F495856

General Info

Members Datasets Scaffolds Average Seq Length
1839 762 1597 267

Family's Representative Sequence

Representative Sequence 3300005455|Ga0070663_100415887|Ga0070663_1004158871
Length 271
Sequence MYEFKYHRPTTVRQAANLLAKHSEAKLLAGGHSLIPVMKLRLAKPSDLVDLSQIEGLNTIELKGRSIVIGAMAKHGEVANSKVVQEALPVLAEVPGSIGDPAVRHLGTIGGSVANNDPAADYPAAVMALAATVHTNKRQLAADQYFTGLYTTALGEGEIVTKIAFKVPAQSGYAKFRNPASHYPMAGVFVAKHKDGSVRVAVTGAGNGGVFRWSAAESALGGNFSADALKGLSVDKNGMMGDIHGSAEYRANLVAVMARRALENLGKLTMT

Samples

Sample ID Description Type Environment
1 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
2 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
3 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
4 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
5 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
6 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
7 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
8 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
9 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
10 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
11 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
12 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
13 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
14 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
15 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
16 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
17 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
18 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
19 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
20 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
21 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
22 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
23 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
24 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
25 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
26 2545555834 Methylobacterium sp. WSM2598 Isolate Nodule
27 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
28 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
29 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
30 2643221651 Afipia sp. Root123D2 Isolate Unclassified
31 2643221733 Bosea sp. Root381 Isolate Unclassified
32 2643221736 Bosea sp. Root483D1 Isolate Unclassified
33 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
34 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
35 2738543013 Variovorax sp. BT01 Isolate Unclassified
36 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
37 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
38 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
39 2791355199
40 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
41 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
42 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
43 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
44 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
45 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
46 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
47 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
48 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
49 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
50 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
51 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
52 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
53 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
54 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
55 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
56 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
57 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
58 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
59 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
60 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
61 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
62 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
63 2841760612 Bosea sp. Tri-49 Isolate Nodule
64 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
65 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
66 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
67 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
68 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
69 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
70 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
71 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
72 2844104063 Bosea sp. Tri-39 Isolate Nodule
73 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
74 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
75 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
76 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
77 2851246043 Bosea sp. Tri-54 Isolate Nodule
78 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
79 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
80 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
81 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
82 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
83 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
84 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
85 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
86 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
87 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
88 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
89 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
90 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
91 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
92 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
93 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
94 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
95 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
96 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
97 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
98 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
99 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
100 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
101 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
102 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
103 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
104 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
105 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
106 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
107 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
108 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
109 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
110 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
111 2904699407
112 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
113 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
114 2906610324
115 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
116 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
117 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
118 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
119 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
120 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
121 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
122 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
123 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
124 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
125 2922368715
126 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
127 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
128 2922425934
129 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
130 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
131 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
132 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
133 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
134 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
135 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
136 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
137 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
138 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
139 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
140 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
141 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
142 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
143 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
144 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
145 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
146 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
147 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
148 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
149 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
150 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
151 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
152 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
153 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
154 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
155 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
156 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
157 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
158 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
159 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
160 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
161 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
162 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
163 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
164 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
165 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
166 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
167 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
168 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
169 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
170 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
171 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
172 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
173 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
174 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
175 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
176 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
177 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
178 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
179 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
180 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
181 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
182 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
183 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
184 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
185 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
186 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
187 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
188 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
189 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
190 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
191 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
192 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
193 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
194 3003665799 Methylobacterium aquaticum BG2 Isolate Unclassified
195 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
196 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
197 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
198 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
199 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
200 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
201 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
202 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
203 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
204 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
205 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
206 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
207 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
208 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
209 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
210 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
211 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
212 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
213 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
214 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
215 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
216 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
217 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
218 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
219 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
220 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
221 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
222 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
223 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
224 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
225 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
226 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
227 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
228 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
229 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
230 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
231 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
232 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
233 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
234 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
235 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
236 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
237 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
238 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
239 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
240 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
241 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
242 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
243 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
244 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
245 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
246 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
247 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
248 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
249 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
250 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
251 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
252 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
253 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
254 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
255 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
256 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
257 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
258 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
259 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
260 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
261 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
262 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
263 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
264 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
265 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
266 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
267 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
268 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
269 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
270 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
271 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
272 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
273 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
274 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
275 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
276 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
277 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
278 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
279 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
280 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
281 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
282 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
283 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
284 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
285 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
286 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
287 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
288 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
289 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
290 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
291 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
292 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
293 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
294 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
295 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
296 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
297 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
298 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
299 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
300 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
301 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
302 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
303 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
304 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
305 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
306 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
307 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
308 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
309 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
310 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
311 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
312 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
313 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
314 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
315 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
316 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
317 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
318 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
319 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
320 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
321 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
322 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
323 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
324 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
325 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
326 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
327 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
328 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
329 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
330 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
331 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
332 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
333 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
334 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
335 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
336 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
337 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
338 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
339 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
340 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
341 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
342 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
343 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
344 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
345 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
346 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
347 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
348 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
349 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
350 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
351 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
352 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
353 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
354 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
355 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
356 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
357 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
358 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
359 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
360 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
361 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
362 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
363 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
364 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
365 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
366 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
367 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
368 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
369 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
370 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
371 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
372 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
373 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
374 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
375 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
376 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
377 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
378 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
379 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
380 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
381 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
382 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
383 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
384 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
385 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
386 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
387 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
388 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
389 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
390 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
391 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
392 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
393 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
394 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
395 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
396 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
397 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
398 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
399 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
400 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
401 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
402 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
403 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
404 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
405 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
406 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
407 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
408 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
409 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
410 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
411 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
412 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
413 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
414 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
415 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
416 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
417 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
418 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
419 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
420 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
421 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
422 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
423 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
424 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
425 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
426 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
427 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
428 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
429 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
430 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
431 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
432 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
433 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
434 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
435 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
436 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
437 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
438 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
439 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
440 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
441 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
442 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
443 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
444 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
445 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
446 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
447 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
448 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
449 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
450 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
451 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
452 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
453 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
454 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
455 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
456 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
457 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
458 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
459 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
460 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
461 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
462 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
463 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
464 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
465 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
466 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
467 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
468 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
469 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
470 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
471 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
472 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
473 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
474 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
475 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
476 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
477 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
478 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
479 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
480 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
481 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
482 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
483 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
484 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
485 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
486 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
487 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
488 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
489 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
490 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
491 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
492 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
493 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
494 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
495 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
496 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
497 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
498 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
499 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
500 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
501 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
502 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
503 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
504 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
505 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
506 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
507 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
508 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
509 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
510 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
511 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
512 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
513 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
514 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
515 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
516 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
517 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
518 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
519 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
520 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
521 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
522 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
523 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
524 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
525 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
526 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
527 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
528 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
529 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
530 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
531 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
532 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
533 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
534 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
535 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
536 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
537 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
538 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
539 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
540 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
541 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
542 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
543 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
544 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
545 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
546 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
547 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
548 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
549 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
550 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
551 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
552 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
553 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
554 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
555 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
556 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
557 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
558 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
559 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
560 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
561 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
562 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
563 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
564 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
565 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
566 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
567 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
568 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
569 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
570 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
571 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
572 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
573 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
574 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
575 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
576 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
577 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
578 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
579 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
580 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
581 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
582 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
583 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
584 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
585 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
586 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
587 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
588 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
589 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
590 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
591 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
592 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
593 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
594 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
595 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
596 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
597 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
598 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
599 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
600 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
601 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
602 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
603 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
604 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
605 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
606 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
607 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
608 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
609 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
610 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
611 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
612 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
613 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
614 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
615 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
616 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
617 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
618 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
619 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
620 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
621 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
622 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
623 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
624 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
625 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
626 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
627 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
628 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
629 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
630 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
631 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
632 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
633 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
634 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
635 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
636 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
637 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
638 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
639 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
640 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
641 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
642 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
643 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
644 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
645 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
646 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
647 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
648 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
649 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
650 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
651 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
652 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
653 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
654 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
655 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
656 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
657 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
658 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
659 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
660 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
661 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
662 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
663 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
664 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
665 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
666 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
667 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
668 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
669 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
670 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
671 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
672 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
673 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
674 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
675 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
676 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
677 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
678 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
679 3300053097 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere Metagenome Endosphere
680 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
681 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
682 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
683 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
684 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
685 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
686 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
687 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
688 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
689 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
690 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
691 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
692 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
693 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
694 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
695 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
696 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
697 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
698 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
699 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
700 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
701 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
702 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
703 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
704 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
705 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
706 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
707 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
708 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
709 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
710 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
711 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
712 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
713 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
714 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
715 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
716 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
717 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
718 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
719 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
720 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
721 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
722 641522639 Methylobacterium sp. 4-46 Isolate Nodule
723 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule
724 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
725 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
726 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
727 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
728 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
729 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
730 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
731 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
732 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
733 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
734 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
735 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
736 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
737 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
738 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
739 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
740 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
741 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
742 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
743 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
744 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
745 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
746 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
747 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
748 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
749 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
750 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
751 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
752 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
753 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
754 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
755 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
756 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
757 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
758 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
759 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
760 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
761 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule
762 8057529695 Bosea vestrisii A18/4-2 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 86.91
Metatranscriptomes 0.16
Isolates 12.92

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.01
Nodule 10.11
Rhizoplane 6.2
Rhizosphere 64.11
Stem 0
Stem Tuber 0
Unclassified 9.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10005106 3300001979 Bacteria 5573
2 JGI24737J22298_10003117 3300001990 Bacteria 5879
3 JGI24750J21931_1002415 3300002070 Bacteria 2252
4 JGI25151J46595_10056929 3300003187 Bacteria 1278
5 JGI25406J46586_10000101 3300003203 Bacteria 38086
6 JGI25153J46596_10000451 3300003215 Bacteria 26293
7 JGI25153J46596_10001314 3300003215 Bacteria 14880
8 JGI25153J46596_10003659 3300003215 Bacteria 8514
9 JGI25153J46596_10004014 3300003215 Bacteria 8026
10 rootL2_10089904 3300003322 Bacteria 1114
11 JGI25160J50197_1000504 3300003354 Bacteria 23228
12 JGI25160J50197_1017216 3300003354 Bacteria 2299
13 JGI25404J52841_10015895 3300003659 Bacteria 1632
14 Ga0055526_1000667 3300003771 Bacteria 26378
15 Ga0055524_1000035 3300003775 Bacteria 174636
16 Ga0055531_10015335 3300003794 Bacteria 3384
17 Ga0065165_1000306 3300005262 Bacteria 81181
18 Ga0065165_1002349 3300005262 Bacteria 16429
19 Ga0065165_1020357 3300005262 Bacteria 2336
20 Ga0065165_1054102 3300005262 Bacteria 1126
21 Ga0065704_10171119 3300005289 Bacteria 1291
22 Ga0065712_10240790 3300005290 Bacteria 985
23 Ga0065707_10283443 3300005295 Bacteria 1042
24 Ga0070658_10062248 3300005327 Bacteria 3041
25 Ga0070658_10173002 3300005327 Bacteria 1814
26 Ga0070658_10193839 3300005327 Bacteria 1713
27 Ga0070676_10100238 3300005328 Bacteria 1788
28 Ga0070683_100011953 3300005329 Bacteria 7531
29 Ga0070670_100030128 3300005331 Bacteria 4672
30 Ga0070670_100292991 3300005331 Bacteria 1422
31 Ga0070670_100299103 3300005331 Bacteria 1407
32 Ga0070677_10018814 3300005333 Bacteria 2493
33 Ga0068869_100086296 3300005334 Bacteria 2352
34 Ga0068869_100233447 3300005334 Bacteria 1462
35 Ga0070666_10112350 3300005335 Bacteria 1885
36 Ga0070680_100003412 3300005336 Bacteria 11858
37 Ga0070680_100006770 3300005336 Bacteria 8733
38 Ga0070680_100545413 3300005336 Bacteria 994
39 Ga0070682_100026108 3300005337 Bacteria 3492
40 Ga0070682_100174397 3300005337 Bacteria 1497
41 Ga0070660_100007738 3300005339 Bacteria 7493
42 Ga0070660_100238149 3300005339 Bacteria 1482
43 Ga0070660_100346964 3300005339 Bacteria 1222
44 Ga0070689_100491701 3300005340 Bacteria 1050
45 Ga0070687_100179316 3300005343 Bacteria 1268
46 Ga0070661_100141923 3300005344 Bacteria 1810
47 Ga0070661_100518765 3300005344 Bacteria 956
48 Ga0070668_100071133 3300005347 Bacteria 2710
49 Ga0070668_100147708 3300005347 Bacteria 1898
50 Ga0070669_100061596 3300005353 Bacteria 2757
51 Ga0070675_100043504 3300005354 Bacteria 3670
52 Ga0070675_100470781 3300005354 Bacteria 1129
53 Ga0070671_100034075 3300005355 Bacteria 4214
54 Ga0070671_100069367 3300005355 Bacteria 2940
55 Ga0070674_100129168 3300005356 Bacteria 1881
56 Ga0070674_100199981 3300005356 Bacteria 1542
57 Ga0070673_100333760 3300005364 Bacteria 1342
58 Ga0070673_100619091 3300005364 Bacteria 989
59 Ga0070688_100131714 3300005365 Bacteria 1688
60 Ga0070688_100167771 3300005365 Bacteria 1512
61 Ga0070659_100145081 3300005366 Bacteria 1934
62 Ga0070659_100195065 3300005366 Bacteria 1665
63 Ga0070667_100070329 3300005367 Bacteria 2979
64 Ga0070667_100232897 3300005367 Bacteria 1643
65 Ga0070709_10000431 3300005434 Bacteria 25383
66 Ga0070709_10074240 3300005434 Bacteria 2203
67 Ga0070709_10122190 3300005434 Bacteria 1766
68 Ga0070714_100063453 3300005435 Bacteria 3178
69 Ga0070714_100066906 3300005435 Bacteria 3097
70 Ga0070714_100143656 3300005435 Bacteria 2144
71 Ga0070714_100324888 3300005435 Bacteria 1440
72 Ga0070714_100330228 3300005435 Bacteria 1428
73 Ga0070714_100333169 3300005435 Bacteria 1422
74 Ga0070713_100017738 3300005436 Bacteria 5395
75 Ga0070713_100019948 3300005436 Bacteria 5131
76 Ga0070713_100117707 3300005436 Bacteria 2325
77 Ga0070713_100277497 3300005436 Bacteria 1536
78 Ga0070713_100452735 3300005436 Bacteria 1206
79 Ga0070710_10002535 3300005437 Bacteria 8668
80 Ga0070710_10002728 3300005437 Bacteria 8404
81 Ga0070710_10008750 3300005437 Bacteria 4937
82 Ga0070710_10012830 3300005437 Bacteria 4174
83 Ga0070710_10172965 3300005437 Bacteria 1347
84 Ga0070710_10365363 3300005437 Bacteria 959
85 Ga0070711_100011415 3300005439 Bacteria 5516
86 Ga0070711_100022339 3300005439 Bacteria 4099
87 Ga0070711_100028158 3300005439 Bacteria 3694
88 Ga0070711_100079765 3300005439 Bacteria 2329
89 Ga0070711_100181255 3300005439 Bacteria 1612
90 Ga0070711_100241900 3300005439 Bacteria 1411
91 Ga0070700_100141293 3300005441 Bacteria 1636
92 Ga0070708_100302659 3300005445 Bacteria 1505
93 Ga0070708_100415282 3300005445 Bacteria 1269
94 Ga0070663_100048048 3300005455 Bacteria 3025
95 Ga0070663_100068566 3300005455 Bacteria 2575
96 Ga0070663_100130667 3300005455 Bacteria 1906
97 Ga0070663_100204539 3300005455 Bacteria 1542
98 Ga0070663_100299024 3300005455 Bacteria 1288
99 Ga0070663_100321443 3300005455 Bacteria 1244
100 Ga0070663_100415887 3300005455 Bacteria 1102
101 Ga0070663_100510562 3300005455 Bacteria 999
102 Ga0070678_100014099 3300005456 Bacteria 5031
103 Ga0070678_100241529 3300005456 Bacteria 1510
104 Ga0070678_100619204 3300005456 Bacteria 968
105 Ga0070662_100042264 3300005457 Bacteria 3256
106 Ga0070662_100054481 3300005457 Bacteria 2898
107 Ga0070662_100203127 3300005457 Bacteria 1573
108 Ga0070662_100258663 3300005457 Bacteria 1402
109 Ga0070662_100260946 3300005457 Bacteria 1396
110 Ga0070662_100543505 3300005457 Bacteria 973
111 Ga0070681_10008629 3300005458 Bacteria 9990
112 Ga0070681_10032089 3300005458 Bacteria 5271
113 Ga0070681_10043838 3300005458 Bacteria 4478
114 Ga0070681_10117782 3300005458 Bacteria 2593
115 Ga0070681_10334263 3300005458 Bacteria 1424
116 Ga0070681_10515695 3300005458 Bacteria 1109
117 Ga0068867_100172363 3300005459 Bacteria 1715
118 Ga0070706_100522136 3300005467 Bacteria 1105
119 Ga0070698_100159943 3300005471 Bacteria 2196
120 Ga0070698_100309092 3300005471 Bacteria 1511
121 Ga0070698_100424004 3300005471 Bacteria 1265
122 Ga0070698_100570947 3300005471 Bacteria 1071
123 Ga0070679_100099489 3300005530 Bacteria 2895
124 Ga0070679_100111220 3300005530 Bacteria 2725
125 Ga0070679_100182713 3300005530 Bacteria 2069
126 Ga0070679_100590828 3300005530 Bacteria 1054
127 Ga0070684_100011508 3300005535 Bacteria 7046
128 Ga0070684_100028786 3300005535 Bacteria 4701
129 Ga0070684_100265824 3300005535 Bacteria 1570
130 Ga0070684_100521141 3300005535 Bacteria 1102
131 Ga0068853_100014459 3300005539 Bacteria 6463
132 Ga0068853_100024273 3300005539 Bacteria 5081
133 Ga0068853_100118118 3300005539 Bacteria 2363
134 Ga0070672_100191761 3300005543 Bacteria 1706
135 Ga0070672_100309074 3300005543 Bacteria 1341
136 Ga0070672_100405772 3300005543 Bacteria 1169
137 Ga0070686_100057152 3300005544 Bacteria 2505
138 Ga0070686_100211106 3300005544 Bacteria 1397
139 Ga0070693_100182205 3300005547 Bacteria 1353
140 Ga0070693_100260830 3300005547 Bacteria 1152
141 Ga0070665_100038170 3300005548 Bacteria 4828
142 Ga0070665_100054191 3300005548 Bacteria 4022
143 Ga0070665_100056786 3300005548 Bacteria 3925
144 Ga0070665_100116399 3300005548 Bacteria 2676
145 Ga0070665_100162325 3300005548 Bacteria 2236
146 Ga0070665_100230416 3300005548 Bacteria 1852
147 Ga0070665_100334175 3300005548 Bacteria 1520
148 Ga0070704_100277690 3300005549 Bacteria 1386
149 Ga0070704_100518595 3300005549 Bacteria 1037
150 Ga0068855_100010086 3300005563 Bacteria 11386
151 Ga0068855_100042976 3300005563 Bacteria 5355
152 Ga0068855_100044387 3300005563 Bacteria 5260
153 Ga0068855_100150826 3300005563 Bacteria 2643
154 Ga0068855_100360150 3300005563 Bacteria 1600
155 Ga0068855_100646840 3300005563 Bacteria 1136
156 Ga0070664_100312398 3300005564 Bacteria 1422
157 Ga0068857_100057644 3300005577 Bacteria 3447
158 Ga0068857_100082849 3300005577 Bacteria 2865
159 Ga0068857_100106763 3300005577 Bacteria 2514
160 Ga0068857_100368470 3300005577 Bacteria 1332
161 Ga0068857_100392973 3300005577 Bacteria 1289
162 Ga0068854_100003033 3300005578 Bacteria 10440
163 Ga0068854_100021673 3300005578 Bacteria 4363
164 Ga0068854_100097072 3300005578 Bacteria 2203
165 Ga0068856_100001174 3300005614 Bacteria 27573
166 Ga0068856_100013112 3300005614 Bacteria 8029
167 Ga0068856_100043927 3300005614 Bacteria 4396
168 Ga0068856_100114989 3300005614 Bacteria 2690
169 Ga0068856_100204031 3300005614 Bacteria 1991
170 Ga0068856_100386714 3300005614 Bacteria 1419
171 Ga0068856_100570697 3300005614 Bacteria 1153
172 Ga0070702_100102198 3300005615 Bacteria 1760
173 Ga0070702_100224231 3300005615 Bacteria 1259
174 Ga0068852_100010566 3300005616 Bacteria 6905
175 Ga0068852_100015107 3300005616 Bacteria 5973
176 Ga0068852_100596518 3300005616 Bacteria 1108
177 Ga0068859_100340691 3300005617 Bacteria 1594
178 Ga0068859_100810597 3300005617 Bacteria 1023
179 Ga0068864_100012541 3300005618 Bacteria 7008
180 Ga0068864_100042677 3300005618 Bacteria 3881
181 Ga0068864_100162229 3300005618 Bacteria 2032
182 Ga0068864_100469065 3300005618 Bacteria 1207
183 Ga0068866_10071071 3300005718 Bacteria 1839
184 Ga0068861_100231480 3300005719 Bacteria 1567
185 Ga0068851_10077559 3300005834 Bacteria 1730
186 Ga0068851_10229199 3300005834 Bacteria 1047
187 Ga0068870_10050577 3300005840 Bacteria 2196
188 Ga0068863_100215897 3300005841 Bacteria 1847
189 Ga0068863_100454207 3300005841 Bacteria 1258
190 Ga0068863_100479862 3300005841 Bacteria 1222
191 Ga0068858_100075435 3300005842 Bacteria 3132
192 Ga0068858_100263891 3300005842 Bacteria 1637
193 Ga0068858_100443971 3300005842 Bacteria 1250
194 Ga0068858_100829660 3300005842 Bacteria 902
195 Ga0068860_100000240 3300005843 Bacteria 83866
196 Ga0068860_100332997 3300005843 Bacteria 1491
197 Ga0068860_100376457 3300005843 Bacteria 1401
198 Ga0068862_100131593 3300005844 Bacteria 2213
199 Ga0068862_100412615 3300005844 Bacteria 1265
200 Ga0081455_10000678 3300005937 Bacteria 44138
201 Ga0081455_10019291 3300005937 Bacteria 6455
202 Ga0081455_10025536 3300005937 Bacteria 5450
203 Ga0081455_10046347 3300005937 Bacteria 3773
204 Ga0081455_10116694 3300005937 Bacteria 2111
205 Ga0081538_10104598 3300005981 Bacteria 1412
206 Ga0081538_10179576 3300005981 Bacteria 908
207 Ga0081540_1001756 3300005983 Bacteria 18228
208 Ga0081540_1003232 3300005983 Bacteria 12983
209 Ga0081540_1006848 3300005983 Bacteria 8226
210 Ga0081540_1007290 3300005983 Bacteria 7915
211 Ga0081540_1007411 3300005983 Bacteria 7824
212 Ga0081540_1008929 3300005983 Bacteria 6943
213 Ga0081540_1010587 3300005983 Bacteria 6231
214 Ga0081540_1029265 3300005983 Bacteria 3073
215 Ga0081540_1034455 3300005983 Bacteria 2730
216 Ga0081540_1071304 3300005983 Bacteria 1606
217 Ga0081539_10000008 3300005985 Bacteria 525071
218 Ga0081539_10001983 3300005985 Bacteria 31149
219 Ga0081539_10002340 3300005985 Bacteria 27248
220 Ga0081539_10011589 3300005985 Bacteria 6948
221 Ga0081539_10064104 3300005985 Bacteria 2002
222 Ga0070717_10040025 3300006028 Bacteria 3816
223 Ga0070717_10127304 3300006028 Bacteria 2187
224 Ga0070717_10163639 3300006028 Bacteria 1931
225 Ga0075365_10139832 3300006038 Bacteria 1680
226 Ga0075368_10006624 3300006042 Bacteria 4061
227 Ga0075368_10031490 3300006042 Bacteria 2057
228 Ga0075368_10045649 3300006042 Bacteria 1731
229 Ga0075368_10060099 3300006042 Bacteria 1521
230 Ga0075363_100215185 3300006048 Bacteria 1100
231 Ga0075363_100240243 3300006048 Bacteria 1041
232 Ga0075363_100292228 3300006048 Bacteria 944
233 Ga0075364_10008620 3300006051 Bacteria 6098
234 Ga0075364_10012727 3300006051 Bacteria 5158
235 Ga0075364_10053317 3300006051 Bacteria 2644
236 Ga0075364_10259654 3300006051 Bacteria 1181
237 Ga0070715_10000340 3300006163 Bacteria 11630
238 Ga0070716_100035327 3300006173 Bacteria 2747
239 Ga0070716_100037143 3300006173 Bacteria 2690
240 Ga0070716_100071754 3300006173 Bacteria 2037
241 Ga0070716_100297177 3300006173 Bacteria 1121
242 Ga0070712_100005879 3300006175 Bacteria 7596
243 Ga0070712_100009110 3300006175 Bacteria 6248
244 Ga0075362_10006576 3300006177 Bacteria 4340
245 Ga0075362_10033955 3300006177 Bacteria 2221
246 Ga0075367_10055262 3300006178 Bacteria 2356
247 Ga0075367_10126538 3300006178 Bacteria 1577
248 Ga0075367_10201515 3300006178 Bacteria 1243
249 Ga0075369_10074078 3300006186 Bacteria 1502
250 Ga0075369_10112938 3300006186 Bacteria 1225
251 Ga0075366_10085262 3300006195 Bacteria 1889
252 Ga0075366_10169989 3300006195 Bacteria 1322
253 Ga0097621_100267399 3300006237 Bacteria 1501
254 Ga0075370_10132548 3300006353 Bacteria 1454
255 Ga0068871_100228097 3300006358 Bacteria 1616
256 Ga0075428_100202828 3300006844 Bacteria 2144
257 Ga0075434_100185974 3300006871 Bacteria 2098
258 Ga0075434_100297533 3300006871 Bacteria 1634
259 Ga0075429_100083790 3300006880 Bacteria 2779
260 Ga0068865_100380731 3300006881 Bacteria 1151
261 Ga0068865_100458786 3300006881 Bacteria 1055
262 Ga0097620_100340662 3300006931 Bacteria 1594
263 Ga0097620_100810557 3300006931 Bacteria 1023
264 Ga0099824_1012954 3300006942 Bacteria 8860
265 Ga0099822_1001015 3300006943 Bacteria 30678
266 Ga0099823_1008372 3300006944 Bacteria 10525
267 Ga0075435_100184445 3300007076 Bacteria 1764
268 Ga0075435_100344557 3300007076 Bacteria 1277
269 Ga0099794_10039754 3300007265 Bacteria 2234
270 Ga0099795_10000907 3300007788 Bacteria 5971
271 Ga0099795_10017799 3300007788 Bacteria 2271
272 Ga0105250_10052817 3300009092 Bacteria 1631
273 Ga0105240_10008997 3300009093 Bacteria 14190
274 Ga0105240_10010555 3300009093 Bacteria 12972
275 Ga0105240_10013639 3300009093 Bacteria 11145
276 Ga0105240_10088949 3300009093 Bacteria 3778
277 Ga0105240_10094736 3300009093 Bacteria 3641
278 Ga0105240_10198300 3300009093 Bacteria 2354
279 Ga0105240_10204687 3300009093 Bacteria 2311
280 Ga0105245_10071540 3300009098 Bacteria 3150
281 Ga0105245_10121853 3300009098 Bacteria 2437
282 Ga0105245_10242078 3300009098 Bacteria 1749
283 Ga0105245_10324387 3300009098 Bacteria 1518
284 Ga0105245_10622222 3300009098 Bacteria 1108
285 Ga0105247_10037019 3300009101 Bacteria 2976
286 Ga0105247_10091152 3300009101 Bacteria 1935
287 Ga0105247_10142577 3300009101 Bacteria 1571
288 Ga0105247_10524524 3300009101 Bacteria 867
289 Ga0114129_10563371 3300009147 Bacteria 1480
290 Ga0105243_10366575 3300009148 Bacteria 1328
291 Ga0105241_10004508 3300009174 Bacteria 10305
292 Ga0105241_10041098 3300009174 Bacteria 3492
293 Ga0105241_10129917 3300009174 Bacteria 2038
294 Ga0105241_10191561 3300009174 Bacteria 1703
295 Ga0105248_10140847 3300009177 Bacteria 2721
296 Ga0105248_10340195 3300009177 Bacteria 1689
297 Ga0105248_10364148 3300009177 Bacteria 1628
298 Ga0105248_10843798 3300009177 Bacteria 1034
299 Ga0105237_10001564 3300009545 Bacteria 29835
300 Ga0105237_10012234 3300009545 Bacteria 9045
301 Ga0105237_10021242 3300009545 Bacteria 6677
302 Ga0105237_10022559 3300009545 Bacteria 6458
303 Ga0105237_10034753 3300009545 Bacteria 5101
304 Ga0105237_10134999 3300009545 Bacteria 2462
305 Ga0105237_10141911 3300009545 Bacteria 2396
306 Ga0105238_10006286 3300009551 Bacteria 11807
307 Ga0105238_10006661 3300009551 Bacteria 11520
308 Ga0105238_10011390 3300009551 Bacteria 8955
309 Ga0105238_10121170 3300009551 Bacteria 2595
310 Ga0105238_10278536 3300009551 Bacteria 1653
311 Ga0105238_10375144 3300009551 Bacteria 1413
312 Ga0105238_10439022 3300009551 Bacteria 1301
313 Ga0105249_10089260 3300009553 Bacteria 2880
314 Ga0105249_10241487 3300009553 Bacteria 1786
315 Ga0105249_10517832 3300009553 Bacteria 1240
316 Ga0099796_10042904 3300010159 Bacteria 1539
317 Ga0099796_10046241 3300010159 Bacteria 1493
318 Ga0105239_10012332 3300010375 Bacteria 9519
319 Ga0105239_10022799 3300010375 Bacteria 6902
320 Ga0105239_10025169 3300010375 Bacteria 6555
321 Ga0105239_10067521 3300010375 Bacteria 3928
322 Ga0105239_10076462 3300010375 Bacteria 3682
323 Ga0105239_10111037 3300010375 Bacteria 3039
324 Ga0105239_10116579 3300010375 Bacteria 2964
325 Ga0105239_10284342 3300010375 Bacteria 1862
326 Ga0105246_10126402 3300011119 Bacteria 1902
327 Ga0105246_10276173 3300011119 Bacteria 1346
328 Ga0157370_10036903 3300013104 Bacteria 4741
329 Ga0157370_10167235 3300013104 Bacteria 2045
330 Ga0157369_10017344 3300013105 Bacteria 8094
331 Ga0157369_10029148 3300013105 Bacteria 6102
332 Ga0157369_10237904 3300013105 Bacteria 1902
333 Ga0157369_10656488 3300013105 Bacteria 1081
334 Ga0157369_10823051 3300013105 Bacteria 953
335 Ga0171462_1022 3300013250 Bacteria 141292
336 Ga0157374_10026672 3300013296 Bacteria 5201
337 Ga0157378_10102074 3300013297 Bacteria 2620
338 Ga0157378_10301578 3300013297 Bacteria 1551
339 Ga0157378_10789490 3300013297 Bacteria 975
340 Ga0163162_10144314 3300013306 Bacteria 2495
341 Ga0163162_10221407 3300013306 Bacteria 2022
342 Ga0157372_10184738 3300013307 Bacteria 2414
343 Ga0157375_10033676 3300013308 Bacteria 4872
344 Ga0157375_10349593 3300013308 Bacteria 1644
345 Ga0163163_10014045 3300014325 Bacteria 7350
346 Ga0163163_10052168 3300014325 Bacteria 4034
347 Ga0163163_10138625 3300014325 Bacteria 2474
348 Ga0163163_10351886 3300014325 Bacteria 1529
349 Ga0163163_10482258 3300014325 Bacteria 1301
350 Ga0157380_10080678 3300014326 Bacteria 2659
351 Ga0157380_10161273 3300014326 Bacteria 1949
352 Ga0157380_10162004 3300014326 Bacteria 1945
353 Ga0182008_10054337 3300014497 Bacteria 1982
354 Ga0182008_10111167 3300014497 Bacteria 1358
355 Ga0157379_10126823 3300014968 Bacteria 2296
356 Ga0206356_10877305 3300020070 Bacteria 1019
357 Ga0206354_10571467 3300020081 Bacteria 1570
358 Ga0214544_1000020 3300021320 Bacteria 178560
359 Ga0214542_1000024 3300021321 Bacteria 191218
360 Ga0214545_1000011 3300021324 Bacteria 190550
361 Ga0214543_1000033 3300021327 Bacteria 190419
362 Ga0213873_10026144 3300021358 Bacteria 1415
363 Ga0213876_10009084 3300021384 Bacteria 5351
364 Ga0213876_10184671 3300021384 Bacteria 1109
365 Ga0213876_10187411 3300021384 Bacteria 1100
366 Ga0224712_10031926 3300022467 Bacteria 1915
367 Ga0228598_1004399 3300024227 Bacteria 2983
368 Ga0209148_1000574 3300025254 Bacteria 34124
369 Ga0209233_1005617 3300025261 Bacteria 4145
370 Ga0209455_1009617 3300025272 Bacteria 2525
371 Ga0209455_1032789 3300025272 Bacteria 859
372 Ga0209673_1021249 3300025273 Bacteria 2276
373 Ga0209130_1000111 3300025284 Bacteria 131855
374 Ga0209130_1041286 3300025284 Bacteria 888
375 Ga0209675_1001135 3300025291 Bacteria 16248
376 Ga0209025_1001992 3300025294 Bacteria 23425
377 Ga0209564_1000049 3300025295 Bacteria 362075
378 Ga0209564_1000747 3300025295 Bacteria 46025
379 Ga0209564_1004509 3300025295 Bacteria 8477
380 Ga0209564_1007973 3300025295 Bacteria 5327
381 Ga0209564_1034172 3300025295 Bacteria 1496
382 Ga0209758_1000065 3300025297 Bacteria 306288
383 Ga0209758_1000128 3300025297 Bacteria 186771
384 Ga0209758_1000498 3300025297 Bacteria 64011
385 Ga0209758_1000560 3300025297 Bacteria 58586
386 Ga0209758_1003961 3300025297 Bacteria 12845
387 Ga0209758_1003962 3300025297 Bacteria 12844
388 Ga0209758_1004726 3300025297 Bacteria 11098
389 Ga0209758_1006640 3300025297 Bacteria 8187
390 Ga0209256_1000014 3300025299 Bacteria 687409
391 Ga0209256_1003626 3300025299 Bacteria 10573
392 Ga0207426_1000721 3300025302 Bacteria 38161
393 Ga0207426_1000728 3300025302 Bacteria 37754
394 Ga0207426_1002233 3300025302 Bacteria 12914
395 Ga0207426_1008460 3300025302 Bacteria 4152
396 Ga0207697_10041595 3300025315 Bacteria 1887
397 Ga0207656_10005979 3300025321 Bacteria 4347
398 Ga0207656_10021824 3300025321 Bacteria 2562
399 Ga0207656_10145017 3300025321 Bacteria 1121
400 Ga0207696_1041429 3300025711 Bacteria 1345
401 Ga0207653_10019287 3300025885 Bacteria 2150
402 Ga0207682_10011232 3300025893 Bacteria 3500
403 Ga0207692_10008253 3300025898 Bacteria 4307
404 Ga0207692_10049519 3300025898 Bacteria 2120
405 Ga0207692_10268504 3300025898 Bacteria 1028
406 Ga0207710_10031699 3300025900 Bacteria 2313
407 Ga0207710_10036630 3300025900 Bacteria 2164
408 Ga0207688_10084405 3300025901 Bacteria 1818
409 Ga0207688_10105611 3300025901 Bacteria 1630
410 Ga0207680_10083837 3300025903 Bacteria 2010
411 Ga0207680_10247984 3300025903 Bacteria 1229
412 Ga0207680_10361987 3300025903 Bacteria 1020
413 Ga0207647_10001242 3300025904 Bacteria 19628
414 Ga0207699_10005571 3300025906 Bacteria 6039
415 Ga0207699_10006508 3300025906 Bacteria 5663
416 Ga0207699_10075044 3300025906 Bacteria 2079
417 Ga0207645_10043430 3300025907 Bacteria 2877
418 Ga0207645_10096827 3300025907 Bacteria 1901
419 Ga0207645_10161605 3300025907 Bacteria 1466
420 Ga0207705_10074905 3300025909 Bacteria 2458
421 Ga0207705_10248728 3300025909 Bacteria 1355
422 Ga0207684_10342671 3300025910 Bacteria 1287
423 Ga0207654_10004074 3300025911 Bacteria 7362
424 Ga0207654_10110844 3300025911 Bacteria 1707
425 Ga0207654_10131957 3300025911 Bacteria 1582
426 Ga0207654_10323018 3300025911 Bacteria 1055
427 Ga0207707_10000466 3300025912 Bacteria 41992
428 Ga0207707_10011284 3300025912 Bacteria 7776
429 Ga0207707_10032070 3300025912 Bacteria 4599
430 Ga0207707_10098339 3300025912 Bacteria 2558
431 Ga0207707_10163811 3300025912 Bacteria 1943
432 Ga0207707_10306116 3300025912 Bacteria 1373
433 Ga0207695_10000029 3300025913 Bacteria 548364
434 Ga0207695_10001179 3300025913 Bacteria 45082
435 Ga0207695_10024619 3300025913 Bacteria 6764
436 Ga0207695_10448321 3300025913 Bacteria 1174
437 Ga0207695_10450081 3300025913 Bacteria 1171
438 Ga0207671_10003068 3300025914 Bacteria 17080
439 Ga0207671_10043451 3300025914 Bacteria 3323
440 Ga0207671_10067289 3300025914 Bacteria 2668
441 Ga0207671_10093493 3300025914 Bacteria 2268
442 Ga0207671_10124855 3300025914 Bacteria 1970
443 Ga0207671_10393534 3300025914 Bacteria 1102
444 Ga0207693_10000723 3300025915 Bacteria 29753
445 Ga0207693_10068591 3300025915 Bacteria 2776
446 Ga0207663_10000219 3300025916 Bacteria 25504
447 Ga0207663_10025741 3300025916 Bacteria 3407
448 Ga0207663_10071271 3300025916 Bacteria 2242
449 Ga0207663_10072844 3300025916 Bacteria 2221
450 Ga0207663_10133224 3300025916 Bacteria 1720
451 Ga0207663_10198666 3300025916 Bacteria 1445
452 Ga0207660_10022499 3300025917 Bacteria 4247
453 Ga0207660_10344569 3300025917 Bacteria 1193
454 Ga0207660_10351812 3300025917 Bacteria 1181
455 Ga0207662_10065461 3300025918 Bacteria 2189
456 Ga0207657_10006956 3300025919 Bacteria 11651
457 Ga0207657_10022202 3300025919 Bacteria 5951
458 Ga0207657_10174839 3300025919 Bacteria 1738
459 Ga0207657_10179944 3300025919 Bacteria 1709
460 Ga0207649_10031830 3300025920 Bacteria 3139
461 Ga0207649_10432275 3300025920 Bacteria 990
462 Ga0207652_10001798 3300025921 Bacteria 18633
463 Ga0207652_10014679 3300025921 Bacteria 6348
464 Ga0207652_10059169 3300025921 Bacteria 3302
465 Ga0207652_10156850 3300025921 Bacteria 2039
466 Ga0207652_10209704 3300025921 Bacteria 1754
467 Ga0207652_10466364 3300025921 Bacteria 1138
468 Ga0207652_10563702 3300025921 Bacteria 1023
469 Ga0207681_10456414 3300025923 Bacteria 1040
470 Ga0207694_10000131 3300025924 Bacteria 76343
471 Ga0207694_10011244 3300025924 Bacteria 6760
472 Ga0207694_10021078 3300025924 Bacteria 4935
473 Ga0207694_10043180 3300025924 Bacteria 3479
474 Ga0207694_10337701 3300025924 Bacteria 1245
475 Ga0207650_10034857 3300025925 Bacteria 3652
476 Ga0207650_10591916 3300025925 Bacteria 932
477 Ga0207659_10199388 3300025926 Bacteria 1597
478 Ga0207659_10353767 3300025926 Bacteria 1219
479 Ga0207700_10015585 3300025928 Bacteria 5019
480 Ga0207700_10089106 3300025928 Bacteria 2431
481 Ga0207700_10128654 3300025928 Bacteria 2064
482 Ga0207700_10220213 3300025928 Bacteria 1608
483 Ga0207700_10236063 3300025928 Bacteria 1557
484 Ga0207700_10332026 3300025928 Bacteria 1320
485 Ga0207664_10006314 3300025929 Bacteria 8147
486 Ga0207664_10065207 3300025929 Bacteria 2915
487 Ga0207664_10103453 3300025929 Bacteria 2357
488 Ga0207664_10274516 3300025929 Bacteria 1478
489 Ga0207664_10297432 3300025929 Bacteria 1419
490 Ga0207664_10348548 3300025929 Bacteria 1310
491 Ga0207664_10430608 3300025929 Bacteria 1176
492 Ga0207664_10540934 3300025929 Bacteria 1045
493 Ga0207664_10584569 3300025929 Bacteria 1003
494 Ga0207644_10033426 3300025931 Bacteria 3593
495 Ga0207644_10066881 3300025931 Bacteria 2618
496 Ga0207644_10129401 3300025931 Bacteria 1931
497 Ga0207644_10135999 3300025931 Bacteria 1887
498 Ga0207644_10261314 3300025931 Bacteria 1384
499 Ga0207644_10548414 3300025931 Bacteria 957
500 Ga0207690_10068618 3300025932 Bacteria 2437
501 Ga0207690_10177974 3300025932 Bacteria 1599
502 Ga0207706_10062871 3300025933 Bacteria 3269
503 Ga0207706_10146667 3300025933 Bacteria 2076
504 Ga0207706_10157516 3300025933 Bacteria 1997
505 Ga0207706_10198008 3300025933 Bacteria 1762
506 Ga0207686_10167846 3300025934 Bacteria 1545
507 Ga0207709_10015434 3300025935 Bacteria 4235
508 Ga0207670_10074378 3300025936 Bacteria 2358
509 Ga0207670_10496035 3300025936 Bacteria 991
510 Ga0207669_10066264 3300025937 Bacteria 2244
511 Ga0207704_10041836 3300025938 Bacteria 2691
512 Ga0207665_10000064 3300025939 Bacteria 68931
513 Ga0207665_10033157 3300025939 Bacteria 3421
514 Ga0207665_10080284 3300025939 Bacteria 2243
515 Ga0207665_10260141 3300025939 Bacteria 1285
516 Ga0207691_10281127 3300025940 Bacteria 1432
517 Ga0207711_10198112 3300025941 Bacteria 1832
518 Ga0207711_10315053 3300025941 Bacteria 1445
519 Ga0207711_10386148 3300025941 Bacteria 1300
520 Ga0207711_10405465 3300025941 Bacteria 1267
521 Ga0207711_10796551 3300025941 Bacteria 880
522 Ga0207689_10236505 3300025942 Bacteria 1510
523 Ga0207689_10297516 3300025942 Bacteria 1337
524 Ga0207689_10308384 3300025942 Bacteria 1312
525 Ga0207661_10008345 3300025944 Bacteria 7396
526 Ga0207661_10011091 3300025944 Bacteria 6513
527 Ga0207661_10044116 3300025944 Bacteria 3522
528 Ga0207679_10242062 3300025945 Bacteria 1529
529 Ga0207679_10261362 3300025945 Bacteria 1476
530 Ga0207679_10348379 3300025945 Bacteria 1290
531 Ga0207679_10463096 3300025945 Bacteria 1126
532 Ga0207667_10003470 3300025949 Bacteria 19454
533 Ga0207667_10040486 3300025949 Bacteria 4962
534 Ga0207667_10048507 3300025949 Bacteria 4490
535 Ga0207667_10085254 3300025949 Bacteria 3270
536 Ga0207667_10186518 3300025949 Bacteria 2129
537 Ga0207651_10382584 3300025960 Bacteria 1193
538 Ga0207668_10022803 3300025972 Bacteria 4012
539 Ga0207668_10330808 3300025972 Bacteria 1267
540 Ga0207640_10005349 3300025981 Bacteria 6998
541 Ga0207640_10076070 3300025981 Bacteria 2277
542 Ga0207640_10443649 3300025981 Bacteria 1068
543 Ga0207658_10036941 3300025986 Bacteria 3505
544 Ga0207658_10074230 3300025986 Bacteria 2584
545 Ga0207677_10111859 3300026023 Bacteria 2035
546 Ga0207677_10148197 3300026023 Bacteria 1806
547 Ga0207677_10264620 3300026023 Bacteria 1403
548 Ga0207703_10510029 3300026035 Bacteria 1130
549 Ga0207703_10614475 3300026035 Bacteria 1029
550 Ga0207639_10009549 3300026041 Bacteria 6696
551 Ga0207639_10028981 3300026041 Bacteria 4048
552 Ga0207639_10120808 3300026041 Bacteria 2152
553 Ga0207639_10401149 3300026041 Bacteria 1235
554 Ga0207678_10032223 3300026067 Bacteria 4568
555 Ga0207678_10093586 3300026067 Bacteria 2568
556 Ga0207678_10098593 3300026067 Bacteria 2497
557 Ga0207678_10213321 3300026067 Bacteria 1652
558 Ga0207678_10336056 3300026067 Bacteria 1301
559 Ga0207678_10446167 3300026067 Bacteria 1124
560 Ga0207678_10515079 3300026067 Bacteria 1044
561 Ga0207678_10605570 3300026067 Bacteria 961
562 Ga0207708_10035182 3300026075 Bacteria 3812
563 Ga0207708_10249397 3300026075 Bacteria 1430
564 Ga0207702_10000005 3300026078 Bacteria 420296
565 Ga0207702_10000403 3300026078 Bacteria 49280
566 Ga0207702_10009529 3300026078 Bacteria 8154
567 Ga0207702_10081007 3300026078 Bacteria 2818
568 Ga0207702_10317682 3300026078 Bacteria 1482
569 Ga0207702_10337291 3300026078 Bacteria 1439
570 Ga0207702_10403703 3300026078 Bacteria 1318
571 Ga0207648_10085170 3300026089 Bacteria 2757
572 Ga0207648_10306793 3300026089 Bacteria 1424
573 Ga0207676_10032218 3300026095 Bacteria 3948
574 Ga0207676_10220839 3300026095 Bacteria 1687
575 Ga0207676_10507403 3300026095 Bacteria 1146
576 Ga0207676_10626629 3300026095 Bacteria 1035
577 Ga0207674_10001872 3300026116 Bacteria 26801
578 Ga0207674_10007160 3300026116 Bacteria 13032
579 Ga0207674_10037998 3300026116 Bacteria 5001
580 Ga0207674_10047446 3300026116 Bacteria 4403
581 Ga0207674_10093731 3300026116 Bacteria 2991
582 Ga0207674_10094233 3300026116 Bacteria 2981
583 Ga0207674_10243826 3300026116 Bacteria 1744
584 Ga0207675_100069147 3300026118 Bacteria 3300
585 Ga0207675_100456912 3300026118 Bacteria 1266
586 Ga0207675_100688860 3300026118 Bacteria 1030
587 Ga0207683_10007983 3300026121 Bacteria 9051
588 Ga0207683_10065519 3300026121 Bacteria 3203
589 Ga0207683_10134588 3300026121 Bacteria 2225
590 Ga0207683_10173418 3300026121 Bacteria 1954
591 Ga0207683_10347901 3300026121 Bacteria 1360
592 Ga0207683_10553342 3300026121 Bacteria 1064
593 Ga0207698_10008935 3300026142 Bacteria 6356
594 Ga0207698_10013158 3300026142 Bacteria 5447
595 Ga0207698_10407391 3300026142 Bacteria 1301
596 Ga0209389_1000011 3300027296 Bacteria 223265
597 Ga0209389_1000025 3300027296 Bacteria 149588
598 Ga0209589_1000018 3300027357 Bacteria 192614
599 Ga0209589_1000066 3300027357 Bacteria 100795
600 Ga0209489_100017 3300027361 Bacteria 223265
601 Ga0209489_100026 3300027361 Bacteria 192614
602 Ga0209489_100030 3300027361 Bacteria 185999
603 Ga0209700_100027 3300027363 Bacteria 223462
604 Ga0209700_100035 3300027363 Bacteria 192614
605 Ga0209179_1020322 3300027512 Bacteria 1287
606 Ga0209813_10026656 3300027866 Bacteria 1673
607 Ga0207428_10078549 3300027907 Bacteria 2582
608 Ga0268266_10000827 3300028379 Bacteria 40488
609 Ga0268266_10014484 3300028379 Bacteria 6778
610 Ga0268266_10034469 3300028379 Bacteria 4306
611 Ga0268266_10056743 3300028379 Bacteria 3369
612 Ga0268266_10157939 3300028379 Bacteria 2050
613 Ga0268266_10191297 3300028379 Bacteria 1868
614 Ga0268266_10193349 3300028379 Bacteria 1858
615 Ga0268265_10087622 3300028380 Bacteria 2477
616 Ga0268265_10425050 3300028380 Bacteria 1234
617 Ga0268264_10000035 3300028381 Bacteria 398196
618 Ga0268264_10168042 3300028381 Bacteria 1982
619 Ga0268264_10348258 3300028381 Bacteria 1409
620 Ga0265319_1044084 3300028563 Bacteria 1496
621 Ga0265334_10013193 3300028573 Bacteria 3462
622 Ga0265323_10007879 3300028653 Bacteria 4404
623 Ga0265336_10009229 3300028666 Bacteria 3416
624 Ga0307517_10001329 3300028786 Bacteria 41544
625 Ga0307515_10024241 3300028794 Bacteria 10582
626 Ga0307515_10052509 3300028794 Bacteria 6044
627 Ga0307515_10261866 3300028794 Bacteria 1464
628 Ga0265338_10000065 3300028800 Bacteria 188966
629 Ga0265330_10025998 3300031235 Bacteria 2652
630 Ga0265330_10043704 3300031235 Bacteria 1981
631 Ga0265332_10019006 3300031238 Bacteria 3034
632 Ga0265320_10039080 3300031240 Bacteria 2374
633 Ga0265325_10000522 3300031241 Bacteria 27711
634 Ga0265325_10044758 3300031241 Bacteria 2303
635 Ga0265329_10017951 3300031242 Bacteria 2426
636 Ga0265340_10003867 3300031247 Bacteria 8432
637 Ga0265340_10032067 3300031247 Bacteria 2624
638 Ga0265339_10001453 3300031249 Bacteria 17549
639 Ga0265339_10061245 3300031249 Bacteria 2026
640 Ga0265327_10000748 3300031251 Bacteria 50556
641 Ga0265316_10055197 3300031344 Bacteria 3108
642 Ga0307513_10123243 3300031456 Bacteria 2554
643 Ga0307509_10099481 3300031507 Bacteria 2949
644 Ga0307408_100243159 3300031548 Bacteria 1480
645 Ga0307408_100271022 3300031548 Bacteria 1409
646 Ga0307408_100545175 3300031548 Bacteria 1023
647 Ga0265313_10029608 3300031595 Bacteria 2830
648 Ga0265313_10046465 3300031595 Bacteria 2108
649 Ga0307508_10000521 3300031616 Bacteria 45797
650 Ga0307508_10112649 3300031616 Bacteria 2321
651 Ga0307508_10239466 3300031616 Bacteria 1412
652 Ga0265314_10022547 3300031711 Bacteria 4823
653 Ga0265314_10059109 3300031711 Bacteria 2624
654 Ga0265342_10002787 3300031712 Bacteria 14791
655 Ga0265342_10010202 3300031712 Bacteria 6540
656 Ga0265342_10030155 3300031712 Bacteria 3363
657 Ga0265342_10214189 3300031712 Bacteria 1040
658 Ga0307516_10006057 3300031730 Bacteria 14287
659 Ga0307516_10013764 3300031730 Bacteria 8592
660 Ga0307516_10016792 3300031730 Bacteria 7644
661 Ga0307516_10146305 3300031730 Bacteria 2128
662 Ga0307406_10276044 3300031901 Bacteria 1279
663 Ga0307407_10292490 3300031903 Bacteria 1133
664 Ga0307407_10308938 3300031903 Bacteria 1105
665 Ga0307407_10433353 3300031903 Bacteria 950
666 Ga0307412_10406351 3300031911 Bacteria 1110
667 Ga0307412_10607082 3300031911 Bacteria 927
668 Ga0307409_100021265 3300031995 Bacteria 4444
669 Ga0307409_100675185 3300031995 Bacteria 1030
670 Ga0307416_100127917 3300032002 Bacteria 2279
671 Ga0307416_100487924 3300032002 Bacteria 1293
672 Ga0307416_100653719 3300032002 Bacteria 1136
673 Ga0307414_10265283 3300032004 Bacteria 1435
674 Ga0307411_10529524 3300032005 Bacteria 1002
675 Ga0307411_10708050 3300032005 Bacteria 878
676 Ga0307415_100258189 3300032126 Bacteria 1420
677 Ga0307507_10111917 3300033179 Bacteria 2226
678 Ga0307507_10114834 3300033179 Bacteria 2182
679 Ga0307510_10008237 3300033180 Bacteria 12419
680 Ga0307510_10010792 3300033180 Bacteria 10863
681 Ga0307510_10023218 3300033180 Bacteria 7193
682 Ga0307510_10134601 3300033180 Bacteria 2133
683 Ga0307510_10136026 3300033180 Bacteria 2115
684 Ga0315911_1000011 3300033442 Bacteria 264678
685 Ga0373930_0009726 3300034816 Bacteria 1707
686 Ga0373934_0018268 3300035086 Bacteria 2682
687 Ga0373934_0050750 3300035086 Bacteria 1644
688 Ga0373934_0079984 3300035086 Bacteria 1313
689 Ga0373934_0132785 3300035086 Bacteria 1016
690 Ga0373944_0008158 3300035089 Bacteria 2825
691 Ga0373944_0008625 3300035089 Bacteria 2753
692 Ga0373949_0059932 3300035090 Bacteria 977
693 Ga0373923_0007808 3300035111 Bacteria 3779
694 Ga0373923_0009562 3300035111 Bacteria 3503
695 Ga0373923_0011876 3300035111 Bacteria 3207
696 Ga0373923_0012570 3300035111 Bacteria 3134
697 Ga0373923_0040959 3300035111 Bacteria 1908
698 Ga0373923_0264790 3300035111 Bacteria 807
699 Ga0373936_0005534 3300035113 Bacteria 4769
700 Ga0373936_0026481 3300035113 Bacteria 2271
701 Ga0373936_0065892 3300035113 Bacteria 1486
702 Ga0373941_0060016 3300035115 Bacteria 1235
703 Ga0373945_0041758 3300035116 Bacteria 1659
704 Ga0373953_0004604 3300035117 Bacteria 4405
705 Ga0373953_0018376 3300035117 Bacteria 2586
706 Ga0373953_0021341 3300035117 Bacteria 2428
707 Ga0373953_0032120 3300035117 Bacteria 2045
708 Ga0373954_0001728 3300035118 Bacteria 8947
709 Ga0373954_0024119 3300035118 Bacteria 2772
710 Ga0373954_0032251 3300035118 Bacteria 2421
711 Ga0373954_0069666 3300035118 Bacteria 1670
712 Ga0373956_0000275 3300035119 Bacteria 20650
713 Ga0373956_0013116 3300035119 Bacteria 3445
714 Ga0373956_0027086 3300035119 Bacteria 2486
715 Ga0373956_0083356 3300035119 Bacteria 1469
716 Ga0373956_0131516 3300035119 Bacteria 1172
717 Ga0373957_0004250 3300035120 Bacteria 4343
718 Ga0373957_0008902 3300035120 Bacteria 3270
719 Ga0373957_0024316 3300035120 Bacteria 2175
720 Ga0373960_0037420 3300035121 Bacteria 1387
721 Ga0373943_0000038 3300035170 Bacteria 44091
722 Ga0373943_0010166 3300035170 Bacteria 4220
723 Ga0373943_0012935 3300035170 Bacteria 3763
724 Ga0373943_0042188 3300035170 Bacteria 2210
725 Ga0373946_0001215 3300035171 Bacteria 8907
726 Ga0373955_0000324 3300035172 Bacteria 19834
727 Ga0373955_0023312 3300035172 Bacteria 3151
728 Ga0373955_0106666 3300035172 Bacteria 1615
729 Ga0373955_0119720 3300035172 Bacteria 1529
730 Ga0373924_0019316 3300035410 Bacteria 2639
731 Ga0373924_0079202 3300035410 Bacteria 1395
732 Ga0373931_0017129 3300035691 Bacteria 3577
733 Ga0373931_0222613 3300035691 Bacteria 1137
734 Ga0373935_0001897 3300035692 Bacteria 11740
735 Ga0373935_0022533 3300035692 Bacteria 3864
736 Ga0373935_0031933 3300035692 Bacteria 3270
737 Ga0373935_0206967 3300035692 Bacteria 1358
738 Ga0373927_0000665 3300035695 Bacteria 26133
739 Ga0373927_0000759 3300035695 Bacteria 24667
740 Ga0373927_0004910 3300035695 Bacteria 9285
741 Ga0373927_0016732 3300035695 Bacteria 4837
742 Ga0373927_0057701 3300035695 Bacteria 2510
743 Ga0373927_0080765 3300035695 Bacteria 2107
744 Ga0373927_0113416 3300035695 Bacteria 1766
745 Ga0373927_0116489 3300035695 Bacteria 1742
746 Ga0373927_0172677 3300035695 Bacteria 1417
747 Ga0373927_0180085 3300035695 Bacteria 1386
748 Ga0373927_0251582 3300035695 Bacteria 1161
749 Ga0373933_0000405 3300035724 Bacteria 27323
750 Ga0373933_0002641 3300035724 Bacteria 10039
751 Ga0373933_0021114 3300035724 Bacteria 3695
752 Ga0373933_0115209 3300035724 Bacteria 1679
753 Ga0373933_0196709 3300035724 Bacteria 1289
754 Ga0373947_0000024 3300035725 Bacteria 87027
755 Ga0373947_0000555 3300035725 Bacteria 21800
756 Ga0373947_0011853 3300035725 Bacteria 4996
757 Ga0373947_0013984 3300035725 Bacteria 4600
758 Ga0373947_0025304 3300035725 Bacteria 3461
759 Ga0373947_0040313 3300035725 Bacteria 2781
760 Ga0373947_0074470 3300035725 Bacteria 2089
761 Ga0373947_0595055 3300035725 Bacteria 754
762 Ga0373937_0014181 3300036401 Bacteria 7030
763 Ga0373937_0048872 3300036401 Bacteria 3873
764 Ga0373937_0101198 3300036401 Bacteria 2674
765 Ga0373937_0322653 3300036401 Bacteria 1461
766 Ga0373937_0370823 3300036401 Bacteria 1357
767 Ga0373925_0002500 3300037068 Bacteria 14688
768 Ga0373925_0008692 3300037068 Bacteria 7398
769 Ga0373925_0012894 3300037068 Bacteria 6054
770 Ga0373925_0048657 3300037068 Bacteria 3160
771 Ga0373925_0049358 3300037068 Bacteria 3137
772 Ga0373925_0122327 3300037068 Bacteria 2021
773 Ga0373925_0212796 3300037068 Bacteria 1540
774 Ga0373925_0350555 3300037068 Bacteria 1198
775 Ga0373925_0402658 3300037068 Bacteria 1116
776 Ga0395900_0001369 3300037418 Bacteria 29330
777 Ga0395900_0100239 3300037418 Bacteria 2975
778 Ga0395898_0008318 3300037466 Bacteria 10970
779 Ga0395898_0108847 3300037466 Bacteria 2657
780 Ga0395898_0120355 3300037466 Bacteria 2515
781 Ga0395898_0132490 3300037466 Bacteria 2387
782 Ga0395898_0177776 3300037466 Bacteria 2034
783 Ga0395905_0007242 3300037471 Bacteria 11053
784 Ga0395905_0206371 3300037471 Bacteria 1841
785 Ga0395905_0773174 3300037471 Bacteria 863
786 Ga0436364_0278082 3300037853 Bacteria 1108
787 Ga0436364_0507131 3300037853 Bacteria 4255
788 Ga0436364_0685489 3300037853 Bacteria 982
789 Ga0436364_0901535 3300037853 Bacteria 2437
790 Ga0395901_0004623 3300038443 Bacteria 13893
791 Ga0395901_0319175 3300038443 Bacteria 1608
792 Ga0395901_0543609 3300038443 Bacteria 1178
793 Ga0395901_0794120 3300038443 Bacteria 936
794 Ga0237819_08620 3300038705 Bacteria 1404
795 Ga0436365_0051700 3300039437 Bacteria 1716
796 Ga0436365_0171887 3300039437 Bacteria 9138
797 Ga0436365_1002842 3300039437 Bacteria 1071
798 Ga0436365_1022455 3300039437 Bacteria 2158
799 Ga0436365_1339456 3300039437 Bacteria 3791
800 Ga0436365_1677794 3300039437 Bacteria 1011
801 Ga0436365_1681542 3300039437 Bacteria 895
802 Ga0436360_0109705 3300039438 Bacteria 966
803 Ga0436360_0818757 3300039438 Bacteria 1572
804 Ga0436361_0127548 3300039447 Bacteria 12919
805 Ga0436361_0505235 3300039447 Bacteria 1575
806 Ga0436361_1071097 3300039447 Bacteria 784
807 Ga0436361_1139687 3300039447 Bacteria 1384
808 Ga0436363_0068219 3300039450 Bacteria 1241
809 Ga0436363_0665307 3300039450 Bacteria 1015
810 Ga0436363_0892697 3300039450 Bacteria 1253
811 Ga0436362_0437287 3300039453 Bacteria 3404
812 Ga0439453_0004295 3300041408 Bacteria 2112
813 Ga0439465_0038204 3300041413 Bacteria 1546
814 Ga0439459_0016906 3300042438 Bacteria 1353
815 Ga0466969_0073334 3300044656 Bacteria 1643
816 Ga0466972_0000807 3300044658 Bacteria 14916
817 Ga0466972_0023955 3300044658 Bacteria 3032
818 Ga0466966_0001348 3300044684 Bacteria 15776
819 Ga0466966_0102112 3300044684 Bacteria 1773
820 Ga0466966_0164270 3300044684 Bacteria 1351
821 Ga0466961_0000120 3300044693 Bacteria 52569
822 Ga0466963_0023333 3300044694 Bacteria 3927
823 Ga0466963_0036289 3300044694 Bacteria 3214
824 Ga0466963_0081815 3300044694 Bacteria 2188
825 Ga0466968_0004393 3300044735 Bacteria 5266
826 Ga0466970_0033580 3300044765 Bacteria 2712
827 Ga0466970_0069577 3300044765 Bacteria 1892
828 Ga0466970_0239222 3300044765 Bacteria 1016
829 Ga0466957_0049432 3300044842 Bacteria 2557
830 Ga0466959_0040985 3300045049 Bacteria 3420
831 Ga0466958_0020966 3300045836 Bacteria 3815
832 Ga0466958_0059700 3300045836 Bacteria 2321
833 Ga0466967_0023485 3300045976 Bacteria 5054
834 Ga0466967_0324153 3300045976 Bacteria 1486
835 Ga0466967_0411364 3300045976 Bacteria 1317
836 Ga0495617_035336 3300046452 Bacteria 1678
837 Ga0495617_085269 3300046452 Bacteria 1033
838 Ga0495592_0005358 3300046454 Bacteria 9468
839 Ga0495592_0006102 3300046454 Bacteria 8959
840 Ga0495592_0022161 3300046454 Bacteria 4832
841 Ga0495592_0030976 3300046454 Bacteria 4045
842 Ga0495592_0031459 3300046454 Bacteria 4011
843 Ga0495592_0152464 3300046454 Bacteria 1597
844 Ga0495603_0000094 3300046455 Bacteria 40636
845 Ga0495603_0003073 3300046455 Bacteria 9911
846 Ga0495603_0013013 3300046455 Bacteria 5030
847 Ga0495603_0084278 3300046455 Bacteria 1861
848 Ga0495603_0110295 3300046455 Bacteria 1605
849 Ga0495629_0000612 3300046459 Bacteria 29083
850 Ga0495629_0000790 3300046459 Bacteria 25537
851 Ga0495629_0004905 3300046459 Bacteria 10042
852 Ga0495629_0016352 3300046459 Bacteria 5325
853 Ga0495629_0074959 3300046459 Bacteria 2362
854 Ga0495629_0110276 3300046459 Bacteria 1918
855 Ga0495638_0008217 3300046460 Bacteria 7417
856 Ga0495638_0140439 3300046460 Bacteria 1411
857 Ga0495638_0217480 3300046460 Bacteria 1070
858 Ga0495641_0094556 3300046461 Bacteria 1335
859 Ga0495651_0000889 3300046462 Bacteria 23256
860 Ga0495651_0002077 3300046462 Bacteria 15442
861 Ga0495651_0014948 3300046462 Bacteria 5999
862 Ga0495651_0019475 3300046462 Bacteria 5261
863 Ga0495651_0039224 3300046462 Bacteria 3688
864 Ga0495651_0075184 3300046462 Bacteria 2562
865 Ga0495651_0080993 3300046462 Bacteria 2451
866 Ga0495651_0116962 3300046462 Bacteria 1963
867 Ga0495651_0224275 3300046462 Bacteria 1299
868 Ga0495653_0000399 3300046463 Bacteria 34847
869 Ga0495653_0120059 3300046463 Bacteria 1875
870 Ga0495653_0254744 3300046463 Bacteria 1163
871 Ga0495650_0113297 3300046471 Bacteria 1005
872 Ga0495580_0002084 3300046472 Bacteria 17548
873 Ga0495580_0023565 3300046472 Bacteria 4518
874 Ga0495580_0049181 3300046472 Bacteria 2983
875 Ga0495580_0305529 3300046472 Bacteria 1083
876 Ga0495580_0311695 3300046472 Bacteria 1070
877 Ga0495582_0000256 3300046473 Bacteria 29694
878 Ga0495582_0007746 3300046473 Bacteria 5938
879 Ga0495582_0038554 3300046473 Bacteria 2630
880 Ga0495582_0043278 3300046473 Bacteria 2480
881 Ga0495582_0138572 3300046473 Bacteria 1378
882 Ga0495605_0054465 3300046474 Bacteria 1937
883 Ga0495605_0123195 3300046474 Bacteria 1174
884 Ga0495639_0000114 3300046475 Bacteria 40307
885 Ga0495639_0026219 3300046475 Bacteria 2575
886 Ga0495639_0031366 3300046475 Bacteria 2365
887 Ga0495639_0034202 3300046475 Bacteria 2273
888 Ga0495639_0055459 3300046475 Bacteria 1808
889 Ga0495639_0249424 3300046475 Bacteria 877
890 Ga0495662_0003142 3300046476 Bacteria 8329
891 Ga0495662_0009981 3300046476 Bacteria 4662
892 Ga0495662_0020029 3300046476 Bacteria 3237
893 Ga0495662_0048590 3300046476 Bacteria 2049
894 Ga0495664_0001473 3300046477 Bacteria 12457
895 Ga0495664_0003375 3300046477 Bacteria 8681
896 Ga0495585_0106124 3300046492 Bacteria 1498
897 Ga0495585_0156045 3300046492 Bacteria 1187
898 Ga0495585_0184888 3300046492 Bacteria 1069
899 Ga0495594_0012709 3300046499 Bacteria 4392
900 Ga0495594_0091672 3300046499 Bacteria 1703
901 Ga0495594_0226994 3300046499 Bacteria 1065
902 Ga0495607_0050252 3300046501 Bacteria 2428
903 Ga0495583_0139118 3300046506 Bacteria 1012
904 Ga0495606_0007875 3300046507 Bacteria 9402
905 Ga0495606_0035535 3300046507 Bacteria 3404
906 Ga0495606_0041553 3300046507 Bacteria 3083
907 Ga0495606_0085587 3300046507 Bacteria 1950
908 Ga0495608_0002695 3300046511 Bacteria 12755
909 Ga0495608_0010086 3300046511 Bacteria 6588
910 Ga0495608_0048208 3300046511 Bacteria 2831
911 Ga0495608_0101917 3300046511 Bacteria 1850
912 Ga0495610_0099619 3300046512 Bacteria 1304
913 Ga0495616_0175248 3300046513 Bacteria 956
914 Ga0495618_0003477 3300046514 Bacteria 9782
915 Ga0495618_0009727 3300046514 Bacteria 5807
916 Ga0495618_0019706 3300046514 Bacteria 4151
917 Ga0495618_0042423 3300046514 Bacteria 2868
918 Ga0495618_0049423 3300046514 Bacteria 2656
919 Ga0495618_0321043 3300046514 Bacteria 959
920 Ga0495620_0034250 3300046515 Bacteria 2297
921 Ga0495628_0002883 3300046516 Bacteria 15398
922 Ga0495628_0050791 3300046516 Bacteria 3279
923 Ga0495628_0064360 3300046516 Bacteria 2871
924 Ga0495628_0138751 3300046516 Bacteria 1856
925 Ga0495628_0140873 3300046516 Bacteria 1840
926 Ga0495628_0233538 3300046516 Bacteria 1378
927 Ga0495628_0315233 3300046516 Bacteria 1155
928 Ga0495630_0001933 3300046517 Bacteria 14435
929 Ga0495630_0019620 3300046517 Bacteria 4972
930 Ga0495630_0030387 3300046517 Bacteria 4018
931 Ga0495630_0116795 3300046517 Bacteria 2022
932 Ga0495630_0133199 3300046517 Bacteria 1888
933 Ga0495631_0023589 3300046518 Bacteria 2850
934 Ga0495632_0117776 3300046519 Bacteria 1243
935 Ga0495643_0007496 3300046522 Bacteria 7020
936 Ga0495643_0115681 3300046522 Bacteria 1359
937 Ga0495648_0001784 3300046524 Bacteria 20695
938 Ga0495648_0031577 3300046524 Bacteria 3485
939 Ga0495648_0042607 3300046524 Bacteria 2854
940 Ga0495648_0081196 3300046524 Bacteria 1845
941 Ga0495648_0081694 3300046524 Bacteria 1837
942 Ga0495663_0016825 3300046525 Bacteria 2069
943 Ga0495666_0035671 3300046526 Bacteria 2423
944 Ga0495666_0130988 3300046526 Bacteria 1172
945 Ga0495652_0004272 3300046529 Bacteria 13713
946 Ga0495652_0005705 3300046529 Bacteria 11659
947 Ga0495652_0041756 3300046529 Bacteria 3957
948 Ga0495652_0083645 3300046529 Bacteria 2626
949 Ga0495652_0085466 3300046529 Bacteria 2592
950 Ga0495652_0246980 3300046529 Bacteria 1324
951 Ga0495652_0263865 3300046529 Bacteria 1270
952 Ga0495654_0071667 3300046530 Bacteria 1641
953 Ga0495665_0000130 3300046531 Bacteria 35880
954 Ga0495665_0006644 3300046531 Bacteria 6242
955 Ga0495640_0003045 3300046533 Bacteria 13491
956 Ga0495640_0004006 3300046533 Bacteria 11789
957 Ga0495640_0004971 3300046533 Bacteria 10565
958 Ga0495640_0011709 3300046533 Bacteria 6735
959 Ga0495640_0020751 3300046533 Bacteria 4831
960 Ga0495640_0071384 3300046533 Bacteria 2330
961 Ga0495640_0095035 3300046533 Bacteria 1962
962 Ga0495640_0115050 3300046533 Bacteria 1753
963 Ga0495586_0020363 3300046535 Bacteria 3533
964 Ga0495586_0042890 3300046535 Bacteria 2436
965 Ga0495586_0142899 3300046535 Bacteria 1344
966 Ga0495587_0001433 3300046536 Bacteria 15868
967 Ga0495587_0007554 3300046536 Bacteria 7038
968 Ga0495587_0021435 3300046536 Bacteria 3985
969 Ga0495587_0060104 3300046536 Bacteria 2229
970 Ga0495587_0068435 3300046536 Bacteria 2068
971 Ga0495587_0167947 3300046536 Bacteria 1247
972 Ga0495587_0352838 3300046536 Bacteria 820
973 Ga0495598_0013195 3300046537 Bacteria 2043
974 Ga0495609_0065443 3300046538 Bacteria 1602
975 Ga0495621_0030725 3300046539 Bacteria 1838
976 Ga0495597_0016508 3300046542 Bacteria 3485
977 Ga0495597_0026607 3300046542 Bacteria 2657
978 Ga0495645_0023705 3300046543 Bacteria 4446
979 Ga0495645_0035960 3300046543 Bacteria 3611
980 Ga0495645_0060457 3300046543 Bacteria 2746
981 Ga0495645_0124602 3300046543 Bacteria 1811
982 Ga0495645_0222402 3300046543 Bacteria 1269
983 Ga0495645_0223217 3300046543 Bacteria 1266
984 Ga0495622_0006054 3300046557 Bacteria 5621
985 Ga0495622_0101008 3300046557 Bacteria 1322
986 Ga0495667_0000140 3300046559 Bacteria 49325
987 Ga0495667_0006538 3300046559 Bacteria 7912
988 Ga0495667_0013337 3300046559 Bacteria 5563
989 Ga0495667_0019409 3300046559 Bacteria 4586
990 Ga0495667_0168974 3300046559 Bacteria 1405
991 Ga0495656_0011865 3300046615 Bacteria 3205
992 Ga0495656_0059206 3300046615 Bacteria 1665
993 Ga0495656_0062247 3300046615 Bacteria 1631
994 Ga0495656_0068262 3300046615 Bacteria 1571
995 Ga0495656_0104892 3300046615 Bacteria 1313
996 Ga0495656_0198283 3300046615 Bacteria 995
997 Ga0495668_0058812 3300046616 Bacteria 2121
998 Ga0495668_0068180 3300046616 Bacteria 1956
999 Ga0495634_0002801 3300046642 Bacteria 14322
1000 Ga0495634_0004122 3300046642 Bacteria 11510
1001 Ga0495634_0014766 3300046642 Bacteria 5619
1002 Ga0495634_0036929 3300046642 Bacteria 3339
1003 Ga0495634_0037734 3300046642 Bacteria 3299
1004 Ga0495634_0072032 3300046642 Bacteria 2273
1005 Ga0495611_0048653 3300046648 Bacteria 1906
1006 Ga0495625_0052701 3300046660 Bacteria 2912
1007 Ga0495635_0000088 3300046663 Bacteria 54355
1008 Ga0495635_0002155 3300046663 Bacteria 13367
1009 Ga0495635_0003834 3300046663 Bacteria 10442
1010 Ga0495635_0006262 3300046663 Bacteria 8288
1011 Ga0495635_0014805 3300046663 Bacteria 5456
1012 Ga0495635_0049496 3300046663 Bacteria 2896
1013 Ga0495635_0188807 3300046663 Bacteria 1399
1014 Ga0495635_0228812 3300046663 Bacteria 1256
1015 Ga0495659_0049160 3300046664 Bacteria 1530
1016 Ga0495659_0072969 3300046664 Bacteria 1289
1017 Ga0495661_0026825 3300046665 Bacteria 3705
1018 Ga0495588_0002627 3300046674 Bacteria 7696
1019 Ga0495657_0006632 3300046675 Bacteria 9039
1020 Ga0495657_0010076 3300046675 Bacteria 7123
1021 Ga0495657_0025289 3300046675 Bacteria 4219
1022 Ga0495657_0045493 3300046675 Bacteria 2978
1023 Ga0495599_0008020 3300046678 Bacteria 6410
1024 Ga0495599_0011303 3300046678 Bacteria 5483
1025 Ga0495599_0019518 3300046678 Bacteria 4225
1026 Ga0495599_0036813 3300046678 Bacteria 3074
1027 Ga0495599_0053396 3300046678 Bacteria 2531
1028 Ga0495599_0088351 3300046678 Bacteria 1935
1029 Ga0495623_0005061 3300046679 Bacteria 8649
1030 Ga0495623_0008985 3300046679 Bacteria 6488
1031 Ga0495623_0072455 3300046679 Bacteria 2142
1032 Ga0495623_0086458 3300046679 Bacteria 1932
1033 Ga0495646_0003222 3300046680 Bacteria 10148
1034 Ga0495646_0008201 3300046680 Bacteria 6640
1035 Ga0495646_0016220 3300046680 Bacteria 4729
1036 Ga0495646_0041957 3300046680 Bacteria 2810
1037 Ga0495646_0048886 3300046680 Bacteria 2568
1038 Ga0495646_0200630 3300046680 Bacteria 1086
1039 Ga0495647_0031473 3300046681 Bacteria 1973
1040 Ga0495658_0000295 3300046683 Bacteria 28329
1041 Ga0495658_0066283 3300046683 Bacteria 2085
1042 Ga0495658_0125011 3300046683 Bacteria 1560
1043 Ga0495613_0001707 3300046689 Bacteria 16723
1044 Ga0495613_0012740 3300046689 Bacteria 6252
1045 Ga0495613_0022225 3300046689 Bacteria 4727
1046 Ga0495613_0051374 3300046689 Bacteria 3038
1047 Ga0495613_0217683 3300046689 Bacteria 1341
1048 Ga0495613_0371317 3300046689 Bacteria 979
1049 Ga0495624_0000079 3300046690 Bacteria 63196
1050 Ga0495624_0007161 3300046690 Bacteria 7852
1051 Ga0495624_0076668 3300046690 Bacteria 2074
1052 Ga0495624_0173351 3300046690 Bacteria 1316
1053 Ga0495670_0007514 3300046691 Bacteria 5357
1054 Ga0495670_0179861 3300046691 Bacteria 1116
1055 Ga0495671_0102611 3300046692 Bacteria 1397
1056 Ga0495671_0169141 3300046692 Bacteria 1063
1057 Ga0495589_0171033 3300046794 Bacteria 1033
1058 Ga0495600_0000715 3300046809 Bacteria 17456
1059 Ga0495600_0001507 3300046809 Bacteria 12922
1060 Ga0495600_0003313 3300046809 Bacteria 9452
1061 Ga0495600_0016414 3300046809 Bacteria 4698
1062 Ga0495600_0045331 3300046809 Bacteria 2869
1063 Ga0495600_0206043 3300046809 Bacteria 1261
1064 Ga0495600_0311750 3300046809 Bacteria 991
1065 Ga0495581_0000813 3300047315 Bacteria 16574
1066 Ga0495581_0023086 3300047315 Bacteria 3605
1067 Ga0495581_0030786 3300047315 Bacteria 3109
1068 Ga0495581_0034914 3300047315 Bacteria 2910
1069 Ga0495581_0136040 3300047315 Bacteria 1432
1070 Ga0495581_0173687 3300047315 Bacteria 1260
1071 Ga0495604_0001087 3300047317 Bacteria 22562
1072 Ga0495604_0001221 3300047317 Bacteria 21092
1073 Ga0495604_0008665 3300047317 Bacteria 8037
1074 Ga0495604_0075269 3300047317 Bacteria 2542
1075 Ga0495604_0081814 3300047317 Bacteria 2416
1076 Ga0495604_0108302 3300047317 Bacteria 2030
1077 Ga0495604_0313690 3300047317 Bacteria 1050
1078 Ga0495604_0534814 3300047317 Bacteria 757
1079 Ga0495674_0001729 3300047319 Bacteria 21443
1080 Ga0495674_0009348 3300047319 Bacteria 9318
1081 Ga0495674_0027713 3300047319 Bacteria 5173
1082 Ga0495674_0037672 3300047319 Bacteria 4345
1083 Ga0495674_0038076 3300047319 Bacteria 4319
1084 Ga0495674_0271468 3300047319 Bacteria 1391
1085 Ga0495672_0030134 3300047320 Bacteria 3408
1086 Ga0495672_0032478 3300047320 Bacteria 3246
1087 Ga0495672_0092787 3300047320 Bacteria 1655
1088 Ga0495672_0097888 3300047320 Bacteria 1596
1089 Ga0495672_0244629 3300047320 Bacteria 874
1090 Ga0495676_0026719 3300047321 Bacteria 4964
1091 Ga0495676_0120138 3300047321 Bacteria 1913
1092 Ga0495676_0134409 3300047321 Bacteria 1781
1093 Ga0495676_0186419 3300047321 Bacteria 1450
1094 Ga0495680_0003010 3300047322 Bacteria 16808
1095 Ga0495680_0004956 3300047322 Bacteria 12596
1096 Ga0495680_0044392 3300047322 Bacteria 3515
1097 Ga0495680_0056905 3300047322 Bacteria 3026
1098 Ga0495680_0154852 3300047322 Bacteria 1668
1099 Ga0495683_0075200 3300047323 Bacteria 1654
1100 Ga0495683_0151039 3300047323 Bacteria 1081
1101 Ga0495683_0163074 3300047323 Bacteria 1029
1102 Ga0495675_0001246 3300047444 Bacteria 15421
1103 Ga0495675_0008090 3300047444 Bacteria 6507
1104 Ga0495675_0088852 3300047444 Bacteria 1940
1105 Ga0495673_0013336 3300047469 Bacteria 4322
1106 Ga0495684_0001916 3300047471 Bacteria 16683
1107 Ga0495684_0002318 3300047471 Bacteria 15233
1108 Ga0495684_0003908 3300047471 Bacteria 11612
1109 Ga0495684_0018409 3300047471 Bacteria 5381
1110 Ga0495684_0027736 3300047471 Bacteria 4349
1111 Ga0495684_0059076 3300047471 Bacteria 2920
1112 Ga0495684_0077854 3300047471 Bacteria 2516
1113 Ga0495684_0132344 3300047471 Bacteria 1872
1114 Ga0495686_0038077 3300047472 Bacteria 3077
1115 Ga0495686_0048116 3300047472 Bacteria 2690
1116 Ga0495686_0083636 3300047472 Bacteria 1946
1117 Ga0495686_0098662 3300047472 Bacteria 1765
1118 Ga0495686_0153803 3300047472 Bacteria 1349
1119 Ga0495686_0161489 3300047472 Bacteria 1309
1120 Ga0495686_0228039 3300047472 Bacteria 1056
1121 Ga0495593_0000566 3300047673 Bacteria 21032
1122 Ga0495593_0015457 3300047673 Bacteria 4322
1123 Ga0495593_0019520 3300047673 Bacteria 3799
1124 Ga0495593_0020602 3300047673 Bacteria 3692
1125 Ga0495593_0020975 3300047673 Bacteria 3653
1126 Ga0495593_0021001 3300047673 Bacteria 3650
1127 Ga0495593_0077249 3300047673 Bacteria 1725
1128 Ga0495602_0004696 3300048088 Bacteria 14277
1129 Ga0495602_0016336 3300048088 Bacteria 7468
1130 Ga0495602_0040667 3300048088 Bacteria 4258
1131 Ga0495602_0044907 3300048088 Bacteria 4003
1132 Ga0495602_0060397 3300048088 Bacteria 3303
1133 Ga0495602_0216727 3300048088 Bacteria 1448
1134 Ga0495614_0019838 3300048089 Bacteria 2908
1135 Ga0496100_0064505 3300048903 Bacteria 2424
1136 Ga0496100_0164111 3300048903 Bacteria 1594
1137 Ga0496100_0182248 3300048903 Bacteria 1519
1138 Ga0496100_0205322 3300048903 Bacteria 1438
1139 Ga0496100_0248372 3300048903 Bacteria 1315
1140 Ga0496101_0009451 3300048904 Bacteria 6409
1141 Ga0496101_0083482 3300048904 Bacteria 2365
1142 Ga0496101_0150986 3300048904 Bacteria 1777
1143 Ga0496101_0193837 3300048904 Bacteria 1569
1144 Ga0496101_0239824 3300048904 Bacteria 1411
1145 Ga0496101_0262613 3300048904 Bacteria 1347
1146 Ga0496101_0317155 3300048904 Bacteria 1223
1147 Ga0496102_0024292 3300048905 Bacteria 5386
1148 Ga0496102_0031372 3300048905 Bacteria 4766
1149 Ga0496102_0072784 3300048905 Bacteria 3159
1150 Ga0496102_0283199 3300048905 Bacteria 1562
1151 Ga0496102_0372167 3300048905 Bacteria 1344
1152 Ga0496102_0494059 3300048905 Bacteria 1145
1153 Ga0496103_0004130 3300048906 Bacteria 8815
1154 Ga0496103_0019927 3300048906 Bacteria 4028
1155 Ga0496103_0111218 3300048906 Bacteria 1740
1156 Ga0496103_0335066 3300048906 Bacteria 973
1157 Ga0496104_0006339 3300048907 Bacteria 10404
1158 Ga0496104_0008465 3300048907 Bacteria 9146
1159 Ga0496104_0012053 3300048907 Bacteria 7760
1160 Ga0496104_0021422 3300048907 Bacteria 5934
1161 Ga0496104_0029317 3300048907 Bacteria 5104
1162 Ga0496104_0030986 3300048907 Bacteria 4971
1163 Ga0496104_0079108 3300048907 Bacteria 3133
1164 Ga0496105_0009668 3300048908 Bacteria 7549
1165 Ga0496105_0027210 3300048908 Bacteria 4669
1166 Ga0496105_0032798 3300048908 Bacteria 4263
1167 Ga0496105_0074989 3300048908 Bacteria 2794
1168 Ga0496105_0092579 3300048908 Bacteria 2496
1169 Ga0496105_0211701 3300048908 Bacteria 1580
1170 Ga0496105_0261563 3300048908 Bacteria 1399
1171 Ga0496106_0000116 3300048909 Bacteria 61237
1172 Ga0496106_0022726 3300048909 Bacteria 4661
1173 Ga0496106_0024317 3300048909 Bacteria 4502
1174 Ga0496106_0062719 3300048909 Bacteria 2823
1175 Ga0496106_0066200 3300048909 Bacteria 2751
1176 Ga0496106_0114384 3300048909 Bacteria 2104
1177 Ga0496106_0128967 3300048909 Bacteria 1982
1178 Ga0496106_0239901 3300048909 Bacteria 1448
1179 Ga0496106_0254815 3300048909 Bacteria 1404
1180 Ga0496106_0329650 3300048909 Bacteria 1225
1181 Ga0496107_0021741 3300048910 Bacteria 4533
1182 Ga0496107_0070931 3300048910 Bacteria 2530
1183 Ga0496107_0094510 3300048910 Bacteria 2187
1184 Ga0496107_0136798 3300048910 Bacteria 1810
1185 Ga0496107_0195916 3300048910 Bacteria 1501
1186 Ga0496107_0294035 3300048910 Bacteria 1209
1187 Ga0496108_0005887 3300048911 Bacteria 9941
1188 Ga0496108_0037082 3300048911 Bacteria 4059
1189 Ga0496108_0071572 3300048911 Bacteria 2926
1190 Ga0496108_0154633 3300048911 Bacteria 1980
1191 Ga0496108_0242174 3300048911 Bacteria 1569
1192 Ga0496108_0315679 3300048911 Bacteria 1362
1193 Ga0496108_0391171 3300048911 Bacteria 1214
1194 Ga0496108_0429678 3300048911 Bacteria 1154
1195 Ga0496108_0451193 3300048911 Bacteria 1123
1196 Ga0496109_0000767 3300048912 Bacteria 26714
1197 Ga0496109_0001670 3300048912 Bacteria 18492
1198 Ga0496109_0031408 3300048912 Bacteria 4766
1199 Ga0496109_0041185 3300048912 Bacteria 4185
1200 Ga0496109_0254244 3300048912 Bacteria 1655
1201 Ga0496109_0305290 3300048912 Bacteria 1501
1202 Ga0496109_0389691 3300048912 Bacteria 1316
1203 Ga0496110_0005923 3300048913 Bacteria 9621
1204 Ga0496110_0007781 3300048913 Bacteria 8585
1205 Ga0496110_0024667 3300048913 Bacteria 5128
1206 Ga0496110_0123068 3300048913 Bacteria 2339
1207 Ga0496110_0138070 3300048913 Bacteria 2204
1208 Ga0496110_0225784 3300048913 Bacteria 1703
1209 Ga0496110_0264610 3300048913 Bacteria 1565
1210 Ga0496110_0339412 3300048913 Bacteria 1369
1211 Ga0496111_0024351 3300048914 Bacteria 4261
1212 Ga0496111_0029482 3300048914 Bacteria 3897
1213 Ga0496111_0192000 3300048914 Bacteria 1518
1214 Ga0496111_0220107 3300048914 Bacteria 1410
1215 Ga0496111_0366367 3300048914 Bacteria 1066
1216 Ga0496112_0000016 3300048915 Bacteria 194634
1217 Ga0496112_0014881 3300048915 Bacteria 7239
1218 Ga0496112_0015593 3300048915 Bacteria 7097
1219 Ga0496112_0087250 3300048915 Bacteria 3087
1220 Ga0496112_0128319 3300048915 Bacteria 2507
1221 Ga0496112_0149949 3300048915 Bacteria 2299
1222 Ga0496112_0180437 3300048915 Bacteria 2075
1223 Ga0496112_0311744 3300048915 Bacteria 1518
1224 Ga0496112_0433061 3300048915 Bacteria 1253
1225 Ga0496113_0007323 3300048916 Bacteria 7085
1226 Ga0496113_0069408 3300048916 Bacteria 2676
1227 Ga0496113_0136406 3300048916 Bacteria 1928
1228 Ga0496113_0137829 3300048916 Bacteria 1918
1229 Ga0496113_0220184 3300048916 Bacteria 1512
1230 Ga0496113_0227005 3300048916 Bacteria 1489
1231 Ga0496113_0268183 3300048916 Bacteria 1364
1232 Ga0496113_0291562 3300048916 Bacteria 1305
1233 Ga0496113_0548198 3300048916 Bacteria 927
1234 Ga0496114_0046385 3300048917 Bacteria 3611
1235 Ga0496114_0128189 3300048917 Bacteria 2189
1236 Ga0496114_0133272 3300048917 Bacteria 2147
1237 Ga0496114_0136972 3300048917 Bacteria 2117
1238 Ga0496114_0177823 3300048917 Bacteria 1857
1239 Ga0496114_0317996 3300048917 Bacteria 1375
1240 Ga0496115_0024734 3300048918 Bacteria 4670
1241 Ga0496115_0027014 3300048918 Bacteria 4486
1242 Ga0496115_0035229 3300048918 Bacteria 3959
1243 Ga0496115_0048150 3300048918 Bacteria 3409
1244 Ga0496115_0049691 3300048918 Bacteria 3358
1245 Ga0496115_0121003 3300048918 Bacteria 2154
1246 Ga0496115_0531175 3300048918 Bacteria 942
1247 Ga0496116_0000887 3300048919 Bacteria 37313
1248 Ga0496116_0110033 3300048919 Bacteria 1622
1249 Ga0496116_0163984 3300048919 Bacteria 1215
1250 Ga0496117_0015351 3300048920 Bacteria 6534
1251 Ga0496117_0042896 3300048920 Bacteria 3296
1252 Ga0496117_0112285 3300048920 Bacteria 1695
1253 Ga0496117_0117519 3300048920 Bacteria 1641
1254 Ga0496117_0140118 3300048920 Bacteria 1450
1255 Ga0496117_0248257 3300048920 Bacteria 972
1256 Ga0496118_0006231 3300048921 Bacteria 13190
1257 Ga0496118_0023410 3300048921 Bacteria 5364
1258 Ga0496118_0040378 3300048921 Bacteria 3711
1259 Ga0496118_0045409 3300048921 Bacteria 3430
1260 Ga0496118_0053224 3300048921 Bacteria 3080
1261 Ga0496118_0099050 3300048921 Bacteria 1977
1262 Ga0496119_0014445 3300048922 Bacteria 6179
1263 Ga0496119_0096594 3300048922 Bacteria 1667
1264 Ga0496119_0168290 3300048922 Bacteria 1160
1265 Ga0496120_0080284 3300048923 Bacteria 1768
1266 Ga0496120_0120086 3300048923 Bacteria 1360
1267 Ga0496121_0000041 3300048924 Bacteria 346686
1268 Ga0496121_0002334 3300048924 Bacteria 29308
1269 Ga0496121_0002685 3300048924 Bacteria 26602
1270 Ga0496121_0041583 3300048924 Bacteria 4014
1271 Ga0496121_0059090 3300048924 Bacteria 3164
1272 Ga0496121_0061958 3300048924 Bacteria 3066
1273 Ga0496121_0096352 3300048924 Bacteria 2296
1274 Ga0496121_0122140 3300048924 Bacteria 1965
1275 Ga0496121_0141895 3300048924 Bacteria 1780
1276 Ga0496121_0249023 3300048924 Bacteria 1233
1277 Ga0496121_0291522 3300048924 Bacteria 1111
1278 Ga0496121_0442191 3300048924 Bacteria 840
1279 Ga0496122_0001252 3300048925 Bacteria 42547
1280 Ga0496122_0007556 3300048925 Bacteria 12031
1281 Ga0496122_0016277 3300048925 Bacteria 7052
1282 Ga0496122_0059832 3300048925 Bacteria 2810
1283 Ga0496123_0001065 3300048926 Bacteria 41481
1284 Ga0496123_0030507 3300048926 Bacteria 3945
1285 Ga0496124_0000910 3300048927 Bacteria 47763
1286 Ga0496124_0057376 3300048927 Bacteria 3281
1287 Ga0496124_0106460 3300048927 Bacteria 2264
1288 Ga0496124_0110332 3300048927 Bacteria 2215
1289 Ga0496124_0135253 3300048927 Bacteria 1952
1290 Ga0496125_0000092 3300048928 Bacteria 211050
1291 Ga0496125_0005023 3300048928 Bacteria 14935
1292 Ga0496125_0007013 3300048928 Bacteria 12054
1293 Ga0496125_0008149 3300048928 Bacteria 11029
1294 Ga0496125_0013816 3300048928 Bacteria 7908
1295 Ga0496125_0144375 3300048928 Bacteria 1648
1296 Ga0496126_0002727 3300048929 Bacteria 23333
1297 Ga0496126_0003329 3300048929 Bacteria 20436
1298 Ga0496126_0011637 3300048929 Bacteria 9081
1299 Ga0496126_0012110 3300048929 Bacteria 8853
1300 Ga0496126_0023131 3300048929 Bacteria 6024
1301 Ga0496126_0040296 3300048929 Bacteria 4330
1302 Ga0496126_0060287 3300048929 Bacteria 3413
1303 Ga0496126_0060318 3300048929 Bacteria 3412
1304 Ga0496126_0065503 3300048929 Bacteria 3251
1305 Ga0496126_0108664 3300048929 Bacteria 2418
1306 Ga0496126_0129680 3300048929 Bacteria 2180
1307 Ga0496126_0139840 3300048929 Bacteria 2085
1308 Ga0496126_0198101 3300048929 Bacteria 1697
1309 Ga0496126_0218886 3300048929 Bacteria 1600
1310 Ga0496126_0242229 3300048929 Bacteria 1506
1311 Ga0496126_0251864 3300048929 Bacteria 1471
1312 Ga0496126_0280382 3300048929 Bacteria 1381
1313 Ga0496126_0336710 3300048929 Bacteria 1237
1314 Ga0496126_0383393 3300048929 Bacteria 1143
1315 Ga0496126_0590146 3300048929 Bacteria 876
1316 Ga0495678_081381 3300049459 Bacteria 1162
1317 Ga0495682_0021395 3300049460 Bacteria 2423
1318 Ga0495682_0073204 3300049460 Bacteria 1233
1319 Ga0501031_0022335 3300049568 Bacteria 4124
1320 Ga0501031_0083908 3300049568 Bacteria 2076
1321 Ga0501031_0151868 3300049568 Bacteria 1513
1322 Ga0501031_0181556 3300049568 Bacteria 1374
1323 Ga0501032_0000046 3300049569 Bacteria 109405
1324 Ga0501032_0003451 3300049569 Bacteria 12113
1325 Ga0501032_0009690 3300049569 Bacteria 6976
1326 Ga0501032_0012480 3300049569 Bacteria 6070
1327 Ga0501032_0031524 3300049569 Bacteria 3634
1328 Ga0501033_0001341 3300049570 Bacteria 21887
1329 Ga0501033_0001563 3300049570 Bacteria 20194
1330 Ga0501033_0101248 3300049570 Bacteria 2102
1331 Ga0501033_0152143 3300049570 Bacteria 1669
1332 Ga0501033_0171027 3300049570 Bacteria 1560
1333 Ga0501034_0001492 3300049571 Bacteria 30823
1334 Ga0501034_0046490 3300049571 Bacteria 4385
1335 Ga0501034_0071642 3300049571 Bacteria 3475
1336 Ga0501034_0089953 3300049571 Bacteria 3068
1337 Ga0501034_0134959 3300049571 Bacteria 2449
1338 Ga0501034_0288271 3300049571 Bacteria 1580
1339 Ga0501036_0000326 3300049572 Bacteria 33146
1340 Ga0501036_0029963 3300049572 Bacteria 4598
1341 Ga0501036_0046952 3300049572 Bacteria 3657
1342 Ga0501036_0124937 3300049572 Bacteria 2173
1343 Ga0501036_0176428 3300049572 Bacteria 1799
1344 Ga0501036_0258825 3300049572 Bacteria 1458
1345 Ga0501036_0453407 3300049572 Bacteria 1068
1346 Ga0501037_0000309 3300049573 Bacteria 41492
1347 Ga0501037_0000457 3300049573 Bacteria 33231
1348 Ga0501037_0023815 3300049573 Bacteria 4527
1349 Ga0501037_0205292 3300049573 Bacteria 1391
1350 Ga0501037_0231096 3300049573 Bacteria 1298
1351 Ga0501037_0321889 3300049573 Bacteria 1070
1352 Ga0501038_0000026 3300049574 Bacteria 146493
1353 Ga0501038_0002061 3300049574 Bacteria 18607
1354 Ga0501038_0016287 3300049574 Bacteria 6740
1355 Ga0501038_0081738 3300049574 Bacteria 2721
1356 Ga0501039_0074976 3300049575 Bacteria 2629
1357 Ga0501039_0118408 3300049575 Bacteria 2074
1358 Ga0501041_0107888 3300049577 Bacteria 1727
1359 Ga0501042_0051874 3300049578 Bacteria 2926
1360 Ga0501042_0107526 3300049578 Bacteria 2008
1361 Ga0501042_0263549 3300049578 Bacteria 1244
1362 Ga0501043_0000135 3300049579 Bacteria 68762
1363 Ga0501043_0022795 3300049579 Bacteria 4910
1364 Ga0501043_0025639 3300049579 Bacteria 4625
1365 Ga0501043_0129290 3300049579 Bacteria 1980
1366 Ga0501043_0397547 3300049579 Bacteria 1042
1367 Ga0501046_0012002 3300049580 Bacteria 7390
1368 Ga0501046_0019630 3300049580 Bacteria 5603
1369 Ga0501046_0109514 3300049580 Bacteria 2111
1370 Ga0501047_0000101 3300049581 Bacteria 104950
1371 Ga0501047_0012471 3300049581 Bacteria 8049
1372 Ga0501047_0015152 3300049581 Bacteria 7340
1373 Ga0501047_0021168 3300049581 Bacteria 6245
1374 Ga0501047_0061378 3300049581 Bacteria 3627
1375 Ga0501047_0076352 3300049581 Bacteria 3224
1376 Ga0501047_0151516 3300049581 Bacteria 2195
1377 Ga0501047_0222535 3300049581 Bacteria 1743
1378 Ga0501047_0391244 3300049581 Bacteria 1223
1379 Ga0501048_0007052 3300049582 Bacteria 8536
1380 Ga0501048_0238464 3300049582 Bacteria 1291
1381 Ga0501048_0563429 3300049582 Bacteria 818
1382 Ga0501067_0021140 3300049583 Bacteria 3601
1383 Ga0501067_0262947 3300049583 Bacteria 960
1384 Ga0501068_0000977 3300049584 Bacteria 15021
1385 Ga0501068_0002854 3300049584 Bacteria 9192
1386 Ga0501068_0004441 3300049584 Bacteria 7634
1387 Ga0501068_0107517 3300049584 Bacteria 1732
1388 Ga0501069_0004828 3300049585 Bacteria 6980
1389 Ga0501069_0023367 3300049585 Bacteria 3371
1390 Ga0501069_0050013 3300049585 Bacteria 2324
1391 Ga0501070_0000297 3300049586 Bacteria 46317
1392 Ga0501070_0011694 3300049586 Bacteria 7411
1393 Ga0501070_0052986 3300049586 Bacteria 3366
1394 Ga0501070_0161193 3300049586 Bacteria 1849
1395 Ga0501070_0170731 3300049586 Bacteria 1791
1396 Ga0501071_0009558 3300049587 Bacteria 6466
1397 Ga0501071_0139437 3300049587 Bacteria 1805
1398 Ga0501072_0129771 3300049588 Bacteria 2009
1399 Ga0501073_0000840 3300049589 Bacteria 21856
1400 Ga0501073_0002836 3300049589 Bacteria 12987
1401 Ga0501073_0029876 3300049589 Bacteria 3893
1402 Ga0501073_0178908 3300049589 Bacteria 1468
1403 Ga0501074_0003222 3300049590 Bacteria 11525
1404 Ga0501074_0014547 3300049590 Bacteria 5725
1405 Ga0501074_0047411 3300049590 Bacteria 3106
1406 Ga0501076_0110407 3300049592 Bacteria 2223
1407 Ga0501077_0157100 3300049593 Bacteria 1444
1408 Ga0501079_0206584 3300049741 Bacteria 1534
1409 Ga0501079_0241222 3300049741 Bacteria 1412
1410 Ga0501079_0260835 3300049741 Bacteria 1354
1411 Ga0501080_0000121 3300049742 Bacteria 54804
1412 Ga0501080_0005263 3300049742 Bacteria 11523
1413 Ga0501080_0265493 3300049742 Bacteria 1563
1414 Ga0501080_0339254 3300049742 Bacteria 1358
1415 Ga0501081_0281475 3300049743 Bacteria 1218
1416 Ga0501081_0451496 3300049743 Bacteria 955
1417 Ga0501083_0122647 3300049744 Bacteria 1704
1418 Ga0501083_0136697 3300049744 Bacteria 1606
1419 Ga0501035_0000588 3300049822 Bacteria 40021
1420 Ga0501035_0019565 3300049822 Bacteria 6220
1421 Ga0501035_0022877 3300049822 Bacteria 5739
1422 Ga0501035_0071627 3300049822 Bacteria 3068
1423 Ga0501035_0251576 3300049822 Bacteria 1500
1424 Ga0501035_0384522 3300049822 Bacteria 1170
1425 Ga0501044_0000782 3300049823 Bacteria 38567
1426 Ga0501044_0002089 3300049823 Bacteria 22997
1427 Ga0501044_0029859 3300049823 Bacteria 5747
1428 Ga0501044_0033001 3300049823 Bacteria 5440
1429 Ga0501044_0049387 3300049823 Bacteria 4344
1430 Ga0501044_0061427 3300049823 Bacteria 3844
1431 Ga0501044_0087029 3300049823 Bacteria 3156
1432 Ga0501044_0198500 3300049823 Bacteria 1965
1433 Ga0501044_0206966 3300049823 Bacteria 1918
1434 Ga0501044_0327811 3300049823 Bacteria 1454
1435 Ga0501044_0409443 3300049823 Bacteria 1267
1436 Ga0501045_0007572 3300049824 Bacteria 7548
1437 Ga0501045_0008047 3300049824 Bacteria 7344
1438 Ga0501045_0021109 3300049824 Bacteria 4657
1439 Ga0501045_0303263 3300049824 Bacteria 1189
1440 nmdc:mga03683_10072_c1 3300050489 Bacteria 2248
1441 nmdc:mga03683_21738_c1 3300050489 Bacteria 2479
1442 nmdc:mga03n38_1460_c1 3300050490 Bacteria 6789
1443 nmdc:mga03n38_278947_c1 3300050490 Bacteria 891
1444 nmdc:mga03n38_8390_c1 3300050490 Bacteria 3707
1445 nmdc:mga03n38_99571_c1 3300050490 Bacteria 1400
1446 nmdc:mga00v17_11368_c1 3300050491 Bacteria 4893
1447 nmdc:mga00v17_268834_c1 3300050491 Bacteria 1106
1448 nmdc:mga00v17_35768_c1 3300050491 Bacteria 2958
1449 nmdc:mga00v17_83059_c1 3300050491 Bacteria 2003
1450 nmdc:mga0yw44_12608_c1 3300050492 Bacteria 4415
1451 nmdc:mga0yw44_1312_c2 3300050492 Bacteria 2308
1452 nmdc:mga0yw44_213541_c1 3300050492 Bacteria 1277
1453 nmdc:mga0yw44_226711_c1 3300050492 Bacteria 1240
1454 nmdc:mga0yw44_305994_c1 3300050492 Bacteria 1066
1455 nmdc:mga0yw44_9069_c1 3300050492 Bacteria 3509
1456 nmdc:mga0k408_170790_c1 3300050493 Bacteria 1296
1457 nmdc:mga0k408_9648_c1 3300050493 Bacteria 5209
1458 nmdc:mga06z11_121540_c1 3300050494 Bacteria 1457
1459 nmdc:mga06z11_43075_c1 3300050494 Bacteria 2268
1460 nmdc:mga06z11_4937_c1 3300050494 Bacteria 5295
1461 nmdc:mga06z11_83128_c1 3300050494 Bacteria 1723
1462 nmdc:mga07m45_15739_c1 3300050496 Bacteria 4041
1463 nmdc:mga07m45_87674_c1 3300050496 Bacteria 1781
1464 nmdc:mga05p37_195042_c1 3300050507 Bacteria 2456
1465 nmdc:mga06r32_420333_c1 3300050510 Bacteria 1318
1466 nmdc:mga06r32_70105_c1 3300050510 Bacteria 3389
1467 nmdc:mga08y16_20502_c1 3300050511 Bacteria 6977
1468 nmdc:mga0n895_113422_c1 3300050512 Bacteria 2728
1469 nmdc:mga0n895_123090_c1 3300050512 Bacteria 2615
1470 nmdc:mga0n895_300581_c1 3300050512 Bacteria 1627
1471 nmdc:mga0n895_351408_c1 3300050512 Bacteria 1493
1472 nmdc:mga0n895_402230_c1 3300050512 Bacteria 1385
1473 nmdc:mga0n895_450009_c1 3300050512 Bacteria 1300
1474 nmdc:mga0rr50_287994_c1 3300050513 Bacteria 1372
1475 nmdc:mga0rr50_77127_c1 3300050513 Bacteria 2560
1476 nmdc:mga08x19_102384_c1 3300050514 Bacteria 1901
1477 nmdc:mga08x19_358814_c1 3300050514 Bacteria 1018
1478 nmdc:mga08x19_61814_c1 3300050514 Bacteria 2427
1479 nmdc:mga0a205_552580_c1 3300050515 Bacteria 1006
1480 nmdc:mga0sz30_31406_c1 3300050516 Bacteria 2198
1481 Ga0495601_0002964 3300053077 Bacteria 9655
1482 Ga0495601_0010057 3300053077 Bacteria 5615
1483 Ga0495601_0011143 3300053077 Bacteria 5372
1484 Ga0495601_0110968 3300053077 Bacteria 1776
1485 Ga0495601_0163376 3300053077 Bacteria 1455
1486 Ga0495601_0176564 3300053077 Bacteria 1396
1487 Ga0495612_0000375 3300053078 Bacteria 17906
1488 Ga0495612_0001295 3300053078 Bacteria 10325
1489 Ga0495612_0009654 3300053078 Bacteria 3909
1490 Ga0495612_0041156 3300053078 Bacteria 1884
1491 Ga0500610_0140088 3300053079 Bacteria 1222
1492 Ga0500635_0007489 3300053080 Bacteria 2960
1493 Ga0495595_0046163 3300053084 Bacteria 2005
1494 Ga0495595_0093655 3300053084 Bacteria 1443
1495 Ga0495595_0121161 3300053084 Bacteria 1274
1496 Ga0495595_0167424 3300053084 Bacteria 1086
1497 Ga0495619_0000332 3300053085 Bacteria 33066
1498 Ga0495619_0001363 3300053085 Bacteria 16048
1499 Ga0495619_0024539 3300053085 Bacteria 3868
1500 Ga0495619_0045692 3300053085 Bacteria 2878
1501 Ga0495619_0084961 3300053085 Bacteria 2136
1502 Ga0495619_0095263 3300053085 Bacteria 2019
1503 Ga0500643_000019 3300053087 Bacteria 294301
1504 Ga0500643_016934 3300053087 Bacteria 2454
1505 Ga0500644_0021160 3300053088 Bacteria 1944
1506 Ga0500651_0037492 3300053093 Bacteria 3055
1507 Ga0500651_0044729 3300053093 Bacteria 2787
1508 Ga0500651_0054718 3300053093 Bacteria 2500
1509 Ga0500651_0101648 3300053093 Bacteria 1762
1510 Ga0500651_0222345 3300053093 Bacteria 1106
1511 Ga0500566_0000071 3300053094 Bacteria 49154
1512 Ga0500566_0000537 3300053094 Bacteria 21255
1513 Ga0500566_0000554 3300053094 Bacteria 20984
1514 Ga0500566_0006182 3300053094 Bacteria 7117
1515 Ga0500641_0017441 3300053096 Bacteria 2685
1516 Ga0500641_0028512 3300053096 Bacteria 2181
1517 Ga0500641_0061325 3300053096 Bacteria 1566
1518 Ga0500648_082402 3300053097 Bacteria 1809
1519 Ga0500650_0000453 3300053098 Bacteria 10240
1520 Ga0500650_0121043 3300053098 Bacteria 1220
1521 Ga0500555_004804 3300053103 Bacteria 3834
1522 Ga0500555_059998 3300053103 Bacteria 1025
1523 Ga0500556_0000024 3300053104 Bacteria 167556
1524 Ga0500556_0006656 3300053104 Bacteria 3284
1525 Ga0500562_011769 3300053108 Bacteria 2221
1526 Ga0500562_022437 3300053108 Bacteria 1646
1527 Ga0500562_045720 3300053108 Bacteria 1167
1528 Ga0500569_028264 3300053109 Bacteria 1553
1529 Ga0500572_001322 3300053111 Bacteria 6910
1530 Ga0500572_001883 3300053111 Bacteria 5293
1531 Ga0500592_001232 3300053116 Bacteria 4176
1532 Ga0500595_001457 3300053119 Bacteria 12614
1533 Ga0500595_004502 3300053119 Bacteria 6234
1534 Ga0500595_008270 3300053119 Bacteria 4256
1535 Ga0500595_010034 3300053119 Bacteria 3785
1536 Ga0500595_025194 3300053119 Bacteria 2065
1537 Ga0500595_029921 3300053119 Bacteria 1842
1538 Ga0500607_050466 3300053121 Bacteria 2216
1539 Ga0500607_068383 3300053121 Bacteria 1838
1540 Ga0500608_001306 3300053122 Bacteria 8879
1541 Ga0500608_180527 3300053122 Bacteria 894
1542 Ga0500614_030732 3300053123 Bacteria 1312
1543 Ga0500642_0000035 3300053130 Bacteria 106656
1544 Ga0500642_0000063 3300053130 Bacteria 58680
1545 Ga0500652_003392 3300053131 Bacteria 4823
1546 Ga0500559_0000521 3300053136 Bacteria 27007
1547 Ga0500559_0000985 3300053136 Bacteria 17756
1548 Ga0500559_0008086 3300053136 Bacteria 4628
1549 Ga0500568_0000681 3300053139 Bacteria 24452
1550 Ga0500568_0002331 3300053139 Bacteria 11264
1551 Ga0500568_0003711 3300053139 Bacteria 8376
1552 Ga0500568_0058119 3300053139 Bacteria 1503
1553 Ga0500573_0008062 3300053140 Bacteria 5788
1554 Ga0500577_0002124 3300053142 Bacteria 5059
1555 Ga0500577_0083133 3300053142 Bacteria 1281
1556 Ga0500586_027712 3300053145 Bacteria 1843
1557 Ga0500588_0053957 3300053146 Bacteria 1264
1558 Ga0500603_000166 3300053150 Bacteria 16600
1559 Ga0500603_001970 3300053150 Bacteria 4567
1560 Ga0500603_004393 3300053150 Bacteria 3019
1561 Ga0500604_0017700 3300053151 Bacteria 1976
1562 Ga0500616_0000084 3300053153 Bacteria 195562
1563 Ga0500616_0000122 3300053153 Bacteria 140228
1564 Ga0500616_0025276 3300053153 Bacteria 3295
1565 Ga0500616_0036047 3300053153 Bacteria 2686
1566 Ga0500620_007717 3300053155 Bacteria 2676
1567 Ga0500620_109462 3300053155 Bacteria 967
1568 Ga0500622_0002777 3300053156 Bacteria 12312
1569 Ga0500622_0006487 3300053156 Bacteria 6771
1570 Ga0500624_001268 3300053157 Bacteria 4418
1571 Ga0500627_0017182 3300053158 Bacteria 2838
1572 Ga0500634_0062232 3300053161 Bacteria 1977
1573 Ga0500634_0084158 3300053161 Bacteria 1631
1574 Ga0500638_000418 3300053162 Bacteria 10135
1575 Ga0500638_011072 3300053162 Bacteria 3984
1576 Ga0500638_054637 3300053162 Bacteria 1926
1577 Ga0500638_105071 3300053162 Bacteria 1312
1578 Ga0500639_000166 3300053163 Bacteria 32001
1579 Ga0500639_008722 3300053163 Bacteria 5290
1580 Ga0500639_096716 3300053163 Bacteria 1461
1581 Ga0500636_0000076 3300053177 Bacteria 48321
1582 Ga0500636_0042821 3300053177 Bacteria 2675
1583 Ga0500636_0191729 3300053177 Bacteria 1088
1584 Ga0500637_0000135 3300053178 Bacteria 27083
1585 Ga0500576_038105 3300053725 Bacteria 2171
1586 Ga0500625_001804 3300053729 Bacteria 7638
1587 Ga0500645_004477 3300053730 Bacteria 5348
1588 Ga0500645_031825 3300053730 Bacteria 1584
1589 Ga0500645_060425 3300053730 Bacteria 1096
1590 Ga0500552_017880 3300053733 Bacteria 977
1591 Ga0500596_001174 3300053735 Bacteria 5279
1592 Ga0500599_002572 3300053736 Bacteria 2180
1593 Ga0500601_000249 3300053737 Bacteria 10384
1594 Ga0501084_0136438 3300054114 Bacteria 2065
1595 Ga0500661_001607 3300055283 Bacteria 4269
1596 Ga0501082_0000684 3300060353 Bacteria 29862
1597 Ga0530510_0412608 3300061734 Bacteria 1019

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053093 Ga0500651_0044729 Ga0500651_0044729_351_1142 218
2 3300053093 Ga0500651_0054718 Ga0500651_0054718_1791_2480 218
3 3300048904 Ga0496101_0193837 Ga0496101_0193837_499_1290 222
4 3300035725 Ga0373947_0595055 Ga0373947_0595055_17_700 227
5 3300047317 Ga0495604_0534814 Ga0495604_0534814_37_729 230
6 3300035111 Ga0373923_0264790 Ga0373923_0264790_33_734 231
7 3300039438 Ga0436360_0109705 Ga0436360_0109705_22_735 231
8 3300048920 Ga0496117_0140118 Ga0496117_0140118_641_1417 231
9 3300031251 Ga0265327_10000748 Ga0265327_100007482 233
10 3300039447 Ga0436361_0505235 Ga0436361_0505235_83_871 237
11 3300046559 Ga0495667_0168974 Ga0495667_0168974_674_1390 238
12 3300026121 Ga0207683_10553342 Ga0207683_105533421 240
13 3300006051 Ga0075364_10259654 Ga0075364_102596542 242
14 3300050491 nmdc:mga00v17_268834_c1 nmdc:mga00v17_268834_c1_223_1023 242
15 3300039447 Ga0436361_1071097 Ga0436361_1071097_26_772 248
16 3300046529 Ga0495652_0263865 Ga0495652_0263865_10_762 250
17 3300048914 Ga0496111_0192000 Ga0496111_0192000_538_1296 252
18 3300053084 Ga0495595_0167424 Ga0495595_0167424_305_1072 253
19 3300053157 Ga0500624_001268 Ga0500624_001268_2922_3722 255
20 3300005456 Ga0070678_100619204 Ga0070678_1006192041 256
21 3300046455 Ga0495603_0110295 Ga0495603_0110295_13_783 256
22 3300046506 Ga0495583_0139118 Ga0495583_0139118_227_997 256
23 3300046557 Ga0495622_0101008 Ga0495622_0101008_531_1301 256
24 3300053079 Ga0500610_0140088 Ga0500610_0140088_437_1207 256
25 3300025295 Ga0209564_1000747 Ga0209564_100074717 257
26 3300046524 Ga0495648_0031577 Ga0495648_0031577_2684_3457 257
27 3300046536 Ga0495587_0352838 Ga0495587_0352838_23_802 257
28 3300046543 Ga0495645_0222402 Ga0495645_0222402_16_789 257
29 3300046660 Ga0495625_0052701 Ga0495625_0052701_18_791 257
30 3300048088 Ga0495602_0216727 Ga0495602_0216727_651_1424 257
31 3300049582 Ga0501048_0563429 Ga0501048_0563429_31_804 257
32 3300049583 Ga0501067_0262947 Ga0501067_0262947_16_789 257
33 3300049824 Ga0501045_0303263 Ga0501045_0303263_394_1167 257
34 iso_pu_bacteria 2738543013 2739249992 259
35 iso_pu_bacteria 2928115317 2928119443 259
36 3300050494 nmdc:mga06z11_121540_c1 nmdc:mga06z11_121540_c1_532_1368 261
37 iso_pu_bacteria 3003665799 3003667949 262
38 3300037853 Ga0436364_0278082 Ga0436364_0278082_66_899 263
39 3300048929 Ga0496126_0251864 Ga0496126_0251864_510_1301 263
40 iso_pu_bacteria 2513237101 2513696940 263
41 iso_pu_bacteria 2545555834 2545676146 263
42 iso_pu_bacteria 2643221733 2644732030 263
43 iso_pu_bacteria 2721755755 2723846389 263
44 iso_pu_bacteria 2791355199 2793076953 263
45 iso_pu_bacteria 2874604998 2874610645 263
46 iso_pu_bacteria 2876808645 2876811885 263
47 iso_pu_bacteria 2879110137 2879118713 263
48 iso_pu_bacteria 2889033259 2889039101 263
49 iso_pu_bacteria 2917699015 2917699095 263
50 iso_pu_bacteria 2922361189 2922362199 263
51 iso_pu_bacteria 2922386360 2922388046 263
52 iso_pu_bacteria 641522639 641645577 263
53 iso_pu_bacteria 643348564 643599486 263
54 iso_pu_bacteria 8006964411 8006964770 263
55 iso_pu_bacteria 8006984368 8006991834 263
56 iso_pu_bacteria 8006994254 8006995509 263
57 iso_pu_bacteria 8056673599 8056676441 263
58 3300005327 Ga0070658_10062248 Ga0070658_100622482 264
59 3300005336 Ga0070680_100003412 Ga0070680_10000341212 264
60 3300005339 Ga0070660_100346964 Ga0070660_1003469642 264
61 3300005458 Ga0070681_10008629 Ga0070681_100086293 264
62 3300005471 Ga0070698_100424004 Ga0070698_1004240042 264
63 3300005530 Ga0070679_100111220 Ga0070679_1001112203 264
64 3300009093 Ga0105240_10088949 Ga0105240_100889492 264
65 3300009093 Ga0105240_10094736 Ga0105240_100947362 264
66 3300009545 Ga0105237_10034753 Ga0105237_100347534 264
67 3300009553 Ga0105249_10517832 Ga0105249_105178322 264
68 3300013105 Ga0157369_10656488 Ga0157369_106564882 264
69 3300014497 Ga0182008_10054337 Ga0182008_100543372 264
70 3300020070 Ga0206356_10877305 Ga0206356_108773051 264
71 3300025909 Ga0207705_10248728 Ga0207705_102487281 264
72 3300025919 Ga0207657_10174839 Ga0207657_101748392 264
73 3300031241 Ga0265325_10000522 Ga0265325_1000052213 264
74 3300031548 Ga0307408_100545175 Ga0307408_1005451751 264
75 3300031995 Ga0307409_100675185 Ga0307409_1006751851 264
76 3300032002 Ga0307416_100653719 Ga0307416_1006537192 264
77 3300035725 Ga0373947_0074470 Ga0373947_0074470_301_1098 264
78 3300037068 Ga0373925_0049358 Ga0373925_0049358_1303_2100 264
79 3300039437 Ga0436365_1002842 Ga0436365_1002842_212_1006 264
80 3300039447 Ga0436361_0127548 Ga0436361_0127548_1974_2768 264
81 3300041408 Ga0439453_0004295 Ga0439453_0004295_550_1344 264
82 3300046475 Ga0495639_0026219 Ga0495639_0026219_821_1615 264
83 3300046516 Ga0495628_0315233 Ga0495628_0315233_348_1142 264
84 3300046809 Ga0495600_0311750 Ga0495600_0311750_136_930 264
85 3300047315 Ga0495581_0030786 Ga0495581_0030786_587_1381 264
86 3300048906 Ga0496103_0335066 Ga0496103_0335066_32_826 264
87 3300048907 Ga0496104_0006339 Ga0496104_0006339_5305_6099 264
88 3300048907 Ga0496104_0012053 Ga0496104_0012053_1647_2441 264
89 3300048911 Ga0496108_0005887 Ga0496108_0005887_941_1735 264
90 3300048911 Ga0496108_0315679 Ga0496108_0315679_403_1203 264
91 3300048912 Ga0496109_0001670 Ga0496109_0001670_4643_5437 264
92 3300048913 Ga0496110_0007781 Ga0496110_0007781_6699_7493 264
93 3300048913 Ga0496110_0138070 Ga0496110_0138070_1359_2153 264
94 3300048914 Ga0496111_0029482 Ga0496111_0029482_1390_2184 264
95 3300048916 Ga0496113_0007323 Ga0496113_0007323_2106_2900 264
96 3300048917 Ga0496114_0133272 Ga0496114_0133272_82_876 264
97 3300048918 Ga0496115_0024734 Ga0496115_0024734_1392_2186 264
98 3300048918 Ga0496115_0035229 Ga0496115_0035229_3104_3898 264
99 3300049568 Ga0501031_0022335 Ga0501031_0022335_131_925 264
100 3300049569 Ga0501032_0003451 Ga0501032_0003451_2620_3414 264
101 3300049571 Ga0501034_0046490 Ga0501034_0046490_2526_3320 264
102 3300049572 Ga0501036_0029963 Ga0501036_0029963_1408_2202 264
103 3300049573 Ga0501037_0023815 Ga0501037_0023815_3142_3936 264
104 3300049574 Ga0501038_0081738 Ga0501038_0081738_639_1433 264
105 3300049578 Ga0501042_0107526 Ga0501042_0107526_142_936 264
106 3300049579 Ga0501043_0025639 Ga0501043_0025639_2192_2986 264
107 3300049579 Ga0501043_0129290 Ga0501043_0129290_737_1531 264
108 3300049580 Ga0501046_0012002 Ga0501046_0012002_15_809 264
109 3300049581 Ga0501047_0012471 Ga0501047_0012471_26_820 264
110 3300049581 Ga0501047_0151516 Ga0501047_0151516_17_811 264
111 3300049582 Ga0501048_0007052 Ga0501048_0007052_6594_7388 264
112 3300049582 Ga0501048_0238464 Ga0501048_0238464_113_907 264
113 3300049583 Ga0501067_0021140 Ga0501067_0021140_1285_2079 264
114 3300049584 Ga0501068_0002854 Ga0501068_0002854_1829_2623 264
115 3300049585 Ga0501069_0004828 Ga0501069_0004828_5719_6513 264
116 3300049586 Ga0501070_0052986 Ga0501070_0052986_639_1433 264
117 3300049586 Ga0501070_0161193 Ga0501070_0161193_936_1733 264
118 3300049587 Ga0501071_0009558 Ga0501071_0009558_5218_6012 264
119 3300049588 Ga0501072_0129771 Ga0501072_0129771_899_1693 264
120 3300049589 Ga0501073_0002836 Ga0501073_0002836_6135_6929 264
121 3300049590 Ga0501074_0003222 Ga0501074_0003222_6884_7678 264
122 3300049592 Ga0501076_0110407 Ga0501076_0110407_1044_1838 264
123 3300049741 Ga0501079_0241222 Ga0501079_0241222_279_1073 264
124 3300049742 Ga0501080_0005263 Ga0501080_0005263_5827_6621 264
125 3300049742 Ga0501080_0265493 Ga0501080_0265493_645_1439 264
126 3300049743 Ga0501081_0281475 Ga0501081_0281475_62_856 264
127 3300049744 Ga0501083_0122647 Ga0501083_0122647_804_1598 264
128 3300049744 Ga0501083_0136697 Ga0501083_0136697_279_1073 264
129 3300049822 Ga0501035_0019565 Ga0501035_0019565_3196_3990 264
130 3300049823 Ga0501044_0000782 Ga0501044_0000782_31228_32022 264
131 3300049823 Ga0501044_0029859 Ga0501044_0029859_2291_3085 264
132 3300049824 Ga0501045_0007572 Ga0501045_0007572_5654_6448 264
133 3300054114 Ga0501084_0136438 Ga0501084_0136438_368_1162 264
134 iso_pu_bacteria 2507262055 2507510033 264
135 iso_pu_bacteria 2508501009 2508544035 264
136 iso_pu_bacteria 2508501042 2508698030 264
137 iso_pu_bacteria 2508501128 2509147561 264
138 iso_pu_bacteria 2511231028 2511397584 264
139 iso_pu_bacteria 2513237092 2513628194 264
140 iso_pu_bacteria 2513237094 2513643565 264
141 iso_pu_bacteria 2513237095 2513648999 264
142 iso_pu_bacteria 2513237096 2513660086 264
143 iso_pu_bacteria 2513237098 2513676424 264
144 iso_pu_bacteria 2513237102 2513702569 264
145 iso_pu_bacteria 2513237104 2513720548 264
146 iso_pu_bacteria 2513237137 2513858263 264
147 iso_pu_bacteria 2513237139 2513878116 264
148 iso_pu_bacteria 2513237141 2513893302 264
149 iso_pu_bacteria 2513237145 2513922104 264
150 iso_pu_bacteria 2513237161 2514012588 264
151 iso_pu_bacteria 2515154112 2515629462 264
152 iso_pu_bacteria 2517093001 2517107530 264
153 iso_pu_bacteria 2517572143 2517893848 264
154 iso_pu_bacteria 2524023205 2524439064 264
155 iso_pu_bacteria 2524023210 2524469465 264
156 iso_pu_bacteria 2524023228 2524537802 264
157 iso_pu_bacteria 2528768022 2528849605 264
158 iso_pu_bacteria 2602042107 2603861052 264
159 iso_pu_bacteria 2617270735 2617353072 264
160 iso_pu_bacteria 2617270741 2617378957 264
161 iso_pu_bacteria 2643221651 2644287818 264
162 iso_pu_bacteria 2643221736 2644743223 264
163 iso_pu_bacteria 2667528175 2671122844 264
164 iso_pu_bacteria 2744054633 2745078823 264
165 iso_pu_bacteria 2791355196 2793059986 264
166 iso_pu_bacteria 2791355197 2793072518 264
167 iso_pu_bacteria 2802429603 2805920077 264
168 iso_pu_bacteria 2816332527 2818241597 264
169 iso_pu_bacteria 2824600985 2824605600 264
170 iso_pu_bacteria 2824609381 2824609850 264
171 iso_pu_bacteria 2824617872 2824626448 264
172 iso_pu_bacteria 2824626560 2824633852 264
173 iso_pu_bacteria 2824635225 2824643784 264
174 iso_pu_bacteria 2824644064 2824652503 264
175 iso_pu_bacteria 2824653114 2824655751 264
176 iso_pu_bacteria 2824661429 2824669460 264
177 iso_pu_bacteria 2824671348 2824674208 264
178 iso_pu_bacteria 2824679649 2824686171 264
179 iso_pu_bacteria 2824687955 2824693012 264
180 iso_pu_bacteria 2824696289 2824698895 264
181 iso_pu_bacteria 2824704595 2824713468 264
182 iso_pu_bacteria 2824714736 2824722991 264
183 iso_pu_bacteria 2824723954 2824732419 264
184 iso_pu_bacteria 2824732956 2824740491 264
185 iso_pu_bacteria 2824746037 2824752352 264
186 iso_pu_bacteria 2824753945 2824758025 264
187 iso_pu_bacteria 2824763712 2824766163 264
188 iso_pu_bacteria 2824773399 2824781046 264
189 iso_pu_bacteria 2838122688 2838127525 264
190 iso_pu_bacteria 2841760612 2841761258 264
191 iso_pu_bacteria 2841941048 2841941522 264
192 iso_pu_bacteria 2841949485 2841952462 264
193 iso_pu_bacteria 2841957949 2841959480 264
194 iso_pu_bacteria 2841966195 2841967665 264
195 iso_pu_bacteria 2841974524 2841982168 264
196 iso_pu_bacteria 2841983080 2841986486 264
197 iso_pu_bacteria 2842038055 2842038248 264
198 iso_pu_bacteria 2842045827 2842048806 264
199 iso_pu_bacteria 2844104063 2844104283 264
200 iso_pu_bacteria 2844315083 2844317729 264
201 iso_pu_bacteria 2847930680 2847934519 264
202 iso_pu_bacteria 2847939898 2847945127 264
203 iso_pu_bacteria 2849076700 2849080692 264
204 iso_pu_bacteria 2851246043 2851247271 264
205 iso_pu_bacteria 2857509624 2857509947 264
206 iso_pu_bacteria 2857524615 2857528818 264
207 iso_pu_bacteria 2874590934 2874596779 264
208 iso_pu_bacteria 2874612657 2874618218 264
209 iso_pu_bacteria 2874620515 2874623206 264
210 iso_pu_bacteria 2874628541 2874636045 264
211 iso_pu_bacteria 2874645413 2874652991 264
212 iso_pu_bacteria 2876761206 2876766697 264
213 iso_pu_bacteria 2876771140 2876776925 264
214 iso_pu_bacteria 2876818435 2876825325 264
215 iso_pu_bacteria 2879074833 2879081062 264
216 iso_pu_bacteria 2879083081 2879089711 264
217 iso_pu_bacteria 2879099564 2879107726 264
218 iso_pu_bacteria 2879127579 2879130800 264
219 iso_pu_bacteria 2879142872 2879147611 264
220 iso_pu_bacteria 2881364244 2881365681 264
221 iso_pu_bacteria 2881665667 2881671718 264
222 iso_pu_bacteria 2885366525 2885368929 264
223 iso_pu_bacteria 2885383462 2885387426 264
224 iso_pu_bacteria 2885409591 2885414266 264
225 iso_pu_bacteria 2888378607 2888382456 264
226 iso_pu_bacteria 2888388044 2888388233 264
227 iso_pu_bacteria 2888419890 2888423038 264
228 iso_pu_bacteria 2893066018 2893069015 264
229 iso_pu_bacteria 2903727486 2903735409 264
230 iso_pu_bacteria 2903748898 2903751859 264
231 iso_pu_bacteria 2903768456 2903776324 264
232 iso_pu_bacteria 2904666416 2904670026 264
233 iso_pu_bacteria 2904690495 2904691630 264
234 iso_pu_bacteria 2904699407 2904700761 264
235 iso_pu_bacteria 2904711408 2904718485 264
236 iso_pu_bacteria 2906602504 2906608672 264
237 iso_pu_bacteria 2906610324 2906610729 264
238 iso_pu_bacteria 2906626472 2906633540 264
239 iso_pu_bacteria 2906635258 2906635893 264
240 iso_pu_bacteria 2906643746 2906649914 264
241 iso_pu_bacteria 2906660503 2906664011 264
242 iso_pu_bacteria 2908739725 2908744248 264
243 iso_pu_bacteria 2908756301 2908761838 264
244 iso_pu_bacteria 2908775508 2908778705 264
245 iso_pu_bacteria 2919073203 2919079244 264
246 iso_pu_bacteria 2922368715 2922375508 264
247 iso_pu_bacteria 2922393267 2922394979 264
248 iso_pu_bacteria 2922425934 2922428589 264
249 iso_pu_bacteria 2929615660 2929616244 264
250 iso_pu_bacteria 2929624759 2929624988 264
251 iso_pu_bacteria 2932784394 2932787091 264
252 iso_pu_bacteria 2932794094 2932797316 264
253 iso_pu_bacteria 2932801729 2932804799 264
254 iso_pu_bacteria 2932809354 2932811285 264
255 iso_pu_bacteria 2932818245 2932819842 264
256 iso_pu_bacteria 2932828146 2932832319 264
257 iso_pu_bacteria 2933577622 2933578472 264
258 iso_pu_bacteria 2935608549 2935611062 264
259 iso_pu_bacteria 2935616580 2935619031 264
260 iso_pu_bacteria 2935630451 2935634566 264
261 iso_pu_bacteria 2935638405 2935643152 264
262 iso_pu_bacteria 2935648319 2935648498 264
263 iso_pu_bacteria 2935656913 2935657514 264
264 iso_pu_bacteria 2935665750 2935669778 264
265 iso_pu_bacteria 2935675223 2935677082 264
266 iso_pu_bacteria 2935684952 2935693119 264
267 iso_pu_bacteria 2935694250 2935695388 264
268 iso_pu_bacteria 2935703347 2935709503 264
269 iso_pu_bacteria 2935713505 2935719727 264
270 iso_pu_bacteria 2935722832 2935729506 264
271 iso_pu_bacteria 2935732158 2935739610 264
272 iso_pu_bacteria 2935741537 2935748648 264
273 iso_pu_bacteria 2935750917 2935756765 264
274 iso_pu_bacteria 2935760218 2935761249 264
275 iso_pu_bacteria 2935769743 2935771476 264
276 iso_pu_bacteria 2935777560 2935779166 264
277 iso_pu_bacteria 2935785616 2935788369 264
278 iso_pu_bacteria 2935793552 2935800906 264
279 iso_pu_bacteria 2935801545 2935807298 264
280 iso_pu_bacteria 2935810662 2935812437 264
281 iso_pu_bacteria 2935819856 2935820547 264
282 iso_pu_bacteria 2935827899 2935832704 264
283 iso_pu_bacteria 2935837841 2935839217 264
284 iso_pu_bacteria 2935847175 2935849444 264
285 iso_pu_bacteria 2935855204 2935857396 264
286 iso_pu_bacteria 2935864058 2935864925 264
287 iso_pu_bacteria 2935873716 2935876703 264
288 iso_pu_bacteria 2935883170 2935884965 264
289 iso_pu_bacteria 2935908558 2935911782 264
290 iso_pu_bacteria 2935916978 2935919437 264
291 iso_pu_bacteria 2935926038 2935928811 264
292 iso_pu_bacteria 2935934488 2935938456 264
293 iso_pu_bacteria 2935942939 2935945652 264
294 iso_pu_bacteria 2935951376 2935954741 264
295 iso_pu_bacteria 2935959822 2935963339 264
296 iso_pu_bacteria 2935967501 2935970628 264
297 iso_pu_bacteria 2935975950 2935979135 264
298 iso_pu_bacteria 2935984226 2935987854 264
299 iso_pu_bacteria 2935992306 2935999683 264
300 iso_pu_bacteria 2936002035 2936008296 264
301 iso_pu_bacteria 2936011229 2936011408 264
302 iso_pu_bacteria 2936019824 2936020003 264
303 iso_pu_bacteria 2936028420 2936028599 264
304 iso_pu_bacteria 2936037263 2936039030 264
305 iso_pu_bacteria 2936046547 2936046726 264
306 iso_pu_bacteria 2936055302 2936063109 264
307 iso_pu_bacteria 2940556831 2940562679 264
308 iso_pu_bacteria 2941507105 2941509052 264
309 iso_pu_bacteria 2941515067 2941516881 264
310 iso_pu_bacteria 2941523033 2941525024 264
311 iso_pu_bacteria 2941531003 2941536369 264
312 iso_pu_bacteria 2941538514 2941539907 264
313 iso_pu_bacteria 3005474847 3005478718 264
314 iso_pu_bacteria 3005483717 3005487929 264
315 iso_pu_bacteria 3005506211 3005508749 264
316 iso_pu_bacteria 3005587118 3005589437 264
317 iso_pu_bacteria 3005594810 3005597463 264
318 iso_pu_bacteria 3005710791 3005713495 264
319 iso_pu_bacteria 3005718088 3005720901 264
320 iso_pu_bacteria 8006926726 8006930226 264
321 iso_pu_bacteria 8006933436 8006942628 264
322 iso_pu_bacteria 8006973647 8006982356 264
323 iso_pu_bacteria 8016511872 8016515115 264
324 iso_pu_bacteria 8016522445 8016522905 264
325 iso_pu_bacteria 8016530956 8016536368 264
326 iso_pu_bacteria 8016539877 8016540643 264
327 iso_pu_bacteria 8016548790 8016552600 264
328 iso_pu_bacteria 8016566248 8016574728 264
329 iso_pu_bacteria 8016575299 8016578802 264
330 iso_pu_bacteria 8016583857 8016590843 264
331 iso_pu_bacteria 8016595262 8016598843 264
332 iso_pu_bacteria 8016603502 8016612237 264
333 iso_pu_bacteria 8016622563 8016628389 264
334 iso_pu_bacteria 8016630954 8016632588 264
335 iso_pu_bacteria 8017057580 8017061338 264
336 iso_pu_bacteria 8019530166 8019536087 264
337 iso_pu_bacteria 8019538911 8019543384 264
338 iso_pu_bacteria 8019547302 8019555470 264
339 iso_pu_bacteria 8019555841 8019558400 264
340 iso_pu_bacteria 8019565922 8019566897 264
341 iso_pu_bacteria 8019576017 8019580807 264
342 iso_pu_bacteria 8019597564 8019602795 264
343 iso_pu_bacteria 8019608314 8019615759 264
344 iso_pu_bacteria 8019619141 8019626506 264
345 iso_pu_bacteria 8019629233 8019635982 264
346 iso_pu_bacteria 8019638758 8019643682 264
347 iso_pu_bacteria 8019648815 8019656462 264
348 iso_pu_bacteria 8019659431 8019663749 264
349 iso_pu_bacteria 8019678201 8019682746 264
350 iso_pu_bacteria 8055742211 8055747891 264
351 iso_pu_bacteria 8056681323 8056687981 264
352 iso_pu_bacteria 8056689827 8056695894 264
353 iso_pu_bacteria 8056967851 8056969529 264
354 iso_pu_bacteria 8057529695 8057530559 264
355 3300003215 JGI25153J46596_10000451 JGI25153J46596_1000045114 265
356 3300005471 Ga0070698_100570947 Ga0070698_1005709472 265
357 3300006042 Ga0075368_10006624 Ga0075368_100066245 265
358 3300006048 Ga0075363_100215185 Ga0075363_1002151852 265
359 3300006177 Ga0075362_10033955 Ga0075362_100339553 265
360 3300006178 Ga0075367_10126538 Ga0075367_101265382 265
361 3300006195 Ga0075366_10169989 Ga0075366_101699891 265
362 3300006353 Ga0075370_10132548 Ga0075370_101325482 265
363 3300006881 Ga0068865_100458786 Ga0068865_1004587861 265
364 3300007788 Ga0099795_10000907 Ga0099795_100009074 265
365 3300010159 Ga0099796_10046241 Ga0099796_100462411 265
366 3300025297 Ga0209758_1000128 Ga0209758_1000128202 265
367 3300035692 Ga0373935_0206967 Ga0373935_0206967_151_948 265
368 3300037068 Ga0373925_0212796 Ga0373925_0212796_584_1381 265
369 3300046460 Ga0495638_0217480 Ga0495638_0217480_29_853 265
370 3300048924 Ga0496121_0059090 Ga0496121_0059090_1229_2029 265
371 3300048925 Ga0496122_0001252 Ga0496122_0001252_25116_25919 265
372 3300048926 Ga0496123_0001065 Ga0496123_0001065_15591_16394 265
373 3300049589 Ga0501073_0178908 Ga0501073_0178908_368_1165 265
374 3300050489 nmdc:mga03683_21738_c1 nmdc:mga03683_21738_c1_486_1283 265
375 3300050492 nmdc:mga0yw44_226711_c1 nmdc:mga0yw44_226711_c1_302_1099 265
376 3300050494 nmdc:mga06z11_83128_c1 nmdc:mga06z11_83128_c1_102_899 265
377 3300050512 nmdc:mga0n895_402230_c1 nmdc:mga0n895_402230_c1_574_1371 265
378 3300050513 nmdc:mga0rr50_77127_c1 nmdc:mga0rr50_77127_c1_946_1743 265
379 3300053153 Ga0500616_0025276 Ga0500616_0025276_210_1007 265
380 3300053730 Ga0500645_004477 Ga0500645_004477_2260_3063 265
381 3300005364 Ga0070673_100333760 Ga0070673_1003337602 266
382 3300005445 Ga0070708_100415282 Ga0070708_1004152822 266
383 3300005937 Ga0081455_10000678 Ga0081455_1000067835 266
384 3300006048 Ga0075363_100240243 Ga0075363_1002402432 266
385 3300006051 Ga0075364_10012727 Ga0075364_100127275 266
386 3300006177 Ga0075362_10006576 Ga0075362_100065764 266
387 3300006871 Ga0075434_100185974 Ga0075434_1001859744 266
388 3300009101 Ga0105247_10524524 Ga0105247_105245241 266
389 3300009545 Ga0105237_10022559 Ga0105237_100225594 266
390 3300025914 Ga0207671_10093493 Ga0207671_100934932 266
391 3300031903 Ga0307407_10292490 Ga0307407_102924902 266
392 3300037068 Ga0373925_0048657 Ga0373925_0048657_1240_2040 266
393 3300037853 Ga0436364_0901535 Ga0436364_0901535_770_1570 266
394 3300047320 Ga0495672_0092787 Ga0495672_0092787_620_1420 266
395 3300048903 Ga0496100_0248372 Ga0496100_0248372_301_1101 266
396 3300048904 Ga0496101_0150986 Ga0496101_0150986_832_1632 266
397 3300048908 Ga0496105_0092579 Ga0496105_0092579_1106_1906 266
398 3300048917 Ga0496114_0046385 Ga0496114_0046385_201_1001 266
399 3300050489 nmdc:mga03683_10072_c1 nmdc:mga03683_10072_c1_116_916 266
400 3300050490 nmdc:mga03n38_278947_c1 nmdc:mga03n38_278947_c1_11_811 266
401 3300050490 nmdc:mga03n38_8390_c1 nmdc:mga03n38_8390_c1_2364_3164 266
402 3300050491 nmdc:mga00v17_11368_c1 nmdc:mga00v17_11368_c1_1486_2286 266
403 3300050492 nmdc:mga0yw44_1312_c2 nmdc:mga0yw44_1312_c2_1088_1888 266
404 3300050496 nmdc:mga07m45_15739_c1 nmdc:mga07m45_15739_c1_1570_2370 266
405 3300050510 nmdc:mga06r32_420333_c1 nmdc:mga06r32_420333_c1_29_829 266
406 3300050510 nmdc:mga06r32_70105_c1 nmdc:mga06r32_70105_c1_1649_2449 266
407 3300050512 nmdc:mga0n895_123090_c1 nmdc:mga0n895_123090_c1_492_1292 266
408 3300053139 Ga0500568_0002331 Ga0500568_0002331_5349_6149 266
409 3300053139 Ga0500568_0058119 Ga0500568_0058119_497_1297 266
410 3300002070 JGI24750J21931_1002415 JGI24750J21931_10024152 267
411 3300003215 JGI25153J46596_10001314 JGI25153J46596_1000131416 267
412 3300003322 rootL2_10089904 rootL2_100899042 267
413 3300003659 JGI25404J52841_10015895 JGI25404J52841_100158952 267
414 3300003771 Ga0055526_1000667 Ga0055526_100066726 267
415 3300003775 Ga0055524_1000035 Ga0055524_1000035170 267
416 3300005289 Ga0065704_10171119 Ga0065704_101711192 267
417 3300005331 Ga0070670_100299103 Ga0070670_1002991032 267
418 3300005334 Ga0068869_100086296 Ga0068869_1000862963 267
419 3300005334 Ga0068869_100233447 Ga0068869_1002334472 267
420 3300005337 Ga0070682_100174397 Ga0070682_1001743972 267
421 3300005339 Ga0070660_100238149 Ga0070660_1002381491 267
422 3300005340 Ga0070689_100491701 Ga0070689_1004917012 267
423 3300005344 Ga0070661_100141923 Ga0070661_1001419232 267
424 3300005347 Ga0070668_100147708 Ga0070668_1001477083 267
425 3300005353 Ga0070669_100061596 Ga0070669_1000615962 267
426 3300005356 Ga0070674_100129168 Ga0070674_1001291681 267
427 3300005365 Ga0070688_100167771 Ga0070688_1001677711 267
428 3300005366 Ga0070659_100195065 Ga0070659_1001950651 267
429 3300005436 Ga0070713_100452735 Ga0070713_1004527351 267
430 3300005437 Ga0070710_10365363 Ga0070710_103653631 267
431 3300005441 Ga0070700_100141293 Ga0070700_1001412932 267
432 3300005455 Ga0070663_100048048 Ga0070663_1000480482 267
433 3300005455 Ga0070663_100068566 Ga0070663_1000685663 267
434 3300005455 Ga0070663_100130667 Ga0070663_1001306672 267
435 3300005455 Ga0070663_100204539 Ga0070663_1002045392 267
436 3300005455 Ga0070663_100321443 Ga0070663_1003214431 267
437 3300005456 Ga0070678_100241529 Ga0070678_1002415292 267
438 3300005457 Ga0070662_100054481 Ga0070662_1000544814 267
439 3300005457 Ga0070662_100203127 Ga0070662_1002031272 267
440 3300005458 Ga0070681_10515695 Ga0070681_105156951 267
441 3300005459 Ga0068867_100172363 Ga0068867_1001723632 267
442 3300005471 Ga0070698_100159943 Ga0070698_1001599433 267
443 3300005530 Ga0070679_100182713 Ga0070679_1001827132 267
444 3300005535 Ga0070684_100265824 Ga0070684_1002658241 267
445 3300005535 Ga0070684_100521141 Ga0070684_1005211411 267
446 3300005543 Ga0070672_100309074 Ga0070672_1003090741 267
447 3300005544 Ga0070686_100057152 Ga0070686_1000571523 267
448 3300005547 Ga0070693_100182205 Ga0070693_1001822051 267
449 3300005548 Ga0070665_100056786 Ga0070665_1000567864 267
450 3300005548 Ga0070665_100116399 Ga0070665_1001163992 267
451 3300005548 Ga0070665_100162325 Ga0070665_1001623252 267
452 3300005548 Ga0070665_100230416 Ga0070665_1002304162 267
453 3300005549 Ga0070704_100277690 Ga0070704_1002776901 267
454 3300005563 Ga0068855_100150826 Ga0068855_1001508263 267
455 3300005564 Ga0070664_100312398 Ga0070664_1003123982 267
456 3300005577 Ga0068857_100368470 Ga0068857_1003684702 267
457 3300005578 Ga0068854_100021673 Ga0068854_1000216732 267
458 3300005614 Ga0068856_100001174 Ga0068856_1000011746 267
459 3300005614 Ga0068856_100114989 Ga0068856_1001149894 267
460 3300005615 Ga0070702_100102198 Ga0070702_1001021981 267
461 3300005617 Ga0068859_100810597 Ga0068859_1008105971 267
462 3300005618 Ga0068864_100012541 Ga0068864_1000125415 267
463 3300005618 Ga0068864_100162229 Ga0068864_1001622293 267
464 3300005718 Ga0068866_10071071 Ga0068866_100710712 267
465 3300005719 Ga0068861_100231480 Ga0068861_1002314802 267
466 3300005841 Ga0068863_100479862 Ga0068863_1004798622 267
467 3300005842 Ga0068858_100075435 Ga0068858_1000754353 267
468 3300005842 Ga0068858_100263891 Ga0068858_1002638912 267
469 3300005842 Ga0068858_100829660 Ga0068858_1008296601 267
470 3300005843 Ga0068860_100332997 Ga0068860_1003329972 267
471 3300005844 Ga0068862_100131593 Ga0068862_1001315933 267
472 3300005844 Ga0068862_100412615 Ga0068862_1004126152 267
473 3300005937 Ga0081455_10025536 Ga0081455_100255362 267
474 3300005937 Ga0081455_10116694 Ga0081455_101166943 267
475 3300005981 Ga0081538_10104598 Ga0081538_101045982 267
476 3300005981 Ga0081538_10179576 Ga0081538_101795761 267
477 3300005983 Ga0081540_1001756 Ga0081540_100175610 267
478 3300005983 Ga0081540_1006848 Ga0081540_10068488 267
479 3300005983 Ga0081540_1007290 Ga0081540_10072903 267
480 3300005983 Ga0081540_1010587 Ga0081540_10105872 267
481 3300005983 Ga0081540_1034455 Ga0081540_10344553 267
482 3300005985 Ga0081539_10011589 Ga0081539_100115896 267
483 3300006042 Ga0075368_10045649 Ga0075368_100456493 267
484 3300006042 Ga0075368_10060099 Ga0075368_100600992 267
485 3300006048 Ga0075363_100292228 Ga0075363_1002922281 267
486 3300006051 Ga0075364_10008620 Ga0075364_100086203 267
487 3300006186 Ga0075369_10074078 Ga0075369_100740781 267
488 3300006880 Ga0075429_100083790 Ga0075429_1000837902 267
489 3300006881 Ga0068865_100380731 Ga0068865_1003807312 267
490 3300006931 Ga0097620_100810557 Ga0097620_1008105572 267
491 3300007076 Ga0075435_100184445 Ga0075435_1001844452 267
492 3300009092 Ga0105250_10052817 Ga0105250_100528172 267
493 3300009093 Ga0105240_10204687 Ga0105240_102046873 267
494 3300009098 Ga0105245_10242078 Ga0105245_102420782 267
495 3300009098 Ga0105245_10324387 Ga0105245_103243872 267
496 3300009147 Ga0114129_10563371 Ga0114129_105633712 267
497 3300009148 Ga0105243_10366575 Ga0105243_103665752 267
498 3300009177 Ga0105248_10340195 Ga0105248_103401951 267
499 3300009177 Ga0105248_10843798 Ga0105248_108437982 267
500 3300009545 Ga0105237_10021242 Ga0105237_100212422 267
501 3300009545 Ga0105237_10134999 Ga0105237_101349992 267
502 3300009553 Ga0105249_10089260 Ga0105249_100892603 267
503 3300009553 Ga0105249_10241487 Ga0105249_102414871 267
504 3300010375 Ga0105239_10067521 Ga0105239_100675213 267
505 3300010375 Ga0105239_10076462 Ga0105239_100764624 267
506 3300013104 Ga0157370_10167235 Ga0157370_101672351 267
507 3300013105 Ga0157369_10017344 Ga0157369_100173449 267
508 3300013105 Ga0157369_10029148 Ga0157369_100291489 267
509 3300013250 Ga0171462_1022 Ga0171462_102241 267
510 3300013296 Ga0157374_10026672 Ga0157374_100266723 267
511 3300013297 Ga0157378_10102074 Ga0157378_101020743 267
512 3300013297 Ga0157378_10789490 Ga0157378_107894901 267
513 3300013306 Ga0163162_10221407 Ga0163162_102214072 267
514 3300013308 Ga0157375_10033676 Ga0157375_100336763 267
515 3300014325 Ga0163163_10138625 Ga0163163_101386253 267
516 3300014326 Ga0157380_10080678 Ga0157380_100806782 267
517 3300014968 Ga0157379_10126823 Ga0157379_101268232 267
518 3300022467 Ga0224712_10031926 Ga0224712_100319262 267
519 3300025273 Ga0209673_1021249 Ga0209673_10212492 267
520 3300025291 Ga0209675_1001135 Ga0209675_10011358 267
521 3300025295 Ga0209564_1000049 Ga0209564_1000049114 267
522 3300025297 Ga0209758_1003961 Ga0209758_100396112 267
523 3300025299 Ga0209256_1000014 Ga0209256_1000014525 267
524 3300025315 Ga0207697_10041595 Ga0207697_100415951 267
525 3300025711 Ga0207696_1041429 Ga0207696_10414291 267
526 3300025885 Ga0207653_10019287 Ga0207653_100192871 267
527 3300025900 Ga0207710_10031699 Ga0207710_100316993 267
528 3300025901 Ga0207688_10105611 Ga0207688_101056112 267
529 3300025903 Ga0207680_10361987 Ga0207680_103619871 267
530 3300025907 Ga0207645_10043430 Ga0207645_100434304 267
531 3300025910 Ga0207684_10342671 Ga0207684_103426711 267
532 3300025912 Ga0207707_10163811 Ga0207707_101638112 267
533 3300025913 Ga0207695_10448321 Ga0207695_104483212 267
534 3300025919 Ga0207657_10179944 Ga0207657_101799442 267
535 3300025920 Ga0207649_10432275 Ga0207649_104322751 267
536 3300025921 Ga0207652_10156850 Ga0207652_101568502 267
537 3300025921 Ga0207652_10466364 Ga0207652_104663641 267
538 3300025921 Ga0207652_10563702 Ga0207652_105637022 267
539 3300025923 Ga0207681_10456414 Ga0207681_104564142 267
540 3300025924 Ga0207694_10043180 Ga0207694_100431803 267
541 3300025925 Ga0207650_10591916 Ga0207650_105919161 267
542 3300025926 Ga0207659_10353767 Ga0207659_103537672 267
543 3300025928 Ga0207700_10220213 Ga0207700_102202132 267
544 3300025928 Ga0207700_10332026 Ga0207700_103320262 267
545 3300025931 Ga0207644_10129401 Ga0207644_101294012 267
546 3300025931 Ga0207644_10261314 Ga0207644_102613142 267
547 3300025932 Ga0207690_10177974 Ga0207690_101779742 267
548 3300025933 Ga0207706_10157516 Ga0207706_101575162 267
549 3300025933 Ga0207706_10198008 Ga0207706_101980082 267
550 3300025935 Ga0207709_10015434 Ga0207709_100154343 267
551 3300025936 Ga0207670_10496035 Ga0207670_104960351 267
552 3300025938 Ga0207704_10041836 Ga0207704_100418362 267
553 3300025940 Ga0207691_10281127 Ga0207691_102811272 267
554 3300025941 Ga0207711_10315053 Ga0207711_103150532 267
555 3300025941 Ga0207711_10405465 Ga0207711_104054652 267
556 3300025942 Ga0207689_10236505 Ga0207689_102365052 267
557 3300025942 Ga0207689_10297516 Ga0207689_102975162 267
558 3300025942 Ga0207689_10308384 Ga0207689_103083842 267
559 3300025945 Ga0207679_10242062 Ga0207679_102420622 267
560 3300025945 Ga0207679_10261362 Ga0207679_102613622 267
561 3300025949 Ga0207667_10085254 Ga0207667_100852542 267
562 3300025949 Ga0207667_10186518 Ga0207667_101865182 267
563 3300025960 Ga0207651_10382584 Ga0207651_103825842 267
564 3300025972 Ga0207668_10022803 Ga0207668_100228034 267
565 3300025972 Ga0207668_10330808 Ga0207668_103308082 267
566 3300025981 Ga0207640_10076070 Ga0207640_100760702 267
567 3300026023 Ga0207677_10111859 Ga0207677_101118593 267
568 3300026023 Ga0207677_10148197 Ga0207677_101481972 267
569 3300026035 Ga0207703_10510029 Ga0207703_105100291 267
570 3300026035 Ga0207703_10614475 Ga0207703_106144751 267
571 3300026067 Ga0207678_10032223 Ga0207678_100322234 267
572 3300026067 Ga0207678_10093586 Ga0207678_100935863 267
573 3300026067 Ga0207678_10098593 Ga0207678_100985932 267
574 3300026067 Ga0207678_10446167 Ga0207678_104461672 267
575 3300026067 Ga0207678_10515079 Ga0207678_105150792 267
576 3300026075 Ga0207708_10035182 Ga0207708_100351824 267
577 3300026075 Ga0207708_10249397 Ga0207708_102493972 267
578 3300026078 Ga0207702_10000403 Ga0207702_1000040332 267
579 3300026078 Ga0207702_10317682 Ga0207702_103176822 267
580 3300026078 Ga0207702_10337291 Ga0207702_103372912 267
581 3300026089 Ga0207648_10085170 Ga0207648_100851702 267
582 3300026089 Ga0207648_10306793 Ga0207648_103067931 267
583 3300026095 Ga0207676_10032218 Ga0207676_100322184 267
584 3300026095 Ga0207676_10626629 Ga0207676_106266292 267
585 3300026118 Ga0207675_100069147 Ga0207675_1000691473 267
586 3300026121 Ga0207683_10007983 Ga0207683_1000798310 267
587 3300026121 Ga0207683_10134588 Ga0207683_101345883 267
588 3300026121 Ga0207683_10173418 Ga0207683_101734183 267
589 3300028379 Ga0268266_10000827 Ga0268266_1000082730 267
590 3300028379 Ga0268266_10034469 Ga0268266_100344692 267
591 3300028379 Ga0268266_10191297 Ga0268266_101912972 267
592 3300028379 Ga0268266_10193349 Ga0268266_101933492 267
593 3300028380 Ga0268265_10087622 Ga0268265_100876222 267
594 3300028380 Ga0268265_10425050 Ga0268265_104250502 267
595 3300028381 Ga0268264_10168042 Ga0268264_101680422 267
596 3300028381 Ga0268264_10348258 Ga0268264_103482582 267
597 3300028786 Ga0307517_10001329 Ga0307517_1000132935 267
598 3300028794 Ga0307515_10024241 Ga0307515_100242414 267
599 3300028794 Ga0307515_10261866 Ga0307515_102618662 267
600 3300031456 Ga0307513_10123243 Ga0307513_101232433 267
601 3300031548 Ga0307408_100243159 Ga0307408_1002431592 267
602 3300031616 Ga0307508_10112649 Ga0307508_101126492 267
603 3300031711 Ga0265314_10059109 Ga0265314_100591092 267
604 3300031730 Ga0307516_10146305 Ga0307516_101463052 267
605 3300031901 Ga0307406_10276044 Ga0307406_102760442 267
606 3300031903 Ga0307407_10308938 Ga0307407_103089381 267
607 3300031903 Ga0307407_10433353 Ga0307407_104333531 267
608 3300031911 Ga0307412_10406351 Ga0307412_104063511 267
609 3300031995 Ga0307409_100021265 Ga0307409_1000212652 267
610 3300032002 Ga0307416_100127917 Ga0307416_1001279173 267
611 3300032002 Ga0307416_100487924 Ga0307416_1004879242 267
612 3300032004 Ga0307414_10265283 Ga0307414_102652831 267
613 3300032005 Ga0307411_10529524 Ga0307411_105295241 267
614 3300032005 Ga0307411_10708050 Ga0307411_107080501 267
615 3300033180 Ga0307510_10023218 Ga0307510_100232186 267
616 3300035117 Ga0373953_0018376 Ga0373953_0018376_1082_1885 267
617 3300035118 Ga0373954_0032251 Ga0373954_0032251_1587_2390 267
618 3300035119 Ga0373956_0013116 Ga0373956_0013116_1869_2672 267
619 3300035120 Ga0373957_0004250 Ga0373957_0004250_2866_3669 267
620 3300035170 Ga0373943_0012935 Ga0373943_0012935_2181_2984 267
621 3300035691 Ga0373931_0222613 Ga0373931_0222613_61_864 267
622 3300035692 Ga0373935_0022533 Ga0373935_0022533_1510_2313 267
623 3300035724 Ga0373933_0002641 Ga0373933_0002641_3416_4219 267
624 3300035725 Ga0373947_0040313 Ga0373947_0040313_185_988 267
625 3300037418 Ga0395900_0100239 Ga0395900_0100239_905_1708 267
626 3300037466 Ga0395898_0108847 Ga0395898_0108847_581_1384 267
627 3300037466 Ga0395898_0120355 Ga0395898_0120355_1050_1853 267
628 3300038443 Ga0395901_0794120 Ga0395901_0794120_116_919 267
629 3300039450 Ga0436363_0665307 Ga0436363_0665307_120_923 267
630 3300039450 Ga0436363_0892697 Ga0436363_0892697_55_858 267
631 3300041413 Ga0439465_0038204 Ga0439465_0038204_131_934 267
632 3300044684 Ga0466966_0102112 Ga0466966_0102112_467_1270 267
633 3300044694 Ga0466963_0023333 Ga0466963_0023333_375_1178 267
634 3300044694 Ga0466963_0081815 Ga0466963_0081815_30_833 267
635 3300045836 Ga0466958_0020966 Ga0466958_0020966_1202_2005 267
636 3300045976 Ga0466967_0411364 Ga0466967_0411364_447_1250 267
637 3300046452 Ga0495617_035336 Ga0495617_035336_662_1465 267
638 3300046452 Ga0495617_085269 Ga0495617_085269_197_1000 267
639 3300046454 Ga0495592_0006102 Ga0495592_0006102_5817_6620 267
640 3300046459 Ga0495629_0074959 Ga0495629_0074959_908_1711 267
641 3300046461 Ga0495641_0094556 Ga0495641_0094556_499_1302 267
642 3300046462 Ga0495651_0002077 Ga0495651_0002077_9956_10759 267
643 3300046462 Ga0495651_0116962 Ga0495651_0116962_1124_1927 267
644 3300046473 Ga0495582_0043278 Ga0495582_0043278_1163_1966 267
645 3300046473 Ga0495582_0138572 Ga0495582_0138572_474_1277 267
646 3300046474 Ga0495605_0123195 Ga0495605_0123195_316_1119 267
647 3300046492 Ga0495585_0106124 Ga0495585_0106124_264_1067 267
648 3300046492 Ga0495585_0156045 Ga0495585_0156045_181_984 267
649 3300046492 Ga0495585_0184888 Ga0495585_0184888_38_841 267
650 3300046499 Ga0495594_0091672 Ga0495594_0091672_642_1445 267
651 3300046511 Ga0495608_0002695 Ga0495608_0002695_11721_12524 267
652 3300046512 Ga0495610_0099619 Ga0495610_0099619_379_1182 267
653 3300046516 Ga0495628_0002883 Ga0495628_0002883_4915_5718 267
654 3300046517 Ga0495630_0133199 Ga0495630_0133199_38_841 267
655 3300046518 Ga0495631_0023589 Ga0495631_0023589_153_956 267
656 3300046519 Ga0495632_0117776 Ga0495632_0117776_310_1113 267
657 3300046522 Ga0495643_0115681 Ga0495643_0115681_167_970 267
658 3300046526 Ga0495666_0130988 Ga0495666_0130988_292_1095 267
659 3300046529 Ga0495652_0083645 Ga0495652_0083645_55_858 267
660 3300046533 Ga0495640_0003045 Ga0495640_0003045_4820_5623 267
661 3300046536 Ga0495587_0007554 Ga0495587_0007554_5588_6391 267
662 3300046538 Ga0495609_0065443 Ga0495609_0065443_677_1480 267
663 3300046543 Ga0495645_0060457 Ga0495645_0060457_665_1468 267
664 3300046559 Ga0495667_0000140 Ga0495667_0000140_33787_34590 267
665 3300046615 Ga0495656_0059206 Ga0495656_0059206_608_1411 267
666 3300046615 Ga0495656_0062247 Ga0495656_0062247_775_1578 267
667 3300046615 Ga0495656_0068262 Ga0495656_0068262_462_1265 267
668 3300046616 Ga0495668_0068180 Ga0495668_0068180_475_1278 267
669 3300046642 Ga0495634_0004122 Ga0495634_0004122_6025_6828 267
670 3300046648 Ga0495611_0048653 Ga0495611_0048653_569_1372 267
671 3300046663 Ga0495635_0014805 Ga0495635_0014805_66_869 267
672 3300046664 Ga0495659_0049160 Ga0495659_0049160_339_1142 267
673 3300046664 Ga0495659_0072969 Ga0495659_0072969_32_835 267
674 3300046678 Ga0495599_0019518 Ga0495599_0019518_2184_2987 267
675 3300046679 Ga0495623_0005061 Ga0495623_0005061_3251_4054 267
676 3300046680 Ga0495646_0008201 Ga0495646_0008201_4598_5401 267
677 3300046691 Ga0495670_0179861 Ga0495670_0179861_237_1040 267
678 3300046809 Ga0495600_0001507 Ga0495600_0001507_6125_6928 267
679 3300047315 Ga0495581_0136040 Ga0495581_0136040_553_1356 267
680 3300047317 Ga0495604_0001087 Ga0495604_0001087_11668_12471 267
681 3300047320 Ga0495672_0030134 Ga0495672_0030134_1679_2482 267
682 3300047320 Ga0495672_0244629 Ga0495672_0244629_29_832 267
683 3300047321 Ga0495676_0186419 Ga0495676_0186419_66_869 267
684 3300047323 Ga0495683_0075200 Ga0495683_0075200_723_1526 267
685 3300047323 Ga0495683_0163074 Ga0495683_0163074_190_993 267
686 3300047444 Ga0495675_0001246 Ga0495675_0001246_4117_4920 267
687 3300047471 Ga0495684_0132344 Ga0495684_0132344_246_1049 267
688 3300047472 Ga0495686_0228039 Ga0495686_0228039_47_850 267
689 3300047673 Ga0495593_0020602 Ga0495593_0020602_465_1268 267
690 3300048903 Ga0496100_0164111 Ga0496100_0164111_92_895 267
691 3300048904 Ga0496101_0009451 Ga0496101_0009451_4617_5420 267
692 3300048904 Ga0496101_0239824 Ga0496101_0239824_386_1189 267
693 3300048905 Ga0496102_0283199 Ga0496102_0283199_599_1402 267
694 3300048905 Ga0496102_0372167 Ga0496102_0372167_339_1142 267
695 3300048906 Ga0496103_0019927 Ga0496103_0019927_2912_3715 267
696 3300048907 Ga0496104_0008465 Ga0496104_0008465_5606_6409 267
697 3300048908 Ga0496105_0027210 Ga0496105_0027210_417_1220 267
698 3300048908 Ga0496105_0211701 Ga0496105_0211701_291_1094 267
699 3300048909 Ga0496106_0066200 Ga0496106_0066200_1846_2649 267
700 3300048909 Ga0496106_0128967 Ga0496106_0128967_989_1792 267
701 3300048909 Ga0496106_0329650 Ga0496106_0329650_357_1160 267
702 3300048910 Ga0496107_0070931 Ga0496107_0070931_1323_2126 267
703 3300048910 Ga0496107_0136798 Ga0496107_0136798_793_1596 267
704 3300048911 Ga0496108_0242174 Ga0496108_0242174_440_1243 267
705 3300048912 Ga0496109_0041185 Ga0496109_0041185_3110_3913 267
706 3300048912 Ga0496109_0305290 Ga0496109_0305290_23_826 267
707 3300048913 Ga0496110_0005923 Ga0496110_0005923_510_1313 267
708 3300048914 Ga0496111_0366367 Ga0496111_0366367_195_998 267
709 3300048915 Ga0496112_0433061 Ga0496112_0433061_375_1178 267
710 3300048916 Ga0496113_0227005 Ga0496113_0227005_493_1296 267
711 3300048916 Ga0496113_0291562 Ga0496113_0291562_316_1119 267
712 3300048917 Ga0496114_0136972 Ga0496114_0136972_488_1291 267
713 3300048918 Ga0496115_0027014 Ga0496115_0027014_2860_3663 267
714 3300048918 Ga0496115_0049691 Ga0496115_0049691_503_1306 267
715 3300048922 Ga0496119_0096594 Ga0496119_0096594_684_1487 267
716 3300048924 Ga0496121_0096352 Ga0496121_0096352_1424_2227 267
717 3300048924 Ga0496121_0249023 Ga0496121_0249023_34_837 267
718 3300048924 Ga0496121_0291522 Ga0496121_0291522_170_973 267
719 3300048927 Ga0496124_0135253 Ga0496124_0135253_329_1132 267
720 3300048929 Ga0496126_0002727 Ga0496126_0002727_3720_4523 267
721 3300048929 Ga0496126_0108664 Ga0496126_0108664_1152_1955 267
722 3300048929 Ga0496126_0280382 Ga0496126_0280382_157_960 267
723 3300048929 Ga0496126_0383393 Ga0496126_0383393_157_960 267
724 3300048929 Ga0496126_0590146 Ga0496126_0590146_57_860 267
725 3300049459 Ga0495678_081381 Ga0495678_081381_293_1096 267
726 3300049572 Ga0501036_0124937 Ga0501036_0124937_1205_2008 267
727 3300049577 Ga0501041_0107888 Ga0501041_0107888_94_897 267
728 3300049585 Ga0501069_0050013 Ga0501069_0050013_1111_1914 267
729 3300050490 nmdc:mga03n38_1460_c1 nmdc:mga03n38_1460_c1_5948_6751 267
730 3300050492 nmdc:mga0yw44_12608_c1 nmdc:mga0yw44_12608_c1_2776_3579 267
731 3300050492 nmdc:mga0yw44_213541_c1 nmdc:mga0yw44_213541_c1_348_1151 267
732 3300050493 nmdc:mga0k408_170790_c1 nmdc:mga0k408_170790_c1_461_1264 267
733 3300050496 nmdc:mga07m45_87674_c1 nmdc:mga07m45_87674_c1_552_1355 267
734 3300050507 nmdc:mga05p37_195042_c1 nmdc:mga05p37_195042_c1_224_1027 267
735 3300050512 nmdc:mga0n895_351408_c1 nmdc:mga0n895_351408_c1_335_1138 267
736 3300050514 nmdc:mga08x19_102384_c1 nmdc:mga08x19_102384_c1_47_850 267
737 3300050515 nmdc:mga0a205_552580_c1 nmdc:mga0a205_552580_c1_137_940 267
738 3300053077 Ga0495601_0010057 Ga0495601_0010057_62_865 267
739 3300053077 Ga0495601_0176564 Ga0495601_0176564_263_1066 267
740 3300053078 Ga0495612_0000375 Ga0495612_0000375_7299_8102 267
741 3300053085 Ga0495619_0045692 Ga0495619_0045692_495_1355 267
742 3300053087 Ga0500643_016934 Ga0500643_016934_1624_2427 267
743 3300053094 Ga0500566_0006182 Ga0500566_0006182_923_1726 267
744 3300053096 Ga0500641_0061325 Ga0500641_0061325_212_1015 267
745 3300053108 Ga0500562_045720 Ga0500562_045720_50_853 267
746 3300053119 Ga0500595_004502 Ga0500595_004502_3283_4086 267
747 3300053119 Ga0500595_025194 Ga0500595_025194_788_1591 267
748 3300053122 Ga0500608_180527 Ga0500608_180527_81_884 267
749 3300053123 Ga0500614_030732 Ga0500614_030732_330_1133 267
750 3300053153 Ga0500616_0036047 Ga0500616_0036047_1257_2060 267
751 3300053155 Ga0500620_109462 Ga0500620_109462_11_814 267
752 3300053156 Ga0500622_0002777 Ga0500622_0002777_82_885 267
753 3300053161 Ga0500634_0062232 Ga0500634_0062232_294_1097 267
754 3300053162 Ga0500638_000418 Ga0500638_000418_2799_3602 267
755 3300053162 Ga0500638_105071 Ga0500638_105071_469_1272 267
756 3300053178 Ga0500637_0000135 Ga0500637_0000135_14005_14808 267
757 3300055283 Ga0500661_001607 Ga0500661_001607_2444_3247 267
758 3300061734 Ga0530510_0412608 Ga0530510_0412608_28_831 267
759 3300001979 JGI24740J21852_10005106 JGI24740J21852_100051063 268
760 3300001990 JGI24737J22298_10003117 JGI24737J22298_100031174 268
761 3300003187 JGI25151J46595_10056929 JGI25151J46595_100569292 268
762 3300003203 JGI25406J46586_10000101 JGI25406J46586_1000010130 268
763 3300003215 JGI25153J46596_10003659 JGI25153J46596_100036591 268
764 3300003215 JGI25153J46596_10004014 JGI25153J46596_100040141 268
765 3300003354 JGI25160J50197_1000504 JGI25160J50197_10005045 268
766 3300003354 JGI25160J50197_1017216 JGI25160J50197_10172162 268
767 3300003794 Ga0055531_10015335 Ga0055531_100153354 268
768 3300005262 Ga0065165_1000306 Ga0065165_100030635 268
769 3300005262 Ga0065165_1002349 Ga0065165_10023499 268
770 3300005262 Ga0065165_1020357 Ga0065165_10203572 268
771 3300005262 Ga0065165_1054102 Ga0065165_10541021 268
772 3300005290 Ga0065712_10240790 Ga0065712_102407901 268
773 3300005295 Ga0065707_10283443 Ga0065707_102834431 268
774 3300005327 Ga0070658_10173002 Ga0070658_101730022 268
775 3300005327 Ga0070658_10193839 Ga0070658_101938393 268
776 3300005328 Ga0070676_10100238 Ga0070676_101002381 268
777 3300005329 Ga0070683_100011953 Ga0070683_1000119539 268
778 3300005331 Ga0070670_100030128 Ga0070670_1000301282 268
779 3300005331 Ga0070670_100292991 Ga0070670_1002929912 268
780 3300005333 Ga0070677_10018814 Ga0070677_100188142 268
781 3300005335 Ga0070666_10112350 Ga0070666_101123502 268
782 3300005336 Ga0070680_100006770 Ga0070680_1000067704 268
783 3300005336 Ga0070680_100545413 Ga0070680_1005454131 268
784 3300005337 Ga0070682_100026108 Ga0070682_1000261082 268
785 3300005339 Ga0070660_100007738 Ga0070660_1000077383 268
786 3300005343 Ga0070687_100179316 Ga0070687_1001793162 268
787 3300005344 Ga0070661_100518765 Ga0070661_1005187651 268
788 3300005347 Ga0070668_100071133 Ga0070668_1000711331 268
789 3300005354 Ga0070675_100043504 Ga0070675_1000435043 268
790 3300005354 Ga0070675_100470781 Ga0070675_1004707811 268
791 3300005355 Ga0070671_100034075 Ga0070671_1000340753 268
792 3300005355 Ga0070671_100069367 Ga0070671_1000693672 268
793 3300005356 Ga0070674_100199981 Ga0070674_1001999812 268
794 3300005364 Ga0070673_100619091 Ga0070673_1006190911 268
795 3300005365 Ga0070688_100131714 Ga0070688_1001317141 268
796 3300005366 Ga0070659_100145081 Ga0070659_1001450812 268
797 3300005367 Ga0070667_100070329 Ga0070667_1000703294 268
798 3300005367 Ga0070667_100232897 Ga0070667_1002328972 268
799 3300005434 Ga0070709_10000431 Ga0070709_1000043126 268
800 3300005434 Ga0070709_10074240 Ga0070709_100742402 268
801 3300005434 Ga0070709_10122190 Ga0070709_101221902 268
802 3300005435 Ga0070714_100063453 Ga0070714_1000634533 268
803 3300005435 Ga0070714_100066906 Ga0070714_1000669063 268
804 3300005435 Ga0070714_100143656 Ga0070714_1001436562 268
805 3300005435 Ga0070714_100324888 Ga0070714_1003248882 268
806 3300005435 Ga0070714_100330228 Ga0070714_1003302282 268
807 3300005435 Ga0070714_100333169 Ga0070714_1003331691 268
808 3300005436 Ga0070713_100017738 Ga0070713_1000177384 268
809 3300005436 Ga0070713_100019948 Ga0070713_1000199483 268
810 3300005436 Ga0070713_100117707 Ga0070713_1001177071 268
811 3300005436 Ga0070713_100277497 Ga0070713_1002774972 268
812 3300005437 Ga0070710_10002535 Ga0070710_1000253510 268
813 3300005437 Ga0070710_10002728 Ga0070710_100027289 268
814 3300005437 Ga0070710_10008750 Ga0070710_100087503 268
815 3300005437 Ga0070710_10012830 Ga0070710_100128302 268
816 3300005437 Ga0070710_10172965 Ga0070710_101729652 268
817 3300005439 Ga0070711_100011415 Ga0070711_1000114152 268
818 3300005439 Ga0070711_100022339 Ga0070711_1000223392 268
819 3300005439 Ga0070711_100028158 Ga0070711_1000281582 268
820 3300005439 Ga0070711_100079765 Ga0070711_1000797653 268
821 3300005439 Ga0070711_100181255 Ga0070711_1001812552 268
822 3300005439 Ga0070711_100241900 Ga0070711_1002419002 268
823 3300005445 Ga0070708_100302659 Ga0070708_1003026592 268
824 3300005455 Ga0070663_100299024 Ga0070663_1002990242 268
825 3300005455 Ga0070663_100415887 Ga0070663_1004158871 268
826 3300005455 Ga0070663_100510562 Ga0070663_1005105621 268
827 3300005456 Ga0070678_100014099 Ga0070678_1000140992 268
828 3300005457 Ga0070662_100042264 Ga0070662_1000422641 268
829 3300005457 Ga0070662_100258663 Ga0070662_1002586632 268
830 3300005457 Ga0070662_100260946 Ga0070662_1002609461 268
831 3300005457 Ga0070662_100543505 Ga0070662_1005435051 268
832 3300005458 Ga0070681_10032089 Ga0070681_100320895 268
833 3300005458 Ga0070681_10043838 Ga0070681_100438384 268
834 3300005458 Ga0070681_10117782 Ga0070681_101177822 268
835 3300005458 Ga0070681_10334263 Ga0070681_103342631 268
836 3300005467 Ga0070706_100522136 Ga0070706_1005221361 268
837 3300005471 Ga0070698_100309092 Ga0070698_1003090922 268
838 3300005530 Ga0070679_100099489 Ga0070679_1000994891 268
839 3300005530 Ga0070679_100590828 Ga0070679_1005908281 268
840 3300005535 Ga0070684_100011508 Ga0070684_1000115083 268
841 3300005535 Ga0070684_100028786 Ga0070684_1000287862 268
842 3300005539 Ga0068853_100014459 Ga0068853_1000144597 268
843 3300005539 Ga0068853_100024273 Ga0068853_1000242734 268
844 3300005539 Ga0068853_100118118 Ga0068853_1001181182 268
845 3300005543 Ga0070672_100191761 Ga0070672_1001917612 268
846 3300005543 Ga0070672_100405772 Ga0070672_1004057722 268
847 3300005544 Ga0070686_100211106 Ga0070686_1002111062 268
848 3300005547 Ga0070693_100260830 Ga0070693_1002608301 268
849 3300005548 Ga0070665_100038170 Ga0070665_1000381703 268
850 3300005548 Ga0070665_100054191 Ga0070665_1000541914 268
851 3300005548 Ga0070665_100334175 Ga0070665_1003341751 268
852 3300005549 Ga0070704_100518595 Ga0070704_1005185951 268
853 3300005563 Ga0068855_100010086 Ga0068855_10001008613 268
854 3300005563 Ga0068855_100042976 Ga0068855_1000429763 268
855 3300005563 Ga0068855_100044387 Ga0068855_1000443874 268
856 3300005563 Ga0068855_100360150 Ga0068855_1003601503 268
857 3300005563 Ga0068855_100646840 Ga0068855_1006468401 268
858 3300005577 Ga0068857_100057644 Ga0068857_1000576444 268
859 3300005577 Ga0068857_100082849 Ga0068857_1000828493 268
860 3300005577 Ga0068857_100106763 Ga0068857_1001067633 268
861 3300005577 Ga0068857_100392973 Ga0068857_1003929731 268
862 3300005578 Ga0068854_100003033 Ga0068854_1000030332 268
863 3300005578 Ga0068854_100097072 Ga0068854_1000970723 268
864 3300005614 Ga0068856_100013112 Ga0068856_10001311210 268
865 3300005614 Ga0068856_100043927 Ga0068856_1000439275 268
866 3300005614 Ga0068856_100204031 Ga0068856_1002040313 268
867 3300005614 Ga0068856_100386714 Ga0068856_1003867142 268
868 3300005614 Ga0068856_100570697 Ga0068856_1005706972 268
869 3300005615 Ga0070702_100224231 Ga0070702_1002242312 268
870 3300005616 Ga0068852_100010566 Ga0068852_1000105664 268
871 3300005616 Ga0068852_100015107 Ga0068852_1000151074 268
872 3300005616 Ga0068852_100596518 Ga0068852_1005965181 268
873 3300005617 Ga0068859_100340691 Ga0068859_1003406911 268
874 3300005618 Ga0068864_100042677 Ga0068864_1000426772 268
875 3300005618 Ga0068864_100469065 Ga0068864_1004690651 268
876 3300005834 Ga0068851_10077559 Ga0068851_100775592 268
877 3300005834 Ga0068851_10229199 Ga0068851_102291991 268
878 3300005840 Ga0068870_10050577 Ga0068870_100505771 268
879 3300005841 Ga0068863_100215897 Ga0068863_1002158972 268
880 3300005841 Ga0068863_100454207 Ga0068863_1004542072 268
881 3300005842 Ga0068858_100443971 Ga0068858_1004439711 268
882 3300005843 Ga0068860_100000240 Ga0068860_10000024059 268
883 3300005843 Ga0068860_100376457 Ga0068860_1003764572 268
884 3300005937 Ga0081455_10019291 Ga0081455_100192913 268
885 3300005937 Ga0081455_10046347 Ga0081455_100463473 268
886 3300005983 Ga0081540_1003232 Ga0081540_100323213 268
887 3300005983 Ga0081540_1007411 Ga0081540_10074116 268
888 3300005983 Ga0081540_1008929 Ga0081540_10089293 268
889 3300005983 Ga0081540_1029265 Ga0081540_10292654 268
890 3300005983 Ga0081540_1071304 Ga0081540_10713041 268
891 3300005985 Ga0081539_10000008 Ga0081539_10000008519 268
892 3300005985 Ga0081539_10001983 Ga0081539_1000198323 268
893 3300005985 Ga0081539_10002340 Ga0081539_100023405 268
894 3300005985 Ga0081539_10064104 Ga0081539_100641043 268
895 3300006028 Ga0070717_10040025 Ga0070717_100400252 268
896 3300006028 Ga0070717_10127304 Ga0070717_101273043 268
897 3300006028 Ga0070717_10163639 Ga0070717_101636392 268
898 3300006038 Ga0075365_10139832 Ga0075365_101398322 268
899 3300006042 Ga0075368_10031490 Ga0075368_100314902 268
900 3300006051 Ga0075364_10053317 Ga0075364_100533172 268
901 3300006163 Ga0070715_10000340 Ga0070715_100003407 268
902 3300006173 Ga0070716_100035327 Ga0070716_1000353272 268
903 3300006173 Ga0070716_100037143 Ga0070716_1000371433 268
904 3300006173 Ga0070716_100071754 Ga0070716_1000717543 268
905 3300006173 Ga0070716_100297177 Ga0070716_1002971772 268
906 3300006175 Ga0070712_100005879 Ga0070712_1000058796 268
907 3300006175 Ga0070712_100009110 Ga0070712_1000091105 268
908 3300006178 Ga0075367_10055262 Ga0075367_100552622 268
909 3300006178 Ga0075367_10201515 Ga0075367_102015152 268
910 3300006186 Ga0075369_10112938 Ga0075369_101129382 268
911 3300006195 Ga0075366_10085262 Ga0075366_100852622 268
912 3300006237 Ga0097621_100267399 Ga0097621_1002673992 268
913 3300006358 Ga0068871_100228097 Ga0068871_1002280972 268
914 3300006844 Ga0075428_100202828 Ga0075428_1002028282 268
915 3300006871 Ga0075434_100297533 Ga0075434_1002975332 268
916 3300006931 Ga0097620_100340662 Ga0097620_1003406621 268
917 3300006942 Ga0099824_1012954 Ga0099824_10129544 268
918 3300006943 Ga0099822_1001015 Ga0099822_100101527 268
919 3300006944 Ga0099823_1008372 Ga0099823_10083724 268
920 3300007076 Ga0075435_100344557 Ga0075435_1003445572 268
921 3300007265 Ga0099794_10039754 Ga0099794_100397542 268
922 3300007788 Ga0099795_10017799 Ga0099795_100177992 268
923 3300009093 Ga0105240_10008997 Ga0105240_1000899710 268
924 3300009093 Ga0105240_10010555 Ga0105240_1001055514 268
925 3300009093 Ga0105240_10013639 Ga0105240_100136393 268
926 3300009093 Ga0105240_10198300 Ga0105240_101983003 268
927 3300009098 Ga0105245_10071540 Ga0105245_100715403 268
928 3300009098 Ga0105245_10121853 Ga0105245_101218533 268
929 3300009098 Ga0105245_10622222 Ga0105245_106222222 268
930 3300009101 Ga0105247_10037019 Ga0105247_100370192 268
931 3300009101 Ga0105247_10091152 Ga0105247_100911521 268
932 3300009101 Ga0105247_10142577 Ga0105247_101425772 268
933 3300009174 Ga0105241_10004508 Ga0105241_1000450811 268
934 3300009174 Ga0105241_10041098 Ga0105241_100410983 268
935 3300009174 Ga0105241_10129917 Ga0105241_101299172 268
936 3300009174 Ga0105241_10191561 Ga0105241_101915612 268
937 3300009177 Ga0105248_10140847 Ga0105248_101408474 268
938 3300009177 Ga0105248_10364148 Ga0105248_103641482 268
939 3300009545 Ga0105237_10001564 Ga0105237_1000156418 268
940 3300009545 Ga0105237_10012234 Ga0105237_1001223410 268
941 3300009545 Ga0105237_10141911 Ga0105237_101419112 268
942 3300009551 Ga0105238_10006286 Ga0105238_100062864 268
943 3300009551 Ga0105238_10006661 Ga0105238_100066618 268
944 3300009551 Ga0105238_10011390 Ga0105238_100113906 268
945 3300009551 Ga0105238_10121170 Ga0105238_101211702 268
946 3300009551 Ga0105238_10278536 Ga0105238_102785362 268
947 3300009551 Ga0105238_10375144 Ga0105238_103751441 268
948 3300009551 Ga0105238_10439022 Ga0105238_104390222 268
949 3300010159 Ga0099796_10042904 Ga0099796_100429042 268
950 3300010375 Ga0105239_10012332 Ga0105239_100123328 268
951 3300010375 Ga0105239_10022799 Ga0105239_100227994 268
952 3300010375 Ga0105239_10025169 Ga0105239_100251694 268
953 3300010375 Ga0105239_10111037 Ga0105239_101110374 268
954 3300010375 Ga0105239_10116579 Ga0105239_101165792 268
955 3300010375 Ga0105239_10284342 Ga0105239_102843422 268
956 3300011119 Ga0105246_10126402 Ga0105246_101264021 268
957 3300011119 Ga0105246_10276173 Ga0105246_102761732 268
958 3300013104 Ga0157370_10036903 Ga0157370_100369035 268
959 3300013105 Ga0157369_10237904 Ga0157369_102379042 268
960 3300013105 Ga0157369_10823051 Ga0157369_108230511 268
961 3300013297 Ga0157378_10301578 Ga0157378_103015782 268
962 3300013306 Ga0163162_10144314 Ga0163162_101443142 268
963 3300013307 Ga0157372_10184738 Ga0157372_101847381 268
964 3300013308 Ga0157375_10349593 Ga0157375_103495932 268
965 3300014325 Ga0163163_10014045 Ga0163163_100140452 268
966 3300014325 Ga0163163_10052168 Ga0163163_100521684 268
967 3300014325 Ga0163163_10351886 Ga0163163_103518862 268
968 3300014325 Ga0163163_10482258 Ga0163163_104822581 268
969 3300014326 Ga0157380_10161273 Ga0157380_101612732 268
970 3300014326 Ga0157380_10162004 Ga0157380_101620042 268
971 3300014497 Ga0182008_10111167 Ga0182008_101111671 268
972 3300020081 Ga0206354_10571467 Ga0206354_105714672 268
973 3300021320 Ga0214544_1000020 Ga0214544_1000020157 268
974 3300021321 Ga0214542_1000024 Ga0214542_1000024168 268
975 3300021324 Ga0214545_1000011 Ga0214545_1000011168 268
976 3300021327 Ga0214543_1000033 Ga0214543_100003336 268
977 3300021358 Ga0213873_10026144 Ga0213873_100261441 268
978 3300021384 Ga0213876_10009084 Ga0213876_100090843 268
979 3300021384 Ga0213876_10184671 Ga0213876_101846712 268
980 3300021384 Ga0213876_10187411 Ga0213876_101874111 268
981 3300024227 Ga0228598_1004399 Ga0228598_10043992 268
982 3300025254 Ga0209148_1000574 Ga0209148_100057430 268
983 3300025261 Ga0209233_1005617 Ga0209233_10056175 268
984 3300025272 Ga0209455_1009617 Ga0209455_10096174 268
985 3300025272 Ga0209455_1032789 Ga0209455_10327891 268
986 3300025284 Ga0209130_1000111 Ga0209130_100011142 268
987 3300025284 Ga0209130_1041286 Ga0209130_10412861 268
988 3300025294 Ga0209025_1001992 Ga0209025_100199224 268
989 3300025295 Ga0209564_1004509 Ga0209564_10045092 268
990 3300025295 Ga0209564_1007973 Ga0209564_10079734 268
991 3300025295 Ga0209564_1034172 Ga0209564_10341722 268
992 3300025297 Ga0209758_1000065 Ga0209758_100006513 268
993 3300025297 Ga0209758_1000498 Ga0209758_100049837 268
994 3300025297 Ga0209758_1000560 Ga0209758_100056027 268
995 3300025297 Ga0209758_1003962 Ga0209758_100396212 268
996 3300025297 Ga0209758_1004726 Ga0209758_100472613 268
997 3300025297 Ga0209758_1006640 Ga0209758_10066409 268
998 3300025299 Ga0209256_1003626 Ga0209256_100362612 268
999 3300025302 Ga0207426_1000721 Ga0207426_10007214 268
1000 3300025302 Ga0207426_1000728 Ga0207426_100072813 268
1001 3300025302 Ga0207426_1002233 Ga0207426_100223317 268
1002 3300025302 Ga0207426_1008460 Ga0207426_10084601 268
1003 3300025321 Ga0207656_10005979 Ga0207656_100059796 268
1004 3300025321 Ga0207656_10021824 Ga0207656_100218242 268
1005 3300025321 Ga0207656_10145017 Ga0207656_101450171 268
1006 3300025893 Ga0207682_10011232 Ga0207682_100112322 268
1007 3300025898 Ga0207692_10008253 Ga0207692_100082532 268
1008 3300025898 Ga0207692_10049519 Ga0207692_100495192 268
1009 3300025898 Ga0207692_10268504 Ga0207692_102685042 268
1010 3300025900 Ga0207710_10036630 Ga0207710_100366302 268
1011 3300025901 Ga0207688_10084405 Ga0207688_100844052 268
1012 3300025903 Ga0207680_10083837 Ga0207680_100838372 268
1013 3300025903 Ga0207680_10247984 Ga0207680_102479842 268
1014 3300025904 Ga0207647_10001242 Ga0207647_100012428 268
1015 3300025906 Ga0207699_10005571 Ga0207699_100055713 268
1016 3300025906 Ga0207699_10006508 Ga0207699_100065087 268
1017 3300025906 Ga0207699_10075044 Ga0207699_100750442 268
1018 3300025907 Ga0207645_10096827 Ga0207645_100968272 268
1019 3300025907 Ga0207645_10161605 Ga0207645_101616052 268
1020 3300025909 Ga0207705_10074905 Ga0207705_100749052 268
1021 3300025911 Ga0207654_10004074 Ga0207654_100040743 268
1022 3300025911 Ga0207654_10110844 Ga0207654_101108442 268
1023 3300025911 Ga0207654_10131957 Ga0207654_101319572 268
1024 3300025911 Ga0207654_10323018 Ga0207654_103230182 268
1025 3300025912 Ga0207707_10000466 Ga0207707_100004664 268
1026 3300025912 Ga0207707_10011284 Ga0207707_1001128410 268
1027 3300025912 Ga0207707_10032070 Ga0207707_100320702 268
1028 3300025912 Ga0207707_10098339 Ga0207707_100983393 268
1029 3300025912 Ga0207707_10306116 Ga0207707_103061161 268
1030 3300025913 Ga0207695_10000029 Ga0207695_10000029104 268
1031 3300025913 Ga0207695_10001179 Ga0207695_1000117925 268
1032 3300025913 Ga0207695_10024619 Ga0207695_100246197 268
1033 3300025913 Ga0207695_10450081 Ga0207695_104500812 268
1034 3300025914 Ga0207671_10003068 Ga0207671_1000306815 268
1035 3300025914 Ga0207671_10043451 Ga0207671_100434512 268
1036 3300025914 Ga0207671_10067289 Ga0207671_100672893 268
1037 3300025914 Ga0207671_10124855 Ga0207671_101248552 268
1038 3300025914 Ga0207671_10393534 Ga0207671_103935342 268
1039 3300025915 Ga0207693_10000723 Ga0207693_1000072319 268
1040 3300025915 Ga0207693_10068591 Ga0207693_100685913 268
1041 3300025916 Ga0207663_10000219 Ga0207663_1000021924 268
1042 3300025916 Ga0207663_10025741 Ga0207663_100257414 268
1043 3300025916 Ga0207663_10071271 Ga0207663_100712712 268
1044 3300025916 Ga0207663_10072844 Ga0207663_100728443 268
1045 3300025916 Ga0207663_10133224 Ga0207663_101332242 268
1046 3300025916 Ga0207663_10198666 Ga0207663_101986662 268
1047 3300025917 Ga0207660_10022499 Ga0207660_100224994 268
1048 3300025917 Ga0207660_10344569 Ga0207660_103445692 268
1049 3300025917 Ga0207660_10351812 Ga0207660_103518122 268
1050 3300025918 Ga0207662_10065461 Ga0207662_100654612 268
1051 3300025919 Ga0207657_10006956 Ga0207657_100069563 268
1052 3300025919 Ga0207657_10022202 Ga0207657_100222024 268
1053 3300025920 Ga0207649_10031830 Ga0207649_100318302 268
1054 3300025921 Ga0207652_10001798 Ga0207652_1000179811 268
1055 3300025921 Ga0207652_10014679 Ga0207652_100146796 268
1056 3300025921 Ga0207652_10059169 Ga0207652_100591693 268
1057 3300025921 Ga0207652_10209704 Ga0207652_102097042 268
1058 3300025924 Ga0207694_10000131 Ga0207694_1000013120 268
1059 3300025924 Ga0207694_10011244 Ga0207694_100112444 268
1060 3300025924 Ga0207694_10021078 Ga0207694_100210785 268
1061 3300025924 Ga0207694_10337701 Ga0207694_103377012 268
1062 3300025925 Ga0207650_10034857 Ga0207650_100348572 268
1063 3300025926 Ga0207659_10199388 Ga0207659_101993882 268
1064 3300025928 Ga0207700_10015585 Ga0207700_100155852 268
1065 3300025928 Ga0207700_10089106 Ga0207700_100891061 268
1066 3300025928 Ga0207700_10128654 Ga0207700_101286542 268
1067 3300025928 Ga0207700_10236063 Ga0207700_102360632 268
1068 3300025929 Ga0207664_10006314 Ga0207664_100063146 268
1069 3300025929 Ga0207664_10065207 Ga0207664_100652072 268
1070 3300025929 Ga0207664_10103453 Ga0207664_101034533 268
1071 3300025929 Ga0207664_10274516 Ga0207664_102745162 268
1072 3300025929 Ga0207664_10297432 Ga0207664_102974322 268
1073 3300025929 Ga0207664_10348548 Ga0207664_103485482 268
1074 3300025929 Ga0207664_10430608 Ga0207664_104306082 268
1075 3300025929 Ga0207664_10540934 Ga0207664_105409341 268
1076 3300025929 Ga0207664_10584569 Ga0207664_105845691 268
1077 3300025931 Ga0207644_10033426 Ga0207644_100334262 268
1078 3300025931 Ga0207644_10066881 Ga0207644_100668812 268
1079 3300025931 Ga0207644_10135999 Ga0207644_101359992 268
1080 3300025931 Ga0207644_10548414 Ga0207644_105484142 268
1081 3300025932 Ga0207690_10068618 Ga0207690_100686182 268
1082 3300025933 Ga0207706_10062871 Ga0207706_100628714 268
1083 3300025933 Ga0207706_10146667 Ga0207706_101466672 268
1084 3300025934 Ga0207686_10167846 Ga0207686_101678462 268
1085 3300025936 Ga0207670_10074378 Ga0207670_100743782 268
1086 3300025937 Ga0207669_10066264 Ga0207669_100662642 268
1087 3300025939 Ga0207665_10000064 Ga0207665_1000006419 268
1088 3300025939 Ga0207665_10033157 Ga0207665_100331573 268
1089 3300025939 Ga0207665_10080284 Ga0207665_100802843 268
1090 3300025939 Ga0207665_10260141 Ga0207665_102601412 268
1091 3300025941 Ga0207711_10198112 Ga0207711_101981122 268
1092 3300025941 Ga0207711_10386148 Ga0207711_103861481 268
1093 3300025941 Ga0207711_10796551 Ga0207711_107965511 268
1094 3300025944 Ga0207661_10008345 Ga0207661_100083453 268
1095 3300025944 Ga0207661_10011091 Ga0207661_100110915 268
1096 3300025944 Ga0207661_10044116 Ga0207661_100441163 268
1097 3300025945 Ga0207679_10348379 Ga0207679_103483791 268
1098 3300025945 Ga0207679_10463096 Ga0207679_104630961 268
1099 3300025949 Ga0207667_10003470 Ga0207667_1000347013 268
1100 3300025949 Ga0207667_10040486 Ga0207667_100404863 268
1101 3300025949 Ga0207667_10048507 Ga0207667_100485075 268
1102 3300025981 Ga0207640_10005349 Ga0207640_100053495 268
1103 3300025981 Ga0207640_10443649 Ga0207640_104436491 268
1104 3300025986 Ga0207658_10036941 Ga0207658_100369412 268
1105 3300025986 Ga0207658_10074230 Ga0207658_100742303 268
1106 3300026023 Ga0207677_10264620 Ga0207677_102646202 268
1107 3300026041 Ga0207639_10009549 Ga0207639_100095496 268
1108 3300026041 Ga0207639_10028981 Ga0207639_100289813 268
1109 3300026041 Ga0207639_10120808 Ga0207639_101208082 268
1110 3300026041 Ga0207639_10401149 Ga0207639_104011491 268
1111 3300026067 Ga0207678_10213321 Ga0207678_102133211 268
1112 3300026067 Ga0207678_10336056 Ga0207678_103360562 268
1113 3300026067 Ga0207678_10605570 Ga0207678_106055701 268
1114 3300026078 Ga0207702_10000005 Ga0207702_10000005344 268
1115 3300026078 Ga0207702_10009529 Ga0207702_100095298 268
1116 3300026078 Ga0207702_10081007 Ga0207702_100810073 268
1117 3300026078 Ga0207702_10403703 Ga0207702_104037032 268
1118 3300026095 Ga0207676_10220839 Ga0207676_102208392 268
1119 3300026095 Ga0207676_10507403 Ga0207676_105074032 268
1120 3300026116 Ga0207674_10001872 Ga0207674_1000187223 268
1121 3300026116 Ga0207674_10007160 Ga0207674_1000716011 268
1122 3300026116 Ga0207674_10037998 Ga0207674_100379982 268
1123 3300026116 Ga0207674_10047446 Ga0207674_100474463 268
1124 3300026116 Ga0207674_10093731 Ga0207674_100937312 268
1125 3300026116 Ga0207674_10094233 Ga0207674_100942331 268
1126 3300026116 Ga0207674_10243826 Ga0207674_102438261 268
1127 3300026118 Ga0207675_100456912 Ga0207675_1004569122 268
1128 3300026118 Ga0207675_100688860 Ga0207675_1006888602 268
1129 3300026121 Ga0207683_10065519 Ga0207683_100655194 268
1130 3300026121 Ga0207683_10347901 Ga0207683_103479012 268
1131 3300026142 Ga0207698_10008935 Ga0207698_100089352 268
1132 3300026142 Ga0207698_10013158 Ga0207698_100131583 268
1133 3300026142 Ga0207698_10407391 Ga0207698_104073912 268
1134 3300027296 Ga0209389_1000011 Ga0209389_100001149 268
1135 3300027296 Ga0209389_1000025 Ga0209389_1000025110 268
1136 3300027357 Ga0209589_1000018 Ga0209589_100001831 268
1137 3300027357 Ga0209589_1000066 Ga0209589_100006659 268
1138 3300027361 Ga0209489_100017 Ga0209489_100017185 268
1139 3300027361 Ga0209489_100026 Ga0209489_10002631 268
1140 3300027361 Ga0209489_100030 Ga0209489_10003054 268
1141 3300027363 Ga0209700_100027 Ga0209700_10002749 268
1142 3300027363 Ga0209700_100035 Ga0209700_10003531 268
1143 3300027512 Ga0209179_1020322 Ga0209179_10203222 268
1144 3300027866 Ga0209813_10026656 Ga0209813_100266562 268
1145 3300027907 Ga0207428_10078549 Ga0207428_100785492 268
1146 3300028379 Ga0268266_10014484 Ga0268266_100144842 268
1147 3300028379 Ga0268266_10056743 Ga0268266_100567434 268
1148 3300028379 Ga0268266_10157939 Ga0268266_101579392 268
1149 3300028381 Ga0268264_10000035 Ga0268264_10000035125 268
1150 3300028563 Ga0265319_1044084 Ga0265319_10440842 268
1151 3300028573 Ga0265334_10013193 Ga0265334_100131933 268
1152 3300028653 Ga0265323_10007879 Ga0265323_100078791 268
1153 3300028666 Ga0265336_10009229 Ga0265336_100092292 268
1154 3300028794 Ga0307515_10052509 Ga0307515_100525098 268
1155 3300028800 Ga0265338_10000065 Ga0265338_1000006520 268
1156 3300031235 Ga0265330_10025998 Ga0265330_100259983 268
1157 3300031235 Ga0265330_10043704 Ga0265330_100437042 268
1158 3300031238 Ga0265332_10019006 Ga0265332_100190062 268
1159 3300031240 Ga0265320_10039080 Ga0265320_100390802 268
1160 3300031241 Ga0265325_10044758 Ga0265325_100447582 268
1161 3300031242 Ga0265329_10017951 Ga0265329_100179513 268
1162 3300031247 Ga0265340_10003867 Ga0265340_100038675 268
1163 3300031247 Ga0265340_10032067 Ga0265340_100320673 268
1164 3300031249 Ga0265339_10001453 Ga0265339_100014539 268
1165 3300031249 Ga0265339_10061245 Ga0265339_100612453 268
1166 3300031344 Ga0265316_10055197 Ga0265316_100551972 268
1167 3300031507 Ga0307509_10099481 Ga0307509_100994813 268
1168 3300031548 Ga0307408_100271022 Ga0307408_1002710222 268
1169 3300031595 Ga0265313_10029608 Ga0265313_100296082 268
1170 3300031595 Ga0265313_10046465 Ga0265313_100464653 268
1171 3300031616 Ga0307508_10000521 Ga0307508_1000052138 268
1172 3300031616 Ga0307508_10239466 Ga0307508_102394662 268
1173 3300031711 Ga0265314_10022547 Ga0265314_100225472 268
1174 3300031712 Ga0265342_10002787 Ga0265342_1000278714 268
1175 3300031712 Ga0265342_10010202 Ga0265342_100102026 268
1176 3300031712 Ga0265342_10030155 Ga0265342_100301552 268
1177 3300031712 Ga0265342_10214189 Ga0265342_102141892 268
1178 3300031730 Ga0307516_10006057 Ga0307516_1000605711 268
1179 3300031730 Ga0307516_10013764 Ga0307516_100137643 268
1180 3300031730 Ga0307516_10016792 Ga0307516_100167922 268
1181 3300031911 Ga0307412_10607082 Ga0307412_106070821 268
1182 3300032126 Ga0307415_100258189 Ga0307415_1002581892 268
1183 3300033179 Ga0307507_10111917 Ga0307507_101119172 268
1184 3300033179 Ga0307507_10114834 Ga0307507_101148342 268
1185 3300033180 Ga0307510_10008237 Ga0307510_1000823712 268
1186 3300033180 Ga0307510_10010792 Ga0307510_1001079213 268
1187 3300033180 Ga0307510_10134601 Ga0307510_101346013 268
1188 3300033180 Ga0307510_10136026 Ga0307510_101360263 268
1189 3300033442 Ga0315911_1000011 Ga0315911_100001135 268
1190 3300034816 Ga0373930_0009726 Ga0373930_0009726_256_1062 268
1191 3300035086 Ga0373934_0018268 Ga0373934_0018268_1260_2066 268
1192 3300035086 Ga0373934_0050750 Ga0373934_0050750_55_861 268
1193 3300035086 Ga0373934_0079984 Ga0373934_0079984_299_1105 268
1194 3300035086 Ga0373934_0132785 Ga0373934_0132785_169_975 268
1195 3300035089 Ga0373944_0008158 Ga0373944_0008158_1279_2091 268
1196 3300035089 Ga0373944_0008625 Ga0373944_0008625_666_1472 268
1197 3300035090 Ga0373949_0059932 Ga0373949_0059932_57_863 268
1198 3300035111 Ga0373923_0007808 Ga0373923_0007808_2542_3348 268
1199 3300035111 Ga0373923_0009562 Ga0373923_0009562_836_1642 268
1200 3300035111 Ga0373923_0011876 Ga0373923_0011876_1134_1940 268
1201 3300035111 Ga0373923_0012570 Ga0373923_0012570_1930_2736 268
1202 3300035111 Ga0373923_0040959 Ga0373923_0040959_625_1437 268
1203 3300035113 Ga0373936_0005534 Ga0373936_0005534_1280_2086 268
1204 3300035113 Ga0373936_0026481 Ga0373936_0026481_1442_2254 268
1205 3300035113 Ga0373936_0065892 Ga0373936_0065892_95_907 268
1206 3300035115 Ga0373941_0060016 Ga0373941_0060016_205_1011 268
1207 3300035116 Ga0373945_0041758 Ga0373945_0041758_395_1207 268
1208 3300035117 Ga0373953_0004604 Ga0373953_0004604_2011_2817 268
1209 3300035117 Ga0373953_0021341 Ga0373953_0021341_56_862 268
1210 3300035117 Ga0373953_0032120 Ga0373953_0032120_509_1315 268
1211 3300035118 Ga0373954_0001728 Ga0373954_0001728_985_1791 268
1212 3300035118 Ga0373954_0024119 Ga0373954_0024119_87_893 268
1213 3300035118 Ga0373954_0069666 Ga0373954_0069666_730_1536 268
1214 3300035119 Ga0373956_0000275 Ga0373956_0000275_1668_2474 268
1215 3300035119 Ga0373956_0027086 Ga0373956_0027086_736_1542 268
1216 3300035119 Ga0373956_0083356 Ga0373956_0083356_385_1197 268
1217 3300035119 Ga0373956_0131516 Ga0373956_0131516_13_819 268
1218 3300035120 Ga0373957_0008902 Ga0373957_0008902_251_1057 268
1219 3300035120 Ga0373957_0024316 Ga0373957_0024316_396_1202 268
1220 3300035121 Ga0373960_0037420 Ga0373960_0037420_349_1155 268
1221 3300035170 Ga0373943_0000038 Ga0373943_0000038_40270_41082 268
1222 3300035170 Ga0373943_0010166 Ga0373943_0010166_1082_1888 268
1223 3300035170 Ga0373943_0042188 Ga0373943_0042188_223_1029 268
1224 3300035171 Ga0373946_0001215 Ga0373946_0001215_2569_3381 268
1225 3300035172 Ga0373955_0000324 Ga0373955_0000324_11857_12663 268
1226 3300035172 Ga0373955_0023312 Ga0373955_0023312_1678_2484 268
1227 3300035172 Ga0373955_0106666 Ga0373955_0106666_722_1534 268
1228 3300035172 Ga0373955_0119720 Ga0373955_0119720_294_1100 268
1229 3300035410 Ga0373924_0019316 Ga0373924_0019316_1436_2242 268
1230 3300035410 Ga0373924_0079202 Ga0373924_0079202_168_974 268
1231 3300035691 Ga0373931_0017129 Ga0373931_0017129_2257_3063 268
1232 3300035692 Ga0373935_0001897 Ga0373935_0001897_7622_8434 268
1233 3300035692 Ga0373935_0031933 Ga0373935_0031933_1978_2784 268
1234 3300035695 Ga0373927_0000665 Ga0373927_0000665_10142_10948 268
1235 3300035695 Ga0373927_0000759 Ga0373927_0000759_9609_10421 268
1236 3300035695 Ga0373927_0004910 Ga0373927_0004910_2673_3485 268
1237 3300035695 Ga0373927_0016732 Ga0373927_0016732_1333_2139 268
1238 3300035695 Ga0373927_0057701 Ga0373927_0057701_751_1557 268
1239 3300035695 Ga0373927_0080765 Ga0373927_0080765_438_1244 268
1240 3300035695 Ga0373927_0113416 Ga0373927_0113416_338_1144 268
1241 3300035695 Ga0373927_0116489 Ga0373927_0116489_91_897 268
1242 3300035695 Ga0373927_0172677 Ga0373927_0172677_400_1206 268
1243 3300035695 Ga0373927_0180085 Ga0373927_0180085_398_1204 268
1244 3300035695 Ga0373927_0251582 Ga0373927_0251582_310_1116 268
1245 3300035724 Ga0373933_0000405 Ga0373933_0000405_21580_22386 268
1246 3300035724 Ga0373933_0021114 Ga0373933_0021114_1905_2711 268
1247 3300035724 Ga0373933_0115209 Ga0373933_0115209_666_1472 268
1248 3300035724 Ga0373933_0196709 Ga0373933_0196709_54_866 268
1249 3300035725 Ga0373947_0000024 Ga0373947_0000024_34876_35688 268
1250 3300035725 Ga0373947_0000555 Ga0373947_0000555_3834_4640 268
1251 3300035725 Ga0373947_0011853 Ga0373947_0011853_2389_3201 268
1252 3300035725 Ga0373947_0013984 Ga0373947_0013984_1133_1939 268
1253 3300035725 Ga0373947_0025304 Ga0373947_0025304_474_1280 268
1254 3300036401 Ga0373937_0014181 Ga0373937_0014181_4660_5466 268
1255 3300036401 Ga0373937_0048872 Ga0373937_0048872_2772_3578 268
1256 3300036401 Ga0373937_0101198 Ga0373937_0101198_769_1575 268
1257 3300036401 Ga0373937_0322653 Ga0373937_0322653_619_1425 268
1258 3300036401 Ga0373937_0370823 Ga0373937_0370823_121_927 268
1259 3300037068 Ga0373925_0002500 Ga0373925_0002500_4276_5082 268
1260 3300037068 Ga0373925_0008692 Ga0373925_0008692_5060_5866 268
1261 3300037068 Ga0373925_0012894 Ga0373925_0012894_5172_5984 268
1262 3300037068 Ga0373925_0122327 Ga0373925_0122327_1204_2010 268
1263 3300037068 Ga0373925_0350555 Ga0373925_0350555_347_1153 268
1264 3300037068 Ga0373925_0402658 Ga0373925_0402658_234_1040 268
1265 3300037418 Ga0395900_0001369 Ga0395900_0001369_23762_24568 268
1266 3300037466 Ga0395898_0008318 Ga0395898_0008318_4771_5577 268
1267 3300037466 Ga0395898_0132490 Ga0395898_0132490_667_1473 268
1268 3300037466 Ga0395898_0177776 Ga0395898_0177776_699_1505 268
1269 3300037471 Ga0395905_0007242 Ga0395905_0007242_4730_5536 268
1270 3300037471 Ga0395905_0206371 Ga0395905_0206371_367_1173 268
1271 3300037471 Ga0395905_0773174 Ga0395905_0773174_39_845 268
1272 3300037853 Ga0436364_0507131 Ga0436364_0507131_960_1766 268
1273 3300037853 Ga0436364_0685489 Ga0436364_0685489_121_927 268
1274 3300038443 Ga0395901_0004623 Ga0395901_0004623_4293_5099 268
1275 3300038443 Ga0395901_0319175 Ga0395901_0319175_651_1457 268
1276 3300038443 Ga0395901_0543609 Ga0395901_0543609_353_1159 268
1277 3300038705 Ga0237819_08620 Ga0237819_08620_418_1227 268
1278 3300039437 Ga0436365_0051700 Ga0436365_0051700_421_1293 268
1279 3300039437 Ga0436365_0171887 Ga0436365_0171887_1862_2668 268
1280 3300039437 Ga0436365_1022455 Ga0436365_1022455_866_1672 268
1281 3300039437 Ga0436365_1339456 Ga0436365_1339456_1944_2756 268
1282 3300039437 Ga0436365_1677794 Ga0436365_1677794_45_851 268
1283 3300039437 Ga0436365_1681542 Ga0436365_1681542_33_839 268
1284 3300039438 Ga0436360_0818757 Ga0436360_0818757_197_1003 268
1285 3300039447 Ga0436361_1139687 Ga0436361_1139687_460_1266 268
1286 3300039450 Ga0436363_0068219 Ga0436363_0068219_325_1140 268
1287 3300039453 Ga0436362_0437287 Ga0436362_0437287_2086_2892 268
1288 3300042438 Ga0439459_0016906 Ga0439459_0016906_310_1137 268
1289 3300044656 Ga0466969_0073334 Ga0466969_0073334_308_1114 268
1290 3300044658 Ga0466972_0000807 Ga0466972_0000807_10954_11760 268
1291 3300044658 Ga0466972_0023955 Ga0466972_0023955_540_1346 268
1292 3300044684 Ga0466966_0001348 Ga0466966_0001348_297_1103 268
1293 3300044684 Ga0466966_0164270 Ga0466966_0164270_192_998 268
1294 3300044693 Ga0466961_0000120 Ga0466961_0000120_29004_29810 268
1295 3300044694 Ga0466963_0036289 Ga0466963_0036289_2211_3017 268
1296 3300044735 Ga0466968_0004393 Ga0466968_0004393_802_1608 268
1297 3300044765 Ga0466970_0033580 Ga0466970_0033580_903_1709 268
1298 3300044765 Ga0466970_0069577 Ga0466970_0069577_897_1703 268
1299 3300044765 Ga0466970_0239222 Ga0466970_0239222_42_848 268
1300 3300044842 Ga0466957_0049432 Ga0466957_0049432_750_1556 268
1301 3300045049 Ga0466959_0040985 Ga0466959_0040985_2526_3332 268
1302 3300045836 Ga0466958_0059700 Ga0466958_0059700_479_1285 268
1303 3300045976 Ga0466967_0023485 Ga0466967_0023485_3328_4134 268
1304 3300045976 Ga0466967_0324153 Ga0466967_0324153_494_1306 268
1305 3300046454 Ga0495592_0005358 Ga0495592_0005358_1377_2183 268
1306 3300046454 Ga0495592_0022161 Ga0495592_0022161_2553_3359 268
1307 3300046454 Ga0495592_0030976 Ga0495592_0030976_44_850 268
1308 3300046454 Ga0495592_0031459 Ga0495592_0031459_771_1577 268
1309 3300046454 Ga0495592_0152464 Ga0495592_0152464_238_1044 268
1310 3300046455 Ga0495603_0000094 Ga0495603_0000094_31494_32300 268
1311 3300046455 Ga0495603_0003073 Ga0495603_0003073_3701_4507 268
1312 3300046455 Ga0495603_0013013 Ga0495603_0013013_3282_4088 268
1313 3300046455 Ga0495603_0084278 Ga0495603_0084278_301_1107 268
1314 3300046459 Ga0495629_0000612 Ga0495629_0000612_26136_26942 268
1315 3300046459 Ga0495629_0000790 Ga0495629_0000790_21959_22765 268
1316 3300046459 Ga0495629_0004905 Ga0495629_0004905_740_1546 268
1317 3300046459 Ga0495629_0016352 Ga0495629_0016352_1951_2757 268
1318 3300046459 Ga0495629_0110276 Ga0495629_0110276_509_1315 268
1319 3300046460 Ga0495638_0008217 Ga0495638_0008217_4018_4824 268
1320 3300046460 Ga0495638_0140439 Ga0495638_0140439_207_1013 268
1321 3300046462 Ga0495651_0000889 Ga0495651_0000889_12075_12881 268
1322 3300046462 Ga0495651_0014948 Ga0495651_0014948_4357_5163 268
1323 3300046462 Ga0495651_0019475 Ga0495651_0019475_3483_4295 268
1324 3300046462 Ga0495651_0039224 Ga0495651_0039224_637_1443 268
1325 3300046462 Ga0495651_0075184 Ga0495651_0075184_346_1152 268
1326 3300046462 Ga0495651_0080993 Ga0495651_0080993_635_1441 268
1327 3300046462 Ga0495651_0224275 Ga0495651_0224275_454_1260 268
1328 3300046463 Ga0495653_0000399 Ga0495653_0000399_8800_9606 268
1329 3300046463 Ga0495653_0120059 Ga0495653_0120059_431_1237 268
1330 3300046463 Ga0495653_0254744 Ga0495653_0254744_295_1107 268
1331 3300046471 Ga0495650_0113297 Ga0495650_0113297_20_826 268
1332 3300046472 Ga0495580_0002084 Ga0495580_0002084_4126_4932 268
1333 3300046472 Ga0495580_0023565 Ga0495580_0023565_396_1202 268
1334 3300046472 Ga0495580_0049181 Ga0495580_0049181_611_1423 268
1335 3300046472 Ga0495580_0305529 Ga0495580_0305529_31_837 268
1336 3300046472 Ga0495580_0311695 Ga0495580_0311695_30_836 268
1337 3300046473 Ga0495582_0000256 Ga0495582_0000256_9465_10271 268
1338 3300046473 Ga0495582_0007746 Ga0495582_0007746_3584_4390 268
1339 3300046473 Ga0495582_0038554 Ga0495582_0038554_649_1455 268
1340 3300046474 Ga0495605_0054465 Ga0495605_0054465_607_1413 268
1341 3300046475 Ga0495639_0000114 Ga0495639_0000114_7648_8454 268
1342 3300046475 Ga0495639_0031366 Ga0495639_0031366_174_980 268
1343 3300046475 Ga0495639_0034202 Ga0495639_0034202_1017_1823 268
1344 3300046475 Ga0495639_0055459 Ga0495639_0055459_407_1213 268
1345 3300046475 Ga0495639_0249424 Ga0495639_0249424_53_859 268
1346 3300046476 Ga0495662_0003142 Ga0495662_0003142_958_1764 268
1347 3300046476 Ga0495662_0009981 Ga0495662_0009981_852_1664 268
1348 3300046476 Ga0495662_0020029 Ga0495662_0020029_1347_2159 268
1349 3300046476 Ga0495662_0048590 Ga0495662_0048590_281_1093 268
1350 3300046477 Ga0495664_0001473 Ga0495664_0001473_5564_6376 268
1351 3300046477 Ga0495664_0003375 Ga0495664_0003375_2543_3349 268
1352 3300046499 Ga0495594_0012709 Ga0495594_0012709_2585_3391 268
1353 3300046499 Ga0495594_0226994 Ga0495594_0226994_18_830 268
1354 3300046501 Ga0495607_0050252 Ga0495607_0050252_921_1727 268
1355 3300046507 Ga0495606_0007875 Ga0495606_0007875_7289_8095 268
1356 3300046507 Ga0495606_0035535 Ga0495606_0035535_811_1617 268
1357 3300046507 Ga0495606_0041553 Ga0495606_0041553_171_977 268
1358 3300046507 Ga0495606_0085587 Ga0495606_0085587_515_1321 268
1359 3300046511 Ga0495608_0010086 Ga0495608_0010086_1426_2232 268
1360 3300046511 Ga0495608_0048208 Ga0495608_0048208_1557_2363 268
1361 3300046511 Ga0495608_0101917 Ga0495608_0101917_1008_1814 268
1362 3300046513 Ga0495616_0175248 Ga0495616_0175248_129_935 268
1363 3300046514 Ga0495618_0003477 Ga0495618_0003477_7994_8800 268
1364 3300046514 Ga0495618_0009727 Ga0495618_0009727_181_993 268
1365 3300046514 Ga0495618_0019706 Ga0495618_0019706_124_930 268
1366 3300046514 Ga0495618_0042423 Ga0495618_0042423_931_1737 268
1367 3300046514 Ga0495618_0049423 Ga0495618_0049423_803_1609 268
1368 3300046514 Ga0495618_0321043 Ga0495618_0321043_46_858 268
1369 3300046515 Ga0495620_0034250 Ga0495620_0034250_1297_2103 268
1370 3300046516 Ga0495628_0050791 Ga0495628_0050791_732_1544 268
1371 3300046516 Ga0495628_0064360 Ga0495628_0064360_1095_1901 268
1372 3300046516 Ga0495628_0138751 Ga0495628_0138751_496_1302 268
1373 3300046516 Ga0495628_0140873 Ga0495628_0140873_335_1141 268
1374 3300046516 Ga0495628_0233538 Ga0495628_0233538_104_910 268
1375 3300046517 Ga0495630_0001933 Ga0495630_0001933_1893_2705 268
1376 3300046517 Ga0495630_0019620 Ga0495630_0019620_2636_3448 268
1377 3300046517 Ga0495630_0030387 Ga0495630_0030387_313_1119 268
1378 3300046517 Ga0495630_0116795 Ga0495630_0116795_175_981 268
1379 3300046522 Ga0495643_0007496 Ga0495643_0007496_2265_3071 268
1380 3300046524 Ga0495648_0001784 Ga0495648_0001784_13222_14028 268
1381 3300046524 Ga0495648_0042607 Ga0495648_0042607_739_1545 268
1382 3300046524 Ga0495648_0081196 Ga0495648_0081196_841_1647 268
1383 3300046524 Ga0495648_0081694 Ga0495648_0081694_346_1152 268
1384 3300046525 Ga0495663_0016825 Ga0495663_0016825_432_1259 268
1385 3300046526 Ga0495666_0035671 Ga0495666_0035671_1203_2009 268
1386 3300046529 Ga0495652_0004272 Ga0495652_0004272_4845_5651 268
1387 3300046529 Ga0495652_0005705 Ga0495652_0005705_3000_3812 268
1388 3300046529 Ga0495652_0041756 Ga0495652_0041756_1678_2484 268
1389 3300046529 Ga0495652_0085466 Ga0495652_0085466_1169_1975 268
1390 3300046529 Ga0495652_0246980 Ga0495652_0246980_405_1217 268
1391 3300046530 Ga0495654_0071667 Ga0495654_0071667_778_1584 268
1392 3300046531 Ga0495665_0000130 Ga0495665_0000130_13898_14704 268
1393 3300046531 Ga0495665_0006644 Ga0495665_0006644_2903_3709 268
1394 3300046533 Ga0495640_0004006 Ga0495640_0004006_6896_7708 268
1395 3300046533 Ga0495640_0004971 Ga0495640_0004971_8823_9629 268
1396 3300046533 Ga0495640_0011709 Ga0495640_0011709_4895_5701 268
1397 3300046533 Ga0495640_0020751 Ga0495640_0020751_3526_4332 268
1398 3300046533 Ga0495640_0071384 Ga0495640_0071384_878_1684 268
1399 3300046533 Ga0495640_0095035 Ga0495640_0095035_215_1027 268
1400 3300046533 Ga0495640_0115050 Ga0495640_0115050_841_1647 268
1401 3300046535 Ga0495586_0020363 Ga0495586_0020363_262_1074 268
1402 3300046535 Ga0495586_0042890 Ga0495586_0042890_1477_2283 268
1403 3300046535 Ga0495586_0142899 Ga0495586_0142899_475_1281 268
1404 3300046536 Ga0495587_0001433 Ga0495587_0001433_11857_12663 268
1405 3300046536 Ga0495587_0021435 Ga0495587_0021435_2081_2887 268
1406 3300046536 Ga0495587_0060104 Ga0495587_0060104_935_1741 268
1407 3300046536 Ga0495587_0068435 Ga0495587_0068435_1043_1849 268
1408 3300046536 Ga0495587_0167947 Ga0495587_0167947_312_1118 268
1409 3300046537 Ga0495598_0013195 Ga0495598_0013195_607_1434 268
1410 3300046539 Ga0495621_0030725 Ga0495621_0030725_933_1760 268
1411 3300046542 Ga0495597_0016508 Ga0495597_0016508_1731_2537 268
1412 3300046542 Ga0495597_0026607 Ga0495597_0026607_1680_2486 268
1413 3300046543 Ga0495645_0023705 Ga0495645_0023705_912_1718 268
1414 3300046543 Ga0495645_0035960 Ga0495645_0035960_2646_3458 268
1415 3300046543 Ga0495645_0124602 Ga0495645_0124602_764_1576 268
1416 3300046543 Ga0495645_0223217 Ga0495645_0223217_416_1222 268
1417 3300046557 Ga0495622_0006054 Ga0495622_0006054_828_1634 268
1418 3300046559 Ga0495667_0006538 Ga0495667_0006538_56_862 268
1419 3300046559 Ga0495667_0013337 Ga0495667_0013337_2366_3172 268
1420 3300046559 Ga0495667_0019409 Ga0495667_0019409_1228_2034 268
1421 3300046615 Ga0495656_0011865 Ga0495656_0011865_2269_3096 268
1422 3300046615 Ga0495656_0104892 Ga0495656_0104892_86_892 268
1423 3300046615 Ga0495656_0198283 Ga0495656_0198283_86_892 268
1424 3300046616 Ga0495668_0058812 Ga0495668_0058812_781_1587 268
1425 3300046642 Ga0495634_0002801 Ga0495634_0002801_45_851 268
1426 3300046642 Ga0495634_0014766 Ga0495634_0014766_1739_2551 268
1427 3300046642 Ga0495634_0036929 Ga0495634_0036929_141_947 268
1428 3300046642 Ga0495634_0037734 Ga0495634_0037734_1024_1830 268
1429 3300046642 Ga0495634_0072032 Ga0495634_0072032_620_1426 268
1430 3300046663 Ga0495635_0000088 Ga0495635_0000088_27522_28328 268
1431 3300046663 Ga0495635_0002155 Ga0495635_0002155_8156_8962 268
1432 3300046663 Ga0495635_0003834 Ga0495635_0003834_6285_7091 268
1433 3300046663 Ga0495635_0006262 Ga0495635_0006262_4823_5635 268
1434 3300046663 Ga0495635_0049496 Ga0495635_0049496_1353_2159 268
1435 3300046663 Ga0495635_0188807 Ga0495635_0188807_355_1161 268
1436 3300046663 Ga0495635_0228812 Ga0495635_0228812_155_961 268
1437 3300046665 Ga0495661_0026825 Ga0495661_0026825_916_1722 268
1438 3300046674 Ga0495588_0002627 Ga0495588_0002627_4967_5773 268
1439 3300046675 Ga0495657_0006632 Ga0495657_0006632_7097_7903 268
1440 3300046675 Ga0495657_0010076 Ga0495657_0010076_4881_5687 268
1441 3300046675 Ga0495657_0025289 Ga0495657_0025289_2317_3123 268
1442 3300046675 Ga0495657_0045493 Ga0495657_0045493_578_1384 268
1443 3300046678 Ga0495599_0008020 Ga0495599_0008020_4918_5724 268
1444 3300046678 Ga0495599_0011303 Ga0495599_0011303_2994_3800 268
1445 3300046678 Ga0495599_0036813 Ga0495599_0036813_1631_2437 268
1446 3300046678 Ga0495599_0053396 Ga0495599_0053396_1588_2400 268
1447 3300046678 Ga0495599_0088351 Ga0495599_0088351_924_1730 268
1448 3300046679 Ga0495623_0008985 Ga0495623_0008985_838_1644 268
1449 3300046679 Ga0495623_0072455 Ga0495623_0072455_848_1654 268
1450 3300046679 Ga0495623_0086458 Ga0495623_0086458_798_1604 268
1451 3300046680 Ga0495646_0003222 Ga0495646_0003222_5088_5894 268
1452 3300046680 Ga0495646_0016220 Ga0495646_0016220_2558_3364 268
1453 3300046680 Ga0495646_0041957 Ga0495646_0041957_1862_2674 268
1454 3300046680 Ga0495646_0048886 Ga0495646_0048886_85_891 268
1455 3300046680 Ga0495646_0200630 Ga0495646_0200630_169_975 268
1456 3300046681 Ga0495647_0031473 Ga0495647_0031473_989_1795 268
1457 3300046683 Ga0495658_0000295 Ga0495658_0000295_26496_27302 268
1458 3300046683 Ga0495658_0066283 Ga0495658_0066283_160_966 268
1459 3300046683 Ga0495658_0125011 Ga0495658_0125011_309_1115 268
1460 3300046689 Ga0495613_0001707 Ga0495613_0001707_1158_1964 268
1461 3300046689 Ga0495613_0012740 Ga0495613_0012740_3192_4004 268
1462 3300046689 Ga0495613_0022225 Ga0495613_0022225_3503_4309 268
1463 3300046689 Ga0495613_0051374 Ga0495613_0051374_647_1453 268
1464 3300046689 Ga0495613_0217683 Ga0495613_0217683_17_823 268
1465 3300046689 Ga0495613_0371317 Ga0495613_0371317_106_912 268
1466 3300046690 Ga0495624_0000079 Ga0495624_0000079_14647_15453 268
1467 3300046690 Ga0495624_0007161 Ga0495624_0007161_1819_2631 268
1468 3300046690 Ga0495624_0076668 Ga0495624_0076668_79_885 268
1469 3300046690 Ga0495624_0173351 Ga0495624_0173351_350_1156 268
1470 3300046691 Ga0495670_0007514 Ga0495670_0007514_2429_3235 268
1471 3300046692 Ga0495671_0102611 Ga0495671_0102611_26_832 268
1472 3300046692 Ga0495671_0169141 Ga0495671_0169141_57_863 268
1473 3300046794 Ga0495589_0171033 Ga0495589_0171033_54_860 268
1474 3300046809 Ga0495600_0000715 Ga0495600_0000715_3219_4025 268
1475 3300046809 Ga0495600_0003313 Ga0495600_0003313_5287_6093 268
1476 3300046809 Ga0495600_0016414 Ga0495600_0016414_3206_4012 268
1477 3300046809 Ga0495600_0045331 Ga0495600_0045331_1393_2205 268
1478 3300046809 Ga0495600_0206043 Ga0495600_0206043_445_1251 268
1479 3300047315 Ga0495581_0000813 Ga0495581_0000813_2510_3316 268
1480 3300047315 Ga0495581_0023086 Ga0495581_0023086_235_1047 268
1481 3300047315 Ga0495581_0034914 Ga0495581_0034914_1157_1963 268
1482 3300047315 Ga0495581_0173687 Ga0495581_0173687_430_1236 268
1483 3300047317 Ga0495604_0001221 Ga0495604_0001221_4081_4887 268
1484 3300047317 Ga0495604_0008665 Ga0495604_0008665_80_886 268
1485 3300047317 Ga0495604_0075269 Ga0495604_0075269_115_921 268
1486 3300047317 Ga0495604_0081814 Ga0495604_0081814_1156_1968 268
1487 3300047317 Ga0495604_0108302 Ga0495604_0108302_881_1687 268
1488 3300047317 Ga0495604_0313690 Ga0495604_0313690_95_901 268
1489 3300047319 Ga0495674_0001729 Ga0495674_0001729_4575_5381 268
1490 3300047319 Ga0495674_0009348 Ga0495674_0009348_3684_4496 268
1491 3300047319 Ga0495674_0027713 Ga0495674_0027713_1646_2452 268
1492 3300047319 Ga0495674_0037672 Ga0495674_0037672_1315_2121 268
1493 3300047319 Ga0495674_0038076 Ga0495674_0038076_2762_3568 268
1494 3300047319 Ga0495674_0271468 Ga0495674_0271468_132_944 268
1495 3300047320 Ga0495672_0032478 Ga0495672_0032478_589_1395 268
1496 3300047320 Ga0495672_0097888 Ga0495672_0097888_646_1452 268
1497 3300047321 Ga0495676_0026719 Ga0495676_0026719_3151_3957 268
1498 3300047321 Ga0495676_0120138 Ga0495676_0120138_204_1016 268
1499 3300047321 Ga0495676_0134409 Ga0495676_0134409_592_1398 268
1500 3300047322 Ga0495680_0003010 Ga0495680_0003010_1576_2382 268
1501 3300047322 Ga0495680_0004956 Ga0495680_0004956_4512_5318 268
1502 3300047322 Ga0495680_0044392 Ga0495680_0044392_1172_1984 268
1503 3300047322 Ga0495680_0056905 Ga0495680_0056905_1534_2340 268
1504 3300047322 Ga0495680_0154852 Ga0495680_0154852_430_1242 268
1505 3300047323 Ga0495683_0151039 Ga0495683_0151039_123_929 268
1506 3300047444 Ga0495675_0008090 Ga0495675_0008090_4845_5651 268
1507 3300047444 Ga0495675_0088852 Ga0495675_0088852_103_909 268
1508 3300047469 Ga0495673_0013336 Ga0495673_0013336_957_1763 268
1509 3300047471 Ga0495684_0001916 Ga0495684_0001916_12385_13191 268
1510 3300047471 Ga0495684_0002318 Ga0495684_0002318_3307_4119 268
1511 3300047471 Ga0495684_0003908 Ga0495684_0003908_2950_3762 268
1512 3300047471 Ga0495684_0018409 Ga0495684_0018409_2061_2867 268
1513 3300047471 Ga0495684_0027736 Ga0495684_0027736_1197_2003 268
1514 3300047471 Ga0495684_0059076 Ga0495684_0059076_1762_2568 268
1515 3300047471 Ga0495684_0077854 Ga0495684_0077854_479_1291 268
1516 3300047472 Ga0495686_0038077 Ga0495686_0038077_1366_2172 268
1517 3300047472 Ga0495686_0048116 Ga0495686_0048116_1150_1956 268
1518 3300047472 Ga0495686_0083636 Ga0495686_0083636_425_1231 268
1519 3300047472 Ga0495686_0098662 Ga0495686_0098662_515_1321 268
1520 3300047472 Ga0495686_0153803 Ga0495686_0153803_263_1069 268
1521 3300047472 Ga0495686_0161489 Ga0495686_0161489_192_998 268
1522 3300047673 Ga0495593_0000566 Ga0495593_0000566_12894_13700 268
1523 3300047673 Ga0495593_0015457 Ga0495593_0015457_2498_3310 268
1524 3300047673 Ga0495593_0019520 Ga0495593_0019520_484_1290 268
1525 3300047673 Ga0495593_0020975 Ga0495593_0020975_1886_2692 268
1526 3300047673 Ga0495593_0021001 Ga0495593_0021001_1027_1833 268
1527 3300047673 Ga0495593_0077249 Ga0495593_0077249_395_1201 268
1528 3300048088 Ga0495602_0004696 Ga0495602_0004696_8070_8876 268
1529 3300048088 Ga0495602_0016336 Ga0495602_0016336_1426_2232 268
1530 3300048088 Ga0495602_0040667 Ga0495602_0040667_1040_1846 268
1531 3300048088 Ga0495602_0044907 Ga0495602_0044907_2477_3289 268
1532 3300048088 Ga0495602_0060397 Ga0495602_0060397_854_1660 268
1533 3300048089 Ga0495614_0019838 Ga0495614_0019838_551_1357 268
1534 3300048903 Ga0496100_0064505 Ga0496100_0064505_159_965 268
1535 3300048903 Ga0496100_0182248 Ga0496100_0182248_370_1176 268
1536 3300048903 Ga0496100_0205322 Ga0496100_0205322_377_1183 268
1537 3300048904 Ga0496101_0083482 Ga0496101_0083482_1156_1962 268
1538 3300048904 Ga0496101_0262613 Ga0496101_0262613_522_1328 268
1539 3300048904 Ga0496101_0317155 Ga0496101_0317155_245_1051 268
1540 3300048905 Ga0496102_0024292 Ga0496102_0024292_1573_2379 268
1541 3300048905 Ga0496102_0031372 Ga0496102_0031372_3415_4221 268
1542 3300048905 Ga0496102_0072784 Ga0496102_0072784_2259_3065 268
1543 3300048905 Ga0496102_0494059 Ga0496102_0494059_10_816 268
1544 3300048906 Ga0496103_0004130 Ga0496103_0004130_7430_8236 268
1545 3300048906 Ga0496103_0111218 Ga0496103_0111218_349_1155 268
1546 3300048907 Ga0496104_0021422 Ga0496104_0021422_1772_2578 268
1547 3300048907 Ga0496104_0029317 Ga0496104_0029317_1005_1811 268
1548 3300048907 Ga0496104_0030986 Ga0496104_0030986_764_1570 268
1549 3300048907 Ga0496104_0079108 Ga0496104_0079108_2079_2885 268
1550 3300048908 Ga0496105_0009668 Ga0496105_0009668_2820_3626 268
1551 3300048908 Ga0496105_0032798 Ga0496105_0032798_950_1756 268
1552 3300048908 Ga0496105_0074989 Ga0496105_0074989_730_1536 268
1553 3300048908 Ga0496105_0261563 Ga0496105_0261563_357_1163 268
1554 3300048909 Ga0496106_0000116 Ga0496106_0000116_34535_35341 268
1555 3300048909 Ga0496106_0022726 Ga0496106_0022726_598_1404 268
1556 3300048909 Ga0496106_0024317 Ga0496106_0024317_2537_3343 268
1557 3300048909 Ga0496106_0062719 Ga0496106_0062719_1319_2125 268
1558 3300048909 Ga0496106_0114384 Ga0496106_0114384_332_1138 268
1559 3300048909 Ga0496106_0239901 Ga0496106_0239901_594_1400 268
1560 3300048909 Ga0496106_0254815 Ga0496106_0254815_40_846 268
1561 3300048910 Ga0496107_0021741 Ga0496107_0021741_1941_2747 268
1562 3300048910 Ga0496107_0094510 Ga0496107_0094510_1327_2133 268
1563 3300048910 Ga0496107_0195916 Ga0496107_0195916_315_1121 268
1564 3300048910 Ga0496107_0294035 Ga0496107_0294035_299_1105 268
1565 3300048911 Ga0496108_0037082 Ga0496108_0037082_1062_1868 268
1566 3300048911 Ga0496108_0071572 Ga0496108_0071572_122_928 268
1567 3300048911 Ga0496108_0154633 Ga0496108_0154633_813_1619 268
1568 3300048911 Ga0496108_0391171 Ga0496108_0391171_173_985 268
1569 3300048911 Ga0496108_0429678 Ga0496108_0429678_267_1073 268
1570 3300048911 Ga0496108_0451193 Ga0496108_0451193_139_945 268
1571 3300048912 Ga0496109_0000767 Ga0496109_0000767_24533_25339 268
1572 3300048912 Ga0496109_0031408 Ga0496109_0031408_1322_2128 268
1573 3300048912 Ga0496109_0254244 Ga0496109_0254244_618_1424 268
1574 3300048912 Ga0496109_0389691 Ga0496109_0389691_17_823 268
1575 3300048913 Ga0496110_0024667 Ga0496110_0024667_795_1601 268
1576 3300048913 Ga0496110_0123068 Ga0496110_0123068_177_983 268
1577 3300048913 Ga0496110_0225784 Ga0496110_0225784_834_1640 268
1578 3300048913 Ga0496110_0264610 Ga0496110_0264610_329_1135 268
1579 3300048913 Ga0496110_0339412 Ga0496110_0339412_315_1121 268
1580 3300048914 Ga0496111_0024351 Ga0496111_0024351_851_1657 268
1581 3300048914 Ga0496111_0220107 Ga0496111_0220107_121_927 268
1582 3300048915 Ga0496112_0000016 Ga0496112_0000016_38185_38991 268
1583 3300048915 Ga0496112_0014881 Ga0496112_0014881_4207_5019 268
1584 3300048915 Ga0496112_0015593 Ga0496112_0015593_3441_4247 268
1585 3300048915 Ga0496112_0087250 Ga0496112_0087250_375_1181 268
1586 3300048915 Ga0496112_0128319 Ga0496112_0128319_1152_1958 268
1587 3300048915 Ga0496112_0149949 Ga0496112_0149949_1078_1890 268
1588 3300048915 Ga0496112_0180437 Ga0496112_0180437_786_1592 268
1589 3300048915 Ga0496112_0311744 Ga0496112_0311744_393_1199 268
1590 3300048916 Ga0496113_0069408 Ga0496113_0069408_1564_2370 268
1591 3300048916 Ga0496113_0136406 Ga0496113_0136406_15_821 268
1592 3300048916 Ga0496113_0137829 Ga0496113_0137829_1059_1865 268
1593 3300048916 Ga0496113_0220184 Ga0496113_0220184_433_1239 268
1594 3300048916 Ga0496113_0268183 Ga0496113_0268183_352_1158 268
1595 3300048916 Ga0496113_0548198 Ga0496113_0548198_84_890 268
1596 3300048917 Ga0496114_0128189 Ga0496114_0128189_414_1220 268
1597 3300048917 Ga0496114_0177823 Ga0496114_0177823_29_835 268
1598 3300048917 Ga0496114_0317996 Ga0496114_0317996_415_1221 268
1599 3300048918 Ga0496115_0048150 Ga0496115_0048150_899_1705 268
1600 3300048918 Ga0496115_0121003 Ga0496115_0121003_409_1215 268
1601 3300048918 Ga0496115_0531175 Ga0496115_0531175_99_905 268
1602 3300048919 Ga0496116_0000887 Ga0496116_0000887_21359_22165 268
1603 3300048919 Ga0496116_0110033 Ga0496116_0110033_789_1595 268
1604 3300048919 Ga0496116_0163984 Ga0496116_0163984_294_1181 268
1605 3300048920 Ga0496117_0015351 Ga0496117_0015351_2179_2985 268
1606 3300048920 Ga0496117_0042896 Ga0496117_0042896_1854_2660 268
1607 3300048920 Ga0496117_0112285 Ga0496117_0112285_662_1468 268
1608 3300048920 Ga0496117_0117519 Ga0496117_0117519_29_835 268
1609 3300048920 Ga0496117_0248257 Ga0496117_0248257_30_836 268
1610 3300048921 Ga0496118_0006231 Ga0496118_0006231_7041_7847 268
1611 3300048921 Ga0496118_0023410 Ga0496118_0023410_1126_2013 268
1612 3300048921 Ga0496118_0040378 Ga0496118_0040378_2530_3336 268
1613 3300048921 Ga0496118_0045409 Ga0496118_0045409_976_1782 268
1614 3300048921 Ga0496118_0053224 Ga0496118_0053224_728_1534 268
1615 3300048921 Ga0496118_0099050 Ga0496118_0099050_774_1580 268
1616 3300048922 Ga0496119_0014445 Ga0496119_0014445_3555_4361 268
1617 3300048922 Ga0496119_0168290 Ga0496119_0168290_275_1081 268
1618 3300048923 Ga0496120_0080284 Ga0496120_0080284_631_1437 268
1619 3300048923 Ga0496120_0120086 Ga0496120_0120086_401_1207 268
1620 3300048924 Ga0496121_0000041 Ga0496121_0000041_281610_282416 268
1621 3300048924 Ga0496121_0002334 Ga0496121_0002334_778_1584 268
1622 3300048924 Ga0496121_0002685 Ga0496121_0002685_14689_15495 268
1623 3300048924 Ga0496121_0041583 Ga0496121_0041583_1715_2602 268
1624 3300048924 Ga0496121_0061958 Ga0496121_0061958_1704_2510 268
1625 3300048924 Ga0496121_0122140 Ga0496121_0122140_380_1186 268
1626 3300048924 Ga0496121_0141895 Ga0496121_0141895_207_1013 268
1627 3300048924 Ga0496121_0442191 Ga0496121_0442191_20_826 268
1628 3300048925 Ga0496122_0007556 Ga0496122_0007556_4120_4926 268
1629 3300048925 Ga0496122_0016277 Ga0496122_0016277_4025_4831 268
1630 3300048925 Ga0496122_0059832 Ga0496122_0059832_1309_2115 268
1631 3300048926 Ga0496123_0030507 Ga0496123_0030507_2078_2884 268
1632 3300048927 Ga0496124_0000910 Ga0496124_0000910_41181_41987 268
1633 3300048927 Ga0496124_0057376 Ga0496124_0057376_2103_2909 268
1634 3300048927 Ga0496124_0106460 Ga0496124_0106460_1393_2199 268
1635 3300048927 Ga0496124_0110332 Ga0496124_0110332_1235_2041 268
1636 3300048928 Ga0496125_0000092 Ga0496125_0000092_188302_189108 268
1637 3300048928 Ga0496125_0005023 Ga0496125_0005023_1719_2525 268
1638 3300048928 Ga0496125_0007013 Ga0496125_0007013_3111_3917 268
1639 3300048928 Ga0496125_0008149 Ga0496125_0008149_7631_8437 268
1640 3300048928 Ga0496125_0013816 Ga0496125_0013816_1275_2081 268
1641 3300048928 Ga0496125_0144375 Ga0496125_0144375_88_894 268
1642 3300048929 Ga0496126_0003329 Ga0496126_0003329_14288_15094 268
1643 3300048929 Ga0496126_0011637 Ga0496126_0011637_2516_3322 268
1644 3300048929 Ga0496126_0012110 Ga0496126_0012110_5013_5819 268
1645 3300048929 Ga0496126_0023131 Ga0496126_0023131_2902_3708 268
1646 3300048929 Ga0496126_0040296 Ga0496126_0040296_2290_3096 268
1647 3300048929 Ga0496126_0060287 Ga0496126_0060287_2044_2850 268
1648 3300048929 Ga0496126_0060318 Ga0496126_0060318_1727_2533 268
1649 3300048929 Ga0496126_0065503 Ga0496126_0065503_663_1469 268
1650 3300048929 Ga0496126_0129680 Ga0496126_0129680_649_1455 268
1651 3300048929 Ga0496126_0139840 Ga0496126_0139840_901_1707 268
1652 3300048929 Ga0496126_0198101 Ga0496126_0198101_851_1657 268
1653 3300048929 Ga0496126_0218886 Ga0496126_0218886_294_1100 268
1654 3300048929 Ga0496126_0242229 Ga0496126_0242229_615_1484 268
1655 3300048929 Ga0496126_0336710 Ga0496126_0336710_293_1099 268
1656 3300049460 Ga0495682_0021395 Ga0495682_0021395_1139_1945 268
1657 3300049460 Ga0495682_0073204 Ga0495682_0073204_376_1182 268
1658 3300049568 Ga0501031_0083908 Ga0501031_0083908_411_1217 268
1659 3300049568 Ga0501031_0151868 Ga0501031_0151868_415_1221 268
1660 3300049568 Ga0501031_0181556 Ga0501031_0181556_35_841 268
1661 3300049569 Ga0501032_0000046 Ga0501032_0000046_44231_45037 268
1662 3300049569 Ga0501032_0009690 Ga0501032_0009690_1059_1865 268
1663 3300049569 Ga0501032_0012480 Ga0501032_0012480_689_1495 268
1664 3300049569 Ga0501032_0031524 Ga0501032_0031524_2708_3514 268
1665 3300049570 Ga0501033_0001341 Ga0501033_0001341_1856_2662 268
1666 3300049570 Ga0501033_0001563 Ga0501033_0001563_12525_13331 268
1667 3300049570 Ga0501033_0101248 Ga0501033_0101248_427_1233 268
1668 3300049570 Ga0501033_0152143 Ga0501033_0152143_723_1529 268
1669 3300049570 Ga0501033_0171027 Ga0501033_0171027_478_1284 268
1670 3300049571 Ga0501034_0001492 Ga0501034_0001492_14833_15639 268
1671 3300049571 Ga0501034_0071642 Ga0501034_0071642_305_1111 268
1672 3300049571 Ga0501034_0089953 Ga0501034_0089953_2074_2880 268
1673 3300049571 Ga0501034_0134959 Ga0501034_0134959_1241_2047 268
1674 3300049571 Ga0501034_0288271 Ga0501034_0288271_39_845 268
1675 3300049572 Ga0501036_0000326 Ga0501036_0000326_10511_11317 268
1676 3300049572 Ga0501036_0046952 Ga0501036_0046952_1729_2535 268
1677 3300049572 Ga0501036_0176428 Ga0501036_0176428_82_888 268
1678 3300049572 Ga0501036_0258825 Ga0501036_0258825_406_1212 268
1679 3300049572 Ga0501036_0453407 Ga0501036_0453407_49_855 268
1680 3300049573 Ga0501037_0000309 Ga0501037_0000309_14751_15557 268
1681 3300049573 Ga0501037_0000457 Ga0501037_0000457_15023_15829 268
1682 3300049573 Ga0501037_0205292 Ga0501037_0205292_404_1210 268
1683 3300049573 Ga0501037_0231096 Ga0501037_0231096_467_1273 268
1684 3300049573 Ga0501037_0321889 Ga0501037_0321889_150_956 268
1685 3300049574 Ga0501038_0000026 Ga0501038_0000026_111816_112622 268
1686 3300049574 Ga0501038_0002061 Ga0501038_0002061_2613_3419 268
1687 3300049574 Ga0501038_0016287 Ga0501038_0016287_1713_2519 268
1688 3300049575 Ga0501039_0074976 Ga0501039_0074976_978_1784 268
1689 3300049575 Ga0501039_0118408 Ga0501039_0118408_980_1786 268
1690 3300049578 Ga0501042_0051874 Ga0501042_0051874_1527_2333 268
1691 3300049578 Ga0501042_0263549 Ga0501042_0263549_202_1008 268
1692 3300049579 Ga0501043_0000135 Ga0501043_0000135_45090_45896 268
1693 3300049579 Ga0501043_0022795 Ga0501043_0022795_1256_2062 268
1694 3300049579 Ga0501043_0397547 Ga0501043_0397547_11_817 268
1695 3300049580 Ga0501046_0019630 Ga0501046_0019630_1823_2629 268
1696 3300049580 Ga0501046_0109514 Ga0501046_0109514_395_1201 268
1697 3300049581 Ga0501047_0000101 Ga0501047_0000101_63164_63970 268
1698 3300049581 Ga0501047_0015152 Ga0501047_0015152_2765_3571 268
1699 3300049581 Ga0501047_0021168 Ga0501047_0021168_1457_2263 268
1700 3300049581 Ga0501047_0061378 Ga0501047_0061378_643_1449 268
1701 3300049581 Ga0501047_0076352 Ga0501047_0076352_255_1061 268
1702 3300049581 Ga0501047_0222535 Ga0501047_0222535_840_1646 268
1703 3300049581 Ga0501047_0391244 Ga0501047_0391244_389_1195 268
1704 3300049584 Ga0501068_0000977 Ga0501068_0000977_1525_2331 268
1705 3300049584 Ga0501068_0004441 Ga0501068_0004441_2015_2821 268
1706 3300049584 Ga0501068_0107517 Ga0501068_0107517_405_1211 268
1707 3300049585 Ga0501069_0023367 Ga0501069_0023367_445_1251 268
1708 3300049586 Ga0501070_0000297 Ga0501070_0000297_28401_29207 268
1709 3300049586 Ga0501070_0011694 Ga0501070_0011694_3572_4378 268
1710 3300049586 Ga0501070_0170731 Ga0501070_0170731_213_1019 268
1711 3300049587 Ga0501071_0139437 Ga0501071_0139437_350_1156 268
1712 3300049589 Ga0501073_0000840 Ga0501073_0000840_19626_20432 268
1713 3300049589 Ga0501073_0029876 Ga0501073_0029876_2656_3462 268
1714 3300049590 Ga0501074_0014547 Ga0501074_0014547_115_921 268
1715 3300049590 Ga0501074_0047411 Ga0501074_0047411_241_1047 268
1716 3300049593 Ga0501077_0157100 Ga0501077_0157100_624_1430 268
1717 3300049741 Ga0501079_0206584 Ga0501079_0206584_347_1153 268
1718 3300049741 Ga0501079_0260835 Ga0501079_0260835_195_1001 268
1719 3300049742 Ga0501080_0000121 Ga0501080_0000121_51759_52565 268
1720 3300049742 Ga0501080_0339254 Ga0501080_0339254_256_1062 268
1721 3300049743 Ga0501081_0451496 Ga0501081_0451496_120_926 268
1722 3300049822 Ga0501035_0000588 Ga0501035_0000588_17007_17813 268
1723 3300049822 Ga0501035_0022877 Ga0501035_0022877_2368_3174 268
1724 3300049822 Ga0501035_0071627 Ga0501035_0071627_122_928 268
1725 3300049822 Ga0501035_0251576 Ga0501035_0251576_539_1345 268
1726 3300049822 Ga0501035_0384522 Ga0501035_0384522_78_884 268
1727 3300049823 Ga0501044_0002089 Ga0501044_0002089_16509_17315 268
1728 3300049823 Ga0501044_0033001 Ga0501044_0033001_2493_3299 268
1729 3300049823 Ga0501044_0049387 Ga0501044_0049387_386_1192 268
1730 3300049823 Ga0501044_0061427 Ga0501044_0061427_2006_2812 268
1731 3300049823 Ga0501044_0087029 Ga0501044_0087029_2160_2972 268
1732 3300049823 Ga0501044_0198500 Ga0501044_0198500_686_1492 268
1733 3300049823 Ga0501044_0206966 Ga0501044_0206966_546_1352 268
1734 3300049823 Ga0501044_0327811 Ga0501044_0327811_453_1259 268
1735 3300049823 Ga0501044_0409443 Ga0501044_0409443_410_1216 268
1736 3300049824 Ga0501045_0008047 Ga0501045_0008047_6390_7196 268
1737 3300049824 Ga0501045_0021109 Ga0501045_0021109_3678_4484 268
1738 3300050490 nmdc:mga03n38_99571_c1 nmdc:mga03n38_99571_c1_133_939 268
1739 3300050491 nmdc:mga00v17_35768_c1 nmdc:mga00v17_35768_c1_1679_2485 268
1740 3300050491 nmdc:mga00v17_83059_c1 nmdc:mga00v17_83059_c1_1176_1982 268
1741 3300050492 nmdc:mga0yw44_305994_c1 nmdc:mga0yw44_305994_c1_194_1000 268
1742 3300050492 nmdc:mga0yw44_9069_c1 nmdc:mga0yw44_9069_c1_659_1465 268
1743 3300050493 nmdc:mga0k408_9648_c1 nmdc:mga0k408_9648_c1_2463_3269 268
1744 3300050494 nmdc:mga06z11_43075_c1 nmdc:mga06z11_43075_c1_1218_2024 268
1745 3300050494 nmdc:mga06z11_4937_c1 nmdc:mga06z11_4937_c1_158_964 268
1746 3300050511 nmdc:mga08y16_20502_c1 nmdc:mga08y16_20502_c1_979_1803 268
1747 3300050512 nmdc:mga0n895_113422_c1 nmdc:mga0n895_113422_c1_1271_2077 268
1748 3300050512 nmdc:mga0n895_300581_c1 nmdc:mga0n895_300581_c1_363_1169 268
1749 3300050512 nmdc:mga0n895_450009_c1 nmdc:mga0n895_450009_c1_57_863 268
1750 3300050513 nmdc:mga0rr50_287994_c1 nmdc:mga0rr50_287994_c1_534_1340 268
1751 3300050514 nmdc:mga08x19_358814_c1 nmdc:mga08x19_358814_c1_21_827 268
1752 3300050514 nmdc:mga08x19_61814_c1 nmdc:mga08x19_61814_c1_1350_2162 268
1753 3300050516 nmdc:mga0sz30_31406_c1 nmdc:mga0sz30_31406_c1_444_1250 268
1754 3300053077 Ga0495601_0002964 Ga0495601_0002964_8535_9347 268
1755 3300053077 Ga0495601_0011143 Ga0495601_0011143_1771_2577 268
1756 3300053077 Ga0495601_0110968 Ga0495601_0110968_661_1473 268
1757 3300053077 Ga0495601_0163376 Ga0495601_0163376_131_937 268
1758 3300053078 Ga0495612_0001295 Ga0495612_0001295_3000_3812 268
1759 3300053078 Ga0495612_0009654 Ga0495612_0009654_1548_2354 268
1760 3300053078 Ga0495612_0041156 Ga0495612_0041156_935_1741 268
1761 3300053080 Ga0500635_0007489 Ga0500635_0007489_1033_1839 268
1762 3300053084 Ga0495595_0046163 Ga0495595_0046163_685_1491 268
1763 3300053084 Ga0495595_0093655 Ga0495595_0093655_27_833 268
1764 3300053084 Ga0495595_0121161 Ga0495595_0121161_239_1051 268
1765 3300053085 Ga0495619_0000332 Ga0495619_0000332_6923_7729 268
1766 3300053085 Ga0495619_0001363 Ga0495619_0001363_6086_6898 268
1767 3300053085 Ga0495619_0024539 Ga0495619_0024539_459_1265 268
1768 3300053085 Ga0495619_0084961 Ga0495619_0084961_868_1674 268
1769 3300053085 Ga0495619_0095263 Ga0495619_0095263_399_1205 268
1770 3300053087 Ga0500643_000019 Ga0500643_000019_94892_95698 268
1771 3300053088 Ga0500644_0021160 Ga0500644_0021160_916_1722 268
1772 3300053093 Ga0500651_0037492 Ga0500651_0037492_252_1058 268
1773 3300053093 Ga0500651_0101648 Ga0500651_0101648_743_1549 268
1774 3300053093 Ga0500651_0222345 Ga0500651_0222345_168_974 268
1775 3300053094 Ga0500566_0000071 Ga0500566_0000071_42217_43023 268
1776 3300053094 Ga0500566_0000537 Ga0500566_0000537_291_1097 268
1777 3300053094 Ga0500566_0000554 Ga0500566_0000554_15416_16222 268
1778 3300053096 Ga0500641_0017441 Ga0500641_0017441_1579_2385 268
1779 3300053096 Ga0500641_0028512 Ga0500641_0028512_698_1504 268
1780 3300053097 Ga0500648_082402 Ga0500648_082402_332_1138 268
1781 3300053098 Ga0500650_0000453 Ga0500650_0000453_7762_8568 268
1782 3300053098 Ga0500650_0121043 Ga0500650_0121043_160_966 268
1783 3300053103 Ga0500555_004804 Ga0500555_004804_2997_3803 268
1784 3300053103 Ga0500555_059998 Ga0500555_059998_34_840 268
1785 3300053104 Ga0500556_0000024 Ga0500556_0000024_117581_118387 268
1786 3300053104 Ga0500556_0006656 Ga0500556_0006656_402_1208 268
1787 3300053108 Ga0500562_011769 Ga0500562_011769_558_1364 268
1788 3300053108 Ga0500562_022437 Ga0500562_022437_620_1426 268
1789 3300053109 Ga0500569_028264 Ga0500569_028264_85_891 268
1790 3300053111 Ga0500572_001322 Ga0500572_001322_423_1229 268
1791 3300053111 Ga0500572_001883 Ga0500572_001883_407_1270 268
1792 3300053116 Ga0500592_001232 Ga0500592_001232_1553_2359 268
1793 3300053119 Ga0500595_001457 Ga0500595_001457_11570_12376 268
1794 3300053119 Ga0500595_008270 Ga0500595_008270_2433_3239 268
1795 3300053119 Ga0500595_010034 Ga0500595_010034_2738_3544 268
1796 3300053119 Ga0500595_029921 Ga0500595_029921_598_1404 268
1797 3300053121 Ga0500607_050466 Ga0500607_050466_606_1412 268
1798 3300053121 Ga0500607_068383 Ga0500607_068383_294_1100 268
1799 3300053122 Ga0500608_001306 Ga0500608_001306_2165_2971 268
1800 3300053130 Ga0500642_0000035 Ga0500642_0000035_19424_20230 268
1801 3300053130 Ga0500642_0000063 Ga0500642_0000063_9175_9981 268
1802 3300053131 Ga0500652_003392 Ga0500652_003392_1695_2501 268
1803 3300053136 Ga0500559_0000521 Ga0500559_0000521_5949_6812 268
1804 3300053136 Ga0500559_0000985 Ga0500559_0000985_6652_7458 268
1805 3300053136 Ga0500559_0008086 Ga0500559_0008086_146_952 268
1806 3300053139 Ga0500568_0000681 Ga0500568_0000681_4268_5074 268
1807 3300053139 Ga0500568_0003711 Ga0500568_0003711_7028_7834 268
1808 3300053140 Ga0500573_0008062 Ga0500573_0008062_3296_4102 268
1809 3300053142 Ga0500577_0002124 Ga0500577_0002124_3703_4509 268
1810 3300053142 Ga0500577_0083133 Ga0500577_0083133_58_864 268
1811 3300053145 Ga0500586_027712 Ga0500586_027712_550_1356 268
1812 3300053146 Ga0500588_0053957 Ga0500588_0053957_391_1197 268
1813 3300053150 Ga0500603_000166 Ga0500603_000166_7287_8093 268
1814 3300053150 Ga0500603_001970 Ga0500603_001970_1188_1994 268
1815 3300053150 Ga0500603_004393 Ga0500603_004393_788_1657 268
1816 3300053151 Ga0500604_0017700 Ga0500604_0017700_981_1787 268
1817 3300053153 Ga0500616_0000084 Ga0500616_0000084_183338_184144 268
1818 3300053153 Ga0500616_0000122 Ga0500616_0000122_120515_121321 268
1819 3300053155 Ga0500620_007717 Ga0500620_007717_308_1114 268
1820 3300053156 Ga0500622_0006487 Ga0500622_0006487_1022_1828 268
1821 3300053158 Ga0500627_0017182 Ga0500627_0017182_1603_2409 268
1822 3300053161 Ga0500634_0084158 Ga0500634_0084158_676_1482 268
1823 3300053162 Ga0500638_011072 Ga0500638_011072_648_1454 268
1824 3300053162 Ga0500638_054637 Ga0500638_054637_38_844 268
1825 3300053163 Ga0500639_000166 Ga0500639_000166_521_1327 268
1826 3300053163 Ga0500639_008722 Ga0500639_008722_570_1433 268
1827 3300053163 Ga0500639_096716 Ga0500639_096716_326_1132 268
1828 3300053177 Ga0500636_0000076 Ga0500636_0000076_45729_46535 268
1829 3300053177 Ga0500636_0042821 Ga0500636_0042821_847_1653 268
1830 3300053177 Ga0500636_0191729 Ga0500636_0191729_171_1040 268
1831 3300053725 Ga0500576_038105 Ga0500576_038105_974_1837 268
1832 3300053729 Ga0500625_001804 Ga0500625_001804_3173_3979 268
1833 3300053730 Ga0500645_031825 Ga0500645_031825_688_1494 268
1834 3300053730 Ga0500645_060425 Ga0500645_060425_53_859 268
1835 3300053733 Ga0500552_017880 Ga0500552_017880_82_888 268
1836 3300053735 Ga0500596_001174 Ga0500596_001174_1821_2627 268
1837 3300053736 Ga0500599_002572 Ga0500599_002572_1012_1818 268
1838 3300053737 Ga0500601_000249 Ga0500601_000249_410_1216 268
1839 3300060353 Ga0501082_0000684 Ga0501082_0000684_1224_2051 268

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00941

FAD_binding_5

FAD binding domain in molybdopterin dehydrogenase

2

169

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1zxi-assembly1.cif.gz_F reconstituted co dehydrogenase from oligotropha carboxidovorans 0.8904 3 268
1zxi-assembly1.cif.gz_F reconstituted co dehydrogenase from oligotropha carboxidovorans 0.8809 3 268
1t3q-assembly1.cif.gz_F crystal structure of quinoline 2-oxidoreductase from pseudomonas putida 86 0.8767 3 267
1n5w-assembly1.cif.gz_C crystal structure of the cu,mo-co dehydrogenase (codh); oxidized form 0.876 4 268
1ffu-assembly1.cif.gz_F carbon monoxide dehydrogenase from hydrogenophaga pseudoflava which lacks the mo-pyranopterin moiety of the molybdenum cofactor 0.8658 3 267
ID Description Score Start End Superfamily
1t3qF02 Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3; 0.9672 57 168 3.30.465.10
af_I6Y7N2_57_165_3.30.465.10 Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3; 0.9622 66 166 3.30.465.10
1ffvC03 Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3; 0.9621 57 166 3.30.465.10
af_Q46800_56_173_3.30.465.10 Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3; 0.9397 57 166 3.30.465.10
4zohB02 Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3; 0.9315 57 166 3.30.465.10
ID Description Score Start End GO Terms
AF-A0A2S6TG65-F1-model_v4 FAD-binding PCMH-type domain-containing protein 0.991 56 263 GO:0016491
GO:0071949
AF-A0A3S1U3F1-F1-model_v4 deleted 0.9884 146 265
AF-A0A1H8YRK0-F1-model_v4 Carbon-monoxide dehydrogenase medium subunit 0.9827 168 264
AF-A0A2U2CH22-F1-model_v4 Glutathione S-transferase 0.9792 107 267 GO:0016491
GO:0071949
AF-A0A7G2LZT2-F1-model_v4 Carbon monoxide dehydrogenase 0.9763 188 263

Feature Viewer

pLDDT pTM Quality
91.59 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map