteria | 7239 |
| 1218 | Ga0496112_0015593 | 3300048915 | Bacteria | 7097 |
| 1219 | Ga0496112_0087250 | 3300048915 | Bacteria | 3087 |
| 1220 | Ga0496112_0128319 | 3300048915 | Bacteria | 2507 |
| 1221 | Ga0496112_0149949 | 3300048915 | Bacteria | 2299 |
| 1222 | Ga0496112_0180437 | 3300048915 | Bacteria | 2075 |
| 1223 | Ga0496112_0311744 | 3300048915 | Bacteria | 1518 |
| 1224 | Ga0496112_0433061 | 3300048915 | Bacteria | 1253 |
| 1225 | Ga0496113_0007323 | 3300048916 | Bacteria | 7085 |
| 1226 | Ga0496113_0069408 | 3300048916 | Bacteria | 2676 |
| 1227 | Ga0496113_0136406 | 3300048916 | Bacteria | 1928 |
| 1228 | Ga0496113_0137829 | 3300048916 | Bacteria | 1918 |
| 1229 | Ga0496113_0220184 | 3300048916 | Bacteria | 1512 |
| 1230 | Ga0496113_0227005 | 3300048916 | Bacteria | 1489 |
| 1231 | Ga0496113_0268183 | 3300048916 | Bacteria | 1364 |
| 1232 | Ga0496113_0291562 | 3300048916 | Bacteria | 1305 |
| 1233 | Ga0496113_0548198 | 3300048916 | Bacteria | 927 |
| 1234 | Ga0496114_0046385 | 3300048917 | Bacteria | 3611 |
| 1235 | Ga0496114_0128189 | 3300048917 | Bacteria | 2189 |
| 1236 | Ga0496114_0133272 | 3300048917 | Bacteria | 2147 |
| 1237 | Ga0496114_0136972 | 3300048917 | Bacteria | 2117 |
| 1238 | Ga0496114_0177823 | 3300048917 | Bacteria | 1857 |
| 1239 | Ga0496114_0317996 | 3300048917 | Bacteria | 1375 |
| 1240 | Ga0496115_0024734 | 3300048918 | Bacteria | 4670 |
| 1241 | Ga0496115_0027014 | 3300048918 | Bacteria | 4486 |
| 1242 | Ga0496115_0035229 | 3300048918 | Bacteria | 3959 |
| 1243 | Ga0496115_0048150 | 3300048918 | Bacteria | 3409 |
| 1244 | Ga0496115_0049691 | 3300048918 | Bacteria | 3358 |
| 1245 | Ga0496115_0121003 | 3300048918 | Bacteria | 2154 |
| 1246 | Ga0496115_0531175 | 3300048918 | Bacteria | 942 |
| 1247 | Ga0496116_0000887 | 3300048919 | Bacteria | 37313 |
| 1248 | Ga0496116_0110033 | 3300048919 | Bacteria | 1622 |
| 1249 | Ga0496116_0163984 | 3300048919 | Bacteria | 1215 |
| 1250 | Ga0496117_0015351 | 3300048920 | Bacteria | 6534 |
| 1251 | Ga0496117_0042896 | 3300048920 | Bacteria | 3296 |
| 1252 | Ga0496117_0112285 | 3300048920 | Bacteria | 1695 |
| 1253 | Ga0496117_0117519 | 3300048920 | Bacteria | 1641 |
| 1254 | Ga0496117_0140118 | 3300048920 | Bacteria | 1450 |
| 1255 | Ga0496117_0248257 | 3300048920 | Bacteria | 972 |
| 1256 | Ga0496118_0006231 | 3300048921 | Bacteria | 13190 |
| 1257 | Ga0496118_0023410 | 3300048921 | Bacteria | 5364 |
| 1258 | Ga0496118_0040378 | 3300048921 | Bacteria | 3711 |
| 1259 | Ga0496118_0045409 | 3300048921 | Bacteria | 3430 |
| 1260 | Ga0496118_0053224 | 3300048921 | Bacteria | 3080 |
| 1261 | Ga0496118_0099050 | 3300048921 | Bacteria | 1977 |
| 1262 | Ga0496119_0014445 | 3300048922 | Bacteria | 6179 |
| 1263 | Ga0496119_0096594 | 3300048922 | Bacteria | 1667 |
| 1264 | Ga0496119_0168290 | 3300048922 | Bacteria | 1160 |
| 1265 | Ga0496120_0080284 | 3300048923 | Bacteria | 1768 |
| 1266 | Ga0496120_0120086 | 3300048923 | Bacteria | 1360 |
| 1267 | Ga0496121_0000041 | 3300048924 | Bacteria | 346686 |
| 1268 | Ga0496121_0002334 | 3300048924 | Bacteria | 29308 |
| 1269 | Ga0496121_0002685 | 3300048924 | Bacteria | 26602 |
| 1270 | Ga0496121_0041583 | 3300048924 | Bacteria | 4014 |
| 1271 | Ga0496121_0059090 | 3300048924 | Bacteria | 3164 |
| 1272 | Ga0496121_0061958 | 3300048924 | Bacteria | 3066 |
| 1273 | Ga0496121_0096352 | 3300048924 | Bacteria | 2296 |
| 1274 | Ga0496121_0122140 | 3300048924 | Bacteria | 1965 |
| 1275 | Ga0496121_0141895 | 3300048924 | Bacteria | 1780 |
| 1276 | Ga0496121_0249023 | 3300048924 | Bacteria | 1233 |
| 1277 | Ga0496121_0291522 | 3300048924 | Bacteria | 1111 |
| 1278 | Ga0496121_0442191 | 3300048924 | Bacteria | 840 |
| 1279 | Ga0496122_0001252 | 3300048925 | Bacteria | 42547 |
| 1280 | Ga0496122_0007556 | 3300048925 | Bacteria | 12031 |
| 1281 | Ga0496122_0016277 | 3300048925 | Bacteria | 7052 |
| 1282 | Ga0496122_0059832 | 3300048925 | Bacteria | 2810 |
| 1283 | Ga0496123_0001065 | 3300048926 | Bacteria | 41481 |
| 1284 | Ga0496123_0030507 | 3300048926 | Bacteria | 3945 |
| 1285 | Ga0496124_0000910 | 3300048927 | Bacteria | 47763 |
| 1286 | Ga0496124_0057376 | 3300048927 | Bacteria | 3281 |
| 1287 | Ga0496124_0106460 | 3300048927 | Bacteria | 2264 |
| 1288 | Ga0496124_0110332 | 3300048927 | Bacteria | 2215 |
| 1289 | Ga0496124_0135253 | 3300048927 | Bacteria | 1952 |
| 1290 | Ga0496125_0000092 | 3300048928 | Bacteria | 211050 |
| 1291 | Ga0496125_0005023 | 3300048928 | Bacteria | 14935 |
| 1292 | Ga0496125_0007013 | 3300048928 | Bacteria | 12054 |
| 1293 | Ga0496125_0008149 | 3300048928 | Bacteria | 11029 |
| 1294 | Ga0496125_0013816 | 3300048928 | Bacteria | 7908 |
| 1295 | Ga0496125_0144375 | 3300048928 | Bacteria | 1648 |
| 1296 | Ga0496126_0002727 | 3300048929 | Bacteria | 23333 |
| 1297 | Ga0496126_0003329 | 3300048929 | Bacteria | 20436 |
| 1298 | Ga0496126_0011637 | 3300048929 | Bacteria | 9081 |
| 1299 | Ga0496126_0012110 | 3300048929 | Bacteria | 8853 |
| 1300 | Ga0496126_0023131 | 3300048929 | Bacteria | 6024 |
| 1301 | Ga0496126_0040296 | 3300048929 | Bacteria | 4330 |
| 1302 | Ga0496126_0060287 | 3300048929 | Bacteria | 3413 |
| 1303 | Ga0496126_0060318 | 3300048929 | Bacteria | 3412 |
| 1304 | Ga0496126_0065503 | 3300048929 | Bacteria | 3251 |
| 1305 | Ga0496126_0108664 | 3300048929 | Bacteria | 2418 |
| 1306 | Ga0496126_0129680 | 3300048929 | Bacteria | 2180 |
| 1307 | Ga0496126_0139840 | 3300048929 | Bacteria | 2085 |
| 1308 | Ga0496126_0198101 | 3300048929 | Bacteria | 1697 |
| 1309 | Ga0496126_0218886 | 3300048929 | Bacteria | 1600 |
| 1310 | Ga0496126_0242229 | 3300048929 | Bacteria | 1506 |
| 1311 | Ga0496126_0251864 | 3300048929 | Bacteria | 1471 |
| 1312 | Ga0496126_0280382 | 3300048929 | Bacteria | 1381 |
| 1313 | Ga0496126_0336710 | 3300048929 | Bacteria | 1237 |
| 1314 | Ga0496126_0383393 | 3300048929 | Bacteria | 1143 |
| 1315 | Ga0496126_0590146 | 3300048929 | Bacteria | 876 |
| 1316 | Ga0495678_081381 | 3300049459 | Bacteria | 1162 |
| 1317 | Ga0495682_0021395 | 3300049460 | Bacteria | 2423 |
| 1318 | Ga0495682_0073204 | 3300049460 | Bacteria | 1233 |
| 1319 | Ga0501031_0022335 | 3300049568 | Bacteria | 4124 |
| 1320 | Ga0501031_0083908 | 3300049568 | Bacteria | 2076 |
| 1321 | Ga0501031_0151868 | 3300049568 | Bacteria | 1513 |
| 1322 | Ga0501031_0181556 | 3300049568 | Bacteria | 1374 |
| 1323 | Ga0501032_0000046 | 3300049569 | Bacteria | 109405 |
| 1324 | Ga0501032_0003451 | 3300049569 | Bacteria | 12113 |
| 1325 | Ga0501032_0009690 | 3300049569 | Bacteria | 6976 |
| 1326 | Ga0501032_0012480 | 3300049569 | Bacteria | 6070 |
| 1327 | Ga0501032_0031524 | 3300049569 | Bacteria | 3634 |
| 1328 | Ga0501033_0001341 | 3300049570 | Bacteria | 21887 |
| 1329 | Ga0501033_0001563 | 3300049570 | Bacteria | 20194 |
| 1330 | Ga0501033_0101248 | 3300049570 | Bacteria | 2102 |
| 1331 | Ga0501033_0152143 | 3300049570 | Bacteria | 1669 |
| 1332 | Ga0501033_0171027 | 3300049570 | Bacteria | 1560 |
| 1333 | Ga0501034_0001492 | 3300049571 | Bacteria | 30823 |
| 1334 | Ga0501034_0046490 | 3300049571 | Bacteria | 4385 |
| 1335 | Ga0501034_0071642 | 3300049571 | Bacteria | 3475 |
| 1336 | Ga0501034_0089953 | 3300049571 | Bacteria | 3068 |
| 1337 | Ga0501034_0134959 | 3300049571 | Bacteria | 2449 |
| 1338 | Ga0501034_0288271 | 3300049571 | Bacteria | 1580 |
| 1339 | Ga0501036_0000326 | 3300049572 | Bacteria | 33146 |
| 1340 | Ga0501036_0029963 | 3300049572 | Bacteria | 4598 |
| 1341 | Ga0501036_0046952 | 3300049572 | Bacteria | 3657 |
| 1342 | Ga0501036_0124937 | 3300049572 | Bacteria | 2173 |
| 1343 | Ga0501036_0176428 | 3300049572 | Bacteria | 1799 |
| 1344 | Ga0501036_0258825 | 3300049572 | Bacteria | 1458 |
| 1345 | Ga0501036_0453407 | 3300049572 | Bacteria | 1068 |
| 1346 | Ga0501037_0000309 | 3300049573 | Bacteria | 41492 |
| 1347 | Ga0501037_0000457 | 3300049573 | Bacteria | 33231 |
| 1348 | Ga0501037_0023815 | 3300049573 | Bacteria | 4527 |
| 1349 | Ga0501037_0205292 | 3300049573 | Bacteria | 1391 |
| 1350 | Ga0501037_0231096 | 3300049573 | Bacteria | 1298 |
| 1351 | Ga0501037_0321889 | 3300049573 | Bacteria | 1070 |
| 1352 | Ga0501038_0000026 | 3300049574 | Bacteria | 146493 |
| 1353 | Ga0501038_0002061 | 3300049574 | Bacteria | 18607 |
| 1354 | Ga0501038_0016287 | 3300049574 | Bacteria | 6740 |
| 1355 | Ga0501038_0081738 | 3300049574 | Bacteria | 2721 |
| 1356 | Ga0501039_0074976 | 3300049575 | Bacteria | 2629 |
| 1357 | Ga0501039_0118408 | 3300049575 | Bacteria | 2074 |
| 1358 | Ga0501041_0107888 | 3300049577 | Bacteria | 1727 |
| 1359 | Ga0501042_0051874 | 3300049578 | Bacteria | 2926 |
| 1360 | Ga0501042_0107526 | 3300049578 | Bacteria | 2008 |
| 1361 | Ga0501042_0263549 | 3300049578 | Bacteria | 1244 |
| 1362 | Ga0501043_0000135 | 3300049579 | Bacteria | 68762 |
| 1363 | Ga0501043_0022795 | 3300049579 | Bacteria | 4910 |
| 1364 | Ga0501043_0025639 | 3300049579 | Bacteria | 4625 |
| 1365 | Ga0501043_0129290 | 3300049579 | Bacteria | 1980 |
| 1366 | Ga0501043_0397547 | 3300049579 | Bacteria | 1042 |
| 1367 | Ga0501046_0012002 | 3300049580 | Bacteria | 7390 |
| 1368 | Ga0501046_0019630 | 3300049580 | Bacteria | 5603 |
| 1369 | Ga0501046_0109514 | 3300049580 | Bacteria | 2111 |
| 1370 | Ga0501047_0000101 | 3300049581 | Bacteria | 104950 |
| 1371 | Ga0501047_0012471 | 3300049581 | Bacteria | 8049 |
| 1372 | Ga0501047_0015152 | 3300049581 | Bacteria | 7340 |
| 1373 | Ga0501047_0021168 | 3300049581 | Bacteria | 6245 |
| 1374 | Ga0501047_0061378 | 3300049581 | Bacteria | 3627 |
| 1375 | Ga0501047_0076352 | 3300049581 | Bacteria | 3224 |
| 1376 | Ga0501047_0151516 | 3300049581 | Bacteria | 2195 |
| 1377 | Ga0501047_0222535 | 3300049581 | Bacteria | 1743 |
| 1378 | Ga0501047_0391244 | 3300049581 | Bacteria | 1223 |
| 1379 | Ga0501048_0007052 | 3300049582 | Bacteria | 8536 |
| 1380 | Ga0501048_0238464 | 3300049582 | Bacteria | 1291 |
| 1381 | Ga0501048_0563429 | 3300049582 | Bacteria | 818 |
| 1382 | Ga0501067_0021140 | 3300049583 | Bacteria | 3601 |
| 1383 | Ga0501067_0262947 | 3300049583 | Bacteria | 960 |
| 1384 | Ga0501068_0000977 | 3300049584 | Bacteria | 15021 |
| 1385 | Ga0501068_0002854 | 3300049584 | Bacteria | 9192 |
| 1386 | Ga0501068_0004441 | 3300049584 | Bacteria | 7634 |
| 1387 | Ga0501068_0107517 | 3300049584 | Bacteria | 1732 |
| 1388 | Ga0501069_0004828 | 3300049585 | Bacteria | 6980 |
| 1389 | Ga0501069_0023367 | 3300049585 | Bacteria | 3371 |
| 1390 | Ga0501069_0050013 | 3300049585 | Bacteria | 2324 |
| 1391 | Ga0501070_0000297 | 3300049586 | Bacteria | 46317 |
| 1392 | Ga0501070_0011694 | 3300049586 | Bacteria | 7411 |
| 1393 | Ga0501070_0052986 | 3300049586 | Bacteria | 3366 |
| 1394 | Ga0501070_0161193 | 3300049586 | Bacteria | 1849 |
| 1395 | Ga0501070_0170731 | 3300049586 | Bacteria | 1791 |
| 1396 | Ga0501071_0009558 | 3300049587 | Bacteria | 6466 |
| 1397 | Ga0501071_0139437 | 3300049587 | Bacteria | 1805 |
| 1398 | Ga0501072_0129771 | 3300049588 | Bacteria | 2009 |
| 1399 | Ga0501073_0000840 | 3300049589 | Bacteria | 21856 |
| 1400 | Ga0501073_0002836 | 3300049589 | Bacteria | 12987 |
| 1401 | Ga0501073_0029876 | 3300049589 | Bacteria | 3893 |
| 1402 | Ga0501073_0178908 | 3300049589 | Bacteria | 1468 |
| 1403 | Ga0501074_0003222 | 3300049590 | Bacteria | 11525 |
| 1404 | Ga0501074_0014547 | 3300049590 | Bacteria | 5725 |
| 1405 | Ga0501074_0047411 | 3300049590 | Bacteria | 3106 |
| 1406 | Ga0501076_0110407 | 3300049592 | Bacteria | 2223 |
| 1407 | Ga0501077_0157100 | 3300049593 | Bacteria | 1444 |
| 1408 | Ga0501079_0206584 | 3300049741 | Bacteria | 1534 |
| 1409 | Ga0501079_0241222 | 3300049741 | Bacteria | 1412 |
| 1410 | Ga0501079_0260835 | 3300049741 | Bacteria | 1354 |
| 1411 | Ga0501080_0000121 | 3300049742 | Bacteria | 54804 |
| 1412 | Ga0501080_0005263 | 3300049742 | Bacteria | 11523 |
| 1413 | Ga0501080_0265493 | 3300049742 | Bacteria | 1563 |
| 1414 | Ga0501080_0339254 | 3300049742 | Bacteria | 1358 |
| 1415 | Ga0501081_0281475 | 3300049743 | Bacteria | 1218 |
| 1416 | Ga0501081_0451496 | 3300049743 | Bacteria | 955 |
| 1417 | Ga0501083_0122647 | 3300049744 | Bacteria | 1704 |
| 1418 | Ga0501083_0136697 | 3300049744 | Bacteria | 1606 |
| 1419 | Ga0501035_0000588 | 3300049822 | Bacteria | 40021 |
| 1420 | Ga0501035_0019565 | 3300049822 | Bacteria | 6220 |
| 1421 | Ga0501035_0022877 | 3300049822 | Bacteria | 5739 |
| 1422 | Ga0501035_0071627 | 3300049822 | Bacteria | 3068 |
| 1423 | Ga0501035_0251576 | 3300049822 | Bacteria | 1500 |
| 1424 | Ga0501035_0384522 | 3300049822 | Bacteria | 1170 |
| 1425 | Ga0501044_0000782 | 3300049823 | Bacteria | 38567 |
| 1426 | Ga0501044_0002089 | 3300049823 | Bacteria | 22997 |
| 1427 | Ga0501044_0029859 | 3300049823 | Bacteria | 5747 |
| 1428 | Ga0501044_0033001 | 3300049823 | Bacteria | 5440 |
| 1429 | Ga0501044_0049387 | 3300049823 | Bacteria | 4344 |
| 1430 | Ga0501044_0061427 | 3300049823 | Bacteria | 3844 |
| 1431 | Ga0501044_0087029 | 3300049823 | Bacteria | 3156 |
| 1432 | Ga0501044_0198500 | 3300049823 | Bacteria | 1965 |
| 1433 | Ga0501044_0206966 | 3300049823 | Bacteria | 1918 |
| 1434 | Ga0501044_0327811 | 3300049823 | Bacteria | 1454 |
| 1435 | Ga0501044_0409443 | 3300049823 | Bacteria | 1267 |
| 1436 | Ga0501045_0007572 | 3300049824 | Bacteria | 7548 |
| 1437 | Ga0501045_0008047 | 3300049824 | Bacteria | 7344 |
| 1438 | Ga0501045_0021109 | 3300049824 | Bacteria | 4657 |
| 1439 | Ga0501045_0303263 | 3300049824 | Bacteria | 1189 |
| 1440 | nmdc:mga03683_10072_c1 | 3300050489 | Bacteria | 2248 |
| 1441 | nmdc:mga03683_21738_c1 | 3300050489 | Bacteria | 2479 |
| 1442 | nmdc:mga03n38_1460_c1 | 3300050490 | Bacteria | 6789 |
| 1443 | nmdc:mga03n38_278947_c1 | 3300050490 | Bacteria | 891 |
| 1444 | nmdc:mga03n38_8390_c1 | 3300050490 | Bacteria | 3707 |
| 1445 | nmdc:mga03n38_99571_c1 | 3300050490 | Bacteria | 1400 |
| 1446 | nmdc:mga00v17_11368_c1 | 3300050491 | Bacteria | 4893 |
| 1447 | nmdc:mga00v17_268834_c1 | 3300050491 | Bacteria | 1106 |
| 1448 | nmdc:mga00v17_35768_c1 | 3300050491 | Bacteria | 2958 |
| 1449 | nmdc:mga00v17_83059_c1 | 3300050491 | Bacteria | 2003 |
| 1450 | nmdc:mga0yw44_12608_c1 | 3300050492 | Bacteria | 4415 |
| 1451 | nmdc:mga0yw44_1312_c2 | 3300050492 | Bacteria | 2308 |
| 1452 | nmdc:mga0yw44_213541_c1 | 3300050492 | Bacteria | 1277 |
| 1453 | nmdc:mga0yw44_226711_c1 | 3300050492 | Bacteria | 1240 |
| 1454 | nmdc:mga0yw44_305994_c1 | 3300050492 | Bacteria | 1066 |
| 1455 | nmdc:mga0yw44_9069_c1 | 3300050492 | Bacteria | 3509 |
| 1456 | nmdc:mga0k408_170790_c1 | 3300050493 | Bacteria | 1296 |
| 1457 | nmdc:mga0k408_9648_c1 | 3300050493 | Bacteria | 5209 |
| 1458 | nmdc:mga06z11_121540_c1 | 3300050494 | Bacteria | 1457 |
| 1459 | nmdc:mga06z11_43075_c1 | 3300050494 | Bacteria | 2268 |
| 1460 | nmdc:mga06z11_4937_c1 | 3300050494 | Bacteria | 5295 |
| 1461 | nmdc:mga06z11_83128_c1 | 3300050494 | Bacteria | 1723 |
| 1462 | nmdc:mga07m45_15739_c1 | 3300050496 | Bacteria | 4041 |
| 1463 | nmdc:mga07m45_87674_c1 | 3300050496 | Bacteria | 1781 |
| 1464 | nmdc:mga05p37_195042_c1 | 3300050507 | Bacteria | 2456 |
| 1465 | nmdc:mga06r32_420333_c1 | 3300050510 | Bacteria | 1318 |
| 1466 | nmdc:mga06r32_70105_c1 | 3300050510 | Bacteria | 3389 |
| 1467 | nmdc:mga08y16_20502_c1 | 3300050511 | Bacteria | 6977 |
| 1468 | nmdc:mga0n895_113422_c1 | 3300050512 | Bacteria | 2728 |
| 1469 | nmdc:mga0n895_123090_c1 | 3300050512 | Bacteria | 2615 |
| 1470 | nmdc:mga0n895_300581_c1 | 3300050512 | Bacteria | 1627 |
| 1471 | nmdc:mga0n895_351408_c1 | 3300050512 | Bacteria | 1493 |
| 1472 | nmdc:mga0n895_402230_c1 | 3300050512 | Bacteria | 1385 |
| 1473 | nmdc:mga0n895_450009_c1 | 3300050512 | Bacteria | 1300 |
| 1474 | nmdc:mga0rr50_287994_c1 | 3300050513 | Bacteria | 1372 |
| 1475 | nmdc:mga0rr50_77127_c1 | 3300050513 | Bacteria | 2560 |
| 1476 | nmdc:mga08x19_102384_c1 | 3300050514 | Bacteria | 1901 |
| 1477 | nmdc:mga08x19_358814_c1 | 3300050514 | Bacteria | 1018 |
| 1478 | nmdc:mga08x19_61814_c1 | 3300050514 | Bacteria | 2427 |
| 1479 | nmdc:mga0a205_552580_c1 | 3300050515 | Bacteria | 1006 |
| 1480 | nmdc:mga0sz30_31406_c1 | 3300050516 | Bacteria | 2198 |
| 1481 | Ga0495601_0002964 | 3300053077 | Bacteria | 9655 |
| 1482 | Ga0495601_0010057 | 3300053077 | Bacteria | 5615 |
| 1483 | Ga0495601_0011143 | 3300053077 | Bacteria | 5372 |
| 1484 | Ga0495601_0110968 | 3300053077 | Bacteria | 1776 |
| 1485 | Ga0495601_0163376 | 3300053077 | Bacteria | 1455 |
| 1486 | Ga0495601_0176564 | 3300053077 | Bacteria | 1396 |
| 1487 | Ga0495612_0000375 | 3300053078 | Bacteria | 17906 |
| 1488 | Ga0495612_0001295 | 3300053078 | Bacteria | 10325 |
| 1489 | Ga0495612_0009654 | 3300053078 | Bacteria | 3909 |
| 1490 | Ga0495612_0041156 | 3300053078 | Bacteria | 1884 |
| 1491 | Ga0500610_0140088 | 3300053079 | Bacteria | 1222 |
| 1492 | Ga0500635_0007489 | 3300053080 | Bacteria | 2960 |
| 1493 | Ga0495595_0046163 | 3300053084 | Bacteria | 2005 |
| 1494 | Ga0495595_0093655 | 3300053084 | Bacteria | 1443 |
| 1495 | Ga0495595_0121161 | 3300053084 | Bacteria | 1274 |
| 1496 | Ga0495595_0167424 | 3300053084 | Bacteria | 1086 |
| 1497 | Ga0495619_0000332 | 3300053085 | Bacteria | 33066 |
| 1498 | Ga0495619_0001363 | 3300053085 | Bacteria | 16048 |
| 1499 | Ga0495619_0024539 | 3300053085 | Bacteria | 3868 |
| 1500 | Ga0495619_0045692 | 3300053085 | Bacteria | 2878 |
| 1501 | Ga0495619_0084961 | 3300053085 | Bacteria | 2136 |
| 1502 | Ga0495619_0095263 | 3300053085 | Bacteria | 2019 |
| 1503 | Ga0500643_000019 | 3300053087 | Bacteria | 294301 |
| 1504 | Ga0500643_016934 | 3300053087 | Bacteria | 2454 |
| 1505 | Ga0500644_0021160 | 3300053088 | Bacteria | 1944 |
| 1506 | Ga0500651_0037492 | 3300053093 | Bacteria | 3055 |
| 1507 | Ga0500651_0044729 | 3300053093 | Bacteria | 2787 |
| 1508 | Ga0500651_0054718 | 3300053093 | Bacteria | 2500 |
| 1509 | Ga0500651_0101648 | 3300053093 | Bacteria | 1762 |
| 1510 | Ga0500651_0222345 | 3300053093 | Bacteria | 1106 |
| 1511 | Ga0500566_0000071 | 3300053094 | Bacteria | 49154 |
| 1512 | Ga0500566_0000537 | 3300053094 | Bacteria | 21255 |
| 1513 | Ga0500566_0000554 | 3300053094 | Bacteria | 20984 |
| 1514 | Ga0500566_0006182 | 3300053094 | Bacteria | 7117 |
| 1515 | Ga0500641_0017441 | 3300053096 | Bacteria | 2685 |
| 1516 | Ga0500641_0028512 | 3300053096 | Bacteria | 2181 |
| 1517 | Ga0500641_0061325 | 3300053096 | Bacteria | 1566 |
| 1518 | Ga0500648_082402 | 3300053097 | Bacteria | 1809 |
| 1519 | Ga0500650_0000453 | 3300053098 | Bacteria | 10240 |
| 1520 | Ga0500650_0121043 | 3300053098 | Bacteria | 1220 |
| 1521 | Ga0500555_004804 | 3300053103 | Bacteria | 3834 |
| 1522 | Ga0500555_059998 | 3300053103 | Bacteria | 1025 |
| 1523 | Ga0500556_0000024 | 3300053104 | Bacteria | 167556 |
| 1524 | Ga0500556_0006656 | 3300053104 | Bacteria | 3284 |
| 1525 | Ga0500562_011769 | 3300053108 | Bacteria | 2221 |
| 1526 | Ga0500562_022437 | 3300053108 | Bacteria | 1646 |
| 1527 | Ga0500562_045720 | 3300053108 | Bacteria | 1167 |
| 1528 | Ga0500569_028264 | 3300053109 | Bacteria | 1553 |
| 1529 | Ga0500572_001322 | 3300053111 | Bacteria | 6910 |
| 1530 | Ga0500572_001883 | 3300053111 | Bacteria | 5293 |
| 1531 | Ga0500592_001232 | 3300053116 | Bacteria | 4176 |
| 1532 | Ga0500595_001457 | 3300053119 | Bacteria | 12614 |
| 1533 | Ga0500595_004502 | 3300053119 | Bacteria | 6234 |
| 1534 | Ga0500595_008270 | 3300053119 | Bacteria | 4256 |
| 1535 | Ga0500595_010034 | 3300053119 | Bacteria | 3785 |
| 1536 | Ga0500595_025194 | 3300053119 | Bacteria | 2065 |
| 1537 | Ga0500595_029921 | 3300053119 | Bacteria | 1842 |
| 1538 | Ga0500607_050466 | 3300053121 | Bacteria | 2216 |
| 1539 | Ga0500607_068383 | 3300053121 | Bacteria | 1838 |
| 1540 | Ga0500608_001306 | 3300053122 | Bacteria | 8879 |
| 1541 | Ga0500608_180527 | 3300053122 | Bacteria | 894 |
| 1542 | Ga0500614_030732 | 3300053123 | Bacteria | 1312 |
| 1543 | Ga0500642_0000035 | 3300053130 | Bacteria | 106656 |
| 1544 | Ga0500642_0000063 | 3300053130 | Bacteria | 58680 |
| 1545 | Ga0500652_003392 | 3300053131 | Bacteria | 4823 |
| 1546 | Ga0500559_0000521 | 3300053136 | Bacteria | 27007 |
| 1547 | Ga0500559_0000985 | 3300053136 | Bacteria | 17756 |
| 1548 | Ga0500559_0008086 | 3300053136 | Bacteria | 4628 |
| 1549 | Ga0500568_0000681 | 3300053139 | Bacteria | 24452 |
| 1550 | Ga0500568_0002331 | 3300053139 | Bacteria | 11264 |
| 1551 | Ga0500568_0003711 | 3300053139 | Bacteria | 8376 |
| 1552 | Ga0500568_0058119 | 3300053139 | Bacteria | 1503 |
| 1553 | Ga0500573_0008062 | 3300053140 | Bacteria | 5788 |
| 1554 | Ga0500577_0002124 | 3300053142 | Bacteria | 5059 |
| 1555 | Ga0500577_0083133 | 3300053142 | Bacteria | 1281 |
| 1556 | Ga0500586_027712 | 3300053145 | Bacteria | 1843 |
| 1557 | Ga0500588_0053957 | 3300053146 | Bacteria | 1264 |
| 1558 | Ga0500603_000166 | 3300053150 | Bacteria | 16600 |
| 1559 | Ga0500603_001970 | 3300053150 | Bacteria | 4567 |
| 1560 | Ga0500603_004393 | 3300053150 | Bacteria | 3019 |
| 1561 | Ga0500604_0017700 | 3300053151 | Bacteria | 1976 |
| 1562 | Ga0500616_0000084 | 3300053153 | Bacteria | 195562 |
| 1563 | Ga0500616_0000122 | 3300053153 | Bacteria | 140228 |
| 1564 | Ga0500616_0025276 | 3300053153 | Bacteria | 3295 |
| 1565 | Ga0500616_0036047 | 3300053153 | Bacteria | 2686 |
| 1566 | Ga0500620_007717 | 3300053155 | Bacteria | 2676 |
| 1567 | Ga0500620_109462 | 3300053155 | Bacteria | 967 |
| 1568 | Ga0500622_0002777 | 3300053156 | Bacteria | 12312 |
| 1569 | Ga0500622_0006487 | 3300053156 | Bacteria | 6771 |
| 1570 | Ga0500624_001268 | 3300053157 | Bacteria | 4418 |
| 1571 | Ga0500627_0017182 | 3300053158 | Bacteria | 2838 |
| 1572 | Ga0500634_0062232 | 3300053161 | Bacteria | 1977 |
| 1573 | Ga0500634_0084158 | 3300053161 | Bacteria | 1631 |
| 1574 | Ga0500638_000418 | 3300053162 | Bacteria | 10135 |
| 1575 | Ga0500638_011072 | 3300053162 | Bacteria | 3984 |
| 1576 | Ga0500638_054637 | 3300053162 | Bacteria | 1926 |
| 1577 | Ga0500638_105071 | 3300053162 | Bacteria | 1312 |
| 1578 | Ga0500639_000166 | 3300053163 | Bacteria | 32001 |
| 1579 | Ga0500639_008722 | 3300053163 | Bacteria | 5290 |
| 1580 | Ga0500639_096716 | 3300053163 | Bacteria | 1461 |
| 1581 | Ga0500636_0000076 | 3300053177 | Bacteria | 48321 |
| 1582 | Ga0500636_0042821 | 3300053177 | Bacteria | 2675 |
| 1583 | Ga0500636_0191729 | 3300053177 | Bacteria | 1088 |
| 1584 | Ga0500637_0000135 | 3300053178 | Bacteria | 27083 |
| 1585 | Ga0500576_038105 | 3300053725 | Bacteria | 2171 |
| 1586 | Ga0500625_001804 | 3300053729 | Bacteria | 7638 |
| 1587 | Ga0500645_004477 | 3300053730 | Bacteria | 5348 |
| 1588 | Ga0500645_031825 | 3300053730 | Bacteria | 1584 |
| 1589 | Ga0500645_060425 | 3300053730 | Bacteria | 1096 |
| 1590 | Ga0500552_017880 | 3300053733 | Bacteria | 977 |
| 1591 | Ga0500596_001174 | 3300053735 | Bacteria | 5279 |
| 1592 | Ga0500599_002572 | 3300053736 | Bacteria | 2180 |
| 1593 | Ga0500601_000249 | 3300053737 | Bacteria | 10384 |
| 1594 | Ga0501084_0136438 | 3300054114 | Bacteria | 2065 |
| 1595 | Ga0500661_001607 | 3300055283 | Bacteria | 4269 |
| 1596 | Ga0501082_0000684 | 3300060353 | Bacteria | 29862 |
| 1597 | Ga0530510_0412608 | 3300061734 | Bacteria | 1019 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300053093 | Ga0500651_0044729 | Ga0500651_0044729_351_1142 | 218 |
| 2 | 3300053093 | Ga0500651_0054718 | Ga0500651_0054718_1791_2480 | 218 |
| 3 | 3300048904 | Ga0496101_0193837 | Ga0496101_0193837_499_1290 | 222 |
| 4 | 3300035725 | Ga0373947_0595055 | Ga0373947_0595055_17_700 | 227 |
| 5 | 3300047317 | Ga0495604_0534814 | Ga0495604_0534814_37_729 | 230 |
| 6 | 3300035111 | Ga0373923_0264790 | Ga0373923_0264790_33_734 | 231 |
| 7 | 3300039438 | Ga0436360_0109705 | Ga0436360_0109705_22_735 | 231 |
| 8 | 3300048920 | Ga0496117_0140118 | Ga0496117_0140118_641_1417 | 231 |
| 9 | 3300031251 | Ga0265327_10000748 | Ga0265327_100007482 | 233 |
| 10 | 3300039447 | Ga0436361_0505235 | Ga0436361_0505235_83_871 | 237 |
| 11 | 3300046559 | Ga0495667_0168974 | Ga0495667_0168974_674_1390 | 238 |
| 12 | 3300026121 | Ga0207683_10553342 | Ga0207683_105533421 | 240 |
| 13 | 3300006051 | Ga0075364_10259654 | Ga0075364_102596542 | 242 |
| 14 | 3300050491 | nmdc:mga00v17_268834_c1 | nmdc:mga00v17_268834_c1_223_1023 | 242 |
| 15 | 3300039447 | Ga0436361_1071097 | Ga0436361_1071097_26_772 | 248 |
| 16 | 3300046529 | Ga0495652_0263865 | Ga0495652_0263865_10_762 | 250 |
| 17 | 3300048914 | Ga0496111_0192000 | Ga0496111_0192000_538_1296 | 252 |
| 18 | 3300053084 | Ga0495595_0167424 | Ga0495595_0167424_305_1072 | 253 |
| 19 | 3300053157 | Ga0500624_001268 | Ga0500624_001268_2922_3722 | 255 |
| 20 | 3300005456 | Ga0070678_100619204 | Ga0070678_1006192041 | 256 |
| 21 | 3300046455 | Ga0495603_0110295 | Ga0495603_0110295_13_783 | 256 |
| 22 | 3300046506 | Ga0495583_0139118 | Ga0495583_0139118_227_997 | 256 |
| 23 | 3300046557 | Ga0495622_0101008 | Ga0495622_0101008_531_1301 | 256 |
| 24 | 3300053079 | Ga0500610_0140088 | Ga0500610_0140088_437_1207 | 256 |
| 25 | 3300025295 | Ga0209564_1000747 | Ga0209564_100074717 | 257 |
| 26 | 3300046524 | Ga0495648_0031577 | Ga0495648_0031577_2684_3457 | 257 |
| 27 | 3300046536 | Ga0495587_0352838 | Ga0495587_0352838_23_802 | 257 |
| 28 | 3300046543 | Ga0495645_0222402 | Ga0495645_0222402_16_789 | 257 |
| 29 | 3300046660 | Ga0495625_0052701 | Ga0495625_0052701_18_791 | 257 |
| 30 | 3300048088 | Ga0495602_0216727 | Ga0495602_0216727_651_1424 | 257 |
| 31 | 3300049582 | Ga0501048_0563429 | Ga0501048_0563429_31_804 | 257 |
| 32 | 3300049583 | Ga0501067_0262947 | Ga0501067_0262947_16_789 | 257 |
| 33 | 3300049824 | Ga0501045_0303263 | Ga0501045_0303263_394_1167 | 257 |
| 34 | iso_pu_bacteria | 2738543013 | 2739249992 | 259 |
| 35 | iso_pu_bacteria | 2928115317 | 2928119443 | 259 |
| 36 | 3300050494 | nmdc:mga06z11_121540_c1 | nmdc:mga06z11_121540_c1_532_1368 | 261 |
| 37 | iso_pu_bacteria | 3003665799 | 3003667949 | 262 |
| 38 | 3300037853 | Ga0436364_0278082 | Ga0436364_0278082_66_899 | 263 |
| 39 | 3300048929 | Ga0496126_0251864 | Ga0496126_0251864_510_1301 | 263 |
| 40 | iso_pu_bacteria | 2513237101 | 2513696940 | 263 |
| 41 | iso_pu_bacteria | 2545555834 | 2545676146 | 263 |
| 42 | iso_pu_bacteria | 2643221733 | 2644732030 | 263 |
| 43 | iso_pu_bacteria | 2721755755 | 2723846389 | 263 |
| 44 | iso_pu_bacteria | 2791355199 | 2793076953 | 263 |
| 45 | iso_pu_bacteria | 2874604998 | 2874610645 | 263 |
| 46 | iso_pu_bacteria | 2876808645 | 2876811885 | 263 |
| 47 | iso_pu_bacteria | 2879110137 | 2879118713 | 263 |
| 48 | iso_pu_bacteria | 2889033259 | 2889039101 | 263 |
| 49 | iso_pu_bacteria | 2917699015 | 2917699095 | 263 |
| 50 | iso_pu_bacteria | 2922361189 | 2922362199 | 263 |
| 51 | iso_pu_bacteria | 2922386360 | 2922388046 | 263 |
| 52 | iso_pu_bacteria | 641522639 | 641645577 | 263 |
| 53 | iso_pu_bacteria | 643348564 | 643599486 | 263 |
| 54 | iso_pu_bacteria | 8006964411 | 8006964770 | 263 |
| 55 | iso_pu_bacteria | 8006984368 | 8006991834 | 263 |
| 56 | iso_pu_bacteria | 8006994254 | 8006995509 | 263 |
| 57 | iso_pu_bacteria | 8056673599 | 8056676441 | 263 |
| 58 | 3300005327 | Ga0070658_10062248 | Ga0070658_100622482 | 264 |
| 59 | 3300005336 | Ga0070680_100003412 | Ga0070680_10000341212 | 264 |
| 60 | 3300005339 | Ga0070660_100346964 | Ga0070660_1003469642 | 264 |
| 61 | 3300005458 | Ga0070681_10008629 | Ga0070681_100086293 | 264 |
| 62 | 3300005471 | Ga0070698_100424004 | Ga0070698_1004240042 | 264 |
| 63 | 3300005530 | Ga0070679_100111220 | Ga0070679_1001112203 | 264 |
| 64 | 3300009093 | Ga0105240_10088949 | Ga0105240_100889492 | 264 |
| 65 | 3300009093 | Ga0105240_10094736 | Ga0105240_100947362 | 264 |
| 66 | 3300009545 | Ga0105237_10034753 | Ga0105237_100347534 | 264 |
| 67 | 3300009553 | Ga0105249_10517832 | Ga0105249_105178322 | 264 |
| 68 | 3300013105 | Ga0157369_10656488 | Ga0157369_106564882 | 264 |
| 69 | 3300014497 | Ga0182008_10054337 | Ga0182008_100543372 | 264 |
| 70 | 3300020070 | Ga0206356_10877305 | Ga0206356_108773051 | 264 |
| 71 | 3300025909 | Ga0207705_10248728 | Ga0207705_102487281 | 264 |
| 72 | 3300025919 | Ga0207657_10174839 | Ga0207657_101748392 | 264 |
| 73 | 3300031241 | Ga0265325_10000522 | Ga0265325_1000052213 | 264 |
| 74 | 3300031548 | Ga0307408_100545175 | Ga0307408_1005451751 | 264 |
| 75 | 3300031995 | Ga0307409_100675185 | Ga0307409_1006751851 | 264 |
| 76 | 3300032002 | Ga0307416_100653719 | Ga0307416_1006537192 | 264 |
| 77 | 3300035725 | Ga0373947_0074470 | Ga0373947_0074470_301_1098 | 264 |
| 78 | 3300037068 | Ga0373925_0049358 | Ga0373925_0049358_1303_2100 | 264 |
| 79 | 3300039437 | Ga0436365_1002842 | Ga0436365_1002842_212_1006 | 264 |
| 80 | 3300039447 | Ga0436361_0127548 | Ga0436361_0127548_1974_2768 | 264 |
| 81 | 3300041408 | Ga0439453_0004295 | Ga0439453_0004295_550_1344 | 264 |
| 82 | 3300046475 | Ga0495639_0026219 | Ga0495639_0026219_821_1615 | 264 |
| 83 | 3300046516 | Ga0495628_0315233 | Ga0495628_0315233_348_1142 | 264 |
| 84 | 3300046809 | Ga0495600_0311750 | Ga0495600_0311750_136_930 | 264 |
| 85 | 3300047315 | Ga0495581_0030786 | Ga0495581_0030786_587_1381 | 264 |
| 86 | 3300048906 | Ga0496103_0335066 | Ga0496103_0335066_32_826 | 264 |
| 87 | 3300048907 | Ga0496104_0006339 | Ga0496104_0006339_5305_6099 | 264 |
| 88 | 3300048907 | Ga0496104_0012053 | Ga0496104_0012053_1647_2441 | 264 |
| 89 | 3300048911 | Ga0496108_0005887 | Ga0496108_0005887_941_1735 | 264 |
| 90 | 3300048911 | Ga0496108_0315679 | Ga0496108_0315679_403_1203 | 264 |
| 91 | 3300048912 | Ga0496109_0001670 | Ga0496109_0001670_4643_5437 | 264 |
| 92 | 3300048913 | Ga0496110_0007781 | Ga0496110_0007781_6699_7493 | 264 |
| 93 | 3300048913 | Ga0496110_0138070 | Ga0496110_0138070_1359_2153 | 264 |
| 94 | 3300048914 | Ga0496111_0029482 | Ga0496111_0029482_1390_2184 | 264 |
| 95 | 3300048916 | Ga0496113_0007323 | Ga0496113_0007323_2106_2900 | 264 |
| 96 | 3300048917 | Ga0496114_0133272 | Ga0496114_0133272_82_876 | 264 |
| 97 | 3300048918 | Ga0496115_0024734 | Ga0496115_0024734_1392_2186 | 264 |
| 98 | 3300048918 | Ga0496115_0035229 | Ga0496115_0035229_3104_3898 | 264 |
| 99 | 3300049568 | Ga0501031_0022335 | Ga0501031_0022335_131_925 | 264 |
| 100 | 3300049569 | Ga0501032_0003451 | Ga0501032_0003451_2620_3414 | 264 |
| 101 | 3300049571 | Ga0501034_0046490 | Ga0501034_0046490_2526_3320 | 264 |
| 102 | 3300049572 | Ga0501036_0029963 | Ga0501036_0029963_1408_2202 | 264 |
| 103 | 3300049573 | Ga0501037_0023815 | Ga0501037_0023815_3142_3936 | 264 |
| 104 | 3300049574 | Ga0501038_0081738 | Ga0501038_0081738_639_1433 | 264 |
| 105 | 3300049578 | Ga0501042_0107526 | Ga0501042_0107526_142_936 | 264 |
| 106 | 3300049579 | Ga0501043_0025639 | Ga0501043_0025639_2192_2986 | 264 |
| 107 | 3300049579 | Ga0501043_0129290 | Ga0501043_0129290_737_1531 | 264 |
| 108 | 3300049580 | Ga0501046_0012002 | Ga0501046_0012002_15_809 | 264 |
| 109 | 3300049581 | Ga0501047_0012471 | Ga0501047_0012471_26_820 | 264 |
| 110 | 3300049581 | Ga0501047_0151516 | Ga0501047_0151516_17_811 | 264 |
| 111 | 3300049582 | Ga0501048_0007052 | Ga0501048_0007052_6594_7388 | 264 |
| 112 | 3300049582 | Ga0501048_0238464 | Ga0501048_0238464_113_907 | 264 |
| 113 | 3300049583 | Ga0501067_0021140 | Ga0501067_0021140_1285_2079 | 264 |
| 114 | 3300049584 | Ga0501068_0002854 | Ga0501068_0002854_1829_2623 | 264 |
| 115 | 3300049585 | Ga0501069_0004828 | Ga0501069_0004828_5719_6513 | 264 |
| 116 | 3300049586 | Ga0501070_0052986 | Ga0501070_0052986_639_1433 | 264 |
| 117 | 3300049586 | Ga0501070_0161193 | Ga0501070_0161193_936_1733 | 264 |
| 118 | 3300049587 | Ga0501071_0009558 | Ga0501071_0009558_5218_6012 | 264 |
| 119 | 3300049588 | Ga0501072_0129771 | Ga0501072_0129771_899_1693 | 264 |
| 120 | 3300049589 | Ga0501073_0002836 | Ga0501073_0002836_6135_6929 | 264 |
| 121 | 3300049590 | Ga0501074_0003222 | Ga0501074_0003222_6884_7678 | 264 |
| 122 | 3300049592 | Ga0501076_0110407 | Ga0501076_0110407_1044_1838 | 264 |
| 123 | 3300049741 | Ga0501079_0241222 | Ga0501079_0241222_279_1073 | 264 |
| 124 | 3300049742 | Ga0501080_0005263 | Ga0501080_0005263_5827_6621 | 264 |
| 125 | 3300049742 | Ga0501080_0265493 | Ga0501080_0265493_645_1439 | 264 |
| 126 | 3300049743 | Ga0501081_0281475 | Ga0501081_0281475_62_856 | 264 |
| 127 | 3300049744 | Ga0501083_0122647 | Ga0501083_0122647_804_1598 | 264 |
| 128 | 3300049744 | Ga0501083_0136697 | Ga0501083_0136697_279_1073 | 264 |
| 129 | 3300049822 | Ga0501035_0019565 | Ga0501035_0019565_3196_3990 | 264 |
| 130 | 3300049823 | Ga0501044_0000782 | Ga0501044_0000782_31228_32022 | 264 |
| 131 | 3300049823 | Ga0501044_0029859 | Ga0501044_0029859_2291_3085 | 264 |
| 132 | 3300049824 | Ga0501045_0007572 | Ga0501045_0007572_5654_6448 | 264 |
| 133 | 3300054114 | Ga0501084_0136438 | Ga0501084_0136438_368_1162 | 264 |
| 134 | iso_pu_bacteria | 2507262055 | 2507510033 | 264 |
| 135 | iso_pu_bacteria | 2508501009 | 2508544035 | 264 |
| 136 | iso_pu_bacteria | 2508501042 | 2508698030 | 264 |
| 137 | iso_pu_bacteria | 2508501128 | 2509147561 | 264 |
| 138 | iso_pu_bacteria | 2511231028 | 2511397584 | 264 |
| 139 | iso_pu_bacteria | 2513237092 | 2513628194 | 264 |
| 140 | iso_pu_bacteria | 2513237094 | 2513643565 | 264 |
| 141 | iso_pu_bacteria | 2513237095 | 2513648999 | 264 |
| 142 | iso_pu_bacteria | 2513237096 | 2513660086 | 264 |
| 143 | iso_pu_bacteria | 2513237098 | 2513676424 | 264 |
| 144 | iso_pu_bacteria | 2513237102 | 2513702569 | 264 |
| 145 | iso_pu_bacteria | 2513237104 | 2513720548 | 264 |
| 146 | iso_pu_bacteria | 2513237137 | 2513858263 | 264 |
| 147 | iso_pu_bacteria | 2513237139 | 2513878116 | 264 |
| 148 | iso_pu_bacteria | 2513237141 | 2513893302 | 264 |
| 149 | iso_pu_bacteria | 2513237145 | 2513922104 | 264 |
| 150 | iso_pu_bacteria | 2513237161 | 2514012588 | 264 |
| 151 | iso_pu_bacteria | 2515154112 | 2515629462 | 264 |
| 152 | iso_pu_bacteria | 2517093001 | 2517107530 | 264 |
| 153 | iso_pu_bacteria | 2517572143 | 2517893848 | 264 |
| 154 | iso_pu_bacteria | 2524023205 | 2524439064 | 264 |
| 155 | iso_pu_bacteria | 2524023210 | 2524469465 | 264 |
| 156 | iso_pu_bacteria | 2524023228 | 2524537802 | 264 |
| 157 | iso_pu_bacteria | 2528768022 | 2528849605 | 264 |
| 158 | iso_pu_bacteria | 2602042107 | 2603861052 | 264 |
| 159 | iso_pu_bacteria | 2617270735 | 2617353072 | 264 |
| 160 | iso_pu_bacteria | 2617270741 | 2617378957 | 264 |
| 161 | iso_pu_bacteria | 2643221651 | 2644287818 | 264 |
| 162 | iso_pu_bacteria | 2643221736 | 2644743223 | 264 |
| 163 | iso_pu_bacteria | 2667528175 | 2671122844 | 264 |
| 164 | iso_pu_bacteria | 2744054633 | 2745078823 | 264 |
| 165 | iso_pu_bacteria | 2791355196 | 2793059986 | 264 |
| 166 | iso_pu_bacteria | 2791355197 | 2793072518 | 264 |
| 167 | iso_pu_bacteria | 2802429603 | 2805920077 | 264 |
| 168 | iso_pu_bacteria | 2816332527 | 2818241597 | 264 |
| 169 | iso_pu_bacteria | 2824600985 | 2824605600 | 264 |
| 170 | iso_pu_bacteria | 2824609381 | 2824609850 | 264 |
| 171 | iso_pu_bacteria | 2824617872 | 2824626448 | 264 |
| 172 | iso_pu_bacteria | 2824626560 | 2824633852 | 264 |
| 173 | iso_pu_bacteria | 2824635225 | 2824643784 | 264 |
| 174 | iso_pu_bacteria | 2824644064 | 2824652503 | 264 |
| 175 | iso_pu_bacteria | 2824653114 | 2824655751 | 264 |
| 176 | iso_pu_bacteria | 2824661429 | 2824669460 | 264 |
| 177 | iso_pu_bacteria | 2824671348 | 2824674208 | 264 |
| 178 | iso_pu_bacteria | 2824679649 | 2824686171 | 264 |
| 179 | iso_pu_bacteria | 2824687955 | 2824693012 | 264 |
| 180 | iso_pu_bacteria | 2824696289 | 2824698895 | 264 |
| 181 | iso_pu_bacteria | 2824704595 | 2824713468 | 264 |
| 182 | iso_pu_bacteria | 2824714736 | 2824722991 | 264 |
| 183 | iso_pu_bacteria | 2824723954 | 2824732419 | 264 |
| 184 | iso_pu_bacteria | 2824732956 | 2824740491 | 264 |
| 185 | iso_pu_bacteria | 2824746037 | 2824752352 | 264 |
| 186 | iso_pu_bacteria | 2824753945 | 2824758025 | 264 |
| 187 | iso_pu_bacteria | 2824763712 | 2824766163 | 264 |
| 188 | iso_pu_bacteria | 2824773399 | 2824781046 | 264 |
| 189 | iso_pu_bacteria | 2838122688 | 2838127525 | 264 |
| 190 | iso_pu_bacteria | 2841760612 | 2841761258 | 264 |
| 191 | iso_pu_bacteria | 2841941048 | 2841941522 | 264 |
| 192 | iso_pu_bacteria | 2841949485 | 2841952462 | 264 |
| 193 | iso_pu_bacteria | 2841957949 | 2841959480 | 264 |
| 194 | iso_pu_bacteria | 2841966195 | 2841967665 | 264 |
| 195 | iso_pu_bacteria | 2841974524 | 2841982168 | 264 |
| 196 | iso_pu_bacteria | 2841983080 | 2841986486 | 264 |
| 197 | iso_pu_bacteria | 2842038055 | 2842038248 | 264 |
| 198 | iso_pu_bacteria | 2842045827 | 2842048806 | 264 |
| 199 | iso_pu_bacteria | 2844104063 | 2844104283 | 264 |
| 200 | iso_pu_bacteria | 2844315083 | 2844317729 | 264 |
| 201 | iso_pu_bacteria | 2847930680 | 2847934519 | 264 |
| 202 | iso_pu_bacteria | 2847939898 | 2847945127 | 264 |
| 203 | iso_pu_bacteria | 2849076700 | 2849080692 | 264 |
| 204 | iso_pu_bacteria | 2851246043 | 2851247271 | 264 |
| 205 | iso_pu_bacteria | 2857509624 | 2857509947 | 264 |
| 206 | iso_pu_bacteria | 2857524615 | 2857528818 | 264 |
| 207 | iso_pu_bacteria | 2874590934 | 2874596779 | 264 |
| 208 | iso_pu_bacteria | 2874612657 | 2874618218 | 264 |
| 209 | iso_pu_bacteria | 2874620515 | 2874623206 | 264 |
| 210 | iso_pu_bacteria | 2874628541 | 2874636045 | 264 |
| 211 | iso_pu_bacteria | 2874645413 | 2874652991 | 264 |
| 212 | iso_pu_bacteria | 2876761206 | 2876766697 | 264 |
| 213 | iso_pu_bacteria | 2876771140 | 2876776925 | 264 |
| 214 | iso_pu_bacteria | 2876818435 | 2876825325 | 264 |
| 215 | iso_pu_bacteria | 2879074833 | 2879081062 | 264 |
| 216 | iso_pu_bacteria | 2879083081 | 2879089711 | 264 |
| 217 | iso_pu_bacteria | 2879099564 | 2879107726 | 264 |
| 218 | iso_pu_bacteria | 2879127579 | 2879130800 | 264 |
| 219 | iso_pu_bacteria | 2879142872 | 2879147611 | 264 |
| 220 | iso_pu_bacteria | 2881364244 | 2881365681 | 264 |
| 221 | iso_pu_bacteria | 2881665667 | 2881671718 | 264 |
| 222 | iso_pu_bacteria | 2885366525 | 2885368929 | 264 |
| 223 | iso_pu_bacteria | 2885383462 | 2885387426 | 264 |
| 224 | iso_pu_bacteria | 2885409591 | 2885414266 | 264 |
| 225 | iso_pu_bacteria | 2888378607 | 2888382456 | 264 |
| 226 | iso_pu_bacteria | 2888388044 | 2888388233 | 264 |
| 227 | iso_pu_bacteria | 2888419890 | 2888423038 | 264 |
| 228 | iso_pu_bacteria | 2893066018 | 2893069015 | 264 |
| 229 | iso_pu_bacteria | 2903727486 | 2903735409 | 264 |
| 230 | iso_pu_bacteria | 2903748898 | 2903751859 | 264 |
| 231 | iso_pu_bacteria | 2903768456 | 2903776324 | 264 |
| 232 | iso_pu_bacteria | 2904666416 | 2904670026 | 264 |
| 233 | iso_pu_bacteria | 2904690495 | 2904691630 | 264 |
| 234 | iso_pu_bacteria | 2904699407 | 2904700761 | 264 |
| 235 | iso_pu_bacteria | 2904711408 | 2904718485 | 264 |
| 236 | iso_pu_bacteria | 2906602504 | 2906608672 | 264 |
| 237 | iso_pu_bacteria | 2906610324 | 2906610729 | 264 |
| 238 | iso_pu_bacteria | 2906626472 | 2906633540 | 264 |
| 239 | iso_pu_bacteria | 2906635258 | 2906635893 | 264 |
| 240 | iso_pu_bacteria | 2906643746 | 2906649914 | 264 |
| 241 | iso_pu_bacteria | 2906660503 | 2906664011 | 264 |
| 242 | iso_pu_bacteria | 2908739725 | 2908744248 | 264 |
| 243 | iso_pu_bacteria | 2908756301 | 2908761838 | 264 |
| 244 | iso_pu_bacteria | 2908775508 | 2908778705 | 264 |
| 245 | iso_pu_bacteria | 2919073203 | 2919079244 | 264 |
| 246 | iso_pu_bacteria | 2922368715 | 2922375508 | 264 |
| 247 | iso_pu_bacteria | 2922393267 | 2922394979 | 264 |
| 248 | iso_pu_bacteria | 2922425934 | 2922428589 | 264 |
| 249 | iso_pu_bacteria | 2929615660 | 2929616244 | 264 |
| 250 | iso_pu_bacteria | 2929624759 | 2929624988 | 264 |
| 251 | iso_pu_bacteria | 2932784394 | 2932787091 | 264 |
| 252 | iso_pu_bacteria | 2932794094 | 2932797316 | 264 |
| 253 | iso_pu_bacteria | 2932801729 | 2932804799 | 264 |
| 254 | iso_pu_bacteria | 2932809354 | 2932811285 | 264 |
| 255 | iso_pu_bacteria | 2932818245 | 2932819842 | 264 |
| 256 | iso_pu_bacteria | 2932828146 | 2932832319 | 264 |
| 257 | iso_pu_bacteria | 2933577622 | 2933578472 | 264 |
| 258 | iso_pu_bacteria | 2935608549 | 2935611062 | 264 |
| 259 | iso_pu_bacteria | 2935616580 | 2935619031 | 264 |
| 260 | iso_pu_bacteria | 2935630451 | 2935634566 | 264 |
| 261 | iso_pu_bacteria | 2935638405 | 2935643152 | 264 |
| 262 | iso_pu_bacteria | 2935648319 | 2935648498 | 264 |
| 263 | iso_pu_bacteria | 2935656913 | 2935657514 | 264 |
| 264 | iso_pu_bacteria | 2935665750 | 2935669778 | 264 |
| 265 | iso_pu_bacteria | 2935675223 | 2935677082 | 264 |
| 266 | iso_pu_bacteria | 2935684952 | 2935693119 | 264 |
| 267 | iso_pu_bacteria | 2935694250 | 2935695388 | 264 |
| 268 | iso_pu_bacteria | 2935703347 | 2935709503 | 264 |
| 269 | iso_pu_bacteria | 2935713505 | 2935719727 | 264 |
| 270 | iso_pu_bacteria | 2935722832 | 2935729506 | 264 |
| 271 | iso_pu_bacteria | 2935732158 | 2935739610 | 264 |
| 272 | iso_pu_bacteria | 2935741537 | 2935748648 | 264 |
| 273 | iso_pu_bacteria | 2935750917 | 2935756765 | 264 |
| 274 | iso_pu_bacteria | 2935760218 | 2935761249 | 264 |
| 275 | iso_pu_bacteria | 2935769743 | 2935771476 | 264 |
| 276 | iso_pu_bacteria | 2935777560 | 2935779166 | 264 |
| 277 | iso_pu_bacteria | 2935785616 | 2935788369 | 264 |
| 278 | iso_pu_bacteria | 2935793552 | 2935800906 | 264 |
| 279 | iso_pu_bacteria | 2935801545 | 2935807298 | 264 |
| 280 | iso_pu_bacteria | 2935810662 | 2935812437 | 264 |
| 281 | iso_pu_bacteria | 2935819856 | 2935820547 | 264 |
| 282 | iso_pu_bacteria | 2935827899 | 2935832704 | 264 |
| 283 | iso_pu_bacteria | 2935837841 | 2935839217 | 264 |
| 284 | iso_pu_bacteria | 2935847175 | 2935849444 | 264 |
| 285 | iso_pu_bacteria | 2935855204 | 2935857396 | 264 |
| 286 | iso_pu_bacteria | 2935864058 | 2935864925 | 264 |
| 287 | iso_pu_bacteria | 2935873716 | 2935876703 | 264 |
| 288 | iso_pu_bacteria | 2935883170 | 2935884965 | 264 |
| 289 | iso_pu_bacteria | 2935908558 | 2935911782 | 264 |
| 290 | iso_pu_bacteria | 2935916978 | 2935919437 | 264 |
| 291 | iso_pu_bacteria | 2935926038 | 2935928811 | 264 |
| 292 | iso_pu_bacteria | 2935934488 | 2935938456 | 264 |
| 293 | iso_pu_bacteria | 2935942939 | 2935945652 | 264 |
| 294 | iso_pu_bacteria | 2935951376 | 2935954741 | 264 |
| 295 | iso_pu_bacteria | 2935959822 | 2935963339 | 264 |
| 296 | iso_pu_bacteria | 2935967501 | 2935970628 | 264 |
| 297 | iso_pu_bacteria | 2935975950 | 2935979135 | 264 |
| 298 | iso_pu_bacteria | 2935984226 | 2935987854 | 264 |
| 299 | iso_pu_bacteria | 2935992306 | 2935999683 | 264 |
| 300 | iso_pu_bacteria | 2936002035 | 2936008296 | 264 |
| 301 | iso_pu_bacteria | 2936011229 | 2936011408 | 264 |
| 302 | iso_pu_bacteria | 2936019824 | 2936020003 | 264 |
| 303 | iso_pu_bacteria | 2936028420 | 2936028599 | 264 |
| 304 | iso_pu_bacteria | 2936037263 | 2936039030 | 264 |
| 305 | iso_pu_bacteria | 2936046547 | 2936046726 | 264 |
| 306 | iso_pu_bacteria | 2936055302 | 2936063109 | 264 |
| 307 | iso_pu_bacteria | 2940556831 | 2940562679 | 264 |
| 308 | iso_pu_bacteria | 2941507105 | 2941509052 | 264 |
| 309 | iso_pu_bacteria | 2941515067 | 2941516881 | 264 |
| 310 | iso_pu_bacteria | 2941523033 | 2941525024 | 264 |
| 311 | iso_pu_bacteria | 2941531003 | 2941536369 | 264 |
| 312 | iso_pu_bacteria | 2941538514 | 2941539907 | 264 |
| 313 | iso_pu_bacteria | 3005474847 | 3005478718 | 264 |
| 314 | iso_pu_bacteria | 3005483717 | 3005487929 | 264 |
| 315 | iso_pu_bacteria | 3005506211 | 3005508749 | 264 |
| 316 | iso_pu_bacteria | 3005587118 | 3005589437 | 264 |
| 317 | iso_pu_bacteria | 3005594810 | 3005597463 | 264 |
| 318 | iso_pu_bacteria | 3005710791 | 3005713495 | 264 |
| 319 | iso_pu_bacteria | 3005718088 | 3005720901 | 264 |
| 320 | iso_pu_bacteria | 8006926726 | 8006930226 | 264 |
| 321 | iso_pu_bacteria | 8006933436 | 8006942628 | 264 |
| 322 | iso_pu_bacteria | 8006973647 | 8006982356 | 264 |
| 323 | iso_pu_bacteria | 8016511872 | 8016515115 | 264 |
| 324 | iso_pu_bacteria | 8016522445 | 8016522905 | 264 |
| 325 | iso_pu_bacteria | 8016530956 | 8016536368 | 264 |
| 326 | iso_pu_bacteria | 8016539877 | 8016540643 | 264 |
| 327 | iso_pu_bacteria | 8016548790 | 8016552600 | 264 |
| 328 | iso_pu_bacteria | 8016566248 | 8016574728 | 264 |
| 329 | iso_pu_bacteria | 8016575299 | 8016578802 | 264 |
| 330 | iso_pu_bacteria | 8016583857 | 8016590843 | 264 |
| 331 | iso_pu_bacteria | 8016595262 | 8016598843 | 264 |
| 332 | iso_pu_bacteria | 8016603502 | 8016612237 | 264 |
| 333 | iso_pu_bacteria | 8016622563 | 8016628389 | 264 |
| 334 | iso_pu_bacteria | 8016630954 | 8016632588 | 264 |
| 335 | iso_pu_bacteria | 8017057580 | 8017061338 | 264 |
| 336 | iso_pu_bacteria | 8019530166 | 8019536087 | 264 |
| 337 | iso_pu_bacteria | 8019538911 | 8019543384 | 264 |
| 338 | iso_pu_bacteria | 8019547302 | 8019555470 | 264 |
| 339 | iso_pu_bacteria | 8019555841 | 8019558400 | 264 |
| 340 | iso_pu_bacteria | 8019565922 | 8019566897 | 264 |
| 341 | iso_pu_bacteria | 8019576017 | 8019580807 | 264 |
| 342 | iso_pu_bacteria | 8019597564 | 8019602795 | 264 |
| 343 | iso_pu_bacteria | 8019608314 | 8019615759 | 264 |
| 344 | iso_pu_bacteria | 8019619141 | 8019626506 | 264 |
| 345 | iso_pu_bacteria | 8019629233 | 8019635982 | 264 |
| 346 | iso_pu_bacteria | 8019638758 | 8019643682 | 264 |
| 347 | iso_pu_bacteria | 8019648815 | 8019656462 | 264 |
| 348 | iso_pu_bacteria | 8019659431 | 8019663749 | 264 |
| 349 | iso_pu_bacteria | 8019678201 | 8019682746 | 264 |
| 350 | iso_pu_bacteria | 8055742211 | 8055747891 | 264 |
| 351 | iso_pu_bacteria | 8056681323 | 8056687981 | 264 |
| 352 | iso_pu_bacteria | 8056689827 | 8056695894 | 264 |
| 353 | iso_pu_bacteria | 8056967851 | 8056969529 | 264 |
| 354 | iso_pu_bacteria | 8057529695 | 8057530559 | 264 |
| 355 | 3300003215 | JGI25153J46596_10000451 | JGI25153J46596_1000045114 | 265 |
| 356 | 3300005471 | Ga0070698_100570947 | Ga0070698_1005709472 | 265 |
| 357 | 3300006042 | Ga0075368_10006624 | Ga0075368_100066245 | 265 |
| 358 | 3300006048 | Ga0075363_100215185 | Ga0075363_1002151852 | 265 |
| 359 | 3300006177 | Ga0075362_10033955 | Ga0075362_100339553 | 265 |
| 360 | 3300006178 | Ga0075367_10126538 | Ga0075367_101265382 | 265 |
| 361 | 3300006195 | Ga0075366_10169989 | Ga0075366_101699891 | 265 |
| 362 | 3300006353 | Ga0075370_10132548 | Ga0075370_101325482 | 265 |
| 363 | 3300006881 | Ga0068865_100458786 | Ga0068865_1004587861 | 265 |
| 364 | 3300007788 | Ga0099795_10000907 | Ga0099795_100009074 | 265 |
| 365 | 3300010159 | Ga0099796_10046241 | Ga0099796_100462411 | 265 |
| 366 | 3300025297 | Ga0209758_1000128 | Ga0209758_1000128202 | 265 |
| 367 | 3300035692 | Ga0373935_0206967 | Ga0373935_0206967_151_948 | 265 |
| 368 | 3300037068 | Ga0373925_0212796 | Ga0373925_0212796_584_1381 | 265 |
| 369 | 3300046460 | Ga0495638_0217480 | Ga0495638_0217480_29_853 | 265 |
| 370 | 3300048924 | Ga0496121_0059090 | Ga0496121_0059090_1229_2029 | 265 |
| 371 | 3300048925 | Ga0496122_0001252 | Ga0496122_0001252_25116_25919 | 265 |
| 372 | 3300048926 | Ga0496123_0001065 | Ga0496123_0001065_15591_16394 | 265 |
| 373 | 3300049589 | Ga0501073_0178908 | Ga0501073_0178908_368_1165 | 265 |
| 374 | 3300050489 | nmdc:mga03683_21738_c1 | nmdc:mga03683_21738_c1_486_1283 | 265 |
| 375 | 3300050492 | nmdc:mga0yw44_226711_c1 | nmdc:mga0yw44_226711_c1_302_1099 | 265 |
| 376 | 3300050494 | nmdc:mga06z11_83128_c1 | nmdc:mga06z11_83128_c1_102_899 | 265 |
| 377 | 3300050512 | nmdc:mga0n895_402230_c1 | nmdc:mga0n895_402230_c1_574_1371 | 265 |
| 378 | 3300050513 | nmdc:mga0rr50_77127_c1 | nmdc:mga0rr50_77127_c1_946_1743 | 265 |
| 379 | 3300053153 | Ga0500616_0025276 | Ga0500616_0025276_210_1007 | 265 |
| 380 | 3300053730 | Ga0500645_004477 | Ga0500645_004477_2260_3063 | 265 |
| 381 | 3300005364 | Ga0070673_100333760 | Ga0070673_1003337602 | 266 |
| 382 | 3300005445 | Ga0070708_100415282 | Ga0070708_1004152822 | 266 |
| 383 | 3300005937 | Ga0081455_10000678 | Ga0081455_1000067835 | 266 |
| 384 | 3300006048 | Ga0075363_100240243 | Ga0075363_1002402432 | 266 |
| 385 | 3300006051 | Ga0075364_10012727 | Ga0075364_100127275 | 266 |
| 386 | 3300006177 | Ga0075362_10006576 | Ga0075362_100065764 | 266 |
| 387 | 3300006871 | Ga0075434_100185974 | Ga0075434_1001859744 | 266 |
| 388 | 3300009101 | Ga0105247_10524524 | Ga0105247_105245241 | 266 |
| 389 | 3300009545 | Ga0105237_10022559 | Ga0105237_100225594 | 266 |
| 390 | 3300025914 | Ga0207671_10093493 | Ga0207671_100934932 | 266 |
| 391 | 3300031903 | Ga0307407_10292490 | Ga0307407_102924902 | 266 |
| 392 | 3300037068 | Ga0373925_0048657 | Ga0373925_0048657_1240_2040 | 266 |
| 393 | 3300037853 | Ga0436364_0901535 | Ga0436364_0901535_770_1570 | 266 |
| 394 | 3300047320 | Ga0495672_0092787 | Ga0495672_0092787_620_1420 | 266 |
| 395 | 3300048903 | Ga0496100_0248372 | Ga0496100_0248372_301_1101 | 266 |
| 396 | 3300048904 | Ga0496101_0150986 | Ga0496101_0150986_832_1632 | 266 |
| 397 | 3300048908 | Ga0496105_0092579 | Ga0496105_0092579_1106_1906 | 266 |
| 398 | 3300048917 | Ga0496114_0046385 | Ga0496114_0046385_201_1001 | 266 |
| 399 | 3300050489 | nmdc:mga03683_10072_c1 | nmdc:mga03683_10072_c1_116_916 | 266 |
| 400 | 3300050490 | nmdc:mga03n38_278947_c1 | nmdc:mga03n38_278947_c1_11_811 | 266 |
| 401 | 3300050490 | nmdc:mga03n38_8390_c1 | nmdc:mga03n38_8390_c1_2364_3164 | 266 |
| 402 | 3300050491 | nmdc:mga00v17_11368_c1 | nmdc:mga00v17_11368_c1_1486_2286 | 266 |
| 403 | 3300050492 | nmdc:mga0yw44_1312_c2 | nmdc:mga0yw44_1312_c2_1088_1888 | 266 |
| 404 | 3300050496 | nmdc:mga07m45_15739_c1 | nmdc:mga07m45_15739_c1_1570_2370 | 266 |
| 405 | 3300050510 | nmdc:mga06r32_420333_c1 | nmdc:mga06r32_420333_c1_29_829 | 266 |
| 406 | 3300050510 | nmdc:mga06r32_70105_c1 | nmdc:mga06r32_70105_c1_1649_2449 | 266 |
| 407 | 3300050512 | nmdc:mga0n895_123090_c1 | nmdc:mga0n895_123090_c1_492_1292 | 266 |
| 408 | 3300053139 | Ga0500568_0002331 | Ga0500568_0002331_5349_6149 | 266 |
| 409 | 3300053139 | Ga0500568_0058119 | Ga0500568_0058119_497_1297 | 266 |
| 410 | 3300002070 | JGI24750J21931_1002415 | JGI24750J21931_10024152 | 267 |
| 411 | 3300003215 | JGI25153J46596_10001314 | JGI25153J46596_1000131416 | 267 |
| 412 | 3300003322 | rootL2_10089904 | rootL2_100899042 | 267 |
| 413 | 3300003659 | JGI25404J52841_10015895 | JGI25404J52841_100158952 | 267 |
| 414 | 3300003771 | Ga0055526_1000667 | Ga0055526_100066726 | 267 |
| 415 | 3300003775 | Ga0055524_1000035 | Ga0055524_1000035170 | 267 |
| 416 | 3300005289 | Ga0065704_10171119 | Ga0065704_101711192 | 267 |
| 417 | 3300005331 | Ga0070670_100299103 | Ga0070670_1002991032 | 267 |
| 418 | 3300005334 | Ga0068869_100086296 | Ga0068869_1000862963 | 267 |
| 419 | 3300005334 | Ga0068869_100233447 | Ga0068869_1002334472 | 267 |
| 420 | 3300005337 | Ga0070682_100174397 | Ga0070682_1001743972 | 267 |
| 421 | 3300005339 | Ga0070660_100238149 | Ga0070660_1002381491 | 267 |
| 422 | 3300005340 | Ga0070689_100491701 | Ga0070689_1004917012 | 267 |
| 423 | 3300005344 | Ga0070661_100141923 | Ga0070661_1001419232 | 267 |
| 424 | 3300005347 | Ga0070668_100147708 | Ga0070668_1001477083 | 267 |
| 425 | 3300005353 | Ga0070669_100061596 | Ga0070669_1000615962 | 267 |
| 426 | 3300005356 | Ga0070674_100129168 | Ga0070674_1001291681 | 267 |
| 427 | 3300005365 | Ga0070688_100167771 | Ga0070688_1001677711 | 267 |
| 428 | 3300005366 | Ga0070659_100195065 | Ga0070659_1001950651 | 267 |
| 429 | 3300005436 | Ga0070713_100452735 | Ga0070713_1004527351 | 267 |
| 430 | 3300005437 | Ga0070710_10365363 | Ga0070710_103653631 | 267 |
| 431 | 3300005441 | Ga0070700_100141293 | Ga0070700_1001412932 | 267 |
| 432 | 3300005455 | Ga0070663_100048048 | Ga0070663_1000480482 | 267 |
| 433 | 3300005455 | Ga0070663_100068566 | Ga0070663_1000685663 | 267 |
| 434 | 3300005455 | Ga0070663_100130667 | Ga0070663_1001306672 | 267 |
| 435 | 3300005455 | Ga0070663_100204539 | Ga0070663_1002045392 | 267 |
| 436 | 3300005455 | Ga0070663_100321443 | Ga0070663_1003214431 | 267 |
| 437 | 3300005456 | Ga0070678_100241529 | Ga0070678_1002415292 | 267 |
| 438 | 3300005457 | Ga0070662_100054481 | Ga0070662_1000544814 | 267 |
| 439 | 3300005457 | Ga0070662_100203127 | Ga0070662_1002031272 | 267 |
| 440 | 3300005458 | Ga0070681_10515695 | Ga0070681_105156951 | 267 |
| 441 | 3300005459 | Ga0068867_100172363 | Ga0068867_1001723632 | 267 |
| 442 | 3300005471 | Ga0070698_100159943 | Ga0070698_1001599433 | 267 |
| 443 | 3300005530 | Ga0070679_100182713 | Ga0070679_1001827132 | 267 |
| 444 | 3300005535 | Ga0070684_100265824 | Ga0070684_1002658241 | 267 |
| 445 | 3300005535 | Ga0070684_100521141 | Ga0070684_1005211411 | 267 |
| 446 | 3300005543 | Ga0070672_100309074 | Ga0070672_1003090741 | 267 |
| 447 | 3300005544 | Ga0070686_100057152 | Ga0070686_1000571523 | 267 |
| 448 | 3300005547 | Ga0070693_100182205 | Ga0070693_1001822051 | 267 |
| 449 | 3300005548 | Ga0070665_100056786 | Ga0070665_1000567864 | 267 |
| 450 | 3300005548 | Ga0070665_100116399 | Ga0070665_1001163992 | 267 |
| 451 | 3300005548 | Ga0070665_100162325 | Ga0070665_1001623252 | 267 |
| 452 | 3300005548 | Ga0070665_100230416 | Ga0070665_1002304162 | 267 |
| 453 | 3300005549 | Ga0070704_100277690 | Ga0070704_1002776901 | 267 |
| 454 | 3300005563 | Ga0068855_100150826 | Ga0068855_1001508263 | 267 |
| 455 | 3300005564 | Ga0070664_100312398 | Ga0070664_1003123982 | 267 |
| 456 | 3300005577 | Ga0068857_100368470 | Ga0068857_1003684702 | 267 |
| 457 | 3300005578 | Ga0068854_100021673 | Ga0068854_1000216732 | 267 |
| 458 | 3300005614 | Ga0068856_100001174 | Ga0068856_1000011746 | 267 |
| 459 | 3300005614 | Ga0068856_100114989 | Ga0068856_1001149894 | 267 |
| 460 | 3300005615 | Ga0070702_100102198 | Ga0070702_1001021981 | 267 |
| 461 | 3300005617 | Ga0068859_100810597 | Ga0068859_1008105971 | 267 |
| 462 | 3300005618 | Ga0068864_100012541 | Ga0068864_1000125415 | 267 |
| 463 | 3300005618 | Ga0068864_100162229 | Ga0068864_1001622293 | 267 |
| 464 | 3300005718 | Ga0068866_10071071 | Ga0068866_100710712 | 267 |
| 465 | 3300005719 | Ga0068861_100231480 | Ga0068861_1002314802 | 267 |
| 466 | 3300005841 | Ga0068863_100479862 | Ga0068863_1004798622 | 267 |
| 467 | 3300005842 | Ga0068858_100075435 | Ga0068858_1000754353 | 267 |
| 468 | 3300005842 | Ga0068858_100263891 | Ga0068858_1002638912 | 267 |
| 469 | 3300005842 | Ga0068858_100829660 | Ga0068858_1008296601 | 267 |
| 470 | 3300005843 | Ga0068860_100332997 | Ga0068860_1003329972 | 267 |
| 471 | 3300005844 | Ga0068862_100131593 | Ga0068862_1001315933 | 267 |
| 472 | 3300005844 | Ga0068862_100412615 | Ga0068862_1004126152 | 267 |
| 473 | 3300005937 | Ga0081455_10025536 | Ga0081455_100255362 | 267 |
| 474 | 3300005937 | Ga0081455_10116694 | Ga0081455_101166943 | 267 |
| 475 | 3300005981 | Ga0081538_10104598 | Ga0081538_101045982 | 267 |
| 476 | 3300005981 | Ga0081538_10179576 | Ga0081538_101795761 | 267 |
| 477 | 3300005983 | Ga0081540_1001756 | Ga0081540_100175610 | 267 |
| 478 | 3300005983 | Ga0081540_1006848 | Ga0081540_10068488 | 267 |
| 479 | 3300005983 | Ga0081540_1007290 | Ga0081540_10072903 | 267 |
| 480 | 3300005983 | Ga0081540_1010587 | Ga0081540_10105872 | 267 |
| 481 | 3300005983 | Ga0081540_1034455 | Ga0081540_10344553 | 267 |
| 482 | 3300005985 | Ga0081539_10011589 | Ga0081539_100115896 | 267 |
| 483 | 3300006042 | Ga0075368_10045649 | Ga0075368_100456493 | 267 |
| 484 | 3300006042 | Ga0075368_10060099 | Ga0075368_100600992 | 267 |
| 485 | 3300006048 | Ga0075363_100292228 | Ga0075363_1002922281 | 267 |
| 486 | 3300006051 | Ga0075364_10008620 | Ga0075364_100086203 | 267 |
| 487 | 3300006186 | Ga0075369_10074078 | Ga0075369_100740781 | 267 |
| 488 | 3300006880 | Ga0075429_100083790 | Ga0075429_1000837902 | 267 |
| 489 | 3300006881 | Ga0068865_100380731 | Ga0068865_1003807312 | 267 |
| 490 | 3300006931 | Ga0097620_100810557 | Ga0097620_1008105572 | 267 |
| 491 | 3300007076 | Ga0075435_100184445 | Ga0075435_1001844452 | 267 |
| 492 | 3300009092 | Ga0105250_10052817 | Ga0105250_100528172 | 267 |
| 493 | 3300009093 | Ga0105240_10204687 | Ga0105240_102046873 | 267 |
| 494 | 3300009098 | Ga0105245_10242078 | Ga0105245_102420782 | 267 |
| 495 | 3300009098 | Ga0105245_10324387 | Ga0105245_103243872 | 267 |
| 496 | 3300009147 | Ga0114129_10563371 | Ga0114129_105633712 | 267 |
| 497 | 3300009148 | Ga0105243_10366575 | Ga0105243_103665752 | 267 |
| 498 | 3300009177 | Ga0105248_10340195 | Ga0105248_103401951 | 267 |
| 499 | 3300009177 | Ga0105248_10843798 | Ga0105248_108437982 | 267 |
| 500 | 3300009545 | Ga0105237_10021242 | Ga0105237_100212422 | 267 |
| 501 | 3300009545 | Ga0105237_10134999 | Ga0105237_101349992 | 267 |
| 502 | 3300009553 | Ga0105249_10089260 | Ga0105249_100892603 | 267 |
| 503 | 3300009553 | Ga0105249_10241487 | Ga0105249_102414871 | 267 |
| 504 | 3300010375 | Ga0105239_10067521 | Ga0105239_100675213 | 267 |
| 505 | 3300010375 | Ga0105239_10076462 | Ga0105239_100764624 | 267 |
| 506 | 3300013104 | Ga0157370_10167235 | Ga0157370_101672351 | 267 |
| 507 | 3300013105 | Ga0157369_10017344 | Ga0157369_100173449 | 267 |
| 508 | 3300013105 | Ga0157369_10029148 | Ga0157369_100291489 | 267 |
| 509 | 3300013250 | Ga0171462_1022 | Ga0171462_102241 | 267 |
| 510 | 3300013296 | Ga0157374_10026672 | Ga0157374_100266723 | 267 |
| 511 | 3300013297 | Ga0157378_10102074 | Ga0157378_101020743 | 267 |
| 512 | 3300013297 | Ga0157378_10789490 | Ga0157378_107894901 | 267 |
| 513 | 3300013306 | Ga0163162_10221407 | Ga0163162_102214072 | 267 |
| 514 | 3300013308 | Ga0157375_10033676 | Ga0157375_100336763 | 267 |
| 515 | 3300014325 | Ga0163163_10138625 | Ga0163163_101386253 | 267 |
| 516 | 3300014326 | Ga0157380_10080678 | Ga0157380_100806782 | 267 |
| 517 | 3300014968 | Ga0157379_10126823 | Ga0157379_101268232 | 267 |
| 518 | 3300022467 | Ga0224712_10031926 | Ga0224712_100319262 | 267 |
| 519 | 3300025273 | Ga0209673_1021249 | Ga0209673_10212492 | 267 |
| 520 | 3300025291 | Ga0209675_1001135 | Ga0209675_10011358 | 267 |
| 521 | 3300025295 | Ga0209564_1000049 | Ga0209564_1000049114 | 267 |
| 522 | 3300025297 | Ga0209758_1003961 | Ga0209758_100396112 | 267 |
| 523 | 3300025299 | Ga0209256_1000014 | Ga0209256_1000014525 | 267 |
| 524 | 3300025315 | Ga0207697_10041595 | Ga0207697_100415951 | 267 |
| 525 | 3300025711 | Ga0207696_1041429 | Ga0207696_10414291 | 267 |
| 526 | 3300025885 | Ga0207653_10019287 | Ga0207653_100192871 | 267 |
| 527 | 3300025900 | Ga0207710_10031699 | Ga0207710_100316993 | 267 |
| 528 | 3300025901 | Ga0207688_10105611 | Ga0207688_101056112 | 267 |
| 529 | 3300025903 | Ga0207680_10361987 | Ga0207680_103619871 | 267 |
| 530 | 3300025907 | Ga0207645_10043430 | Ga0207645_100434304 | 267 |
| 531 | 3300025910 | Ga0207684_10342671 | Ga0207684_103426711 | 267 |
| 532 | 3300025912 | Ga0207707_10163811 | Ga0207707_101638112 | 267 |
| 533 | 3300025913 | Ga0207695_10448321 | Ga0207695_104483212 | 267 |
| 534 | 3300025919 | Ga0207657_10179944 | Ga0207657_101799442 | 267 |
| 535 | 3300025920 | Ga0207649_10432275 | Ga0207649_104322751 | 267 |
| 536 | 3300025921 | Ga0207652_10156850 | Ga0207652_101568502 | 267 |
| 537 | 3300025921 | Ga0207652_10466364 | Ga0207652_104663641 | 267 |
| 538 | 3300025921 | Ga0207652_10563702 | Ga0207652_105637022 | 267 |
| 539 | 3300025923 | Ga0207681_10456414 | Ga0207681_104564142 | 267 |
| 540 | 3300025924 | Ga0207694_10043180 | Ga0207694_100431803 | 267 |
| 541 | 3300025925 | Ga0207650_10591916 | Ga0207650_105919161 | 267 |
| 542 | 3300025926 | Ga0207659_10353767 | Ga0207659_103537672 | 267 |
| 543 | 3300025928 | Ga0207700_10220213 | Ga0207700_102202132 | 267 |
| 544 | 3300025928 | Ga0207700_10332026 | Ga0207700_103320262 | 267 |
| 545 | 3300025931 | Ga0207644_10129401 | Ga0207644_101294012 | 267 |
| 546 | 3300025931 | Ga0207644_10261314 | Ga0207644_102613142 | 267 |
| 547 | 3300025932 | Ga0207690_10177974 | Ga0207690_101779742 | 267 |
| 548 | 3300025933 | Ga0207706_10157516 | Ga0207706_101575162 | 267 |
| 549 | 3300025933 | Ga0207706_10198008 | Ga0207706_101980082 | 267 |
| 550 | 3300025935 | Ga0207709_10015434 | Ga0207709_100154343 | 267 |
| 551 | 3300025936 | Ga0207670_10496035 | Ga0207670_104960351 | 267 |
| 552 | 3300025938 | Ga0207704_10041836 | Ga0207704_100418362 | 267 |
| 553 | 3300025940 | Ga0207691_10281127 | Ga0207691_102811272 | 267 |
| 554 | 3300025941 | Ga0207711_10315053 | Ga0207711_103150532 | 267 |
| 555 | 3300025941 | Ga0207711_10405465 | Ga0207711_104054652 | 267 |
| 556 | 3300025942 | Ga0207689_10236505 | Ga0207689_102365052 | 267 |
| 557 | 3300025942 | Ga0207689_10297516 | Ga0207689_102975162 | 267 |
| 558 | 3300025942 | Ga0207689_10308384 | Ga0207689_103083842 | 267 |
| 559 | 3300025945 | Ga0207679_10242062 | Ga0207679_102420622 | 267 |
| 560 | 3300025945 | Ga0207679_10261362 | Ga0207679_102613622 | 267 |
| 561 | 3300025949 | Ga0207667_10085254 | Ga0207667_100852542 | 267 |
| 562 | 3300025949 | Ga0207667_10186518 | Ga0207667_101865182 | 267 |
| 563 | 3300025960 | Ga0207651_10382584 | Ga0207651_103825842 | 267 |
| 564 | 3300025972 | Ga0207668_10022803 | Ga0207668_100228034 | 267 |
| 565 | 3300025972 | Ga0207668_10330808 | Ga0207668_103308082 | 267 |
| 566 | 3300025981 | Ga0207640_10076070 | Ga0207640_100760702 | 267 |
| 567 | 3300026023 | Ga0207677_10111859 | Ga0207677_101118593 | 267 |
| 568 | 3300026023 | Ga0207677_10148197 | Ga0207677_101481972 | 267 |
| 569 | 3300026035 | Ga0207703_10510029 | Ga0207703_105100291 | 267 |
| 570 | 3300026035 | Ga0207703_10614475 | Ga0207703_106144751 | 267 |
| 571 | 3300026067 | Ga0207678_10032223 | Ga0207678_100322234 | 267 |
| 572 | 3300026067 | Ga0207678_10093586 | Ga0207678_100935863 | 267 |
| 573 | 3300026067 | Ga0207678_10098593 | Ga0207678_100985932 | 267 |
| 574 | 3300026067 | Ga0207678_10446167 | Ga0207678_104461672 | 267 |
| 575 | 3300026067 | Ga0207678_10515079 | Ga0207678_105150792 | 267 |
| 576 | 3300026075 | Ga0207708_10035182 | Ga0207708_100351824 | 267 |
| 577 | 3300026075 | Ga0207708_10249397 | Ga0207708_102493972 | 267 |
| 578 | 3300026078 | Ga0207702_10000403 | Ga0207702_1000040332 | 267 |
| 579 | 3300026078 | Ga0207702_10317682 | Ga0207702_103176822 | 267 |
| 580 | 3300026078 | Ga0207702_10337291 | Ga0207702_103372912 | 267 |
| 581 | 3300026089 | Ga0207648_10085170 | Ga0207648_100851702 | 267 |
| 582 | 3300026089 | Ga0207648_10306793 | Ga0207648_103067931 | 267 |
| 583 | 3300026095 | Ga0207676_10032218 | Ga0207676_100322184 | 267 |
| 584 | 3300026095 | Ga0207676_10626629 | Ga0207676_106266292 | 267 |
| 585 | 3300026118 | Ga0207675_100069147 | Ga0207675_1000691473 | 267 |
| 586 | 3300026121 | Ga0207683_10007983 | Ga0207683_1000798310 | 267 |
| 587 | 3300026121 | Ga0207683_10134588 | Ga0207683_101345883 | 267 |
| 588 | 3300026121 | Ga0207683_10173418 | Ga0207683_101734183 | 267 |
| 589 | 3300028379 | Ga0268266_10000827 | Ga0268266_1000082730 | 267 |
| 590 | 3300028379 | Ga0268266_10034469 | Ga0268266_100344692 | 267 |
| 591 | 3300028379 | Ga0268266_10191297 | Ga0268266_101912972 | 267 |
| 592 | 3300028379 | Ga0268266_10193349 | Ga0268266_101933492 | 267 |
| 593 | 3300028380 | Ga0268265_10087622 | Ga0268265_100876222 | 267 |
| 594 | 3300028380 | Ga0268265_10425050 | Ga0268265_104250502 | 267 |
| 595 | 3300028381 | Ga0268264_10168042 | Ga0268264_101680422 | 267 |
| 596 | 3300028381 | Ga0268264_10348258 | Ga0268264_103482582 | 267 |
| 597 | 3300028786 | Ga0307517_10001329 | Ga0307517_1000132935 | 267 |
| 598 | 3300028794 | Ga0307515_10024241 | Ga0307515_100242414 | 267 |
| 599 | 3300028794 | Ga0307515_10261866 | Ga0307515_102618662 | 267 |
| 600 | 3300031456 | Ga0307513_10123243 | Ga0307513_101232433 | 267 |
| 601 | 3300031548 | Ga0307408_100243159 | Ga0307408_1002431592 | 267 |
| 602 | 3300031616 | Ga0307508_10112649 | Ga0307508_101126492 | 267 |
| 603 | 3300031711 | Ga0265314_10059109 | Ga0265314_100591092 | 267 |
| 604 | 3300031730 | Ga0307516_10146305 | Ga0307516_101463052 | 267 |
| 605 | 3300031901 | Ga0307406_10276044 | Ga0307406_102760442 | 267 |
| 606 | 3300031903 | Ga0307407_10308938 | Ga0307407_103089381 | 267 |
| 607 | 3300031903 | Ga0307407_10433353 | Ga0307407_104333531 | 267 |
| 608 | 3300031911 | Ga0307412_10406351 | Ga0307412_104063511 | 267 |
| 609 | 3300031995 | Ga0307409_100021265 | Ga0307409_1000212652 | 267 |
| 610 | 3300032002 | Ga0307416_100127917 | Ga0307416_1001279173 | 267 |
| 611 | 3300032002 | Ga0307416_100487924 | Ga0307416_1004879242 | 267 |
| 612 | 3300032004 | Ga0307414_10265283 | Ga0307414_102652831 | 267 |
| 613 | 3300032005 | Ga0307411_10529524 | Ga0307411_105295241 | 267 |
| 614 | 3300032005 | Ga0307411_10708050 | Ga0307411_107080501 | 267 |
| 615 | 3300033180 | Ga0307510_10023218 | Ga0307510_100232186 | 267 |
| 616 | 3300035117 | Ga0373953_0018376 | Ga0373953_0018376_1082_1885 | 267 |
| 617 | 3300035118 | Ga0373954_0032251 | Ga0373954_0032251_1587_2390 | 267 |
| 618 | 3300035119 | Ga0373956_0013116 | Ga0373956_0013116_1869_2672 | 267 |
| 619 | 3300035120 | Ga0373957_0004250 | Ga0373957_0004250_2866_3669 | 267 |
| 620 | 3300035170 | Ga0373943_0012935 | Ga0373943_0012935_2181_2984 | 267 |
| 621 | 3300035691 | Ga0373931_0222613 | Ga0373931_0222613_61_864 | 267 |
| 622 | 3300035692 | Ga0373935_0022533 | Ga0373935_0022533_1510_2313 | 267 |
| 623 | 3300035724 | Ga0373933_0002641 | Ga0373933_0002641_3416_4219 | 267 |
| 624 | 3300035725 | Ga0373947_0040313 | Ga0373947_0040313_185_988 | 267 |
| 625 | 3300037418 | Ga0395900_0100239 | Ga0395900_0100239_905_1708 | 267 |
| 626 | 3300037466 | Ga0395898_0108847 | Ga0395898_0108847_581_1384 | 267 |
| 627 | 3300037466 | Ga0395898_0120355 | Ga0395898_0120355_1050_1853 | 267 |
| 628 | 3300038443 | Ga0395901_0794120 | Ga0395901_0794120_116_919 | 267 |
| 629 | 3300039450 | Ga0436363_0665307 | Ga0436363_0665307_120_923 | 267 |
| 630 | 3300039450 | Ga0436363_0892697 | Ga0436363_0892697_55_858 | 267 |
| 631 | 3300041413 | Ga0439465_0038204 | Ga0439465_0038204_131_934 | 267 |
| 632 | 3300044684 | Ga0466966_0102112 | Ga0466966_0102112_467_1270 | 267 |
| 633 | 3300044694 | Ga0466963_0023333 | Ga0466963_0023333_375_1178 | 267 |
| 634 | 3300044694 | Ga0466963_0081815 | Ga0466963_0081815_30_833 | 267 |
| 635 | 3300045836 | Ga0466958_0020966 | Ga0466958_0020966_1202_2005 | 267 |
| 636 | 3300045976 | Ga0466967_0411364 | Ga0466967_0411364_447_1250 | 267 |
| 637 | 3300046452 | Ga0495617_035336 | Ga0495617_035336_662_1465 | 267 |
| 638 | 3300046452 | Ga0495617_085269 | Ga0495617_085269_197_1000 | 267 |
| 639 | 3300046454 | Ga0495592_0006102 | Ga0495592_0006102_5817_6620 | 267 |
| 640 | 3300046459 | Ga0495629_0074959 | Ga0495629_0074959_908_1711 | 267 |
| 641 | 3300046461 | Ga0495641_0094556 | Ga0495641_0094556_499_1302 | 267 |
| 642 | 3300046462 | Ga0495651_0002077 | Ga0495651_0002077_9956_10759 | 267 |
| 643 | 3300046462 | Ga0495651_0116962 | Ga0495651_0116962_1124_1927 | 267 |
| 644 | 3300046473 | Ga0495582_0043278 | Ga0495582_0043278_1163_1966 | 267 |
| 645 | 3300046473 | Ga0495582_0138572 | Ga0495582_0138572_474_1277 | 267 |
| 646 | 3300046474 | Ga0495605_0123195 | Ga0495605_0123195_316_1119 | 267 |
| 647 | 3300046492 | Ga0495585_0106124 | Ga0495585_0106124_264_1067 | 267 |
| 648 | 3300046492 | Ga0495585_0156045 | Ga0495585_0156045_181_984 | 267 |
| 649 | 3300046492 | Ga0495585_0184888 | Ga0495585_0184888_38_841 | 267 |
| 650 | 3300046499 | Ga0495594_0091672 | Ga0495594_0091672_642_1445 | 267 |
| 651 | 3300046511 | Ga0495608_0002695 | Ga0495608_0002695_11721_12524 | 267 |
| 652 | 3300046512 | Ga0495610_0099619 | Ga0495610_0099619_379_1182 | 267 |
| 653 | 3300046516 | Ga0495628_0002883 | Ga0495628_0002883_4915_5718 | 267 |
| 654 | 3300046517 | Ga0495630_0133199 | Ga0495630_0133199_38_841 | 267 |
| 655 | 3300046518 | Ga0495631_0023589 | Ga0495631_0023589_153_956 | 267 |
| 656 | 3300046519 | Ga0495632_0117776 | Ga0495632_0117776_310_1113 | 267 |
| 657 | 3300046522 | Ga0495643_0115681 | Ga0495643_0115681_167_970 | 267 |
| 658 | 3300046526 | Ga0495666_0130988 | Ga0495666_0130988_292_1095 | 267 |
| 659 | 3300046529 | Ga0495652_0083645 | Ga0495652_0083645_55_858 | 267 |
| 660 | 3300046533 | Ga0495640_0003045 | Ga0495640_0003045_4820_5623 | 267 |
| 661 | 3300046536 | Ga0495587_0007554 | Ga0495587_0007554_5588_6391 | 267 |
| 662 | 3300046538 | Ga0495609_0065443 | Ga0495609_0065443_677_1480 | 267 |
| 663 | 3300046543 | Ga0495645_0060457 | Ga0495645_0060457_665_1468 | 267 |
| 664 | 3300046559 | Ga0495667_0000140 | Ga0495667_0000140_33787_34590 | 267 |
| 665 | 3300046615 | Ga0495656_0059206 | Ga0495656_0059206_608_1411 | 267 |
| 666 | 3300046615 | Ga0495656_0062247 | Ga0495656_0062247_775_1578 | 267 |
| 667 | 3300046615 | Ga0495656_0068262 | Ga0495656_0068262_462_1265 | 267 |
| 668 | 3300046616 | Ga0495668_0068180 | Ga0495668_0068180_475_1278 | 267 |
| 669 | 3300046642 | Ga0495634_0004122 | Ga0495634_0004122_6025_6828 | 267 |
| 670 | 3300046648 | Ga0495611_0048653 | Ga0495611_0048653_569_1372 | 267 |
| 671 | 3300046663 | Ga0495635_0014805 | Ga0495635_0014805_66_869 | 267 |
| 672 | 3300046664 | Ga0495659_0049160 | Ga0495659_0049160_339_1142 | 267 |
| 673 | 3300046664 | Ga0495659_0072969 | Ga0495659_0072969_32_835 | 267 |
| 674 | 3300046678 | Ga0495599_0019518 | Ga0495599_0019518_2184_2987 | 267 |
| 675 | 3300046679 | Ga0495623_0005061 | Ga0495623_0005061_3251_4054 | 267 |
| 676 | 3300046680 | Ga0495646_0008201 | Ga0495646_0008201_4598_5401 | 267 |
| 677 | 3300046691 | Ga0495670_0179861 | Ga0495670_0179861_237_1040 | 267 |
| 678 | 3300046809 | Ga0495600_0001507 | Ga0495600_0001507_6125_6928 | 267 |
| 679 | 3300047315 | Ga0495581_0136040 | Ga0495581_0136040_553_1356 | 267 |
| 680 | 3300047317 | Ga0495604_0001087 | Ga0495604_0001087_11668_12471 | 267 |
| 681 | 3300047320 | Ga0495672_0030134 | Ga0495672_0030134_1679_2482 | 267 |
| 682 | 3300047320 | Ga0495672_0244629 | Ga0495672_0244629_29_832 | 267 |
| 683 | 3300047321 | Ga0495676_0186419 | Ga0495676_0186419_66_869 | 267 |
| 684 | 3300047323 | Ga0495683_0075200 | Ga0495683_0075200_723_1526 | 267 |
| 685 | 3300047323 | Ga0495683_0163074 | Ga0495683_0163074_190_993 | 267 |
| 686 | 3300047444 | Ga0495675_0001246 | Ga0495675_0001246_4117_4920 | 267 |
| 687 | 3300047471 | Ga0495684_0132344 | Ga0495684_0132344_246_1049 | 267 |
| 688 | 3300047472 | Ga0495686_0228039 | Ga0495686_0228039_47_850 | 267 |
| 689 | 3300047673 | Ga0495593_0020602 | Ga0495593_0020602_465_1268 | 267 |
| 690 | 3300048903 | Ga0496100_0164111 | Ga0496100_0164111_92_895 | 267 |
| 691 | 3300048904 | Ga0496101_0009451 | Ga0496101_0009451_4617_5420 | 267 |
| 692 | 3300048904 | Ga0496101_0239824 | Ga0496101_0239824_386_1189 | 267 |
| 693 | 3300048905 | Ga0496102_0283199 | Ga0496102_0283199_599_1402 | 267 |
| 694 | 3300048905 | Ga0496102_0372167 | Ga0496102_0372167_339_1142 | 267 |
| 695 | 3300048906 | Ga0496103_0019927 | Ga0496103_0019927_2912_3715 | 267 |
| 696 | 3300048907 | Ga0496104_0008465 | Ga0496104_0008465_5606_6409 | 267 |
| 697 | 3300048908 | Ga0496105_0027210 | Ga0496105_0027210_417_1220 | 267 |
| 698 | 3300048908 | Ga0496105_0211701 | Ga0496105_0211701_291_1094 | 267 |
| 699 | 3300048909 | Ga0496106_0066200 | Ga0496106_0066200_1846_2649 | 267 |
| 700 | 3300048909 | Ga0496106_0128967 | Ga0496106_0128967_989_1792 | 267 |
| 701 | 3300048909 | Ga0496106_0329650 | Ga0496106_0329650_357_1160 | 267 |
| 702 | 3300048910 | Ga0496107_0070931 | Ga0496107_0070931_1323_2126 | 267 |
| 703 | 3300048910 | Ga0496107_0136798 | Ga0496107_0136798_793_1596 | 267 |
| 704 | 3300048911 | Ga0496108_0242174 | Ga0496108_0242174_440_1243 | 267 |
| 705 | 3300048912 | Ga0496109_0041185 | Ga0496109_0041185_3110_3913 | 267 |
| 706 | 3300048912 | Ga0496109_0305290 | Ga0496109_0305290_23_826 | 267 |
| 707 | 3300048913 | Ga0496110_0005923 | Ga0496110_0005923_510_1313 | 267 |
| 708 | 3300048914 | Ga0496111_0366367 | Ga0496111_0366367_195_998 | 267 |
| 709 | 3300048915 | Ga0496112_0433061 | Ga0496112_0433061_375_1178 | 267 |
| 710 | 3300048916 | Ga0496113_0227005 | Ga0496113_0227005_493_1296 | 267 |
| 711 | 3300048916 | Ga0496113_0291562 | Ga0496113_0291562_316_1119 | 267 |
| 712 | 3300048917 | Ga0496114_0136972 | Ga0496114_0136972_488_1291 | 267 |
| 713 | 3300048918 | Ga0496115_0027014 | Ga0496115_0027014_2860_3663 | 267 |
| 714 | 3300048918 | Ga0496115_0049691 | Ga0496115_0049691_503_1306 | 267 |
| 715 | 3300048922 | Ga0496119_0096594 | Ga0496119_0096594_684_1487 | 267 |
| 716 | 3300048924 | Ga0496121_0096352 | Ga0496121_0096352_1424_2227 | 267 |
| 717 | 3300048924 | Ga0496121_0249023 | Ga0496121_0249023_34_837 | 267 |
| 718 | 3300048924 | Ga0496121_0291522 | Ga0496121_0291522_170_973 | 267 |
| 719 | 3300048927 | Ga0496124_0135253 | Ga0496124_0135253_329_1132 | 267 |
| 720 | 3300048929 | Ga0496126_0002727 | Ga0496126_0002727_3720_4523 | 267 |
| 721 | 3300048929 | Ga0496126_0108664 | Ga0496126_0108664_1152_1955 | 267 |
| 722 | 3300048929 | Ga0496126_0280382 | Ga0496126_0280382_157_960 | 267 |
| 723 | 3300048929 | Ga0496126_0383393 | Ga0496126_0383393_157_960 | 267 |
| 724 | 3300048929 | Ga0496126_0590146 | Ga0496126_0590146_57_860 | 267 |
| 725 | 3300049459 | Ga0495678_081381 | Ga0495678_081381_293_1096 | 267 |
| 726 | 3300049572 | Ga0501036_0124937 | Ga0501036_0124937_1205_2008 | 267 |
| 727 | 3300049577 | Ga0501041_0107888 | Ga0501041_0107888_94_897 | 267 |
| 728 | 3300049585 | Ga0501069_0050013 | Ga0501069_0050013_1111_1914 | 267 |
| 729 | 3300050490 | nmdc:mga03n38_1460_c1 | nmdc:mga03n38_1460_c1_5948_6751 | 267 |
| 730 | 3300050492 | nmdc:mga0yw44_12608_c1 | nmdc:mga0yw44_12608_c1_2776_3579 | 267 |
| 731 | 3300050492 | nmdc:mga0yw44_213541_c1 | nmdc:mga0yw44_213541_c1_348_1151 | 267 |
| 732 | 3300050493 | nmdc:mga0k408_170790_c1 | nmdc:mga0k408_170790_c1_461_1264 | 267 |
| 733 | 3300050496 | nmdc:mga07m45_87674_c1 | nmdc:mga07m45_87674_c1_552_1355 | 267 |
| 734 | 3300050507 | nmdc:mga05p37_195042_c1 | nmdc:mga05p37_195042_c1_224_1027 | 267 |
| 735 | 3300050512 | nmdc:mga0n895_351408_c1 | nmdc:mga0n895_351408_c1_335_1138 | 267 |
| 736 | 3300050514 | nmdc:mga08x19_102384_c1 | nmdc:mga08x19_102384_c1_47_850 | 267 |
| 737 | 3300050515 | nmdc:mga0a205_552580_c1 | nmdc:mga0a205_552580_c1_137_940 | 267 |
| 738 | 3300053077 | Ga0495601_0010057 | Ga0495601_0010057_62_865 | 267 |
| 739 | 3300053077 | Ga0495601_0176564 | Ga0495601_0176564_263_1066 | 267 |
| 740 | 3300053078 | Ga0495612_0000375 | Ga0495612_0000375_7299_8102 | 267 |
| 741 | 3300053085 | Ga0495619_0045692 | Ga0495619_0045692_495_1355 | 267 |
| 742 | 3300053087 | Ga0500643_016934 | Ga0500643_016934_1624_2427 | 267 |
| 743 | 3300053094 | Ga0500566_0006182 | Ga0500566_0006182_923_1726 | 267 |
| 744 | 3300053096 | Ga0500641_0061325 | Ga0500641_0061325_212_1015 | 267 |
| 745 | 3300053108 | Ga0500562_045720 | Ga0500562_045720_50_853 | 267 |
| 746 | 3300053119 | Ga0500595_004502 | Ga0500595_004502_3283_4086 | 267 |
| 747 | 3300053119 | Ga0500595_025194 | Ga0500595_025194_788_1591 | 267 |
| 748 | 3300053122 | Ga0500608_180527 | Ga0500608_180527_81_884 | 267 |
| 749 | 3300053123 | Ga0500614_030732 | Ga0500614_030732_330_1133 | 267 |
| 750 | 3300053153 | Ga0500616_0036047 | Ga0500616_0036047_1257_2060 | 267 |
| 751 | 3300053155 | Ga0500620_109462 | Ga0500620_109462_11_814 | 267 |
| 752 | 3300053156 | Ga0500622_0002777 | Ga0500622_0002777_82_885 | 267 |
| 753 | 3300053161 | Ga0500634_0062232 | Ga0500634_0062232_294_1097 | 267 |
| 754 | 3300053162 | Ga0500638_000418 | Ga0500638_000418_2799_3602 | 267 |
| 755 | 3300053162 | Ga0500638_105071 | Ga0500638_105071_469_1272 | 267 |
| 756 | 3300053178 | Ga0500637_0000135 | Ga0500637_0000135_14005_14808 | 267 |
| 757 | 3300055283 | Ga0500661_001607 | Ga0500661_001607_2444_3247 | 267 |
| 758 | 3300061734 | Ga0530510_0412608 | Ga0530510_0412608_28_831 | 267 |
| 759 | 3300001979 | JGI24740J21852_10005106 | JGI24740J21852_100051063 | 268 |
| 760 | 3300001990 | JGI24737J22298_10003117 | JGI24737J22298_100031174 | 268 |
| 761 | 3300003187 | JGI25151J46595_10056929 | JGI25151J46595_100569292 | 268 |
| 762 | 3300003203 | JGI25406J46586_10000101 | JGI25406J46586_1000010130 | 268 |
| 763 | 3300003215 | JGI25153J46596_10003659 | JGI25153J46596_100036591 | 268 |
| 764 | 3300003215 | JGI25153J46596_10004014 | JGI25153J46596_100040141 | 268 |
| 765 | 3300003354 | JGI25160J50197_1000504 | JGI25160J50197_10005045 | 268 |
| 766 | 3300003354 | JGI25160J50197_1017216 | JGI25160J50197_10172162 | 268 |
| 767 | 3300003794 | Ga0055531_10015335 | Ga0055531_100153354 | 268 |
| 768 | 3300005262 | Ga0065165_1000306 | Ga0065165_100030635 | 268 |
| 769 | 3300005262 | Ga0065165_1002349 | Ga0065165_10023499 | 268 |
| 770 | 3300005262 | Ga0065165_1020357 | Ga0065165_10203572 | 268 |
| 771 | 3300005262 | Ga0065165_1054102 | Ga0065165_10541021 | 268 |
| 772 | 3300005290 | Ga0065712_10240790 | Ga0065712_102407901 | 268 |
| 773 | 3300005295 | Ga0065707_10283443 | Ga0065707_102834431 | 268 |
| 774 | 3300005327 | Ga0070658_10173002 | Ga0070658_101730022 | 268 |
| 775 | 3300005327 | Ga0070658_10193839 | Ga0070658_101938393 | 268 |
| 776 | 3300005328 | Ga0070676_10100238 | Ga0070676_101002381 | 268 |
| 777 | 3300005329 | Ga0070683_100011953 | Ga0070683_1000119539 | 268 |
| 778 | 3300005331 | Ga0070670_100030128 | Ga0070670_1000301282 | 268 |
| 779 | 3300005331 | Ga0070670_100292991 | Ga0070670_1002929912 | 268 |
| 780 | 3300005333 | Ga0070677_10018814 | Ga0070677_100188142 | 268 |
| 781 | 3300005335 | Ga0070666_10112350 | Ga0070666_101123502 | 268 |
| 782 | 3300005336 | Ga0070680_100006770 | Ga0070680_1000067704 | 268 |
| 783 | 3300005336 | Ga0070680_100545413 | Ga0070680_1005454131 | 268 |
| 784 | 3300005337 | Ga0070682_100026108 | Ga0070682_1000261082 | 268 |
| 785 | 3300005339 | Ga0070660_100007738 | Ga0070660_1000077383 | 268 |
| 786 | 3300005343 | Ga0070687_100179316 | Ga0070687_1001793162 | 268 |
| 787 | 3300005344 | Ga0070661_100518765 | Ga0070661_1005187651 | 268 |
| 788 | 3300005347 | Ga0070668_100071133 | Ga0070668_1000711331 | 268 |
| 789 | 3300005354 | Ga0070675_100043504 | Ga0070675_1000435043 | 268 |
| 790 | 3300005354 | Ga0070675_100470781 | Ga0070675_1004707811 | 268 |
| 791 | 3300005355 | Ga0070671_100034075 | Ga0070671_1000340753 | 268 |
| 792 | 3300005355 | Ga0070671_100069367 | Ga0070671_1000693672 | 268 |
| 793 | 3300005356 | Ga0070674_100199981 | Ga0070674_1001999812 | 268 |
| 794 | 3300005364 | Ga0070673_100619091 | Ga0070673_1006190911 | 268 |
| 795 | 3300005365 | Ga0070688_100131714 | Ga0070688_1001317141 | 268 |
| 796 | 3300005366 | Ga0070659_100145081 | Ga0070659_1001450812 | 268 |
| 797 | 3300005367 | Ga0070667_100070329 | Ga0070667_1000703294 | 268 |
| 798 | 3300005367 | Ga0070667_100232897 | Ga0070667_1002328972 | 268 |
| 799 | 3300005434 | Ga0070709_10000431 | Ga0070709_1000043126 | 268 |
| 800 | 3300005434 | Ga0070709_10074240 | Ga0070709_100742402 | 268 |
| 801 | 3300005434 | Ga0070709_10122190 | Ga0070709_101221902 | 268 |
| 802 | 3300005435 | Ga0070714_100063453 | Ga0070714_1000634533 | 268 |
| 803 | 3300005435 | Ga0070714_100066906 | Ga0070714_1000669063 | 268 |
| 804 | 3300005435 | Ga0070714_100143656 | Ga0070714_1001436562 | 268 |
| 805 | 3300005435 | Ga0070714_100324888 | Ga0070714_1003248882 | 268 |
| 806 | 3300005435 | Ga0070714_100330228 | Ga0070714_1003302282 | 268 |
| 807 | 3300005435 | Ga0070714_100333169 | Ga0070714_1003331691 | 268 |
| 808 | 3300005436 | Ga0070713_100017738 | Ga0070713_1000177384 | 268 |
| 809 | 3300005436 | Ga0070713_100019948 | Ga0070713_1000199483 | 268 |
| 810 | 3300005436 | Ga0070713_100117707 | Ga0070713_1001177071 | 268 |
| 811 | 3300005436 | Ga0070713_100277497 | Ga0070713_1002774972 | 268 |
| 812 | 3300005437 | Ga0070710_10002535 | Ga0070710_1000253510 | 268 |
| 813 | 3300005437 | Ga0070710_10002728 | Ga0070710_100027289 | 268 |
| 814 | 3300005437 | Ga0070710_10008750 | Ga0070710_100087503 | 268 |
| 815 | 3300005437 | Ga0070710_10012830 | Ga0070710_100128302 | 268 |
| 816 | 3300005437 | Ga0070710_10172965 | Ga0070710_101729652 | 268 |
| 817 | 3300005439 | Ga0070711_100011415 | Ga0070711_1000114152 | 268 |
| 818 | 3300005439 | Ga0070711_100022339 | Ga0070711_1000223392 | 268 |
| 819 | 3300005439 | Ga0070711_100028158 | Ga0070711_1000281582 | 268 |
| 820 | 3300005439 | Ga0070711_100079765 | Ga0070711_1000797653 | 268 |
| 821 | 3300005439 | Ga0070711_100181255 | Ga0070711_1001812552 | 268 |
| 822 | 3300005439 | Ga0070711_100241900 | Ga0070711_1002419002 | 268 |
| 823 | 3300005445 | Ga0070708_100302659 | Ga0070708_1003026592 | 268 |
| 824 | 3300005455 | Ga0070663_100299024 | Ga0070663_1002990242 | 268 |
| 825 | 3300005455 | Ga0070663_100415887 | Ga0070663_1004158871 | 268 |
| 826 | 3300005455 | Ga0070663_100510562 | Ga0070663_1005105621 | 268 |
| 827 | 3300005456 | Ga0070678_100014099 | Ga0070678_1000140992 | 268 |
| 828 | 3300005457 | Ga0070662_100042264 | Ga0070662_1000422641 | 268 |
| 829 | 3300005457 | Ga0070662_100258663 | Ga0070662_1002586632 | 268 |
| 830 | 3300005457 | Ga0070662_100260946 | Ga0070662_1002609461 | 268 |
| 831 | 3300005457 | Ga0070662_100543505 | Ga0070662_1005435051 | 268 |
| 832 | 3300005458 | Ga0070681_10032089 | Ga0070681_100320895 | 268 |
| 833 | 3300005458 | Ga0070681_10043838 | Ga0070681_100438384 | 268 |
| 834 | 3300005458 | Ga0070681_10117782 | Ga0070681_101177822 | 268 |
| 835 | 3300005458 | Ga0070681_10334263 | Ga0070681_103342631 | 268 |
| 836 | 3300005467 | Ga0070706_100522136 | Ga0070706_1005221361 | 268 |
| 837 | 3300005471 | Ga0070698_100309092 | Ga0070698_1003090922 | 268 |
| 838 | 3300005530 | Ga0070679_100099489 | Ga0070679_1000994891 | 268 |
| 839 | 3300005530 | Ga0070679_100590828 | Ga0070679_1005908281 | 268 |
| 840 | 3300005535 | Ga0070684_100011508 | Ga0070684_1000115083 | 268 |
| 841 | 3300005535 | Ga0070684_100028786 | Ga0070684_1000287862 | 268 |
| 842 | 3300005539 | Ga0068853_100014459 | Ga0068853_1000144597 | 268 |
| 843 | 3300005539 | Ga0068853_100024273 | Ga0068853_1000242734 | 268 |
| 844 | 3300005539 | Ga0068853_100118118 | Ga0068853_1001181182 | 268 |
| 845 | 3300005543 | Ga0070672_100191761 | Ga0070672_1001917612 | 268 |
| 846 | 3300005543 | Ga0070672_100405772 | Ga0070672_1004057722 | 268 |
| 847 | 3300005544 | Ga0070686_100211106 | Ga0070686_1002111062 | 268 |
| 848 | 3300005547 | Ga0070693_100260830 | Ga0070693_1002608301 | 268 |
| 849 | 3300005548 | Ga0070665_100038170 | Ga0070665_1000381703 | 268 |
| 850 | 3300005548 | Ga0070665_100054191 | Ga0070665_1000541914 | 268 |
| 851 | 3300005548 | Ga0070665_100334175 | Ga0070665_1003341751 | 268 |
| 852 | 3300005549 | Ga0070704_100518595 | Ga0070704_1005185951 | 268 |
| 853 | 3300005563 | Ga0068855_100010086 | Ga0068855_10001008613 | 268 |
| 854 | 3300005563 | Ga0068855_100042976 | Ga0068855_1000429763 | 268 |
| 855 | 3300005563 | Ga0068855_100044387 | Ga0068855_1000443874 | 268 |
| 856 | 3300005563 | Ga0068855_100360150 | Ga0068855_1003601503 | 268 |
| 857 | 3300005563 | Ga0068855_100646840 | Ga0068855_1006468401 | 268 |
| 858 | 3300005577 | Ga0068857_100057644 | Ga0068857_1000576444 | 268 |
| 859 | 3300005577 | Ga0068857_100082849 | Ga0068857_1000828493 | 268 |
| 860 | 3300005577 | Ga0068857_100106763 | Ga0068857_1001067633 | 268 |
| 861 | 3300005577 | Ga0068857_100392973 | Ga0068857_1003929731 | 268 |
| 862 | 3300005578 | Ga0068854_100003033 | Ga0068854_1000030332 | 268 |
| 863 | 3300005578 | Ga0068854_100097072 | Ga0068854_1000970723 | 268 |
| 864 | 3300005614 | Ga0068856_100013112 | Ga0068856_10001311210 | 268 |
| 865 | 3300005614 | Ga0068856_100043927 | Ga0068856_1000439275 | 268 |
| 866 | 3300005614 | Ga0068856_100204031 | Ga0068856_1002040313 | 268 |
| 867 | 3300005614 | Ga0068856_100386714 | Ga0068856_1003867142 | 268 |
| 868 | 3300005614 | Ga0068856_100570697 | Ga0068856_1005706972 | 268 |
| 869 | 3300005615 | Ga0070702_100224231 | Ga0070702_1002242312 | 268 |
| 870 | 3300005616 | Ga0068852_100010566 | Ga0068852_1000105664 | 268 |
| 871 | 3300005616 | Ga0068852_100015107 | Ga0068852_1000151074 | 268 |
| 872 | 3300005616 | Ga0068852_100596518 | Ga0068852_1005965181 | 268 |
| 873 | 3300005617 | Ga0068859_100340691 | Ga0068859_1003406911 | 268 |
| 874 | 3300005618 | Ga0068864_100042677 | Ga0068864_1000426772 | 268 |
| 875 | 3300005618 | Ga0068864_100469065 | Ga0068864_1004690651 | 268 |
| 876 | 3300005834 | Ga0068851_10077559 | Ga0068851_100775592 | 268 |
| 877 | 3300005834 | Ga0068851_10229199 | Ga0068851_102291991 | 268 |
| 878 | 3300005840 | Ga0068870_10050577 | Ga0068870_100505771 | 268 |
| 879 | 3300005841 | Ga0068863_100215897 | Ga0068863_1002158972 | 268 |
| 880 | 3300005841 | Ga0068863_100454207 | Ga0068863_1004542072 | 268 |
| 881 | 3300005842 | Ga0068858_100443971 | Ga0068858_1004439711 | 268 |
| 882 | 3300005843 | Ga0068860_100000240 | Ga0068860_10000024059 | 268 |
| 883 | 3300005843 | Ga0068860_100376457 | Ga0068860_1003764572 | 268 |
| 884 | 3300005937 | Ga0081455_10019291 | Ga0081455_100192913 | 268 |
| 885 | 3300005937 | Ga0081455_10046347 | Ga0081455_100463473 | 268 |
| 886 | 3300005983 | Ga0081540_1003232 | Ga0081540_100323213 | 268 |
| 887 | 3300005983 | Ga0081540_1007411 | Ga0081540_10074116 | 268 |
| 888 | 3300005983 | Ga0081540_1008929 | Ga0081540_10089293 | 268 |
| 889 | 3300005983 | Ga0081540_1029265 | Ga0081540_10292654 | 268 |
| 890 | 3300005983 | Ga0081540_1071304 | Ga0081540_10713041 | 268 |
| 891 | 3300005985 | Ga0081539_10000008 | Ga0081539_10000008519 | 268 |
| 892 | 3300005985 | Ga0081539_10001983 | Ga0081539_1000198323 | 268 |
| 893 | 3300005985 | Ga0081539_10002340 | Ga0081539_100023405 | 268 |
| 894 | 3300005985 | Ga0081539_10064104 | Ga0081539_100641043 | 268 |
| 895 | 3300006028 | Ga0070717_10040025 | Ga0070717_100400252 | 268 |
| 896 | 3300006028 | Ga0070717_10127304 | Ga0070717_101273043 | 268 |
| 897 | 3300006028 | Ga0070717_10163639 | Ga0070717_101636392 | 268 |
| 898 | 3300006038 | Ga0075365_10139832 | Ga0075365_101398322 | 268 |
| 899 | 3300006042 | Ga0075368_10031490 | Ga0075368_100314902 | 268 |
| 900 | 3300006051 | Ga0075364_10053317 | Ga0075364_100533172 | 268 |
| 901 | 3300006163 | Ga0070715_10000340 | Ga0070715_100003407 | 268 |
| 902 | 3300006173 | Ga0070716_100035327 | Ga0070716_1000353272 | 268 |
| 903 | 3300006173 | Ga0070716_100037143 | Ga0070716_1000371433 | 268 |
| 904 | 3300006173 | Ga0070716_100071754 | Ga0070716_1000717543 | 268 |
| 905 | 3300006173 | Ga0070716_100297177 | Ga0070716_1002971772 | 268 |
| 906 | 3300006175 | Ga0070712_100005879 | Ga0070712_1000058796 | 268 |
| 907 | 3300006175 | Ga0070712_100009110 | Ga0070712_1000091105 | 268 |
| 908 | 3300006178 | Ga0075367_10055262 | Ga0075367_100552622 | 268 |
| 909 | 3300006178 | Ga0075367_10201515 | Ga0075367_102015152 | 268 |
| 910 | 3300006186 | Ga0075369_10112938 | Ga0075369_101129382 | 268 |
| 911 | 3300006195 | Ga0075366_10085262 | Ga0075366_100852622 | 268 |
| 912 | 3300006237 | Ga0097621_100267399 | Ga0097621_1002673992 | 268 |
| 913 | 3300006358 | Ga0068871_100228097 | Ga0068871_1002280972 | 268 |
| 914 | 3300006844 | Ga0075428_100202828 | Ga0075428_1002028282 | 268 |
| 915 | 3300006871 | Ga0075434_100297533 | Ga0075434_1002975332 | 268 |
| 916 | 3300006931 | Ga0097620_100340662 | Ga0097620_1003406621 | 268 |
| 917 | 3300006942 | Ga0099824_1012954 | Ga0099824_10129544 | 268 |
| 918 | 3300006943 | Ga0099822_1001015 | Ga0099822_100101527 | 268 |
| 919 | 3300006944 | Ga0099823_1008372 | Ga0099823_10083724 | 268 |
| 920 | 3300007076 | Ga0075435_100344557 | Ga0075435_1003445572 | 268 |
| 921 | 3300007265 | Ga0099794_10039754 | Ga0099794_100397542 | 268 |
| 922 | 3300007788 | Ga0099795_10017799 | Ga0099795_100177992 | 268 |
| 923 | 3300009093 | Ga0105240_10008997 | Ga0105240_1000899710 | 268 |
| 924 | 3300009093 | Ga0105240_10010555 | Ga0105240_1001055514 | 268 |
| 925 | 3300009093 | Ga0105240_10013639 | Ga0105240_100136393 | 268 |
| 926 | 3300009093 | Ga0105240_10198300 | Ga0105240_101983003 | 268 |
| 927 | 3300009098 | Ga0105245_10071540 | Ga0105245_100715403 | 268 |
| 928 | 3300009098 | Ga0105245_10121853 | Ga0105245_101218533 | 268 |
| 929 | 3300009098 | Ga0105245_10622222 | Ga0105245_106222222 | 268 |
| 930 | 3300009101 | Ga0105247_10037019 | Ga0105247_100370192 | 268 |
| 931 | 3300009101 | Ga0105247_10091152 | Ga0105247_100911521 | 268 |
| 932 | 3300009101 | Ga0105247_10142577 | Ga0105247_101425772 | 268 |
| 933 | 3300009174 | Ga0105241_10004508 | Ga0105241_1000450811 | 268 |
| 934 | 3300009174 | Ga0105241_10041098 | Ga0105241_100410983 | 268 |
| 935 | 3300009174 | Ga0105241_10129917 | Ga0105241_101299172 | 268 |
| 936 | 3300009174 | Ga0105241_10191561 | Ga0105241_101915612 | 268 |
| 937 | 3300009177 | Ga0105248_10140847 | Ga0105248_101408474 | 268 |
| 938 | 3300009177 | Ga0105248_10364148 | Ga0105248_103641482 | 268 |
| 939 | 3300009545 | Ga0105237_10001564 | Ga0105237_1000156418 | 268 |
| 940 | 3300009545 | Ga0105237_10012234 | Ga0105237_1001223410 | 268 |
| 941 | 3300009545 | Ga0105237_10141911 | Ga0105237_101419112 | 268 |
| 942 | 3300009551 | Ga0105238_10006286 | Ga0105238_100062864 | 268 |
| 943 | 3300009551 | Ga0105238_10006661 | Ga0105238_100066618 | 268 |
| 944 | 3300009551 | Ga0105238_10011390 | Ga0105238_100113906 | 268 |
| 945 | 3300009551 | Ga0105238_10121170 | Ga0105238_101211702 | 268 |
| 946 | 3300009551 | Ga0105238_10278536 | Ga0105238_102785362 | 268 |
| 947 | 3300009551 | Ga0105238_10375144 | Ga0105238_103751441 | 268 |
| 948 | 3300009551 | Ga0105238_10439022 | Ga0105238_104390222 | 268 |
| 949 | 3300010159 | Ga0099796_10042904 | Ga0099796_100429042 | 268 |
| 950 | 3300010375 | Ga0105239_10012332 | Ga0105239_100123328 | 268 |
| 951 | 3300010375 | Ga0105239_10022799 | Ga0105239_100227994 | 268 |
| 952 | 3300010375 | Ga0105239_10025169 | Ga0105239_100251694 | 268 |
| 953 | 3300010375 | Ga0105239_10111037 | Ga0105239_101110374 | 268 |
| 954 | 3300010375 | Ga0105239_10116579 | Ga0105239_101165792 | 268 |
| 955 | 3300010375 | Ga0105239_10284342 | Ga0105239_102843422 | 268 |
| 956 | 3300011119 | Ga0105246_10126402 | Ga0105246_101264021 | 268 |
| 957 | 3300011119 | Ga0105246_10276173 | Ga0105246_102761732 | 268 |
| 958 | 3300013104 | Ga0157370_10036903 | Ga0157370_100369035 | 268 |
| 959 | 3300013105 | Ga0157369_10237904 | Ga0157369_102379042 | 268 |
| 960 | 3300013105 | Ga0157369_10823051 | Ga0157369_108230511 | 268 |
| 961 | 3300013297 | Ga0157378_10301578 | Ga0157378_103015782 | 268 |
| 962 | 3300013306 | Ga0163162_10144314 | Ga0163162_101443142 | 268 |
| 963 | 3300013307 | Ga0157372_10184738 | Ga0157372_101847381 | 268 |
| 964 | 3300013308 | Ga0157375_10349593 | Ga0157375_103495932 | 268 |
| 965 | 3300014325 | Ga0163163_10014045 | Ga0163163_100140452 | 268 |
| 966 | 3300014325 | Ga0163163_10052168 | Ga0163163_100521684 | 268 |
| 967 | 3300014325 | Ga0163163_10351886 | Ga0163163_103518862 | 268 |
| 968 | 3300014325 | Ga0163163_10482258 | Ga0163163_104822581 | 268 |
| 969 | 3300014326 | Ga0157380_10161273 | Ga0157380_101612732 | 268 |
| 970 | 3300014326 | Ga0157380_10162004 | Ga0157380_101620042 | 268 |
| 971 | 3300014497 | Ga0182008_10111167 | Ga0182008_101111671 | 268 |
| 972 | 3300020081 | Ga0206354_10571467 | Ga0206354_105714672 | 268 |
| 973 | 3300021320 | Ga0214544_1000020 | Ga0214544_1000020157 | 268 |
| 974 | 3300021321 | Ga0214542_1000024 | Ga0214542_1000024168 | 268 |
| 975 | 3300021324 | Ga0214545_1000011 | Ga0214545_1000011168 | 268 |
| 976 | 3300021327 | Ga0214543_1000033 | Ga0214543_100003336 | 268 |
| 977 | 3300021358 | Ga0213873_10026144 | Ga0213873_100261441 | 268 |
| 978 | 3300021384 | Ga0213876_10009084 | Ga0213876_100090843 | 268 |
| 979 | 3300021384 | Ga0213876_10184671 | Ga0213876_101846712 | 268 |
| 980 | 3300021384 | Ga0213876_10187411 | Ga0213876_101874111 | 268 |
| 981 | 3300024227 | Ga0228598_1004399 | Ga0228598_10043992 | 268 |
| 982 | 3300025254 | Ga0209148_1000574 | Ga0209148_100057430 | 268 |
| 983 | 3300025261 | Ga0209233_1005617 | Ga0209233_10056175 | 268 |
| 984 | 3300025272 | Ga0209455_1009617 | Ga0209455_10096174 | 268 |
| 985 | 3300025272 | Ga0209455_1032789 | Ga0209455_10327891 | 268 |
| 986 | 3300025284 | Ga0209130_1000111 | Ga0209130_100011142 | 268 |
| 987 | 3300025284 | Ga0209130_1041286 | Ga0209130_10412861 | 268 |
| 988 | 3300025294 | Ga0209025_1001992 | Ga0209025_100199224 | 268 |
| 989 | 3300025295 | Ga0209564_1004509 | Ga0209564_10045092 | 268 |
| 990 | 3300025295 | Ga0209564_1007973 | Ga0209564_10079734 | 268 |
| 991 | 3300025295 | Ga0209564_1034172 | Ga0209564_10341722 | 268 |
| 992 | 3300025297 | Ga0209758_1000065 | Ga0209758_100006513 | 268 |
| 993 | 3300025297 | Ga0209758_1000498 | Ga0209758_100049837 | 268 |
| 994 | 3300025297 | Ga0209758_1000560 | Ga0209758_100056027 | 268 |
| 995 | 3300025297 | Ga0209758_1003962 | Ga0209758_100396212 | 268 |
| 996 | 3300025297 | Ga0209758_1004726 | Ga0209758_100472613 | 268 |
| 997 | 3300025297 | Ga0209758_1006640 | Ga0209758_10066409 | 268 |
| 998 | 3300025299 | Ga0209256_1003626 | Ga0209256_100362612 | 268 |
| 999 | 3300025302 | Ga0207426_1000721 | Ga0207426_10007214 | 268 |
| 1000 | 3300025302 | Ga0207426_1000728 | Ga0207426_100072813 | 268 |
| 1001 | 3300025302 | Ga0207426_1002233 | Ga0207426_100223317 | 268 |
| 1002 | 3300025302 | Ga0207426_1008460 | Ga0207426_10084601 | 268 |
| 1003 | 3300025321 | Ga0207656_10005979 | Ga0207656_100059796 | 268 |
| 1004 | 3300025321 | Ga0207656_10021824 | Ga0207656_100218242 | 268 |
| 1005 | 3300025321 | Ga0207656_10145017 | Ga0207656_101450171 | 268 |
| 1006 | 3300025893 | Ga0207682_10011232 | Ga0207682_100112322 | 268 |
| 1007 | 3300025898 | Ga0207692_10008253 | Ga0207692_100082532 | 268 |
| 1008 | 3300025898 | Ga0207692_10049519 | Ga0207692_100495192 | 268 |
| 1009 | 3300025898 | Ga0207692_10268504 | Ga0207692_102685042 | 268 |
| 1010 | 3300025900 | Ga0207710_10036630 | Ga0207710_100366302 | 268 |
| 1011 | 3300025901 | Ga0207688_10084405 | Ga0207688_100844052 | 268 |
| 1012 | 3300025903 | Ga0207680_10083837 | Ga0207680_100838372 | 268 |
| 1013 | 3300025903 | Ga0207680_10247984 | Ga0207680_102479842 | 268 |
| 1014 | 3300025904 | Ga0207647_10001242 | Ga0207647_100012428 | 268 |
| 1015 | 3300025906 | Ga0207699_10005571 | Ga0207699_100055713 | 268 |
| 1016 | 3300025906 | Ga0207699_10006508 | Ga0207699_100065087 | 268 |
| 1017 | 3300025906 | Ga0207699_10075044 | Ga0207699_100750442 | 268 |
| 1018 | 3300025907 | Ga0207645_10096827 | Ga0207645_100968272 | 268 |
| 1019 | 3300025907 | Ga0207645_10161605 | Ga0207645_101616052 | 268 |
| 1020 | 3300025909 | Ga0207705_10074905 | Ga0207705_100749052 | 268 |
| 1021 | 3300025911 | Ga0207654_10004074 | Ga0207654_100040743 | 268 |
| 1022 | 3300025911 | Ga0207654_10110844 | Ga0207654_101108442 | 268 |
| 1023 | 3300025911 | Ga0207654_10131957 | Ga0207654_101319572 | 268 |
| 1024 | 3300025911 | Ga0207654_10323018 | Ga0207654_103230182 | 268 |
| 1025 | 3300025912 | Ga0207707_10000466 | Ga0207707_100004664 | 268 |
| 1026 | 3300025912 | Ga0207707_10011284 | Ga0207707_1001128410 | 268 |
| 1027 | 3300025912 | Ga0207707_10032070 | Ga0207707_100320702 | 268 |
| 1028 | 3300025912 | Ga0207707_10098339 | Ga0207707_100983393 | 268 |
| 1029 | 3300025912 | Ga0207707_10306116 | Ga0207707_103061161 | 268 |
| 1030 | 3300025913 | Ga0207695_10000029 | Ga0207695_10000029104 | 268 |
| 1031 | 3300025913 | Ga0207695_10001179 | Ga0207695_1000117925 | 268 |
| 1032 | 3300025913 | Ga0207695_10024619 | Ga0207695_100246197 | 268 |
| 1033 | 3300025913 | Ga0207695_10450081 | Ga0207695_104500812 | 268 |
| 1034 | 3300025914 | Ga0207671_10003068 | Ga0207671_1000306815 | 268 |
| 1035 | 3300025914 | Ga0207671_10043451 | Ga0207671_100434512 | 268 |
| 1036 | 3300025914 | Ga0207671_10067289 | Ga0207671_100672893 | 268 |
| 1037 | 3300025914 | Ga0207671_10124855 | Ga0207671_101248552 | 268 |
| 1038 | 3300025914 | Ga0207671_10393534 | Ga0207671_103935342 | 268 |
| 1039 | 3300025915 | Ga0207693_10000723 | Ga0207693_1000072319 | 268 |
| 1040 | 3300025915 | Ga0207693_10068591 | Ga0207693_100685913 | 268 |
| 1041 | 3300025916 | Ga0207663_10000219 | Ga0207663_1000021924 | 268 |
| 1042 | 3300025916 | Ga0207663_10025741 | Ga0207663_100257414 | 268 |
| 1043 | 3300025916 | Ga0207663_10071271 | Ga0207663_100712712 | 268 |
| 1044 | 3300025916 | Ga0207663_10072844 | Ga0207663_100728443 | 268 |
| 1045 | 3300025916 | Ga0207663_10133224 | Ga0207663_101332242 | 268 |
| 1046 | 3300025916 | Ga0207663_10198666 | Ga0207663_101986662 | 268 |
| 1047 | 3300025917 | Ga0207660_10022499 | Ga0207660_100224994 | 268 |
| 1048 | 3300025917 | Ga0207660_10344569 | Ga0207660_103445692 | 268 |
| 1049 | 3300025917 | Ga0207660_10351812 | Ga0207660_103518122 | 268 |
| 1050 | 3300025918 | Ga0207662_10065461 | Ga0207662_100654612 | 268 |
| 1051 | 3300025919 | Ga0207657_10006956 | Ga0207657_100069563 | 268 |
| 1052 | 3300025919 | Ga0207657_10022202 | Ga0207657_100222024 | 268 |
| 1053 | 3300025920 | Ga0207649_10031830 | Ga0207649_100318302 | 268 |
| 1054 | 3300025921 | Ga0207652_10001798 | Ga0207652_1000179811 | 268 |
| 1055 | 3300025921 | Ga0207652_10014679 | Ga0207652_100146796 | 268 |
| 1056 | 3300025921 | Ga0207652_10059169 | Ga0207652_100591693 | 268 |
| 1057 | 3300025921 | Ga0207652_10209704 | Ga0207652_102097042 | 268 |
| 1058 | 3300025924 | Ga0207694_10000131 | Ga0207694_1000013120 | 268 |
| 1059 | 3300025924 | Ga0207694_10011244 | Ga0207694_100112444 | 268 |
| 1060 | 3300025924 | Ga0207694_10021078 | Ga0207694_100210785 | 268 |
| 1061 | 3300025924 | Ga0207694_10337701 | Ga0207694_103377012 | 268 |
| 1062 | 3300025925 | Ga0207650_10034857 | Ga0207650_100348572 | 268 |
| 1063 | 3300025926 | Ga0207659_10199388 | Ga0207659_101993882 | 268 |
| 1064 | 3300025928 | Ga0207700_10015585 | Ga0207700_100155852 | 268 |
| 1065 | 3300025928 | Ga0207700_10089106 | Ga0207700_100891061 | 268 |
| 1066 | 3300025928 | Ga0207700_10128654 | Ga0207700_101286542 | 268 |
| 1067 | 3300025928 | Ga0207700_10236063 | Ga0207700_102360632 | 268 |
| 1068 | 3300025929 | Ga0207664_10006314 | Ga0207664_100063146 | 268 |
| 1069 | 3300025929 | Ga0207664_10065207 | Ga0207664_100652072 | 268 |
| 1070 | 3300025929 | Ga0207664_10103453 | Ga0207664_101034533 | 268 |
| 1071 | 3300025929 | Ga0207664_10274516 | Ga0207664_102745162 | 268 |
| 1072 | 3300025929 | Ga0207664_10297432 | Ga0207664_102974322 | 268 |
| 1073 | 3300025929 | Ga0207664_10348548 | Ga0207664_103485482 | 268 |
| 1074 | 3300025929 | Ga0207664_10430608 | Ga0207664_104306082 | 268 |
| 1075 | 3300025929 | Ga0207664_10540934 | Ga0207664_105409341 | 268 |
| 1076 | 3300025929 | Ga0207664_10584569 | Ga0207664_105845691 | 268 |
| 1077 | 3300025931 | Ga0207644_10033426 | Ga0207644_100334262 | 268 |
| 1078 | 3300025931 | Ga0207644_10066881 | Ga0207644_100668812 | 268 |
| 1079 | 3300025931 | Ga0207644_10135999 | Ga0207644_101359992 | 268 |
| 1080 | 3300025931 | Ga0207644_10548414 | Ga0207644_105484142 | 268 |
| 1081 | 3300025932 | Ga0207690_10068618 | Ga0207690_100686182 | 268 |
| 1082 | 3300025933 | Ga0207706_10062871 | Ga0207706_100628714 | 268 |
| 1083 | 3300025933 | Ga0207706_10146667 | Ga0207706_101466672 | 268 |
| 1084 | 3300025934 | Ga0207686_10167846 | Ga0207686_101678462 | 268 |
| 1085 | 3300025936 | Ga0207670_10074378 | Ga0207670_100743782 | 268 |
| 1086 | 3300025937 | Ga0207669_10066264 | Ga0207669_100662642 | 268 |
| 1087 | 3300025939 | Ga0207665_10000064 | Ga0207665_1000006419 | 268 |
| 1088 | 3300025939 | Ga0207665_10033157 | Ga0207665_100331573 | 268 |
| 1089 | 3300025939 | Ga0207665_10080284 | Ga0207665_100802843 | 268 |
| 1090 | 3300025939 | Ga0207665_10260141 | Ga0207665_102601412 | 268 |
| 1091 | 3300025941 | Ga0207711_10198112 | Ga0207711_101981122 | 268 |
| 1092 | 3300025941 | Ga0207711_10386148 | Ga0207711_103861481 | 268 |
| 1093 | 3300025941 | Ga0207711_10796551 | Ga0207711_107965511 | 268 |
| 1094 | 3300025944 | Ga0207661_10008345 | Ga0207661_100083453 | 268 |
| 1095 | 3300025944 | Ga0207661_10011091 | Ga0207661_100110915 | 268 |
| 1096 | 3300025944 | Ga0207661_10044116 | Ga0207661_100441163 | 268 |
| 1097 | 3300025945 | Ga0207679_10348379 | Ga0207679_103483791 | 268 |
| 1098 | 3300025945 | Ga0207679_10463096 | Ga0207679_104630961 | 268 |
| 1099 | 3300025949 | Ga0207667_10003470 | Ga0207667_1000347013 | 268 |
| 1100 | 3300025949 | Ga0207667_10040486 | Ga0207667_100404863 | 268 |
| 1101 | 3300025949 | Ga0207667_10048507 | Ga0207667_100485075 | 268 |
| 1102 | 3300025981 | Ga0207640_10005349 | Ga0207640_100053495 | 268 |
| 1103 | 3300025981 | Ga0207640_10443649 | Ga0207640_104436491 | 268 |
| 1104 | 3300025986 | Ga0207658_10036941 | Ga0207658_100369412 | 268 |
| 1105 | 3300025986 | Ga0207658_10074230 | Ga0207658_100742303 | 268 |
| 1106 | 3300026023 | Ga0207677_10264620 | Ga0207677_102646202 | 268 |
| 1107 | 3300026041 | Ga0207639_10009549 | Ga0207639_100095496 | 268 |
| 1108 | 3300026041 | Ga0207639_10028981 | Ga0207639_100289813 | 268 |
| 1109 | 3300026041 | Ga0207639_10120808 | Ga0207639_101208082 | 268 |
| 1110 | 3300026041 | Ga0207639_10401149 | Ga0207639_104011491 | 268 |
| 1111 | 3300026067 | Ga0207678_10213321 | Ga0207678_102133211 | 268 |
| 1112 | 3300026067 | Ga0207678_10336056 | Ga0207678_103360562 | 268 |
| 1113 | 3300026067 | Ga0207678_10605570 | Ga0207678_106055701 | 268 |
| 1114 | 3300026078 | Ga0207702_10000005 | Ga0207702_10000005344 | 268 |
| 1115 | 3300026078 | Ga0207702_10009529 | Ga0207702_100095298 | 268 |
| 1116 | 3300026078 | Ga0207702_10081007 | Ga0207702_100810073 | 268 |
| 1117 | 3300026078 | Ga0207702_10403703 | Ga0207702_104037032 | 268 |
| 1118 | 3300026095 | Ga0207676_10220839 | Ga0207676_102208392 | 268 |
| 1119 | 3300026095 | Ga0207676_10507403 | Ga0207676_105074032 | 268 |
| 1120 | 3300026116 | Ga0207674_10001872 | Ga0207674_1000187223 | 268 |
| 1121 | 3300026116 | Ga0207674_10007160 | Ga0207674_1000716011 | 268 |
| 1122 | 3300026116 | Ga0207674_10037998 | Ga0207674_100379982 | 268 |
| 1123 | 3300026116 | Ga0207674_10047446 | Ga0207674_100474463 | 268 |
| 1124 | 3300026116 | Ga0207674_10093731 | Ga0207674_100937312 | 268 |
| 1125 | 3300026116 | Ga0207674_10094233 | Ga0207674_100942331 | 268 |
| 1126 | 3300026116 | Ga0207674_10243826 | Ga0207674_102438261 | 268 |
| 1127 | 3300026118 | Ga0207675_100456912 | Ga0207675_1004569122 | 268 |
| 1128 | 3300026118 | Ga0207675_100688860 | Ga0207675_1006888602 | 268 |
| 1129 | 3300026121 | Ga0207683_10065519 | Ga0207683_100655194 | 268 |
| 1130 | 3300026121 | Ga0207683_10347901 | Ga0207683_103479012 | 268 |
| 1131 | 3300026142 | Ga0207698_10008935 | Ga0207698_100089352 | 268 |
| 1132 | 3300026142 | Ga0207698_10013158 | Ga0207698_100131583 | 268 |
| 1133 | 3300026142 | Ga0207698_10407391 | Ga0207698_104073912 | 268 |
| 1134 | 3300027296 | Ga0209389_1000011 | Ga0209389_100001149 | 268 |
| 1135 | 3300027296 | Ga0209389_1000025 | Ga0209389_1000025110 | 268 |
| 1136 | 3300027357 | Ga0209589_1000018 | Ga0209589_100001831 | 268 |
| 1137 | 3300027357 | Ga0209589_1000066 | Ga0209589_100006659 | 268 |
| 1138 | 3300027361 | Ga0209489_100017 | Ga0209489_100017185 | 268 |
| 1139 | 3300027361 | Ga0209489_100026 | Ga0209489_10002631 | 268 |
| 1140 | 3300027361 | Ga0209489_100030 | Ga0209489_10003054 | 268 |
| 1141 | 3300027363 | Ga0209700_100027 | Ga0209700_10002749 | 268 |
| 1142 | 3300027363 | Ga0209700_100035 | Ga0209700_10003531 | 268 |
| 1143 | 3300027512 | Ga0209179_1020322 | Ga0209179_10203222 | 268 |
| 1144 | 3300027866 | Ga0209813_10026656 | Ga0209813_100266562 | 268 |
| 1145 | 3300027907 | Ga0207428_10078549 | Ga0207428_100785492 | 268 |
| 1146 | 3300028379 | Ga0268266_10014484 | Ga0268266_100144842 | 268 |
| 1147 | 3300028379 | Ga0268266_10056743 | Ga0268266_100567434 | 268 |
| 1148 | 3300028379 | Ga0268266_10157939 | Ga0268266_101579392 | 268 |
| 1149 | 3300028381 | Ga0268264_10000035 | Ga0268264_10000035125 | 268 |
| 1150 | 3300028563 | Ga0265319_1044084 | Ga0265319_10440842 | 268 |
| 1151 | 3300028573 | Ga0265334_10013193 | Ga0265334_100131933 | 268 |
| 1152 | 3300028653 | Ga0265323_10007879 | Ga0265323_100078791 | 268 |
| 1153 | 3300028666 | Ga0265336_10009229 | Ga0265336_100092292 | 268 |
| 1154 | 3300028794 | Ga0307515_10052509 | Ga0307515_100525098 | 268 |
| 1155 | 3300028800 | Ga0265338_10000065 | Ga0265338_1000006520 | 268 |
| 1156 | 3300031235 | Ga0265330_10025998 | Ga0265330_100259983 | 268 |
| 1157 | 3300031235 | Ga0265330_10043704 | Ga0265330_100437042 | 268 |
| 1158 | 3300031238 | Ga0265332_10019006 | Ga0265332_100190062 | 268 |
| 1159 | 3300031240 | Ga0265320_10039080 | Ga0265320_100390802 | 268 |
| 1160 | 3300031241 | Ga0265325_10044758 | Ga0265325_100447582 | 268 |
| 1161 | 3300031242 | Ga0265329_10017951 | Ga0265329_100179513 | 268 |
| 1162 | 3300031247 | Ga0265340_10003867 | Ga0265340_100038675 | 268 |
| 1163 | 3300031247 | Ga0265340_10032067 | Ga0265340_100320673 | 268 |
| 1164 | 3300031249 | Ga0265339_10001453 | Ga0265339_100014539 | 268 |
| 1165 | 3300031249 | Ga0265339_10061245 | Ga0265339_100612453 | 268 |
| 1166 | 3300031344 | Ga0265316_10055197 | Ga0265316_100551972 | 268 |
| 1167 | 3300031507 | Ga0307509_10099481 | Ga0307509_100994813 | 268 |
| 1168 | 3300031548 | Ga0307408_100271022 | Ga0307408_1002710222 | 268 |
| 1169 | 3300031595 | Ga0265313_10029608 | Ga0265313_100296082 | 268 |
| 1170 | 3300031595 | Ga0265313_10046465 | Ga0265313_100464653 | 268 |
| 1171 | 3300031616 | Ga0307508_10000521 | Ga0307508_1000052138 | 268 |
| 1172 | 3300031616 | Ga0307508_10239466 | Ga0307508_102394662 | 268 |
| 1173 | 3300031711 | Ga0265314_10022547 | Ga0265314_100225472 | 268 |
| 1174 | 3300031712 | Ga0265342_10002787 | Ga0265342_1000278714 | 268 |
| 1175 | 3300031712 | Ga0265342_10010202 | Ga0265342_100102026 | 268 |
| 1176 | 3300031712 | Ga0265342_10030155 | Ga0265342_100301552 | 268 |
| 1177 | 3300031712 | Ga0265342_10214189 | Ga0265342_102141892 | 268 |
| 1178 | 3300031730 | Ga0307516_10006057 | Ga0307516_1000605711 | 268 |
| 1179 | 3300031730 | Ga0307516_10013764 | Ga0307516_100137643 | 268 |
| 1180 | 3300031730 | Ga0307516_10016792 | Ga0307516_100167922 | 268 |
| 1181 | 3300031911 | Ga0307412_10607082 | Ga0307412_106070821 | 268 |
| 1182 | 3300032126 | Ga0307415_100258189 | Ga0307415_1002581892 | 268 |
| 1183 | 3300033179 | Ga0307507_10111917 | Ga0307507_101119172 | 268 |
| 1184 | 3300033179 | Ga0307507_10114834 | Ga0307507_101148342 | 268 |
| 1185 | 3300033180 | Ga0307510_10008237 | Ga0307510_1000823712 | 268 |
| 1186 | 3300033180 | Ga0307510_10010792 | Ga0307510_1001079213 | 268 |
| 1187 | 3300033180 | Ga0307510_10134601 | Ga0307510_101346013 | 268 |
| 1188 | 3300033180 | Ga0307510_10136026 | Ga0307510_101360263 | 268 |
| 1189 | 3300033442 | Ga0315911_1000011 | Ga0315911_100001135 | 268 |
| 1190 | 3300034816 | Ga0373930_0009726 | Ga0373930_0009726_256_1062 | 268 |
| 1191 | 3300035086 | Ga0373934_0018268 | Ga0373934_0018268_1260_2066 | 268 |
| 1192 | 3300035086 | Ga0373934_0050750 | Ga0373934_0050750_55_861 | 268 |
| 1193 | 3300035086 | Ga0373934_0079984 | Ga0373934_0079984_299_1105 | 268 |
| 1194 | 3300035086 | Ga0373934_0132785 | Ga0373934_0132785_169_975 | 268 |
| 1195 | 3300035089 | Ga0373944_0008158 | Ga0373944_0008158_1279_2091 | 268 |
| 1196 | 3300035089 | Ga0373944_0008625 | Ga0373944_0008625_666_1472 | 268 |
| 1197 | 3300035090 | Ga0373949_0059932 | Ga0373949_0059932_57_863 | 268 |
| 1198 | 3300035111 | Ga0373923_0007808 | Ga0373923_0007808_2542_3348 | 268 |
| 1199 | 3300035111 | Ga0373923_0009562 | Ga0373923_0009562_836_1642 | 268 |
| 1200 | 3300035111 | Ga0373923_0011876 | Ga0373923_0011876_1134_1940 | 268 |
| 1201 | 3300035111 | Ga0373923_0012570 | Ga0373923_0012570_1930_2736 | 268 |
| 1202 | 3300035111 | Ga0373923_0040959 | Ga0373923_0040959_625_1437 | 268 |
| 1203 | 3300035113 | Ga0373936_0005534 | Ga0373936_0005534_1280_2086 | 268 |
| 1204 | 3300035113 | Ga0373936_0026481 | Ga0373936_0026481_1442_2254 | 268 |
| 1205 | 3300035113 | Ga0373936_0065892 | Ga0373936_0065892_95_907 | 268 |
| 1206 | 3300035115 | Ga0373941_0060016 | Ga0373941_0060016_205_1011 | 268 |
| 1207 | 3300035116 | Ga0373945_0041758 | Ga0373945_0041758_395_1207 | 268 |
| 1208 | 3300035117 | Ga0373953_0004604 | Ga0373953_0004604_2011_2817 | 268 |
| 1209 | 3300035117 | Ga0373953_0021341 | Ga0373953_0021341_56_862 | 268 |
| 1210 | 3300035117 | Ga0373953_0032120 | Ga0373953_0032120_509_1315 | 268 |
| 1211 | 3300035118 | Ga0373954_0001728 | Ga0373954_0001728_985_1791 | 268 |
| 1212 | 3300035118 | Ga0373954_0024119 | Ga0373954_0024119_87_893 | 268 |
| 1213 | 3300035118 | Ga0373954_0069666 | Ga0373954_0069666_730_1536 | 268 |
| 1214 | 3300035119 | Ga0373956_0000275 | Ga0373956_0000275_1668_2474 | 268 |
| 1215 | 3300035119 | Ga0373956_0027086 | Ga0373956_0027086_736_1542 | 268 |
| 1216 | 3300035119 | Ga0373956_0083356 | Ga0373956_0083356_385_1197 | 268 |
| 1217 | 3300035119 | Ga0373956_0131516 | Ga0373956_0131516_13_819 | 268 |
| 1218 | 3300035120 | Ga0373957_0008902 | Ga0373957_0008902_251_1057 | 268 |
| 1219 | 3300035120 | Ga0373957_0024316 | Ga0373957_0024316_396_1202 | 268 |
| 1220 | 3300035121 | Ga0373960_0037420 | Ga0373960_0037420_349_1155 | 268 |
| 1221 | 3300035170 | Ga0373943_0000038 | Ga0373943_0000038_40270_41082 | 268 |
| 1222 | 3300035170 | Ga0373943_0010166 | Ga0373943_0010166_1082_1888 | 268 |
| 1223 | 3300035170 | Ga0373943_0042188 | Ga0373943_0042188_223_1029 | 268 |
| 1224 | 3300035171 | Ga0373946_0001215 | Ga0373946_0001215_2569_3381 | 268 |
| 1225 | 3300035172 | Ga0373955_0000324 | Ga0373955_0000324_11857_12663 | 268 |
| 1226 | 3300035172 | Ga0373955_0023312 | Ga0373955_0023312_1678_2484 | 268 |
| 1227 | 3300035172 | Ga0373955_0106666 | Ga0373955_0106666_722_1534 | 268 |
| 1228 | 3300035172 | Ga0373955_0119720 | Ga0373955_0119720_294_1100 | 268 |
| 1229 | 3300035410 | Ga0373924_0019316 | Ga0373924_0019316_1436_2242 | 268 |
| 1230 | 3300035410 | Ga0373924_0079202 | Ga0373924_0079202_168_974 | 268 |
| 1231 | 3300035691 | Ga0373931_0017129 | Ga0373931_0017129_2257_3063 | 268 |
| 1232 | 3300035692 | Ga0373935_0001897 | Ga0373935_0001897_7622_8434 | 268 |
| 1233 | 3300035692 | Ga0373935_0031933 | Ga0373935_0031933_1978_2784 | 268 |
| 1234 | 3300035695 | Ga0373927_0000665 | Ga0373927_0000665_10142_10948 | 268 |
| 1235 | 3300035695 | Ga0373927_0000759 | Ga0373927_0000759_9609_10421 | 268 |
| 1236 | 3300035695 | Ga0373927_0004910 | Ga0373927_0004910_2673_3485 | 268 |
| 1237 | 3300035695 | Ga0373927_0016732 | Ga0373927_0016732_1333_2139 | 268 |
| 1238 | 3300035695 | Ga0373927_0057701 | Ga0373927_0057701_751_1557 | 268 |
| 1239 | 3300035695 | Ga0373927_0080765 | Ga0373927_0080765_438_1244 | 268 |
| 1240 | 3300035695 | Ga0373927_0113416 | Ga0373927_0113416_338_1144 | 268 |
| 1241 | 3300035695 | Ga0373927_0116489 | Ga0373927_0116489_91_897 | 268 |
| 1242 | 3300035695 | Ga0373927_0172677 | Ga0373927_0172677_400_1206 | 268 |
| 1243 | 3300035695 | Ga0373927_0180085 | Ga0373927_0180085_398_1204 | 268 |
| 1244 | 3300035695 | Ga0373927_0251582 | Ga0373927_0251582_310_1116 | 268 |
| 1245 | 3300035724 | Ga0373933_0000405 | Ga0373933_0000405_21580_22386 | 268 |
| 1246 | 3300035724 | Ga0373933_0021114 | Ga0373933_0021114_1905_2711 | 268 |
| 1247 | 3300035724 | Ga0373933_0115209 | Ga0373933_0115209_666_1472 | 268 |
| 1248 | 3300035724 | Ga0373933_0196709 | Ga0373933_0196709_54_866 | 268 |
| 1249 | 3300035725 | Ga0373947_0000024 | Ga0373947_0000024_34876_35688 | 268 |
| 1250 | 3300035725 | Ga0373947_0000555 | Ga0373947_0000555_3834_4640 | 268 |
| 1251 | 3300035725 | Ga0373947_0011853 | Ga0373947_0011853_2389_3201 | 268 |
| 1252 | 3300035725 | Ga0373947_0013984 | Ga0373947_0013984_1133_1939 | 268 |
| 1253 | 3300035725 | Ga0373947_0025304 | Ga0373947_0025304_474_1280 | 268 |
| 1254 | 3300036401 | Ga0373937_0014181 | Ga0373937_0014181_4660_5466 | 268 |
| 1255 | 3300036401 | Ga0373937_0048872 | Ga0373937_0048872_2772_3578 | 268 |
| 1256 | 3300036401 | Ga0373937_0101198 | Ga0373937_0101198_769_1575 | 268 |
| 1257 | 3300036401 | Ga0373937_0322653 | Ga0373937_0322653_619_1425 | 268 |
| 1258 | 3300036401 | Ga0373937_0370823 | Ga0373937_0370823_121_927 | 268 |
| 1259 | 3300037068 | Ga0373925_0002500 | Ga0373925_0002500_4276_5082 | 268 |
| 1260 | 3300037068 | Ga0373925_0008692 | Ga0373925_0008692_5060_5866 | 268 |
| 1261 | 3300037068 | Ga0373925_0012894 | Ga0373925_0012894_5172_5984 | 268 |
| 1262 | 3300037068 | Ga0373925_0122327 | Ga0373925_0122327_1204_2010 | 268 |
| 1263 | 3300037068 | Ga0373925_0350555 | Ga0373925_0350555_347_1153 | 268 |
| 1264 | 3300037068 | Ga0373925_0402658 | Ga0373925_0402658_234_1040 | 268 |
| 1265 | 3300037418 | Ga0395900_0001369 | Ga0395900_0001369_23762_24568 | 268 |
| 1266 | 3300037466 | Ga0395898_0008318 | Ga0395898_0008318_4771_5577 | 268 |
| 1267 | 3300037466 | Ga0395898_0132490 | Ga0395898_0132490_667_1473 | 268 |
| 1268 | 3300037466 | Ga0395898_0177776 | Ga0395898_0177776_699_1505 | 268 |
| 1269 | 3300037471 | Ga0395905_0007242 | Ga0395905_0007242_4730_5536 | 268 |
| 1270 | 3300037471 | Ga0395905_0206371 | Ga0395905_0206371_367_1173 | 268 |
| 1271 | 3300037471 | Ga0395905_0773174 | Ga0395905_0773174_39_845 | 268 |
| 1272 | 3300037853 | Ga0436364_0507131 | Ga0436364_0507131_960_1766 | 268 |
| 1273 | 3300037853 | Ga0436364_0685489 | Ga0436364_0685489_121_927 | 268 |
| 1274 | 3300038443 | Ga0395901_0004623 | Ga0395901_0004623_4293_5099 | 268 |
| 1275 | 3300038443 | Ga0395901_0319175 | Ga0395901_0319175_651_1457 | 268 |
| 1276 | 3300038443 | Ga0395901_0543609 | Ga0395901_0543609_353_1159 | 268 |
| 1277 | 3300038705 | Ga0237819_08620 | Ga0237819_08620_418_1227 | 268 |
| 1278 | 3300039437 | Ga0436365_0051700 | Ga0436365_0051700_421_1293 | 268 |
| 1279 | 3300039437 | Ga0436365_0171887 | Ga0436365_0171887_1862_2668 | 268 |
| 1280 | 3300039437 | Ga0436365_1022455 | Ga0436365_1022455_866_1672 | 268 |
| 1281 | 3300039437 | Ga0436365_1339456 | Ga0436365_1339456_1944_2756 | 268 |
| 1282 | 3300039437 | Ga0436365_1677794 | Ga0436365_1677794_45_851 | 268 |
| 1283 | 3300039437 | Ga0436365_1681542 | Ga0436365_1681542_33_839 | 268 |
| 1284 | 3300039438 | Ga0436360_0818757 | Ga0436360_0818757_197_1003 | 268 |
| 1285 | 3300039447 | Ga0436361_1139687 | Ga0436361_1139687_460_1266 | 268 |
| 1286 | 3300039450 | Ga0436363_0068219 | Ga0436363_0068219_325_1140 | 268 |
| 1287 | 3300039453 | Ga0436362_0437287 | Ga0436362_0437287_2086_2892 | 268 |
| 1288 | 3300042438 | Ga0439459_0016906 | Ga0439459_0016906_310_1137 | 268 |
| 1289 | 3300044656 | Ga0466969_0073334 | Ga0466969_0073334_308_1114 | 268 |
| 1290 | 3300044658 | Ga0466972_0000807 | Ga0466972_0000807_10954_11760 | 268 |
| 1291 | 3300044658 | Ga0466972_0023955 | Ga0466972_0023955_540_1346 | 268 |
| 1292 | 3300044684 | Ga0466966_0001348 | Ga0466966_0001348_297_1103 | 268 |
| 1293 | 3300044684 | Ga0466966_0164270 | Ga0466966_0164270_192_998 | 268 |
| 1294 | 3300044693 | Ga0466961_0000120 | Ga0466961_0000120_29004_29810 | 268 |
| 1295 | 3300044694 | Ga0466963_0036289 | Ga0466963_0036289_2211_3017 | 268 |
| 1296 | 3300044735 | Ga0466968_0004393 | Ga0466968_0004393_802_1608 | 268 |
| 1297 | 3300044765 | Ga0466970_0033580 | Ga0466970_0033580_903_1709 | 268 |
| 1298 | 3300044765 | Ga0466970_0069577 | Ga0466970_0069577_897_1703 | 268 |
| 1299 | 3300044765 | Ga0466970_0239222 | Ga0466970_0239222_42_848 | 268 |
| 1300 | 3300044842 | Ga0466957_0049432 | Ga0466957_0049432_750_1556 | 268 |
| 1301 | 3300045049 | Ga0466959_0040985 | Ga0466959_0040985_2526_3332 | 268 |
| 1302 | 3300045836 | Ga0466958_0059700 | Ga0466958_0059700_479_1285 | 268 |
| 1303 | 3300045976 | Ga0466967_0023485 | Ga0466967_0023485_3328_4134 | 268 |
| 1304 | 3300045976 | Ga0466967_0324153 | Ga0466967_0324153_494_1306 | 268 |
| 1305 | 3300046454 | Ga0495592_0005358 | Ga0495592_0005358_1377_2183 | 268 |
| 1306 | 3300046454 | Ga0495592_0022161 | Ga0495592_0022161_2553_3359 | 268 |
| 1307 | 3300046454 | Ga0495592_0030976 | Ga0495592_0030976_44_850 | 268 |
| 1308 | 3300046454 | Ga0495592_0031459 | Ga0495592_0031459_771_1577 | 268 |
| 1309 | 3300046454 | Ga0495592_0152464 | Ga0495592_0152464_238_1044 | 268 |
| 1310 | 3300046455 | Ga0495603_0000094 | Ga0495603_0000094_31494_32300 | 268 |
| 1311 | 3300046455 | Ga0495603_0003073 | Ga0495603_0003073_3701_4507 | 268 |
| 1312 | 3300046455 | Ga0495603_0013013 | Ga0495603_0013013_3282_4088 | 268 |
| 1313 | 3300046455 | Ga0495603_0084278 | Ga0495603_0084278_301_1107 | 268 |
| 1314 | 3300046459 | Ga0495629_0000612 | Ga0495629_0000612_26136_26942 | 268 |
| 1315 | 3300046459 | Ga0495629_0000790 | Ga0495629_0000790_21959_22765 | 268 |
| 1316 | 3300046459 | Ga0495629_0004905 | Ga0495629_0004905_740_1546 | 268 |
| 1317 | 3300046459 | Ga0495629_0016352 | Ga0495629_0016352_1951_2757 | 268 |
| 1318 | 3300046459 | Ga0495629_0110276 | Ga0495629_0110276_509_1315 | 268 |
| 1319 | 3300046460 | Ga0495638_0008217 | Ga0495638_0008217_4018_4824 | 268 |
| 1320 | 3300046460 | Ga0495638_0140439 | Ga0495638_0140439_207_1013 | 268 |
| 1321 | 3300046462 | Ga0495651_0000889 | Ga0495651_0000889_12075_12881 | 268 |
| 1322 | 3300046462 | Ga0495651_0014948 | Ga0495651_0014948_4357_5163 | 268 |
| 1323 | 3300046462 | Ga0495651_0019475 | Ga0495651_0019475_3483_4295 | 268 |
| 1324 | 3300046462 | Ga0495651_0039224 | Ga0495651_0039224_637_1443 | 268 |
| 1325 | 3300046462 | Ga0495651_0075184 | Ga0495651_0075184_346_1152 | 268 |
| 1326 | 3300046462 | Ga0495651_0080993 | Ga0495651_0080993_635_1441 | 268 |
| 1327 | 3300046462 | Ga0495651_0224275 | Ga0495651_0224275_454_1260 | 268 |
| 1328 | 3300046463 | Ga0495653_0000399 | Ga0495653_0000399_8800_9606 | 268 |
| 1329 | 3300046463 | Ga0495653_0120059 | Ga0495653_0120059_431_1237 | 268 |
| 1330 | 3300046463 | Ga0495653_0254744 | Ga0495653_0254744_295_1107 | 268 |
| 1331 | 3300046471 | Ga0495650_0113297 | Ga0495650_0113297_20_826 | 268 |
| 1332 | 3300046472 | Ga0495580_0002084 | Ga0495580_0002084_4126_4932 | 268 |
| 1333 | 3300046472 | Ga0495580_0023565 | Ga0495580_0023565_396_1202 | 268 |
| 1334 | 3300046472 | Ga0495580_0049181 | Ga0495580_0049181_611_1423 | 268 |
| 1335 | 3300046472 | Ga0495580_0305529 | Ga0495580_0305529_31_837 | 268 |
| 1336 | 3300046472 | Ga0495580_0311695 | Ga0495580_0311695_30_836 | 268 |
| 1337 | 3300046473 | Ga0495582_0000256 | Ga0495582_0000256_9465_10271 | 268 |
| 1338 | 3300046473 | Ga0495582_0007746 | Ga0495582_0007746_3584_4390 | 268 |
| 1339 | 3300046473 | Ga0495582_0038554 | Ga0495582_0038554_649_1455 | 268 |
| 1340 | 3300046474 | Ga0495605_0054465 | Ga0495605_0054465_607_1413 | 268 |
| 1341 | 3300046475 | Ga0495639_0000114 | Ga0495639_0000114_7648_8454 | 268 |
| 1342 | 3300046475 | Ga0495639_0031366 | Ga0495639_0031366_174_980 | 268 |
| 1343 | 3300046475 | Ga0495639_0034202 | Ga0495639_0034202_1017_1823 | 268 |
| 1344 | 3300046475 | Ga0495639_0055459 | Ga0495639_0055459_407_1213 | 268 |
| 1345 | 3300046475 | Ga0495639_0249424 | Ga0495639_0249424_53_859 | 268 |
| 1346 | 3300046476 | Ga0495662_0003142 | Ga0495662_0003142_958_1764 | 268 |
| 1347 | 3300046476 | Ga0495662_0009981 | Ga0495662_0009981_852_1664 | 268 |
| 1348 | 3300046476 | Ga0495662_0020029 | Ga0495662_0020029_1347_2159 | 268 |
| 1349 | 3300046476 | Ga0495662_0048590 | Ga0495662_0048590_281_1093 | 268 |
| 1350 | 3300046477 | Ga0495664_0001473 | Ga0495664_0001473_5564_6376 | 268 |
| 1351 | 3300046477 | Ga0495664_0003375 | Ga0495664_0003375_2543_3349 | 268 |
| 1352 | 3300046499 | Ga0495594_0012709 | Ga0495594_0012709_2585_3391 | 268 |
| 1353 | 3300046499 | Ga0495594_0226994 | Ga0495594_0226994_18_830 | 268 |
| 1354 | 3300046501 | Ga0495607_0050252 | Ga0495607_0050252_921_1727 | 268 |
| 1355 | 3300046507 | Ga0495606_0007875 | Ga0495606_0007875_7289_8095 | 268 |
| 1356 | 3300046507 | Ga0495606_0035535 | Ga0495606_0035535_811_1617 | 268 |
| 1357 | 3300046507 | Ga0495606_0041553 | Ga0495606_0041553_171_977 | 268 |
| 1358 | 3300046507 | Ga0495606_0085587 | Ga0495606_0085587_515_1321 | 268 |
| 1359 | 3300046511 | Ga0495608_0010086 | Ga0495608_0010086_1426_2232 | 268 |
| 1360 | 3300046511 | Ga0495608_0048208 | Ga0495608_0048208_1557_2363 | 268 |
| 1361 | 3300046511 | Ga0495608_0101917 | Ga0495608_0101917_1008_1814 | 268 |
| 1362 | 3300046513 | Ga0495616_0175248 | Ga0495616_0175248_129_935 | 268 |
| 1363 | 3300046514 | Ga0495618_0003477 | Ga0495618_0003477_7994_8800 | 268 |
| 1364 | 3300046514 | Ga0495618_0009727 | Ga0495618_0009727_181_993 | 268 |
| 1365 | 3300046514 | Ga0495618_0019706 | Ga0495618_0019706_124_930 | 268 |
| 1366 | 3300046514 | Ga0495618_0042423 | Ga0495618_0042423_931_1737 | 268 |
| 1367 | 3300046514 | Ga0495618_0049423 | Ga0495618_0049423_803_1609 | 268 |
| 1368 | 3300046514 | Ga0495618_0321043 | Ga0495618_0321043_46_858 | 268 |
| 1369 | 3300046515 | Ga0495620_0034250 | Ga0495620_0034250_1297_2103 | 268 |
| 1370 | 3300046516 | Ga0495628_0050791 | Ga0495628_0050791_732_1544 | 268 |
| 1371 | 3300046516 | Ga0495628_0064360 | Ga0495628_0064360_1095_1901 | 268 |
| 1372 | 3300046516 | Ga0495628_0138751 | Ga0495628_0138751_496_1302 | 268 |
| 1373 | 3300046516 | Ga0495628_0140873 | Ga0495628_0140873_335_1141 | 268 |
| 1374 | 3300046516 | Ga0495628_0233538 | Ga0495628_0233538_104_910 | 268 |
| 1375 | 3300046517 | Ga0495630_0001933 | Ga0495630_0001933_1893_2705 | 268 |
| 1376 | 3300046517 | Ga0495630_0019620 | Ga0495630_0019620_2636_3448 | 268 |
| 1377 | 3300046517 | Ga0495630_0030387 | Ga0495630_0030387_313_1119 | 268 |
| 1378 | 3300046517 | Ga0495630_0116795 | Ga0495630_0116795_175_981 | 268 |
| 1379 | 3300046522 | Ga0495643_0007496 | Ga0495643_0007496_2265_3071 | 268 |
| 1380 | 3300046524 | Ga0495648_0001784 | Ga0495648_0001784_13222_14028 | 268 |
| 1381 | 3300046524 | Ga0495648_0042607 | Ga0495648_0042607_739_1545 | 268 |
| 1382 | 3300046524 | Ga0495648_0081196 | Ga0495648_0081196_841_1647 | 268 |
| 1383 | 3300046524 | Ga0495648_0081694 | Ga0495648_0081694_346_1152 | 268 |
| 1384 | 3300046525 | Ga0495663_0016825 | Ga0495663_0016825_432_1259 | 268 |
| 1385 | 3300046526 | Ga0495666_0035671 | Ga0495666_0035671_1203_2009 | 268 |
| 1386 | 3300046529 | Ga0495652_0004272 | Ga0495652_0004272_4845_5651 | 268 |
| 1387 | 3300046529 | Ga0495652_0005705 | Ga0495652_0005705_3000_3812 | 268 |
| 1388 | 3300046529 | Ga0495652_0041756 | Ga0495652_0041756_1678_2484 | 268 |
| 1389 | 3300046529 | Ga0495652_0085466 | Ga0495652_0085466_1169_1975 | 268 |
| 1390 | 3300046529 | Ga0495652_0246980 | Ga0495652_0246980_405_1217 | 268 |
| 1391 | 3300046530 | Ga0495654_0071667 | Ga0495654_0071667_778_1584 | 268 |
| 1392 | 3300046531 | Ga0495665_0000130 | Ga0495665_0000130_13898_14704 | 268 |
| 1393 | 3300046531 | Ga0495665_0006644 | Ga0495665_0006644_2903_3709 | 268 |
| 1394 | 3300046533 | Ga0495640_0004006 | Ga0495640_0004006_6896_7708 | 268 |
| 1395 | 3300046533 | Ga0495640_0004971 | Ga0495640_0004971_8823_9629 | 268 |
| 1396 | 3300046533 | Ga0495640_0011709 | Ga0495640_0011709_4895_5701 | 268 |
| 1397 | 3300046533 | Ga0495640_0020751 | Ga0495640_0020751_3526_4332 | 268 |
| 1398 | 3300046533 | Ga0495640_0071384 | Ga0495640_0071384_878_1684 | 268 |
| 1399 | 3300046533 | Ga0495640_0095035 | Ga0495640_0095035_215_1027 | 268 |
| 1400 | 3300046533 | Ga0495640_0115050 | Ga0495640_0115050_841_1647 | 268 |
| 1401 | 3300046535 | Ga0495586_0020363 | Ga0495586_0020363_262_1074 | 268 |
| 1402 | 3300046535 | Ga0495586_0042890 | Ga0495586_0042890_1477_2283 | 268 |
| 1403 | 3300046535 | Ga0495586_0142899 | Ga0495586_0142899_475_1281 | 268 |
| 1404 | 3300046536 | Ga0495587_0001433 | Ga0495587_0001433_11857_12663 | 268 |
| 1405 | 3300046536 | Ga0495587_0021435 | Ga0495587_0021435_2081_2887 | 268 |
| 1406 | 3300046536 | Ga0495587_0060104 | Ga0495587_0060104_935_1741 | 268 |
| 1407 | 3300046536 | Ga0495587_0068435 | Ga0495587_0068435_1043_1849 | 268 |
| 1408 | 3300046536 | Ga0495587_0167947 | Ga0495587_0167947_312_1118 | 268 |
| 1409 | 3300046537 | Ga0495598_0013195 | Ga0495598_0013195_607_1434 | 268 |
| 1410 | 3300046539 | Ga0495621_0030725 | Ga0495621_0030725_933_1760 | 268 |
| 1411 | 3300046542 | Ga0495597_0016508 | Ga0495597_0016508_1731_2537 | 268 |
| 1412 | 3300046542 | Ga0495597_0026607 | Ga0495597_0026607_1680_2486 | 268 |
| 1413 | 3300046543 | Ga0495645_0023705 | Ga0495645_0023705_912_1718 | 268 |
| 1414 | 3300046543 | Ga0495645_0035960 | Ga0495645_0035960_2646_3458 | 268 |
| 1415 | 3300046543 | Ga0495645_0124602 | Ga0495645_0124602_764_1576 | 268 |
| 1416 | 3300046543 | Ga0495645_0223217 | Ga0495645_0223217_416_1222 | 268 |
| 1417 | 3300046557 | Ga0495622_0006054 | Ga0495622_0006054_828_1634 | 268 |
| 1418 | 3300046559 | Ga0495667_0006538 | Ga0495667_0006538_56_862 | 268 |
| 1419 | 3300046559 | Ga0495667_0013337 | Ga0495667_0013337_2366_3172 | 268 |
| 1420 | 3300046559 | Ga0495667_0019409 | Ga0495667_0019409_1228_2034 | 268 |
| 1421 | 3300046615 | Ga0495656_0011865 | Ga0495656_0011865_2269_3096 | 268 |
| 1422 | 3300046615 | Ga0495656_0104892 | Ga0495656_0104892_86_892 | 268 |
| 1423 | 3300046615 | Ga0495656_0198283 | Ga0495656_0198283_86_892 | 268 |
| 1424 | 3300046616 | Ga0495668_0058812 | Ga0495668_0058812_781_1587 | 268 |
| 1425 | 3300046642 | Ga0495634_0002801 | Ga0495634_0002801_45_851 | 268 |
| 1426 | 3300046642 | Ga0495634_0014766 | Ga0495634_0014766_1739_2551 | 268 |
| 1427 | 3300046642 | Ga0495634_0036929 | Ga0495634_0036929_141_947 | 268 |
| 1428 | 3300046642 | Ga0495634_0037734 | Ga0495634_0037734_1024_1830 | 268 |
| 1429 | 3300046642 | Ga0495634_0072032 | Ga0495634_0072032_620_1426 | 268 |
| 1430 | 3300046663 | Ga0495635_0000088 | Ga0495635_0000088_27522_28328 | 268 |
| 1431 | 3300046663 | Ga0495635_0002155 | Ga0495635_0002155_8156_8962 | 268 |
| 1432 | 3300046663 | Ga0495635_0003834 | Ga0495635_0003834_6285_7091 | 268 |
| 1433 | 3300046663 | Ga0495635_0006262 | Ga0495635_0006262_4823_5635 | 268 |
| 1434 | 3300046663 | Ga0495635_0049496 | Ga0495635_0049496_1353_2159 | 268 |
| 1435 | 3300046663 | Ga0495635_0188807 | Ga0495635_0188807_355_1161 | 268 |
| 1436 | 3300046663 | Ga0495635_0228812 | Ga0495635_0228812_155_961 | 268 |
| 1437 | 3300046665 | Ga0495661_0026825 | Ga0495661_0026825_916_1722 | 268 |
| 1438 | 3300046674 | Ga0495588_0002627 | Ga0495588_0002627_4967_5773 | 268 |
| 1439 | 3300046675 | Ga0495657_0006632 | Ga0495657_0006632_7097_7903 | 268 |
| 1440 | 3300046675 | Ga0495657_0010076 | Ga0495657_0010076_4881_5687 | 268 |
| 1441 | 3300046675 | Ga0495657_0025289 | Ga0495657_0025289_2317_3123 | 268 |
| 1442 | 3300046675 | Ga0495657_0045493 | Ga0495657_0045493_578_1384 | 268 |
| 1443 | 3300046678 | Ga0495599_0008020 | Ga0495599_0008020_4918_5724 | 268 |
| 1444 | 3300046678 | Ga0495599_0011303 | Ga0495599_0011303_2994_3800 | 268 |
| 1445 | 3300046678 | Ga0495599_0036813 | Ga0495599_0036813_1631_2437 | 268 |
| 1446 | 3300046678 | Ga0495599_0053396 | Ga0495599_0053396_1588_2400 | 268 |
| 1447 | 3300046678 | Ga0495599_0088351 | Ga0495599_0088351_924_1730 | 268 |
| 1448 | 3300046679 | Ga0495623_0008985 | Ga0495623_0008985_838_1644 | 268 |
| 1449 | 3300046679 | Ga0495623_0072455 | Ga0495623_0072455_848_1654 | 268 |
| 1450 | 3300046679 | Ga0495623_0086458 | Ga0495623_0086458_798_1604 | 268 |
| 1451 | 3300046680 | Ga0495646_0003222 | Ga0495646_0003222_5088_5894 | 268 |
| 1452 | 3300046680 | Ga0495646_0016220 | Ga0495646_0016220_2558_3364 | 268 |
| 1453 | 3300046680 | Ga0495646_0041957 | Ga0495646_0041957_1862_2674 | 268 |
| 1454 | 3300046680 | Ga0495646_0048886 | Ga0495646_0048886_85_891 | 268 |
| 1455 | 3300046680 | Ga0495646_0200630 | Ga0495646_0200630_169_975 | 268 |
| 1456 | 3300046681 | Ga0495647_0031473 | Ga0495647_0031473_989_1795 | 268 |
| 1457 | 3300046683 | Ga0495658_0000295 | Ga0495658_0000295_26496_27302 | 268 |
| 1458 | 3300046683 | Ga0495658_0066283 | Ga0495658_0066283_160_966 | 268 |
| 1459 | 3300046683 | Ga0495658_0125011 | Ga0495658_0125011_309_1115 | 268 |
| 1460 | 3300046689 | Ga0495613_0001707 | Ga0495613_0001707_1158_1964 | 268 |
| 1461 | 3300046689 | Ga0495613_0012740 | Ga0495613_0012740_3192_4004 | 268 |
| 1462 | 3300046689 | Ga0495613_0022225 | Ga0495613_0022225_3503_4309 | 268 |
| 1463 | 3300046689 | Ga0495613_0051374 | Ga0495613_0051374_647_1453 | 268 |
| 1464 | 3300046689 | Ga0495613_0217683 | Ga0495613_0217683_17_823 | 268 |
| 1465 | 3300046689 | Ga0495613_0371317 | Ga0495613_0371317_106_912 | 268 |
| 1466 | 3300046690 | Ga0495624_0000079 | Ga0495624_0000079_14647_15453 | 268 |
| 1467 | 3300046690 | Ga0495624_0007161 | Ga0495624_0007161_1819_2631 | 268 |
| 1468 | 3300046690 | Ga0495624_0076668 | Ga0495624_0076668_79_885 | 268 |
| 1469 | 3300046690 | Ga0495624_0173351 | Ga0495624_0173351_350_1156 | 268 |
| 1470 | 3300046691 | Ga0495670_0007514 | Ga0495670_0007514_2429_3235 | 268 |
| 1471 | 3300046692 | Ga0495671_0102611 | Ga0495671_0102611_26_832 | 268 |
| 1472 | 3300046692 | Ga0495671_0169141 | Ga0495671_0169141_57_863 | 268 |
| 1473 | 3300046794 | Ga0495589_0171033 | Ga0495589_0171033_54_860 | 268 |
| 1474 | 3300046809 | Ga0495600_0000715 | Ga0495600_0000715_3219_4025 | 268 |
| 1475 | 3300046809 | Ga0495600_0003313 | Ga0495600_0003313_5287_6093 | 268 |
| 1476 | 3300046809 | Ga0495600_0016414 | Ga0495600_0016414_3206_4012 | 268 |
| 1477 | 3300046809 | Ga0495600_0045331 | Ga0495600_0045331_1393_2205 | 268 |
| 1478 | 3300046809 | Ga0495600_0206043 | Ga0495600_0206043_445_1251 | 268 |
| 1479 | 3300047315 | Ga0495581_0000813 | Ga0495581_0000813_2510_3316 | 268 |
| 1480 | 3300047315 | Ga0495581_0023086 | Ga0495581_0023086_235_1047 | 268 |
| 1481 | 3300047315 | Ga0495581_0034914 | Ga0495581_0034914_1157_1963 | 268 |
| 1482 | 3300047315 | Ga0495581_0173687 | Ga0495581_0173687_430_1236 | 268 |
| 1483 | 3300047317 | Ga0495604_0001221 | Ga0495604_0001221_4081_4887 | 268 |
| 1484 | 3300047317 | Ga0495604_0008665 | Ga0495604_0008665_80_886 | 268 |
| 1485 | 3300047317 | Ga0495604_0075269 | Ga0495604_0075269_115_921 | 268 |
| 1486 | 3300047317 | Ga0495604_0081814 | Ga0495604_0081814_1156_1968 | 268 |
| 1487 | 3300047317 | Ga0495604_0108302 | Ga0495604_0108302_881_1687 | 268 |
| 1488 | 3300047317 | Ga0495604_0313690 | Ga0495604_0313690_95_901 | 268 |
| 1489 | 3300047319 | Ga0495674_0001729 | Ga0495674_0001729_4575_5381 | 268 |
| 1490 | 3300047319 | Ga0495674_0009348 | Ga0495674_0009348_3684_4496 | 268 |
| 1491 | 3300047319 | Ga0495674_0027713 | Ga0495674_0027713_1646_2452 | 268 |
| 1492 | 3300047319 | Ga0495674_0037672 | Ga0495674_0037672_1315_2121 | 268 |
| 1493 | 3300047319 | Ga0495674_0038076 | Ga0495674_0038076_2762_3568 | 268 |
| 1494 | 3300047319 | Ga0495674_0271468 | Ga0495674_0271468_132_944 | 268 |
| 1495 | 3300047320 | Ga0495672_0032478 | Ga0495672_0032478_589_1395 | 268 |
| 1496 | 3300047320 | Ga0495672_0097888 | Ga0495672_0097888_646_1452 | 268 |
| 1497 | 3300047321 | Ga0495676_0026719 | Ga0495676_0026719_3151_3957 | 268 |
| 1498 | 3300047321 | Ga0495676_0120138 | Ga0495676_0120138_204_1016 | 268 |
| 1499 | 3300047321 | Ga0495676_0134409 | Ga0495676_0134409_592_1398 | 268 |
| 1500 | 3300047322 | Ga0495680_0003010 | Ga0495680_0003010_1576_2382 | 268 |
| 1501 | 3300047322 | Ga0495680_0004956 | Ga0495680_0004956_4512_5318 | 268 |
| 1502 | 3300047322 | Ga0495680_0044392 | Ga0495680_0044392_1172_1984 | 268 |
| 1503 | 3300047322 | Ga0495680_0056905 | Ga0495680_0056905_1534_2340 | 268 |
| 1504 | 3300047322 | Ga0495680_0154852 | Ga0495680_0154852_430_1242 | 268 |
| 1505 | 3300047323 | Ga0495683_0151039 | Ga0495683_0151039_123_929 | 268 |
| 1506 | 3300047444 | Ga0495675_0008090 | Ga0495675_0008090_4845_5651 | 268 |
| 1507 | 3300047444 | Ga0495675_0088852 | Ga0495675_0088852_103_909 | 268 |
| 1508 | 3300047469 | Ga0495673_0013336 | Ga0495673_0013336_957_1763 | 268 |
| 1509 | 3300047471 | Ga0495684_0001916 | Ga0495684_0001916_12385_13191 | 268 |
| 1510 | 3300047471 | Ga0495684_0002318 | Ga0495684_0002318_3307_4119 | 268 |
| 1511 | 3300047471 | Ga0495684_0003908 | Ga0495684_0003908_2950_3762 | 268 |
| 1512 | 3300047471 | Ga0495684_0018409 | Ga0495684_0018409_2061_2867 | 268 |
| 1513 | 3300047471 | Ga0495684_0027736 | Ga0495684_0027736_1197_2003 | 268 |
| 1514 | 3300047471 | Ga0495684_0059076 | Ga0495684_0059076_1762_2568 | 268 |
| 1515 | 3300047471 | Ga0495684_0077854 | Ga0495684_0077854_479_1291 | 268 |
| 1516 | 3300047472 | Ga0495686_0038077 | Ga0495686_0038077_1366_2172 | 268 |
| 1517 | 3300047472 | Ga0495686_0048116 | Ga0495686_0048116_1150_1956 | 268 |
| 1518 | 3300047472 | Ga0495686_0083636 | Ga0495686_0083636_425_1231 | 268 |
| 1519 | 3300047472 | Ga0495686_0098662 | Ga0495686_0098662_515_1321 | 268 |
| 1520 | 3300047472 | Ga0495686_0153803 | Ga0495686_0153803_263_1069 | 268 |
| 1521 | 3300047472 | Ga0495686_0161489 | Ga0495686_0161489_192_998 | 268 |
| 1522 | 3300047673 | Ga0495593_0000566 | Ga0495593_0000566_12894_13700 | 268 |
| 1523 | 3300047673 | Ga0495593_0015457 | Ga0495593_0015457_2498_3310 | 268 |
| 1524 | 3300047673 | Ga0495593_0019520 | Ga0495593_0019520_484_1290 | 268 |
| 1525 | 3300047673 | Ga0495593_0020975 | Ga0495593_0020975_1886_2692 | 268 |
| 1526 | 3300047673 | Ga0495593_0021001 | Ga0495593_0021001_1027_1833 | 268 |
| 1527 | 3300047673 | Ga0495593_0077249 | Ga0495593_0077249_395_1201 | 268 |
| 1528 | 3300048088 | Ga0495602_0004696 | Ga0495602_0004696_8070_8876 | 268 |
| 1529 | 3300048088 | Ga0495602_0016336 | Ga0495602_0016336_1426_2232 | 268 |
| 1530 | 3300048088 | Ga0495602_0040667 | Ga0495602_0040667_1040_1846 | 268 |
| 1531 | 3300048088 | Ga0495602_0044907 | Ga0495602_0044907_2477_3289 | 268 |
| 1532 | 3300048088 | Ga0495602_0060397 | Ga0495602_0060397_854_1660 | 268 |
| 1533 | 3300048089 | Ga0495614_0019838 | Ga0495614_0019838_551_1357 | 268 |
| 1534 | 3300048903 | Ga0496100_0064505 | Ga0496100_0064505_159_965 | 268 |
| 1535 | 3300048903 | Ga0496100_0182248 | Ga0496100_0182248_370_1176 | 268 |
| 1536 | 3300048903 | Ga0496100_0205322 | Ga0496100_0205322_377_1183 | 268 |
| 1537 | 3300048904 | Ga0496101_0083482 | Ga0496101_0083482_1156_1962 | 268 |
| 1538 | 3300048904 | Ga0496101_0262613 | Ga0496101_0262613_522_1328 | 268 |
| 1539 | 3300048904 | Ga0496101_0317155 | Ga0496101_0317155_245_1051 | 268 |
| 1540 | 3300048905 | Ga0496102_0024292 | Ga0496102_0024292_1573_2379 | 268 |
| 1541 | 3300048905 | Ga0496102_0031372 | Ga0496102_0031372_3415_4221 | 268 |
| 1542 | 3300048905 | Ga0496102_0072784 | Ga0496102_0072784_2259_3065 | 268 |
| 1543 | 3300048905 | Ga0496102_0494059 | Ga0496102_0494059_10_816 | 268 |
| 1544 | 3300048906 | Ga0496103_0004130 | Ga0496103_0004130_7430_8236 | 268 |
| 1545 | 3300048906 | Ga0496103_0111218 | Ga0496103_0111218_349_1155 | 268 |
| 1546 | 3300048907 | Ga0496104_0021422 | Ga0496104_0021422_1772_2578 | 268 |
| 1547 | 3300048907 | Ga0496104_0029317 | Ga0496104_0029317_1005_1811 | 268 |
| 1548 | 3300048907 | Ga0496104_0030986 | Ga0496104_0030986_764_1570 | 268 |
| 1549 | 3300048907 | Ga0496104_0079108 | Ga0496104_0079108_2079_2885 | 268 |
| 1550 | 3300048908 | Ga0496105_0009668 | Ga0496105_0009668_2820_3626 | 268 |
| 1551 | 3300048908 | Ga0496105_0032798 | Ga0496105_0032798_950_1756 | 268 |
| 1552 | 3300048908 | Ga0496105_0074989 | Ga0496105_0074989_730_1536 | 268 |
| 1553 | 3300048908 | Ga0496105_0261563 | Ga0496105_0261563_357_1163 | 268 |
| 1554 | 3300048909 | Ga0496106_0000116 | Ga0496106_0000116_34535_35341 | 268 |
| 1555 | 3300048909 | Ga0496106_0022726 | Ga0496106_0022726_598_1404 | 268 |
| 1556 | 3300048909 | Ga0496106_0024317 | Ga0496106_0024317_2537_3343 | 268 |
| 1557 | 3300048909 | Ga0496106_0062719 | Ga0496106_0062719_1319_2125 | 268 |
| 1558 | 3300048909 | Ga0496106_0114384 | Ga0496106_0114384_332_1138 | 268 |
| 1559 | 3300048909 | Ga0496106_0239901 | Ga0496106_0239901_594_1400 | 268 |
| 1560 | 3300048909 | Ga0496106_0254815 | Ga0496106_0254815_40_846 | 268 |
| 1561 | 3300048910 | Ga0496107_0021741 | Ga0496107_0021741_1941_2747 | 268 |
| 1562 | 3300048910 | Ga0496107_0094510 | Ga0496107_0094510_1327_2133 | 268 |
| 1563 | 3300048910 | Ga0496107_0195916 | Ga0496107_0195916_315_1121 | 268 |
| 1564 | 3300048910 | Ga0496107_0294035 | Ga0496107_0294035_299_1105 | 268 |
| 1565 | 3300048911 | Ga0496108_0037082 | Ga0496108_0037082_1062_1868 | 268 |
| 1566 | 3300048911 | Ga0496108_0071572 | Ga0496108_0071572_122_928 | 268 |
| 1567 | 3300048911 | Ga0496108_0154633 | Ga0496108_0154633_813_1619 | 268 |
| 1568 | 3300048911 | Ga0496108_0391171 | Ga0496108_0391171_173_985 | 268 |
| 1569 | 3300048911 | Ga0496108_0429678 | Ga0496108_0429678_267_1073 | 268 |
| 1570 | 3300048911 | Ga0496108_0451193 | Ga0496108_0451193_139_945 | 268 |
| 1571 | 3300048912 | Ga0496109_0000767 | Ga0496109_0000767_24533_25339 | 268 |
| 1572 | 3300048912 | Ga0496109_0031408 | Ga0496109_0031408_1322_2128 | 268 |
| 1573 | 3300048912 | Ga0496109_0254244 | Ga0496109_0254244_618_1424 | 268 |
| 1574 | 3300048912 | Ga0496109_0389691 | Ga0496109_0389691_17_823 | 268 |
| 1575 | 3300048913 | Ga0496110_0024667 | Ga0496110_0024667_795_1601 | 268 |
| 1576 | 3300048913 | Ga0496110_0123068 | Ga0496110_0123068_177_983 | 268 |
| 1577 | 3300048913 | Ga0496110_0225784 | Ga0496110_0225784_834_1640 | 268 |
| 1578 | 3300048913 | Ga0496110_0264610 | Ga0496110_0264610_329_1135 | 268 |
| 1579 | 3300048913 | Ga0496110_0339412 | Ga0496110_0339412_315_1121 | 268 |
| 1580 | 3300048914 | Ga0496111_0024351 | Ga0496111_0024351_851_1657 | 268 |
| 1581 | 3300048914 | Ga0496111_0220107 | Ga0496111_0220107_121_927 | 268 |
| 1582 | 3300048915 | Ga0496112_0000016 | Ga0496112_0000016_38185_38991 | 268 |
| 1583 | 3300048915 | Ga0496112_0014881 | Ga0496112_0014881_4207_5019 | 268 |
| 1584 | 3300048915 | Ga0496112_0015593 | Ga0496112_0015593_3441_4247 | 268 |
| 1585 | 3300048915 | Ga0496112_0087250 | Ga0496112_0087250_375_1181 | 268 |
| 1586 | 3300048915 | Ga0496112_0128319 | Ga0496112_0128319_1152_1958 | 268 |
| 1587 | 3300048915 | Ga0496112_0149949 | Ga0496112_0149949_1078_1890 | 268 |
| 1588 | 3300048915 | Ga0496112_0180437 | Ga0496112_0180437_786_1592 | 268 |
| 1589 | 3300048915 | Ga0496112_0311744 | Ga0496112_0311744_393_1199 | 268 |
| 1590 | 3300048916 | Ga0496113_0069408 | Ga0496113_0069408_1564_2370 | 268 |
| 1591 | 3300048916 | Ga0496113_0136406 | Ga0496113_0136406_15_821 | 268 |
| 1592 | 3300048916 | Ga0496113_0137829 | Ga0496113_0137829_1059_1865 | 268 |
| 1593 | 3300048916 | Ga0496113_0220184 | Ga0496113_0220184_433_1239 | 268 |
| 1594 | 3300048916 | Ga0496113_0268183 | Ga0496113_0268183_352_1158 | 268 |
| 1595 | 3300048916 | Ga0496113_0548198 | Ga0496113_0548198_84_890 | 268 |
| 1596 | 3300048917 | Ga0496114_0128189 | Ga0496114_0128189_414_1220 | 268 |
| 1597 | 3300048917 | Ga0496114_0177823 | Ga0496114_0177823_29_835 | 268 |
| 1598 | 3300048917 | Ga0496114_0317996 | Ga0496114_0317996_415_1221 | 268 |
| 1599 | 3300048918 | Ga0496115_0048150 | Ga0496115_0048150_899_1705 | 268 |
| 1600 | 3300048918 | Ga0496115_0121003 | Ga0496115_0121003_409_1215 | 268 |
| 1601 | 3300048918 | Ga0496115_0531175 | Ga0496115_0531175_99_905 | 268 |
| 1602 | 3300048919 | Ga0496116_0000887 | Ga0496116_0000887_21359_22165 | 268 |
| 1603 | 3300048919 | Ga0496116_0110033 | Ga0496116_0110033_789_1595 | 268 |
| 1604 | 3300048919 | Ga0496116_0163984 | Ga0496116_0163984_294_1181 | 268 |
| 1605 | 3300048920 | Ga0496117_0015351 | Ga0496117_0015351_2179_2985 | 268 |
| 1606 | 3300048920 | Ga0496117_0042896 | Ga0496117_0042896_1854_2660 | 268 |
| 1607 | 3300048920 | Ga0496117_0112285 | Ga0496117_0112285_662_1468 | 268 |
| 1608 | 3300048920 | Ga0496117_0117519 | Ga0496117_0117519_29_835 | 268 |
| 1609 | 3300048920 | Ga0496117_0248257 | Ga0496117_0248257_30_836 | 268 |
| 1610 | 3300048921 | Ga0496118_0006231 | Ga0496118_0006231_7041_7847 | 268 |
| 1611 | 3300048921 | Ga0496118_0023410 | Ga0496118_0023410_1126_2013 | 268 |
| 1612 | 3300048921 | Ga0496118_0040378 | Ga0496118_0040378_2530_3336 | 268 |
| 1613 | 3300048921 | Ga0496118_0045409 | Ga0496118_0045409_976_1782 | 268 |
| 1614 | 3300048921 | Ga0496118_0053224 | Ga0496118_0053224_728_1534 | 268 |
| 1615 | 3300048921 | Ga0496118_0099050 | Ga0496118_0099050_774_1580 | 268 |
| 1616 | 3300048922 | Ga0496119_0014445 | Ga0496119_0014445_3555_4361 | 268 |
| 1617 | 3300048922 | Ga0496119_0168290 | Ga0496119_0168290_275_1081 | 268 |
| 1618 | 3300048923 | Ga0496120_0080284 | Ga0496120_0080284_631_1437 | 268 |
| 1619 | 3300048923 | Ga0496120_0120086 | Ga0496120_0120086_401_1207 | 268 |
| 1620 | 3300048924 | Ga0496121_0000041 | Ga0496121_0000041_281610_282416 | 268 |
| 1621 | 3300048924 | Ga0496121_0002334 | Ga0496121_0002334_778_1584 | 268 |
| 1622 | 3300048924 | Ga0496121_0002685 | Ga0496121_0002685_14689_15495 | 268 |
| 1623 | 3300048924 | Ga0496121_0041583 | Ga0496121_0041583_1715_2602 | 268 |
| 1624 | 3300048924 | Ga0496121_0061958 | Ga0496121_0061958_1704_2510 | 268 |
| 1625 | 3300048924 | Ga0496121_0122140 | Ga0496121_0122140_380_1186 | 268 |
| 1626 | 3300048924 | Ga0496121_0141895 | Ga0496121_0141895_207_1013 | 268 |
| 1627 | 3300048924 | Ga0496121_0442191 | Ga0496121_0442191_20_826 | 268 |
| 1628 | 3300048925 | Ga0496122_0007556 | Ga0496122_0007556_4120_4926 | 268 |
| 1629 | 3300048925 | Ga0496122_0016277 | Ga0496122_0016277_4025_4831 | 268 |
| 1630 | 3300048925 | Ga0496122_0059832 | Ga0496122_0059832_1309_2115 | 268 |
| 1631 | 3300048926 | Ga0496123_0030507 | Ga0496123_0030507_2078_2884 | 268 |
| 1632 | 3300048927 | Ga0496124_0000910 | Ga0496124_0000910_41181_41987 | 268 |
| 1633 | 3300048927 | Ga0496124_0057376 | Ga0496124_0057376_2103_2909 | 268 |
| 1634 | 3300048927 | Ga0496124_0106460 | Ga0496124_0106460_1393_2199 | 268 |
| 1635 | 3300048927 | Ga0496124_0110332 | Ga0496124_0110332_1235_2041 | 268 |
| 1636 | 3300048928 | Ga0496125_0000092 | Ga0496125_0000092_188302_189108 | 268 |
| 1637 | 3300048928 | Ga0496125_0005023 | Ga0496125_0005023_1719_2525 | 268 |
| 1638 | 3300048928 | Ga0496125_0007013 | Ga0496125_0007013_3111_3917 | 268 |
| 1639 | 3300048928 | Ga0496125_0008149 | Ga0496125_0008149_7631_8437 | 268 |
| 1640 | 3300048928 | Ga0496125_0013816 | Ga0496125_0013816_1275_2081 | 268 |
| 1641 | 3300048928 | Ga0496125_0144375 | Ga0496125_0144375_88_894 | 268 |
| 1642 | 3300048929 | Ga0496126_0003329 | Ga0496126_0003329_14288_15094 | 268 |
| 1643 | 3300048929 | Ga0496126_0011637 | Ga0496126_0011637_2516_3322 | 268 |
| 1644 | 3300048929 | Ga0496126_0012110 | Ga0496126_0012110_5013_5819 | 268 |
| 1645 | 3300048929 | Ga0496126_0023131 | Ga0496126_0023131_2902_3708 | 268 |
| 1646 | 3300048929 | Ga0496126_0040296 | Ga0496126_0040296_2290_3096 | 268 |
| 1647 | 3300048929 | Ga0496126_0060287 | Ga0496126_0060287_2044_2850 | 268 |
| 1648 | 3300048929 | Ga0496126_0060318 | Ga0496126_0060318_1727_2533 | 268 |
| 1649 | 3300048929 | Ga0496126_0065503 | Ga0496126_0065503_663_1469 | 268 |
| 1650 | 3300048929 | Ga0496126_0129680 | Ga0496126_0129680_649_1455 | 268 |
| 1651 | 3300048929 | Ga0496126_0139840 | Ga0496126_0139840_901_1707 | 268 |
| 1652 | 3300048929 | Ga0496126_0198101 | Ga0496126_0198101_851_1657 | 268 |
| 1653 | 3300048929 | Ga0496126_0218886 | Ga0496126_0218886_294_1100 | 268 |
| 1654 | 3300048929 | Ga0496126_0242229 | Ga0496126_0242229_615_1484 | 268 |
| 1655 | 3300048929 | Ga0496126_0336710 | Ga0496126_0336710_293_1099 | 268 |
| 1656 | 3300049460 | Ga0495682_0021395 | Ga0495682_0021395_1139_1945 | 268 |
| 1657 | 3300049460 | Ga0495682_0073204 | Ga0495682_0073204_376_1182 | 268 |
| 1658 | 3300049568 | Ga0501031_0083908 | Ga0501031_0083908_411_1217 | 268 |
| 1659 | 3300049568 | Ga0501031_0151868 | Ga0501031_0151868_415_1221 | 268 |
| 1660 | 3300049568 | Ga0501031_0181556 | Ga0501031_0181556_35_841 | 268 |
| 1661 | 3300049569 | Ga0501032_0000046 | Ga0501032_0000046_44231_45037 | 268 |
| 1662 | 3300049569 | Ga0501032_0009690 | Ga0501032_0009690_1059_1865 | 268 |
| 1663 | 3300049569 | Ga0501032_0012480 | Ga0501032_0012480_689_1495 | 268 |
| 1664 | 3300049569 | Ga0501032_0031524 | Ga0501032_0031524_2708_3514 | 268 |
| 1665 | 3300049570 | Ga0501033_0001341 | Ga0501033_0001341_1856_2662 | 268 |
| 1666 | 3300049570 | Ga0501033_0001563 | Ga0501033_0001563_12525_13331 | 268 |
| 1667 | 3300049570 | Ga0501033_0101248 | Ga0501033_0101248_427_1233 | 268 |
| 1668 | 3300049570 | Ga0501033_0152143 | Ga0501033_0152143_723_1529 | 268 |
| 1669 | 3300049570 | Ga0501033_0171027 | Ga0501033_0171027_478_1284 | 268 |
| 1670 | 3300049571 | Ga0501034_0001492 | Ga0501034_0001492_14833_15639 | 268 |
| 1671 | 3300049571 | Ga0501034_0071642 | Ga0501034_0071642_305_1111 | 268 |
| 1672 | 3300049571 | Ga0501034_0089953 | Ga0501034_0089953_2074_2880 | 268 |
| 1673 | 3300049571 | Ga0501034_0134959 | Ga0501034_0134959_1241_2047 | 268 |
| 1674 | 3300049571 | Ga0501034_0288271 | Ga0501034_0288271_39_845 | 268 |
| 1675 | 3300049572 | Ga0501036_0000326 | Ga0501036_0000326_10511_11317 | 268 |
| 1676 | 3300049572 | Ga0501036_0046952 | Ga0501036_0046952_1729_2535 | 268 |
| 1677 | 3300049572 | Ga0501036_0176428 | Ga0501036_0176428_82_888 | 268 |
| 1678 | 3300049572 | Ga0501036_0258825 | Ga0501036_0258825_406_1212 | 268 |
| 1679 | 3300049572 | Ga0501036_0453407 | Ga0501036_0453407_49_855 | 268 |
| 1680 | 3300049573 | Ga0501037_0000309 | Ga0501037_0000309_14751_15557 | 268 |
| 1681 | 3300049573 | Ga0501037_0000457 | Ga0501037_0000457_15023_15829 | 268 |
| 1682 | 3300049573 | Ga0501037_0205292 | Ga0501037_0205292_404_1210 | 268 |
| 1683 | 3300049573 | Ga0501037_0231096 | Ga0501037_0231096_467_1273 | 268 |
| 1684 | 3300049573 | Ga0501037_0321889 | Ga0501037_0321889_150_956 | 268 |
| 1685 | 3300049574 | Ga0501038_0000026 | Ga0501038_0000026_111816_112622 | 268 |
| 1686 | 3300049574 | Ga0501038_0002061 | Ga0501038_0002061_2613_3419 | 268 |
| 1687 | 3300049574 | Ga0501038_0016287 | Ga0501038_0016287_1713_2519 | 268 |
| 1688 | 3300049575 | Ga0501039_0074976 | Ga0501039_0074976_978_1784 | 268 |
| 1689 | 3300049575 | Ga0501039_0118408 | Ga0501039_0118408_980_1786 | 268 |
| 1690 | 3300049578 | Ga0501042_0051874 | Ga0501042_0051874_1527_2333 | 268 |
| 1691 | 3300049578 | Ga0501042_0263549 | Ga0501042_0263549_202_1008 | 268 |
| 1692 | 3300049579 | Ga0501043_0000135 | Ga0501043_0000135_45090_45896 | 268 |
| 1693 | 3300049579 | Ga0501043_0022795 | Ga0501043_0022795_1256_2062 | 268 |
| 1694 | 3300049579 | Ga0501043_0397547 | Ga0501043_0397547_11_817 | 268 |
| 1695 | 3300049580 | Ga0501046_0019630 | Ga0501046_0019630_1823_2629 | 268 |
| 1696 | 3300049580 | Ga0501046_0109514 | Ga0501046_0109514_395_1201 | 268 |
| 1697 | 3300049581 | Ga0501047_0000101 | Ga0501047_0000101_63164_63970 | 268 |
| 1698 | 3300049581 | Ga0501047_0015152 | Ga0501047_0015152_2765_3571 | 268 |
| 1699 | 3300049581 | Ga0501047_0021168 | Ga0501047_0021168_1457_2263 | 268 |
| 1700 | 3300049581 | Ga0501047_0061378 | Ga0501047_0061378_643_1449 | 268 |
| 1701 | 3300049581 | Ga0501047_0076352 | Ga0501047_0076352_255_1061 | 268 |
| 1702 | 3300049581 | Ga0501047_0222535 | Ga0501047_0222535_840_1646 | 268 |
| 1703 | 3300049581 | Ga0501047_0391244 | Ga0501047_0391244_389_1195 | 268 |
| 1704 | 3300049584 | Ga0501068_0000977 | Ga0501068_0000977_1525_2331 | 268 |
| 1705 | 3300049584 | Ga0501068_0004441 | Ga0501068_0004441_2015_2821 | 268 |
| 1706 | 3300049584 | Ga0501068_0107517 | Ga0501068_0107517_405_1211 | 268 |
| 1707 | 3300049585 | Ga0501069_0023367 | Ga0501069_0023367_445_1251 | 268 |
| 1708 | 3300049586 | Ga0501070_0000297 | Ga0501070_0000297_28401_29207 | 268 |
| 1709 | 3300049586 | Ga0501070_0011694 | Ga0501070_0011694_3572_4378 | 268 |
| 1710 | 3300049586 | Ga0501070_0170731 | Ga0501070_0170731_213_1019 | 268 |
| 1711 | 3300049587 | Ga0501071_0139437 | Ga0501071_0139437_350_1156 | 268 |
| 1712 | 3300049589 | Ga0501073_0000840 | Ga0501073_0000840_19626_20432 | 268 |
| 1713 | 3300049589 | Ga0501073_0029876 | Ga0501073_0029876_2656_3462 | 268 |
| 1714 | 3300049590 | Ga0501074_0014547 | Ga0501074_0014547_115_921 | 268 |
| 1715 | 3300049590 | Ga0501074_0047411 | Ga0501074_0047411_241_1047 | 268 |
| 1716 | 3300049593 | Ga0501077_0157100 | Ga0501077_0157100_624_1430 | 268 |
| 1717 | 3300049741 | Ga0501079_0206584 | Ga0501079_0206584_347_1153 | 268 |
| 1718 | 3300049741 | Ga0501079_0260835 | Ga0501079_0260835_195_1001 | 268 |
| 1719 | 3300049742 | Ga0501080_0000121 | Ga0501080_0000121_51759_52565 | 268 |
| 1720 | 3300049742 | Ga0501080_0339254 | Ga0501080_0339254_256_1062 | 268 |
| 1721 | 3300049743 | Ga0501081_0451496 | Ga0501081_0451496_120_926 | 268 |
| 1722 | 3300049822 | Ga0501035_0000588 | Ga0501035_0000588_17007_17813 | 268 |
| 1723 | 3300049822 | Ga0501035_0022877 | Ga0501035_0022877_2368_3174 | 268 |
| 1724 | 3300049822 | Ga0501035_0071627 | Ga0501035_0071627_122_928 | 268 |
| 1725 | 3300049822 | Ga0501035_0251576 | Ga0501035_0251576_539_1345 | 268 |
| 1726 | 3300049822 | Ga0501035_0384522 | Ga0501035_0384522_78_884 | 268 |
| 1727 | 3300049823 | Ga0501044_0002089 | Ga0501044_0002089_16509_17315 | 268 |
| 1728 | 3300049823 | Ga0501044_0033001 | Ga0501044_0033001_2493_3299 | 268 |
| 1729 | 3300049823 | Ga0501044_0049387 | Ga0501044_0049387_386_1192 | 268 |
| 1730 | 3300049823 | Ga0501044_0061427 | Ga0501044_0061427_2006_2812 | 268 |
| 1731 | 3300049823 | Ga0501044_0087029 | Ga0501044_0087029_2160_2972 | 268 |
| 1732 | 3300049823 | Ga0501044_0198500 | Ga0501044_0198500_686_1492 | 268 |
| 1733 | 3300049823 | Ga0501044_0206966 | Ga0501044_0206966_546_1352 | 268 |
| 1734 | 3300049823 | Ga0501044_0327811 | Ga0501044_0327811_453_1259 | 268 |
| 1735 | 3300049823 | Ga0501044_0409443 | Ga0501044_0409443_410_1216 | 268 |
| 1736 | 3300049824 | Ga0501045_0008047 | Ga0501045_0008047_6390_7196 | 268 |
| 1737 | 3300049824 | Ga0501045_0021109 | Ga0501045_0021109_3678_4484 | 268 |
| 1738 | 3300050490 | nmdc:mga03n38_99571_c1 | nmdc:mga03n38_99571_c1_133_939 | 268 |
| 1739 | 3300050491 | nmdc:mga00v17_35768_c1 | nmdc:mga00v17_35768_c1_1679_2485 | 268 |
| 1740 | 3300050491 | nmdc:mga00v17_83059_c1 | nmdc:mga00v17_83059_c1_1176_1982 | 268 |
| 1741 | 3300050492 | nmdc:mga0yw44_305994_c1 | nmdc:mga0yw44_305994_c1_194_1000 | 268 |
| 1742 | 3300050492 | nmdc:mga0yw44_9069_c1 | nmdc:mga0yw44_9069_c1_659_1465 | 268 |
| 1743 | 3300050493 | nmdc:mga0k408_9648_c1 | nmdc:mga0k408_9648_c1_2463_3269 | 268 |
| 1744 | 3300050494 | nmdc:mga06z11_43075_c1 | nmdc:mga06z11_43075_c1_1218_2024 | 268 |
| 1745 | 3300050494 | nmdc:mga06z11_4937_c1 | nmdc:mga06z11_4937_c1_158_964 | 268 |
| 1746 | 3300050511 | nmdc:mga08y16_20502_c1 | nmdc:mga08y16_20502_c1_979_1803 | 268 |
| 1747 | 3300050512 | nmdc:mga0n895_113422_c1 | nmdc:mga0n895_113422_c1_1271_2077 | 268 |
| 1748 | 3300050512 | nmdc:mga0n895_300581_c1 | nmdc:mga0n895_300581_c1_363_1169 | 268 |
| 1749 | 3300050512 | nmdc:mga0n895_450009_c1 | nmdc:mga0n895_450009_c1_57_863 | 268 |
| 1750 | 3300050513 | nmdc:mga0rr50_287994_c1 | nmdc:mga0rr50_287994_c1_534_1340 | 268 |
| 1751 | 3300050514 | nmdc:mga08x19_358814_c1 | nmdc:mga08x19_358814_c1_21_827 | 268 |
| 1752 | 3300050514 | nmdc:mga08x19_61814_c1 | nmdc:mga08x19_61814_c1_1350_2162 | 268 |
| 1753 | 3300050516 | nmdc:mga0sz30_31406_c1 | nmdc:mga0sz30_31406_c1_444_1250 | 268 |
| 1754 | 3300053077 | Ga0495601_0002964 | Ga0495601_0002964_8535_9347 | 268 |
| 1755 | 3300053077 | Ga0495601_0011143 | Ga0495601_0011143_1771_2577 | 268 |
| 1756 | 3300053077 | Ga0495601_0110968 | Ga0495601_0110968_661_1473 | 268 |
| 1757 | 3300053077 | Ga0495601_0163376 | Ga0495601_0163376_131_937 | 268 |
| 1758 | 3300053078 | Ga0495612_0001295 | Ga0495612_0001295_3000_3812 | 268 |
| 1759 | 3300053078 | Ga0495612_0009654 | Ga0495612_0009654_1548_2354 | 268 |
| 1760 | 3300053078 | Ga0495612_0041156 | Ga0495612_0041156_935_1741 | 268 |
| 1761 | 3300053080 | Ga0500635_0007489 | Ga0500635_0007489_1033_1839 | 268 |
| 1762 | 3300053084 | Ga0495595_0046163 | Ga0495595_0046163_685_1491 | 268 |
| 1763 | 3300053084 | Ga0495595_0093655 | Ga0495595_0093655_27_833 | 268 |
| 1764 | 3300053084 | Ga0495595_0121161 | Ga0495595_0121161_239_1051 | 268 |
| 1765 | 3300053085 | Ga0495619_0000332 | Ga0495619_0000332_6923_7729 | 268 |
| 1766 | 3300053085 | Ga0495619_0001363 | Ga0495619_0001363_6086_6898 | 268 |
| 1767 | 3300053085 | Ga0495619_0024539 | Ga0495619_0024539_459_1265 | 268 |
| 1768 | 3300053085 | Ga0495619_0084961 | Ga0495619_0084961_868_1674 | 268 |
| 1769 | 3300053085 | Ga0495619_0095263 | Ga0495619_0095263_399_1205 | 268 |
| 1770 | 3300053087 | Ga0500643_000019 | Ga0500643_000019_94892_95698 | 268 |
| 1771 | 3300053088 | Ga0500644_0021160 | Ga0500644_0021160_916_1722 | 268 |
| 1772 | 3300053093 | Ga0500651_0037492 | Ga0500651_0037492_252_1058 | 268 |
| 1773 | 3300053093 | Ga0500651_0101648 | Ga0500651_0101648_743_1549 | 268 |
| 1774 | 3300053093 | Ga0500651_0222345 | Ga0500651_0222345_168_974 | 268 |
| 1775 | 3300053094 | Ga0500566_0000071 | Ga0500566_0000071_42217_43023 | 268 |
| 1776 | 3300053094 | Ga0500566_0000537 | Ga0500566_0000537_291_1097 | 268 |
| 1777 | 3300053094 | Ga0500566_0000554 | Ga0500566_0000554_15416_16222 | 268 |
| 1778 | 3300053096 | Ga0500641_0017441 | Ga0500641_0017441_1579_2385 | 268 |
| 1779 | 3300053096 | Ga0500641_0028512 | Ga0500641_0028512_698_1504 | 268 |
| 1780 | 3300053097 | Ga0500648_082402 | Ga0500648_082402_332_1138 | 268 |
| 1781 | 3300053098 | Ga0500650_0000453 | Ga0500650_0000453_7762_8568 | 268 |
| 1782 | 3300053098 | Ga0500650_0121043 | Ga0500650_0121043_160_966 | 268 |
| 1783 | 3300053103 | Ga0500555_004804 | Ga0500555_004804_2997_3803 | 268 |
| 1784 | 3300053103 | Ga0500555_059998 | Ga0500555_059998_34_840 | 268 |
| 1785 | 3300053104 | Ga0500556_0000024 | Ga0500556_0000024_117581_118387 | 268 |
| 1786 | 3300053104 | Ga0500556_0006656 | Ga0500556_0006656_402_1208 | 268 |
| 1787 | 3300053108 | Ga0500562_011769 | Ga0500562_011769_558_1364 | 268 |
| 1788 | 3300053108 | Ga0500562_022437 | Ga0500562_022437_620_1426 | 268 |
| 1789 | 3300053109 | Ga0500569_028264 | Ga0500569_028264_85_891 | 268 |
| 1790 | 3300053111 | Ga0500572_001322 | Ga0500572_001322_423_1229 | 268 |
| 1791 | 3300053111 | Ga0500572_001883 | Ga0500572_001883_407_1270 | 268 |
| 1792 | 3300053116 | Ga0500592_001232 | Ga0500592_001232_1553_2359 | 268 |
| 1793 | 3300053119 | Ga0500595_001457 | Ga0500595_001457_11570_12376 | 268 |
| 1794 | 3300053119 | Ga0500595_008270 | Ga0500595_008270_2433_3239 | 268 |
| 1795 | 3300053119 | Ga0500595_010034 | Ga0500595_010034_2738_3544 | 268 |
| 1796 | 3300053119 | Ga0500595_029921 | Ga0500595_029921_598_1404 | 268 |
| 1797 | 3300053121 | Ga0500607_050466 | Ga0500607_050466_606_1412 | 268 |
| 1798 | 3300053121 | Ga0500607_068383 | Ga0500607_068383_294_1100 | 268 |
| 1799 | 3300053122 | Ga0500608_001306 | Ga0500608_001306_2165_2971 | 268 |
| 1800 | 3300053130 | Ga0500642_0000035 | Ga0500642_0000035_19424_20230 | 268 |
| 1801 | 3300053130 | Ga0500642_0000063 | Ga0500642_0000063_9175_9981 | 268 |
| 1802 | 3300053131 | Ga0500652_003392 | Ga0500652_003392_1695_2501 | 268 |
| 1803 | 3300053136 | Ga0500559_0000521 | Ga0500559_0000521_5949_6812 | 268 |
| 1804 | 3300053136 | Ga0500559_0000985 | Ga0500559_0000985_6652_7458 | 268 |
| 1805 | 3300053136 | Ga0500559_0008086 | Ga0500559_0008086_146_952 | 268 |
| 1806 | 3300053139 | Ga0500568_0000681 | Ga0500568_0000681_4268_5074 | 268 |
| 1807 | 3300053139 | Ga0500568_0003711 | Ga0500568_0003711_7028_7834 | 268 |
| 1808 | 3300053140 | Ga0500573_0008062 | Ga0500573_0008062_3296_4102 | 268 |
| 1809 | 3300053142 | Ga0500577_0002124 | Ga0500577_0002124_3703_4509 | 268 |
| 1810 | 3300053142 | Ga0500577_0083133 | Ga0500577_0083133_58_864 | 268 |
| 1811 | 3300053145 | Ga0500586_027712 | Ga0500586_027712_550_1356 | 268 |
| 1812 | 3300053146 | Ga0500588_0053957 | Ga0500588_0053957_391_1197 | 268 |
| 1813 | 3300053150 | Ga0500603_000166 | Ga0500603_000166_7287_8093 | 268 |
| 1814 | 3300053150 | Ga0500603_001970 | Ga0500603_001970_1188_1994 | 268 |
| 1815 | 3300053150 | Ga0500603_004393 | Ga0500603_004393_788_1657 | 268 |
| 1816 | 3300053151 | Ga0500604_0017700 | Ga0500604_0017700_981_1787 | 268 |
| 1817 | 3300053153 | Ga0500616_0000084 | Ga0500616_0000084_183338_184144 | 268 |
| 1818 | 3300053153 | Ga0500616_0000122 | Ga0500616_0000122_120515_121321 | 268 |
| 1819 | 3300053155 | Ga0500620_007717 | Ga0500620_007717_308_1114 | 268 |
| 1820 | 3300053156 | Ga0500622_0006487 | Ga0500622_0006487_1022_1828 | 268 |
| 1821 | 3300053158 | Ga0500627_0017182 | Ga0500627_0017182_1603_2409 | 268 |
| 1822 | 3300053161 | Ga0500634_0084158 | Ga0500634_0084158_676_1482 | 268 |
| 1823 | 3300053162 | Ga0500638_011072 | Ga0500638_011072_648_1454 | 268 |
| 1824 | 3300053162 | Ga0500638_054637 | Ga0500638_054637_38_844 | 268 |
| 1825 | 3300053163 | Ga0500639_000166 | Ga0500639_000166_521_1327 | 268 |
| 1826 | 3300053163 | Ga0500639_008722 | Ga0500639_008722_570_1433 | 268 |
| 1827 | 3300053163 | Ga0500639_096716 | Ga0500639_096716_326_1132 | 268 |
| 1828 | 3300053177 | Ga0500636_0000076 | Ga0500636_0000076_45729_46535 | 268 |
| 1829 | 3300053177 | Ga0500636_0042821 | Ga0500636_0042821_847_1653 | 268 |
| 1830 | 3300053177 | Ga0500636_0191729 | Ga0500636_0191729_171_1040 | 268 |
| 1831 | 3300053725 | Ga0500576_038105 | Ga0500576_038105_974_1837 | 268 |
| 1832 | 3300053729 | Ga0500625_001804 | Ga0500625_001804_3173_3979 | 268 |
| 1833 | 3300053730 | Ga0500645_031825 | Ga0500645_031825_688_1494 | 268 |
| 1834 | 3300053730 | Ga0500645_060425 | Ga0500645_060425_53_859 | 268 |
| 1835 | 3300053733 | Ga0500552_017880 | Ga0500552_017880_82_888 | 268 |
| 1836 | 3300053735 | Ga0500596_001174 | Ga0500596_001174_1821_2627 | 268 |
| 1837 | 3300053736 | Ga0500599_002572 | Ga0500599_002572_1012_1818 | 268 |
| 1838 | 3300053737 | Ga0500601_000249 | Ga0500601_000249_410_1216 | 268 |
| 1839 | 3300060353 | Ga0501082_0000684 | Ga0501082_0000684_1224_2051 | 268 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1zxi-assembly1.cif.gz_F | reconstituted co dehydrogenase from oligotropha carboxidovorans | 0.8904 | 3 | 268 |
| 1zxi-assembly1.cif.gz_F | reconstituted co dehydrogenase from oligotropha carboxidovorans | 0.8809 | 3 | 268 |
| 1t3q-assembly1.cif.gz_F | crystal structure of quinoline 2-oxidoreductase from pseudomonas putida 86 | 0.8767 | 3 | 267 |
| 1n5w-assembly1.cif.gz_C | crystal structure of the cu,mo-co dehydrogenase (codh); oxidized form | 0.876 | 4 | 268 |
| 1ffu-assembly1.cif.gz_F | carbon monoxide dehydrogenase from hydrogenophaga pseudoflava which lacks the mo-pyranopterin moiety of the molybdenum cofactor | 0.8658 | 3 | 267 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1t3qF02 | Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3; | 0.9672 | 57 | 168 | 3.30.465.10 |
| af_I6Y7N2_57_165_3.30.465.10 | Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3; | 0.9622 | 66 | 166 | 3.30.465.10 |
| 1ffvC03 | Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3; | 0.9621 | 57 | 166 | 3.30.465.10 |
| af_Q46800_56_173_3.30.465.10 | Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3; | 0.9397 | 57 | 166 | 3.30.465.10 |
| 4zohB02 | Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3; | 0.9315 | 57 | 166 | 3.30.465.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2S6TG65-F1-model_v4 | FAD-binding PCMH-type domain-containing protein | 0.991 | 56 | 263 |
GO:0016491
GO:0071949 |
| AF-A0A3S1U3F1-F1-model_v4 | deleted | 0.9884 | 146 | 265 |
|
| AF-A0A1H8YRK0-F1-model_v4 | Carbon-monoxide dehydrogenase medium subunit | 0.9827 | 168 | 264 |
|
| AF-A0A2U2CH22-F1-model_v4 | Glutathione S-transferase | 0.9792 | 107 | 267 |
GO:0016491
GO:0071949 |
| AF-A0A7G2LZT2-F1-model_v4 | Carbon monoxide dehydrogenase | 0.9763 | 188 | 263 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar