F495847
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1834 | 428 | 3668 | 96 |
Family's Representative Sequence
| Representative Sequence | 3300031911|Ga0307412_11181199|Ga0307412_111811992 |
| Length | 108 |
| Sequence | VRRETRDERLKAMKLTDVIRRPLITEKTTVMREDGRTLVFQVARDANKIDIKRAVEQLLGSKVDSVRTTLSHGKMKRQGKFVGRRSDWKKAYVKLREGEKLPEFLQGA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 2 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 3 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 4 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 5 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 6 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 7 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 8 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 9 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 10 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 11 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 12 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 13 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 14 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 15 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 16 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 23 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 25 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 27 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 29 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 40 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 56 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 57 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 58 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 59 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 63 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 64 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 65 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 66 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 68 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 69 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 73 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 74 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 76 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 77 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 78 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 80 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 81 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 82 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 83 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 84 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 85 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 86 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 87 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 88 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 89 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 90 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 91 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 92 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 93 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 94 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 95 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 96 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 97 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 99 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 100 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 101 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 102 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 103 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 104 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 105 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 106 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 108 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300012481 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610 | Metagenome | Rhizosphere |
| 124 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300027424 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 209 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 213 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 214 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 215 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 216 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 217 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 218 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 219 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 220 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 221 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 222 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 223 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 224 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 225 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 226 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 227 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 228 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 229 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 230 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 231 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 232 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 233 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 234 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 235 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 236 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 237 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 238 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 239 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 240 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 241 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 242 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 243 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 244 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 245 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 246 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 247 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 248 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 249 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 250 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 251 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 252 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 253 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 254 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 255 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 256 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 257 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 258 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 259 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 260 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 261 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 262 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 263 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 264 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 265 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 266 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 267 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 268 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 269 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 270 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 271 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 272 | 3300042124 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 | Metagenome | Rhizosphere |
| 273 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 274 | 3300042126 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 | Metagenome | Rhizosphere |
| 275 | 3300042128 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 | Metagenome | Rhizosphere |
| 276 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 277 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 278 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 279 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 280 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 281 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 282 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 283 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 284 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 285 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 286 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 287 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 288 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 289 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 290 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 291 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 292 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 293 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 294 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 295 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 296 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 345 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 346 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 347 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 348 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 349 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 350 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 351 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 352 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 353 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 354 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 355 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 356 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 357 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 358 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 359 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 360 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 361 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 362 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 363 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 364 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 365 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 366 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 367 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 368 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 369 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 370 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 371 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 372 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 373 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 374 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 375 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 376 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 377 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 378 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 379 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 380 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 381 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 382 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 383 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 384 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 385 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 386 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 387 | 3300049672 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought | Metagenome | Rhizosphere |
| 388 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 389 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 390 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 391 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 392 | 3300049761 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control | Metagenome | Rhizosphere |
| 393 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 394 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 395 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 396 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 397 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 398 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 399 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 400 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 401 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 402 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 403 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 404 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 405 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 406 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 407 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 408 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 409 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 410 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 414 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 415 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 416 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 417 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 418 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 419 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 420 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 421 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 422 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 423 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 424 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 425 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 426 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 427 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 428 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.56 |
| Metatranscriptomes | 0.44 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.2 |
| Nodule | 0 |
| Rhizoplane | 1.69 |
| Rhizosphere | 96.56 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 11.56 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0307412_11181199 | 3300031911 | Unclassified | 684 |
| 2 | JGI24746J21847_1018452 | 3300001977 | Bacteria | 986 |
| 3 | JGI24750J21931_1007440 | 3300002070 | Bacteria | 1378 |
| 4 | JGI24749J21850_1017130 | 3300002076 | Bacteria | 1019 |
| 5 | JGI24033J26618_1013460 | 3300002155 | Bacteria | 993 |
| 6 | JGI24742J22300_10045979 | 3300002244 | Bacteria | 784 |
| 7 | JGI24751J29686_10011336 | 3300002459 | Bacteria | 1838 |
| 8 | Ga0058859_10144798 | 3300004798 | Bacteria | 588 |
| 9 | Ga0058859_11738670 | 3300004798 | Bacteria | 534 |
| 10 | Ga0058861_11446860 | 3300004800 | Bacteria | 601 |
| 11 | Ga0058860_12002057 | 3300004801 | Bacteria | 883 |
| 12 | Ga0065714_10081807 | 3300005288 | Bacteria | 2350 |
| 13 | Ga0065714_10361047 | 3300005288 | Bacteria | 625 |
| 14 | Ga0065714_10426894 | 3300005288 | Unclassified | 543 |
| 15 | Ga0065704_10102280 | 3300005289 | Bacteria | 2210 |
| 16 | Ga0065704_10183591 | 3300005289 | Bacteria | 1224 |
| 17 | Ga0065704_10206902 | 3300005289 | Bacteria | 1124 |
| 18 | Ga0065704_10369091 | 3300005289 | Bacteria | 783 |
| 19 | Ga0065712_10001248 | 3300005290 | Bacteria | 11167 |
| 20 | Ga0065712_10003550 | 3300005290 | Bacteria | 4097 |
| 21 | Ga0065712_10007378 | 3300005290 | Bacteria | 3335 |
| 22 | Ga0065712_10049909 | 3300005290 | Bacteria | 864 |
| 23 | Ga0065712_10086551 | 3300005290 | Bacteria | 2629 |
| 24 | Ga0065712_10331248 | 3300005290 | Bacteria | 792 |
| 25 | Ga0065712_10784529 | 3300005290 | Unclassified | 517 |
| 26 | Ga0065715_10008392 | 3300005293 | Bacteria | 2483 |
| 27 | Ga0065715_10010383 | 3300005293 | Bacteria | 3726 |
| 28 | Ga0065715_10106703 | 3300005293 | Bacteria | 2813 |
| 29 | Ga0065715_10336800 | 3300005293 | Bacteria | 973 |
| 30 | Ga0065715_10369818 | 3300005293 | Unclassified | 923 |
| 31 | Ga0065715_10622502 | 3300005293 | Bacteria | 690 |
| 32 | Ga0065715_10750970 | 3300005293 | Bacteria | 630 |
| 33 | Ga0065715_10869726 | 3300005293 | Unclassified | 585 |
| 34 | Ga0065715_11169787 | 3300005293 | Unclassified | 504 |
| 35 | Ga0065707_10009459 | 3300005295 | Bacteria | 2532 |
| 36 | Ga0065707_10056515 | 3300005295 | Bacteria | 716 |
| 37 | Ga0065707_10060645 | 3300005295 | Bacteria | 720 |
| 38 | Ga0065707_10138907 | 3300005295 | Bacteria | 1800 |
| 39 | Ga0065707_10173153 | 3300005295 | Bacteria | 1470 |
| 40 | Ga0065707_10182556 | 3300005295 | Bacteria | 1409 |
| 41 | Ga0065707_10186529 | 3300005295 | Bacteria | 1385 |
| 42 | Ga0065707_10278564 | 3300005295 | Bacteria | 1053 |
| 43 | Ga0065707_10326011 | 3300005295 | Bacteria | 958 |
| 44 | Ga0070658_10963565 | 3300005327 | Bacteria | 742 |
| 45 | Ga0070658_11195499 | 3300005327 | Bacteria | 661 |
| 46 | Ga0070676_10046078 | 3300005328 | Bacteria | 2541 |
| 47 | Ga0070676_10066138 | 3300005328 | Bacteria | 2159 |
| 48 | Ga0070676_10066427 | 3300005328 | Bacteria | 2155 |
| 49 | Ga0070676_10125499 | 3300005328 | Bacteria | 1616 |
| 50 | Ga0070676_10149939 | 3300005328 | Bacteria | 1492 |
| 51 | Ga0070676_10297697 | 3300005328 | Bacteria | 1093 |
| 52 | Ga0070676_10326103 | 3300005328 | Bacteria | 1049 |
| 53 | Ga0070676_10465502 | 3300005328 | Bacteria | 892 |
| 54 | Ga0070676_11440404 | 3300005328 | Unclassified | 529 |
| 55 | Ga0070683_100045854 | 3300005329 | Bacteria | 4035 |
| 56 | Ga0070683_100786914 | 3300005329 | Bacteria | 912 |
| 57 | Ga0070683_101399426 | 3300005329 | Bacteria | 672 |
| 58 | Ga0070683_101703368 | 3300005329 | Unclassified | 606 |
| 59 | Ga0070690_100024114 | 3300005330 | Bacteria | 3740 |
| 60 | Ga0070690_100056265 | 3300005330 | Bacteria | 2522 |
| 61 | Ga0070690_100058004 | 3300005330 | Bacteria | 2485 |
| 62 | Ga0070690_100196725 | 3300005330 | Bacteria | 1400 |
| 63 | Ga0070690_100482927 | 3300005330 | Bacteria | 924 |
| 64 | Ga0070690_100751155 | 3300005330 | Unclassified | 753 |
| 65 | Ga0070690_101109985 | 3300005330 | Bacteria | 628 |
| 66 | Ga0070690_101372775 | 3300005330 | Unclassified | 568 |
| 67 | Ga0070670_100018641 | 3300005331 | Bacteria | 5947 |
| 68 | Ga0070670_100021447 | 3300005331 | Bacteria | 5557 |
| 69 | Ga0070670_100050331 | 3300005331 | Bacteria | 3580 |
| 70 | Ga0070670_100093752 | 3300005331 | Bacteria | 2582 |
| 71 | Ga0070670_100102390 | 3300005331 | Bacteria | 2466 |
| 72 | Ga0070670_100118076 | 3300005331 | Bacteria | 2287 |
| 73 | Ga0070670_100214598 | 3300005331 | Bacteria | 1673 |
| 74 | Ga0070670_100217335 | 3300005331 | Bacteria | 1663 |
| 75 | Ga0070670_100259725 | 3300005331 | Bacteria | 1514 |
| 76 | Ga0070670_100274762 | 3300005331 | Bacteria | 1471 |
| 77 | Ga0070670_100590930 | 3300005331 | Bacteria | 993 |
| 78 | Ga0070670_100661890 | 3300005331 | Bacteria | 937 |
| 79 | Ga0070670_100889588 | 3300005331 | Bacteria | 807 |
| 80 | Ga0070670_100928772 | 3300005331 | Bacteria | 790 |
| 81 | Ga0070670_101380550 | 3300005331 | Bacteria | 646 |
| 82 | Ga0070677_10014195 | 3300005333 | Bacteria | 2799 |
| 83 | Ga0070677_10028050 | 3300005333 | Bacteria | 2124 |
| 84 | Ga0070677_10064898 | 3300005333 | Bacteria | 1518 |
| 85 | Ga0070677_10188750 | 3300005333 | Bacteria | 986 |
| 86 | Ga0070677_10230946 | 3300005333 | Bacteria | 909 |
| 87 | Ga0070677_10317725 | 3300005333 | Unclassified | 797 |
| 88 | Ga0070677_10389593 | 3300005333 | Unclassified | 732 |
| 89 | Ga0070677_10486353 | 3300005333 | Bacteria | 666 |
| 90 | Ga0070677_10614163 | 3300005333 | Unclassified | 603 |
| 91 | Ga0068869_100037386 | 3300005334 | Bacteria | 3451 |
| 92 | Ga0068869_100111756 | 3300005334 | Bacteria | 2079 |
| 93 | Ga0068869_100168315 | 3300005334 | Bacteria | 1710 |
| 94 | Ga0068869_100263061 | 3300005334 | Bacteria | 1381 |
| 95 | Ga0068869_100446673 | 3300005334 | Bacteria | 1071 |
| 96 | Ga0068869_100580908 | 3300005334 | Bacteria | 945 |
| 97 | Ga0068869_100966245 | 3300005334 | Bacteria | 740 |
| 98 | Ga0068869_101303403 | 3300005334 | Bacteria | 641 |
| 99 | Ga0070666_10036918 | 3300005335 | Bacteria | 3246 |
| 100 | Ga0070666_10081248 | 3300005335 | Bacteria | 2215 |
| 101 | Ga0070666_10158036 | 3300005335 | Bacteria | 1584 |
| 102 | Ga0070666_10210239 | 3300005335 | Bacteria | 1370 |
| 103 | Ga0070666_10327026 | 3300005335 | Bacteria | 1094 |
| 104 | Ga0070666_10636161 | 3300005335 | Bacteria | 780 |
| 105 | Ga0070666_10815005 | 3300005335 | Bacteria | 688 |
| 106 | Ga0070680_100340821 | 3300005336 | Bacteria | 1274 |
| 107 | Ga0070680_100354454 | 3300005336 | Bacteria | 1248 |
| 108 | Ga0070680_100524897 | 3300005336 | Bacteria | 1014 |
| 109 | Ga0070680_100808429 | 3300005336 | Bacteria | 808 |
| 110 | Ga0070680_101784776 | 3300005336 | Unclassified | 533 |
| 111 | Ga0070682_100710619 | 3300005337 | Bacteria | 807 |
| 112 | Ga0070682_101123057 | 3300005337 | Bacteria | 659 |
| 113 | Ga0070682_101299781 | 3300005337 | Unclassified | 618 |
| 114 | Ga0068868_100088677 | 3300005338 | Bacteria | 2489 |
| 115 | Ga0068868_100149500 | 3300005338 | Bacteria | 1923 |
| 116 | Ga0068868_100283184 | 3300005338 | Bacteria | 1404 |
| 117 | Ga0068868_100355242 | 3300005338 | Bacteria | 1256 |
| 118 | Ga0068868_100380992 | 3300005338 | Bacteria | 1214 |
| 119 | Ga0068868_101805901 | 3300005338 | Bacteria | 578 |
| 120 | Ga0068868_102211889 | 3300005338 | Unclassified | 524 |
| 121 | Ga0070660_100971691 | 3300005339 | Unclassified | 717 |
| 122 | Ga0070689_100063350 | 3300005340 | Bacteria | 2877 |
| 123 | Ga0070689_100087017 | 3300005340 | Bacteria | 2458 |
| 124 | Ga0070689_100132175 | 3300005340 | Bacteria | 2002 |
| 125 | Ga0070689_100145366 | 3300005340 | Bacteria | 1909 |
| 126 | Ga0070689_100217622 | 3300005340 | Bacteria | 1566 |
| 127 | Ga0070689_100227667 | 3300005340 | Bacteria | 1531 |
| 128 | Ga0070689_100299583 | 3300005340 | Bacteria | 1338 |
| 129 | Ga0070689_100328948 | 3300005340 | Bacteria | 1278 |
| 130 | Ga0070689_100349992 | 3300005340 | Bacteria | 1239 |
| 131 | Ga0070689_100409239 | 3300005340 | Bacteria | 1148 |
| 132 | Ga0070689_100585490 | 3300005340 | Bacteria | 965 |
| 133 | Ga0070689_100597513 | 3300005340 | Bacteria | 955 |
| 134 | Ga0070689_100618407 | 3300005340 | Bacteria | 940 |
| 135 | Ga0070689_101330603 | 3300005340 | Unclassified | 648 |
| 136 | Ga0070689_102181286 | 3300005340 | Bacteria | 508 |
| 137 | Ga0070691_10429881 | 3300005341 | Bacteria | 750 |
| 138 | Ga0070691_10588800 | 3300005341 | Bacteria | 655 |
| 139 | Ga0070687_100009294 | 3300005343 | Bacteria | 4207 |
| 140 | Ga0070687_100064511 | 3300005343 | Bacteria | 1946 |
| 141 | Ga0070687_100068909 | 3300005343 | Bacteria | 1893 |
| 142 | Ga0070687_100154415 | 3300005343 | Bacteria | 1351 |
| 143 | Ga0070687_100325191 | 3300005343 | Bacteria | 984 |
| 144 | Ga0070687_100335092 | 3300005343 | Bacteria | 971 |
| 145 | Ga0070687_100679539 | 3300005343 | Bacteria | 717 |
| 146 | Ga0070661_100054032 | 3300005344 | Bacteria | 2942 |
| 147 | Ga0070661_100166374 | 3300005344 | Bacteria | 1673 |
| 148 | Ga0070661_100300423 | 3300005344 | Bacteria | 1250 |
| 149 | Ga0070661_100616109 | 3300005344 | Bacteria | 879 |
| 150 | Ga0070661_100890316 | 3300005344 | Bacteria | 734 |
| 151 | Ga0070692_10124946 | 3300005345 | Bacteria | 1439 |
| 152 | Ga0070692_10412887 | 3300005345 | Bacteria | 855 |
| 153 | Ga0070692_10658937 | 3300005345 | Bacteria | 700 |
| 154 | Ga0070692_10854314 | 3300005345 | Bacteria | 626 |
| 155 | Ga0070668_100041626 | 3300005347 | Bacteria | 3520 |
| 156 | Ga0070668_100050799 | 3300005347 | Bacteria | 3193 |
| 157 | Ga0070668_100131846 | 3300005347 | Bacteria | 2006 |
| 158 | Ga0070668_100314381 | 3300005347 | Bacteria | 1317 |
| 159 | Ga0070668_100444833 | 3300005347 | Bacteria | 1113 |
| 160 | Ga0070668_100514748 | 3300005347 | Bacteria | 1037 |
| 161 | Ga0070668_100891361 | 3300005347 | Bacteria | 795 |
| 162 | Ga0070668_101645891 | 3300005347 | Unclassified | 589 |
| 163 | Ga0070669_100001695 | 3300005353 | Bacteria | 15953 |
| 164 | Ga0070669_100004188 | 3300005353 | Bacteria | 10451 |
| 165 | Ga0070669_100054214 | 3300005353 | Bacteria | 2936 |
| 166 | Ga0070669_100170870 | 3300005353 | Bacteria | 1694 |
| 167 | Ga0070669_100177016 | 3300005353 | Bacteria | 1666 |
| 168 | Ga0070669_100217306 | 3300005353 | Bacteria | 1510 |
| 169 | Ga0070669_100459208 | 3300005353 | Unclassified | 1051 |
| 170 | Ga0070669_100611455 | 3300005353 | Bacteria | 914 |
| 171 | Ga0070669_100758525 | 3300005353 | Bacteria | 822 |
| 172 | Ga0070669_100834094 | 3300005353 | Bacteria | 785 |
| 173 | Ga0070669_101016797 | 3300005353 | Bacteria | 712 |
| 174 | Ga0070669_101404393 | 3300005353 | Bacteria | 606 |
| 175 | Ga0070669_101547891 | 3300005353 | Bacteria | 577 |
| 176 | Ga0070669_101713945 | 3300005353 | Bacteria | 548 |
| 177 | Ga0070675_100015584 | 3300005354 | Bacteria | 6014 |
| 178 | Ga0070675_100051728 | 3300005354 | Bacteria | 3376 |
| 179 | Ga0070675_100054827 | 3300005354 | Bacteria | 3280 |
| 180 | Ga0070675_100060492 | 3300005354 | Bacteria | 3127 |
| 181 | Ga0070675_100061239 | 3300005354 | Bacteria | 3107 |
| 182 | Ga0070675_100095940 | 3300005354 | Bacteria | 2491 |
| 183 | Ga0070675_100096375 | 3300005354 | Bacteria | 2485 |
| 184 | Ga0070675_100107421 | 3300005354 | Bacteria | 2357 |
| 185 | Ga0070675_100124649 | 3300005354 | Bacteria | 2191 |
| 186 | Ga0070675_100135858 | 3300005354 | Bacteria | 2099 |
| 187 | Ga0070675_100145573 | 3300005354 | Bacteria | 2028 |
| 188 | Ga0070675_100161027 | 3300005354 | Bacteria | 1930 |
| 189 | Ga0070675_100194769 | 3300005354 | Bacteria | 1757 |
| 190 | Ga0070675_100255515 | 3300005354 | Bacteria | 1534 |
| 191 | Ga0070675_100310605 | 3300005354 | Bacteria | 1391 |
| 192 | Ga0070675_100459749 | 3300005354 | Bacteria | 1142 |
| 193 | Ga0070675_100940801 | 3300005354 | Bacteria | 793 |
| 194 | Ga0070675_100998122 | 3300005354 | Bacteria | 768 |
| 195 | Ga0070675_101145696 | 3300005354 | Bacteria | 716 |
| 196 | Ga0070675_101592946 | 3300005354 | Bacteria | 602 |
| 197 | Ga0070675_101670075 | 3300005354 | Bacteria | 588 |
| 198 | Ga0070675_102032377 | 3300005354 | Unclassified | 530 |
| 199 | Ga0070671_100023005 | 3300005355 | Bacteria | 5092 |
| 200 | Ga0070671_100164618 | 3300005355 | Bacteria | 1875 |
| 201 | Ga0070671_100220359 | 3300005355 | Bacteria | 1609 |
| 202 | Ga0070671_100302905 | 3300005355 | Bacteria | 1361 |
| 203 | Ga0070671_100429744 | 3300005355 | Bacteria | 1132 |
| 204 | Ga0070671_100890876 | 3300005355 | Bacteria | 777 |
| 205 | Ga0070671_100932897 | 3300005355 | Bacteria | 759 |
| 206 | Ga0070671_101107136 | 3300005355 | Bacteria | 696 |
| 207 | Ga0070671_101800649 | 3300005355 | Bacteria | 544 |
| 208 | Ga0070674_100049213 | 3300005356 | Bacteria | 2897 |
| 209 | Ga0070674_100203958 | 3300005356 | Bacteria | 1529 |
| 210 | Ga0070674_100237783 | 3300005356 | Bacteria | 1424 |
| 211 | Ga0070674_100301950 | 3300005356 | Bacteria | 1277 |
| 212 | Ga0070674_100651683 | 3300005356 | Bacteria | 895 |
| 213 | Ga0070674_100784490 | 3300005356 | Bacteria | 821 |
| 214 | Ga0070674_101172945 | 3300005356 | Bacteria | 681 |
| 215 | Ga0070674_101281767 | 3300005356 | Unclassified | 653 |
| 216 | Ga0070674_101754680 | 3300005356 | Bacteria | 562 |
| 217 | Ga0070673_100004781 | 3300005364 | Bacteria | 8602 |
| 218 | Ga0070673_100053702 | 3300005364 | Bacteria | 3167 |
| 219 | Ga0070673_100076722 | 3300005364 | Bacteria | 2699 |
| 220 | Ga0070673_100099675 | 3300005364 | Bacteria | 2390 |
| 221 | Ga0070673_100149769 | 3300005364 | Bacteria | 1975 |
| 222 | Ga0070673_100170983 | 3300005364 | Bacteria | 1855 |
| 223 | Ga0070673_100246112 | 3300005364 | Bacteria | 1556 |
| 224 | Ga0070673_100429437 | 3300005364 | Bacteria | 1186 |
| 225 | Ga0070673_100770633 | 3300005364 | Bacteria | 887 |
| 226 | Ga0070673_100876566 | 3300005364 | Bacteria | 831 |
| 227 | Ga0070673_100978917 | 3300005364 | Bacteria | 787 |
| 228 | Ga0070673_101888936 | 3300005364 | Unclassified | 566 |
| 229 | Ga0070688_100009618 | 3300005365 | Bacteria | 5298 |
| 230 | Ga0070688_100027588 | 3300005365 | Bacteria | 3382 |
| 231 | Ga0070688_100031158 | 3300005365 | Bacteria | 3206 |
| 232 | Ga0070688_100043135 | 3300005365 | Bacteria | 2777 |
| 233 | Ga0070688_100069077 | 3300005365 | Bacteria | 2255 |
| 234 | Ga0070688_100415928 | 3300005365 | Bacteria | 998 |
| 235 | Ga0070688_100711716 | 3300005365 | Bacteria | 779 |
| 236 | Ga0070688_101034941 | 3300005365 | Bacteria | 654 |
| 237 | Ga0070688_101225107 | 3300005365 | Bacteria | 604 |
| 238 | Ga0070688_101334721 | 3300005365 | Bacteria | 580 |
| 239 | Ga0070688_101459728 | 3300005365 | Archaea | 556 |
| 240 | Ga0070688_101785077 | 3300005365 | Bacteria | 505 |
| 241 | Ga0070659_100479777 | 3300005366 | Bacteria | 1058 |
| 242 | Ga0070667_100093786 | 3300005367 | Bacteria | 2585 |
| 243 | Ga0070667_100515864 | 3300005367 | Bacteria | 1096 |
| 244 | Ga0070667_100737417 | 3300005367 | Bacteria | 913 |
| 245 | Ga0070667_100891161 | 3300005367 | Bacteria | 828 |
| 246 | Ga0070667_100932694 | 3300005367 | Bacteria | 809 |
| 247 | Ga0070667_102020533 | 3300005367 | Unclassified | 543 |
| 248 | Ga0070703_10039292 | 3300005406 | Bacteria | 1466 |
| 249 | Ga0070703_10350784 | 3300005406 | Bacteria | 630 |
| 250 | Ga0070709_10325334 | 3300005434 | Bacteria | 1130 |
| 251 | Ga0070709_11708770 | 3300005434 | Bacteria | 514 |
| 252 | Ga0070714_100072180 | 3300005435 | Bacteria | 2988 |
| 253 | Ga0070710_10631472 | 3300005437 | Bacteria | 749 |
| 254 | Ga0070701_10071626 | 3300005438 | Bacteria | 1854 |
| 255 | Ga0070701_10077450 | 3300005438 | Bacteria | 1792 |
| 256 | Ga0070701_10094914 | 3300005438 | Bacteria | 1641 |
| 257 | Ga0070701_10265411 | 3300005438 | Bacteria | 1042 |
| 258 | Ga0070701_11319443 | 3300005438 | Bacteria | 516 |
| 259 | Ga0070711_100080066 | 3300005439 | Bacteria | 2325 |
| 260 | Ga0070705_100050319 | 3300005440 | Bacteria | 2423 |
| 261 | Ga0070705_100080693 | 3300005440 | Bacteria | 1996 |
| 262 | Ga0070705_100254835 | 3300005440 | Bacteria | 1234 |
| 263 | Ga0070705_100360085 | 3300005440 | Bacteria | 1064 |
| 264 | Ga0070705_100472577 | 3300005440 | Bacteria | 945 |
| 265 | Ga0070705_100800366 | 3300005440 | Unclassified | 750 |
| 266 | Ga0070705_100953109 | 3300005440 | Bacteria | 693 |
| 267 | Ga0070705_101152192 | 3300005440 | Bacteria | 637 |
| 268 | Ga0070700_100082208 | 3300005441 | Bacteria | 2082 |
| 269 | Ga0070700_100102200 | 3300005441 | Bacteria | 1890 |
| 270 | Ga0070700_100206269 | 3300005441 | Bacteria | 1384 |
| 271 | Ga0070700_100343072 | 3300005441 | Bacteria | 1105 |
| 272 | Ga0070700_101616157 | 3300005441 | Unclassified | 554 |
| 273 | Ga0070694_100041640 | 3300005444 | Bacteria | 3065 |
| 274 | Ga0070694_100049109 | 3300005444 | Bacteria | 2840 |
| 275 | Ga0070694_100391817 | 3300005444 | Bacteria | 1085 |
| 276 | Ga0070694_100494101 | 3300005444 | Bacteria | 973 |
| 277 | Ga0070694_100714513 | 3300005444 | Bacteria | 816 |
| 278 | Ga0070694_100930958 | 3300005444 | Archaea | 719 |
| 279 | Ga0070694_101212734 | 3300005444 | Bacteria | 632 |
| 280 | Ga0070694_101539681 | 3300005444 | Bacteria | 563 |
| 281 | Ga0070708_100142445 | 3300005445 | Bacteria | 2224 |
| 282 | Ga0070708_100869875 | 3300005445 | Unclassified | 846 |
| 283 | Ga0070663_100347654 | 3300005455 | Bacteria | 1200 |
| 284 | Ga0070663_100679774 | 3300005455 | Bacteria | 873 |
| 285 | Ga0070663_101277492 | 3300005455 | Unclassified | 647 |
| 286 | Ga0070663_101630192 | 3300005455 | Bacteria | 576 |
| 287 | Ga0070663_102093419 | 3300005455 | Bacteria | 510 |
| 288 | Ga0070678_100062889 | 3300005456 | Bacteria | 2743 |
| 289 | Ga0070678_100136342 | 3300005456 | Bacteria | 1958 |
| 290 | Ga0070678_100232037 | 3300005456 | Bacteria | 1539 |
| 291 | Ga0070678_100275124 | 3300005456 | Bacteria | 1421 |
| 292 | Ga0070678_100297794 | 3300005456 | Bacteria | 1370 |
| 293 | Ga0070678_100348308 | 3300005456 | Bacteria | 1273 |
| 294 | Ga0070678_100463952 | 3300005456 | Bacteria | 1112 |
| 295 | Ga0070678_100501424 | 3300005456 | Bacteria | 1071 |
| 296 | Ga0070678_100932795 | 3300005456 | Bacteria | 795 |
| 297 | Ga0070678_101151037 | 3300005456 | Bacteria | 718 |
| 298 | Ga0070662_100026522 | 3300005457 | Bacteria | 4014 |
| 299 | Ga0070662_100297893 | 3300005457 | Bacteria | 1309 |
| 300 | Ga0070662_100622989 | 3300005457 | Bacteria | 909 |
| 301 | Ga0070662_100669242 | 3300005457 | Bacteria | 877 |
| 302 | Ga0070662_100756938 | 3300005457 | Unclassified | 824 |
| 303 | Ga0070662_100795234 | 3300005457 | Bacteria | 804 |
| 304 | Ga0070662_101707090 | 3300005457 | Unclassified | 544 |
| 305 | Ga0070662_101710276 | 3300005457 | Bacteria | 543 |
| 306 | Ga0070681_11702359 | 3300005458 | Bacteria | 557 |
| 307 | Ga0068867_100007115 | 3300005459 | Bacteria | 7904 |
| 308 | Ga0068867_100077745 | 3300005459 | Bacteria | 2494 |
| 309 | Ga0068867_100117902 | 3300005459 | Bacteria | 2047 |
| 310 | Ga0068867_100221530 | 3300005459 | Bacteria | 1525 |
| 311 | Ga0068867_100286576 | 3300005459 | Bacteria | 1352 |
| 312 | Ga0068867_100374425 | 3300005459 | Bacteria | 1194 |
| 313 | Ga0068867_100759914 | 3300005459 | Bacteria | 861 |
| 314 | Ga0068867_101328039 | 3300005459 | Unclassified | 665 |
| 315 | Ga0068867_101539616 | 3300005459 | Unclassified | 620 |
| 316 | Ga0068867_101868940 | 3300005459 | Unclassified | 566 |
| 317 | Ga0068867_101954588 | 3300005459 | Bacteria | 554 |
| 318 | Ga0070685_10033929 | 3300005466 | Bacteria | 2871 |
| 319 | Ga0070685_10051449 | 3300005466 | Bacteria | 2382 |
| 320 | Ga0070685_10054882 | 3300005466 | Bacteria | 2313 |
| 321 | Ga0070685_10341175 | 3300005466 | Bacteria | 1021 |
| 322 | Ga0070685_10425373 | 3300005466 | Bacteria | 925 |
| 323 | Ga0070685_10582793 | 3300005466 | Bacteria | 803 |
| 324 | Ga0070685_10713423 | 3300005466 | Bacteria | 732 |
| 325 | Ga0070685_11075852 | 3300005466 | Bacteria | 607 |
| 326 | Ga0070706_100352903 | 3300005467 | Bacteria | 1371 |
| 327 | Ga0070706_100453721 | 3300005467 | Bacteria | 1193 |
| 328 | Ga0070706_100650535 | 3300005467 | Bacteria | 978 |
| 329 | Ga0070707_100108107 | 3300005468 | Bacteria | 2698 |
| 330 | Ga0070707_100267194 | 3300005468 | Bacteria | 1663 |
| 331 | Ga0070707_100483491 | 3300005468 | Bacteria | 1200 |
| 332 | Ga0070698_100003045 | 3300005471 | Bacteria | 18470 |
| 333 | Ga0070698_100048029 | 3300005471 | Bacteria | 4362 |
| 334 | Ga0070698_100109178 | 3300005471 | Bacteria | 2733 |
| 335 | Ga0070698_100224314 | 3300005471 | Bacteria | 1812 |
| 336 | Ga0070698_100301721 | 3300005471 | Bacteria | 1532 |
| 337 | Ga0070698_100316979 | 3300005471 | Bacteria | 1490 |
| 338 | Ga0070698_100509229 | 3300005471 | Bacteria | 1142 |
| 339 | Ga0070698_100937981 | 3300005471 | Bacteria | 812 |
| 340 | Ga0070698_100966352 | 3300005471 | Bacteria | 798 |
| 341 | Ga0070698_101188617 | 3300005471 | Bacteria | 712 |
| 342 | Ga0070699_100000410 | 3300005518 | Bacteria | 41278 |
| 343 | Ga0070699_100040500 | 3300005518 | Bacteria | 4034 |
| 344 | Ga0070699_100084034 | 3300005518 | Bacteria | 2777 |
| 345 | Ga0070699_100113437 | 3300005518 | Bacteria | 2381 |
| 346 | Ga0070679_101071302 | 3300005530 | Unclassified | 750 |
| 347 | Ga0070679_101178875 | 3300005530 | Bacteria | 711 |
| 348 | Ga0070684_100276538 | 3300005535 | Bacteria | 1538 |
| 349 | Ga0070684_100375159 | 3300005535 | Bacteria | 1310 |
| 350 | Ga0070684_100513072 | 3300005535 | Bacteria | 1111 |
| 351 | Ga0070684_101681197 | 3300005535 | Unclassified | 599 |
| 352 | Ga0070684_102338093 | 3300005535 | Unclassified | 504 |
| 353 | Ga0070697_100048428 | 3300005536 | Bacteria | 3446 |
| 354 | Ga0070697_100150612 | 3300005536 | Bacteria | 1960 |
| 355 | Ga0070697_100352285 | 3300005536 | Bacteria | 1271 |
| 356 | Ga0070697_100456897 | 3300005536 | Bacteria | 1113 |
| 357 | Ga0070697_100738092 | 3300005536 | Bacteria | 870 |
| 358 | Ga0068853_100486487 | 3300005539 | Bacteria | 1164 |
| 359 | Ga0068853_101331646 | 3300005539 | Unclassified | 694 |
| 360 | Ga0068853_101451471 | 3300005539 | Unclassified | 664 |
| 361 | Ga0068853_101505033 | 3300005539 | Bacteria | 652 |
| 362 | Ga0068853_101624470 | 3300005539 | Bacteria | 626 |
| 363 | Ga0068853_101754175 | 3300005539 | Bacteria | 602 |
| 364 | Ga0068853_101933491 | 3300005539 | Unclassified | 572 |
| 365 | Ga0070672_100010895 | 3300005543 | Bacteria | 6323 |
| 366 | Ga0070672_100017126 | 3300005543 | Bacteria | 5209 |
| 367 | Ga0070672_100028528 | 3300005543 | Bacteria | 4176 |
| 368 | Ga0070672_100040121 | 3300005543 | Bacteria | 3590 |
| 369 | Ga0070672_100089424 | 3300005543 | Bacteria | 2481 |
| 370 | Ga0070672_100097051 | 3300005543 | Bacteria | 2385 |
| 371 | Ga0070672_100105396 | 3300005543 | Bacteria | 2292 |
| 372 | Ga0070672_100128201 | 3300005543 | Bacteria | 2083 |
| 373 | Ga0070672_100196448 | 3300005543 | Bacteria | 1686 |
| 374 | Ga0070672_100262712 | 3300005543 | Bacteria | 1456 |
| 375 | Ga0070672_100519258 | 3300005543 | Bacteria | 1032 |
| 376 | Ga0070672_101161992 | 3300005543 | Bacteria | 687 |
| 377 | Ga0070686_100033093 | 3300005544 | Bacteria | 3174 |
| 378 | Ga0070686_100101518 | 3300005544 | Bacteria | 1944 |
| 379 | Ga0070686_100106200 | 3300005544 | Bacteria | 1905 |
| 380 | Ga0070686_100185638 | 3300005544 | Bacteria | 1480 |
| 381 | Ga0070686_100195342 | 3300005544 | Bacteria | 1447 |
| 382 | Ga0070686_100253036 | 3300005544 | Bacteria | 1287 |
| 383 | Ga0070686_100356906 | 3300005544 | Bacteria | 1100 |
| 384 | Ga0070686_100425832 | 3300005544 | Bacteria | 1015 |
| 385 | Ga0070686_101126279 | 3300005544 | Unclassified | 649 |
| 386 | Ga0070686_101166699 | 3300005544 | Bacteria | 638 |
| 387 | Ga0070686_101726916 | 3300005544 | Bacteria | 532 |
| 388 | Ga0070695_100082054 | 3300005545 | Bacteria | 2134 |
| 389 | Ga0070695_100491232 | 3300005545 | Bacteria | 948 |
| 390 | Ga0070695_100930039 | 3300005545 | Bacteria | 704 |
| 391 | Ga0070695_101045731 | 3300005545 | Bacteria | 666 |
| 392 | Ga0070696_100013777 | 3300005546 | Bacteria | 5429 |
| 393 | Ga0070696_100019197 | 3300005546 | Bacteria | 4628 |
| 394 | Ga0070696_100094763 | 3300005546 | Bacteria | 2131 |
| 395 | Ga0070696_100119854 | 3300005546 | Bacteria | 1903 |
| 396 | Ga0070696_100317539 | 3300005546 | Bacteria | 1198 |
| 397 | Ga0070696_101114969 | 3300005546 | Unclassified | 664 |
| 398 | Ga0070693_100120878 | 3300005547 | Bacteria | 1624 |
| 399 | Ga0070693_100127012 | 3300005547 | Bacteria | 1589 |
| 400 | Ga0070693_100611803 | 3300005547 | Unclassified | 788 |
| 401 | Ga0070693_101631974 | 3300005547 | Unclassified | 507 |
| 402 | Ga0070665_100029874 | 3300005548 | Bacteria | 5485 |
| 403 | Ga0070665_100131653 | 3300005548 | Bacteria | 2503 |
| 404 | Ga0070665_100854492 | 3300005548 | Bacteria | 923 |
| 405 | Ga0070665_101052046 | 3300005548 | Bacteria | 826 |
| 406 | Ga0070665_101866308 | 3300005548 | Bacteria | 607 |
| 407 | Ga0070665_102425244 | 3300005548 | Unclassified | 527 |
| 408 | Ga0070704_100046141 | 3300005549 | Bacteria | 3036 |
| 409 | Ga0070704_100414770 | 3300005549 | Bacteria | 1152 |
| 410 | Ga0070704_100444089 | 3300005549 | Bacteria | 1115 |
| 411 | Ga0070704_100577289 | 3300005549 | Bacteria | 985 |
| 412 | Ga0070704_100772165 | 3300005549 | Bacteria | 857 |
| 413 | Ga0070704_101327164 | 3300005549 | Unclassified | 659 |
| 414 | Ga0070704_101416780 | 3300005549 | Bacteria | 638 |
| 415 | Ga0070704_102071170 | 3300005549 | Bacteria | 528 |
| 416 | Ga0068855_101792482 | 3300005563 | Bacteria | 624 |
| 417 | Ga0070664_100006932 | 3300005564 | Bacteria | 9130 |
| 418 | Ga0070664_100021515 | 3300005564 | Bacteria | 5316 |
| 419 | Ga0070664_100587983 | 3300005564 | Bacteria | 1032 |
| 420 | Ga0070664_100930181 | 3300005564 | Bacteria | 816 |
| 421 | Ga0070664_101495934 | 3300005564 | Bacteria | 639 |
| 422 | Ga0070664_101719250 | 3300005564 | Bacteria | 595 |
| 423 | Ga0070664_101920454 | 3300005564 | Bacteria | 562 |
| 424 | Ga0068857_100075415 | 3300005577 | Bacteria | 3007 |
| 425 | Ga0068857_100135256 | 3300005577 | Bacteria | 2225 |
| 426 | Ga0068857_100378849 | 3300005577 | Bacteria | 1313 |
| 427 | Ga0068857_100518418 | 3300005577 | Bacteria | 1120 |
| 428 | Ga0068857_100620944 | 3300005577 | Bacteria | 1023 |
| 429 | Ga0068857_100655754 | 3300005577 | Bacteria | 995 |
| 430 | Ga0068857_100967011 | 3300005577 | Bacteria | 819 |
| 431 | Ga0068857_102213938 | 3300005577 | Bacteria | 540 |
| 432 | Ga0068854_100588839 | 3300005578 | Bacteria | 948 |
| 433 | Ga0068854_100956536 | 3300005578 | Bacteria | 756 |
| 434 | Ga0068856_100854639 | 3300005614 | Bacteria | 929 |
| 435 | Ga0070702_101273778 | 3300005615 | Unclassified | 596 |
| 436 | Ga0070702_101491565 | 3300005615 | Unclassified | 556 |
| 437 | Ga0070702_101533741 | 3300005615 | Bacteria | 549 |
| 438 | Ga0068852_100296798 | 3300005616 | Bacteria | 1563 |
| 439 | Ga0068852_101304063 | 3300005616 | Unclassified | 748 |
| 440 | Ga0068852_101699304 | 3300005616 | Bacteria | 654 |
| 441 | Ga0068852_102696191 | 3300005616 | Unclassified | 516 |
| 442 | Ga0068859_100094444 | 3300005617 | Bacteria | 3043 |
| 443 | Ga0068859_100163281 | 3300005617 | Bacteria | 2306 |
| 444 | Ga0068859_100177615 | 3300005617 | Bacteria | 2211 |
| 445 | Ga0068859_100215905 | 3300005617 | Bacteria | 2005 |
| 446 | Ga0068859_100297773 | 3300005617 | Bacteria | 1706 |
| 447 | Ga0068859_100363417 | 3300005617 | Bacteria | 1543 |
| 448 | Ga0068859_100398784 | 3300005617 | Bacteria | 1472 |
| 449 | Ga0068859_100555295 | 3300005617 | Bacteria | 1243 |
| 450 | Ga0068859_100574147 | 3300005617 | Bacteria | 1221 |
| 451 | Ga0068859_100577590 | 3300005617 | Bacteria | 1218 |
| 452 | Ga0068859_101045159 | 3300005617 | Unclassified | 898 |
| 453 | Ga0068859_101280639 | 3300005617 | Bacteria | 808 |
| 454 | Ga0068859_101789123 | 3300005617 | Unclassified | 679 |
| 455 | Ga0068859_102217852 | 3300005617 | Bacteria | 606 |
| 456 | Ga0068859_102858845 | 3300005617 | Unclassified | 529 |
| 457 | Ga0068864_100017656 | 3300005618 | Bacteria | 5950 |
| 458 | Ga0068864_100025389 | 3300005618 | Bacteria | 4989 |
| 459 | Ga0068864_100101893 | 3300005618 | Bacteria | 2547 |
| 460 | Ga0068864_100177479 | 3300005618 | Bacteria | 1945 |
| 461 | Ga0068864_100565157 | 3300005618 | Bacteria | 1101 |
| 462 | Ga0068864_100691413 | 3300005618 | Bacteria | 996 |
| 463 | Ga0068864_100721607 | 3300005618 | Bacteria | 975 |
| 464 | Ga0068864_101455232 | 3300005618 | Unclassified | 688 |
| 465 | Ga0068866_10049465 | 3300005718 | Bacteria | 2130 |
| 466 | Ga0068866_10421328 | 3300005718 | Bacteria | 866 |
| 467 | Ga0068866_10855560 | 3300005718 | Unclassified | 636 |
| 468 | Ga0068861_100007625 | 3300005719 | Bacteria | 7426 |
| 469 | Ga0068861_100051559 | 3300005719 | Bacteria | 3124 |
| 470 | Ga0068861_100099472 | 3300005719 | Bacteria | 2310 |
| 471 | Ga0068861_100154579 | 3300005719 | Bacteria | 1885 |
| 472 | Ga0068861_100272989 | 3300005719 | Bacteria | 1453 |
| 473 | Ga0068861_100307769 | 3300005719 | Bacteria | 1375 |
| 474 | Ga0068861_100589657 | 3300005719 | Bacteria | 1018 |
| 475 | Ga0068861_100613853 | 3300005719 | Bacteria | 1000 |
| 476 | Ga0068861_100616500 | 3300005719 | Bacteria | 998 |
| 477 | Ga0068861_100717886 | 3300005719 | Bacteria | 930 |
| 478 | Ga0068861_100905169 | 3300005719 | Unclassified | 836 |
| 479 | Ga0068861_101701625 | 3300005719 | Bacteria | 624 |
| 480 | Ga0068851_10147928 | 3300005834 | Bacteria | 1282 |
| 481 | Ga0068851_10450713 | 3300005834 | Bacteria | 765 |
| 482 | Ga0068870_10046546 | 3300005840 | Bacteria | 2275 |
| 483 | Ga0068870_10092027 | 3300005840 | Bacteria | 1698 |
| 484 | Ga0068870_10186931 | 3300005840 | Bacteria | 1247 |
| 485 | Ga0068870_10209083 | 3300005840 | Bacteria | 1187 |
| 486 | Ga0068870_10221388 | 3300005840 | Bacteria | 1159 |
| 487 | Ga0068870_10365982 | 3300005840 | Bacteria | 929 |
| 488 | Ga0068870_10948933 | 3300005840 | Bacteria | 610 |
| 489 | Ga0068870_10975874 | 3300005840 | Unclassified | 603 |
| 490 | Ga0068863_100098441 | 3300005841 | Bacteria | 2778 |
| 491 | Ga0068863_100172370 | 3300005841 | Bacteria | 2076 |
| 492 | Ga0068863_100215365 | 3300005841 | Bacteria | 1850 |
| 493 | Ga0068863_100767052 | 3300005841 | Bacteria | 961 |
| 494 | Ga0068863_100957671 | 3300005841 | Bacteria | 857 |
| 495 | Ga0068863_100968778 | 3300005841 | Bacteria | 853 |
| 496 | Ga0068863_102705671 | 3300005841 | Unclassified | 505 |
| 497 | Ga0068858_100067583 | 3300005842 | Bacteria | 3311 |
| 498 | Ga0068858_100315846 | 3300005842 | Bacteria | 1492 |
| 499 | Ga0068858_101767450 | 3300005842 | Unclassified | 611 |
| 500 | Ga0068860_100051780 | 3300005843 | Bacteria | 3905 |
| 501 | Ga0068860_100100645 | 3300005843 | Bacteria | 2757 |
| 502 | Ga0068860_100540325 | 3300005843 | Bacteria | 1167 |
| 503 | Ga0068860_100614609 | 3300005843 | Bacteria | 1093 |
| 504 | Ga0068860_100905906 | 3300005843 | Bacteria | 898 |
| 505 | Ga0068862_100005694 | 3300005844 | Bacteria | 10395 |
| 506 | Ga0068862_100028432 | 3300005844 | Bacteria | 4708 |
| 507 | Ga0068862_100099165 | 3300005844 | Bacteria | 2546 |
| 508 | Ga0068862_100105656 | 3300005844 | Bacteria | 2468 |
| 509 | Ga0068862_100176656 | 3300005844 | Bacteria | 1914 |
| 510 | Ga0068862_100210268 | 3300005844 | Bacteria | 1758 |
| 511 | Ga0068862_100245086 | 3300005844 | Bacteria | 1631 |
| 512 | Ga0068862_100323771 | 3300005844 | Bacteria | 1423 |
| 513 | Ga0068862_100379175 | 3300005844 | Bacteria | 1319 |
| 514 | Ga0068862_100986130 | 3300005844 | Bacteria | 833 |
| 515 | Ga0068862_101089333 | 3300005844 | Bacteria | 794 |
| 516 | Ga0068862_101141762 | 3300005844 | Unclassified | 776 |
| 517 | Ga0068862_101569489 | 3300005844 | Unclassified | 665 |
| 518 | Ga0081539_10093982 | 3300005985 | Bacteria | 1543 |
| 519 | Ga0081539_10120194 | 3300005985 | Bacteria | 1306 |
| 520 | Ga0081539_10343290 | 3300005985 | Bacteria | 629 |
| 521 | Ga0075364_10395594 | 3300006051 | Bacteria | 943 |
| 522 | Ga0075432_10083665 | 3300006058 | Bacteria | 1160 |
| 523 | Ga0075432_10333510 | 3300006058 | Unclassified | 638 |
| 524 | Ga0075362_10315248 | 3300006177 | Bacteria | 778 |
| 525 | Ga0075367_10153789 | 3300006178 | Bacteria | 1428 |
| 526 | Ga0075367_10279071 | 3300006178 | Bacteria | 1050 |
| 527 | Ga0075369_10176581 | 3300006186 | Bacteria | 982 |
| 528 | Ga0075366_10750146 | 3300006195 | Bacteria | 607 |
| 529 | Ga0097621_100041201 | 3300006237 | Bacteria | 3716 |
| 530 | Ga0097621_100245466 | 3300006237 | Bacteria | 1566 |
| 531 | Ga0097621_100558140 | 3300006237 | Bacteria | 1043 |
| 532 | Ga0097621_100670793 | 3300006237 | Bacteria | 953 |
| 533 | Ga0097621_100720569 | 3300006237 | Bacteria | 920 |
| 534 | Ga0097621_100758682 | 3300006237 | Unclassified | 896 |
| 535 | Ga0097621_100918877 | 3300006237 | Bacteria | 816 |
| 536 | Ga0097621_101147201 | 3300006237 | Bacteria | 731 |
| 537 | Ga0068871_100138289 | 3300006358 | Bacteria | 2070 |
| 538 | Ga0068871_100245321 | 3300006358 | Bacteria | 1559 |
| 539 | Ga0068871_100386821 | 3300006358 | Bacteria | 1244 |
| 540 | Ga0068871_100387839 | 3300006358 | Bacteria | 1242 |
| 541 | Ga0068871_100725337 | 3300006358 | Bacteria | 912 |
| 542 | Ga0068871_100831205 | 3300006358 | Bacteria | 853 |
| 543 | Ga0068871_101501525 | 3300006358 | Bacteria | 637 |
| 544 | Ga0068871_102384753 | 3300006358 | Bacteria | 505 |
| 545 | Ga0075428_100050644 | 3300006844 | Bacteria | 4554 |
| 546 | Ga0075428_100064389 | 3300006844 | Bacteria | 4014 |
| 547 | Ga0075428_100482558 | 3300006844 | Bacteria | 1327 |
| 548 | Ga0075428_100507780 | 3300006844 | Bacteria | 1290 |
| 549 | Ga0075428_100903384 | 3300006844 | Bacteria | 937 |
| 550 | Ga0075428_101644042 | 3300006844 | Bacteria | 671 |
| 551 | Ga0075428_101805209 | 3300006844 | Unclassified | 636 |
| 552 | Ga0075428_102741668 | 3300006844 | Bacteria | 502 |
| 553 | Ga0075430_100051093 | 3300006846 | Bacteria | 3485 |
| 554 | Ga0075430_100349244 | 3300006846 | Bacteria | 1222 |
| 555 | Ga0075430_100435622 | 3300006846 | Bacteria | 1082 |
| 556 | Ga0075430_101000877 | 3300006846 | Unclassified | 689 |
| 557 | Ga0075430_101109444 | 3300006846 | Bacteria | 652 |
| 558 | Ga0075431_100342053 | 3300006847 | Bacteria | 1505 |
| 559 | Ga0075431_100358741 | 3300006847 | Bacteria | 1464 |
| 560 | Ga0075431_100653711 | 3300006847 | Bacteria | 1031 |
| 561 | Ga0075431_100878662 | 3300006847 | Bacteria | 867 |
| 562 | Ga0075431_101243465 | 3300006847 | Unclassified | 706 |
| 563 | Ga0075431_101257139 | 3300006847 | Bacteria | 702 |
| 564 | Ga0075431_101389606 | 3300006847 | Bacteria | 662 |
| 565 | Ga0075431_101424798 | 3300006847 | Bacteria | 652 |
| 566 | Ga0075431_101624564 | 3300006847 | Unclassified | 604 |
| 567 | Ga0075433_10031425 | 3300006852 | Bacteria | 4539 |
| 568 | Ga0075433_10049363 | 3300006852 | Bacteria | 3661 |
| 569 | Ga0075433_10094661 | 3300006852 | Bacteria | 2643 |
| 570 | Ga0075433_10513948 | 3300006852 | Bacteria | 1054 |
| 571 | Ga0075433_11251270 | 3300006852 | Bacteria | 644 |
| 572 | Ga0075434_100009524 | 3300006871 | Bacteria | 9062 |
| 573 | Ga0075434_100041869 | 3300006871 | Bacteria | 4539 |
| 574 | Ga0075434_100051377 | 3300006871 | Bacteria | 4097 |
| 575 | Ga0075434_100178264 | 3300006871 | Bacteria | 2145 |
| 576 | Ga0075434_100479684 | 3300006871 | Bacteria | 1265 |
| 577 | Ga0075434_100486030 | 3300006871 | Bacteria | 1256 |
| 578 | Ga0075434_100861886 | 3300006871 | Unclassified | 921 |
| 579 | Ga0075434_100911247 | 3300006871 | Bacteria | 894 |
| 580 | Ga0075429_100096662 | 3300006880 | Bacteria | 2577 |
| 581 | Ga0075429_100103496 | 3300006880 | Bacteria | 2486 |
| 582 | Ga0075429_100241379 | 3300006880 | Bacteria | 1582 |
| 583 | Ga0075429_100417003 | 3300006880 | Bacteria | 1176 |
| 584 | Ga0075429_100553917 | 3300006880 | Bacteria | 1008 |
| 585 | Ga0075429_100623424 | 3300006880 | Bacteria | 945 |
| 586 | Ga0075429_100902988 | 3300006880 | Bacteria | 773 |
| 587 | Ga0075429_101100159 | 3300006880 | Bacteria | 694 |
| 588 | Ga0075429_101143629 | 3300006880 | Archaea | 680 |
| 589 | Ga0068865_100029531 | 3300006881 | Bacteria | 3639 |
| 590 | Ga0068865_100082989 | 3300006881 | Bacteria | 2305 |
| 591 | Ga0068865_100211485 | 3300006881 | Bacteria | 1512 |
| 592 | Ga0068865_100249052 | 3300006881 | Bacteria | 1402 |
| 593 | Ga0068865_100390130 | 3300006881 | Bacteria | 1138 |
| 594 | Ga0068865_100545437 | 3300006881 | Bacteria | 973 |
| 595 | Ga0068865_100640299 | 3300006881 | Bacteria | 902 |
| 596 | Ga0068865_101397575 | 3300006881 | Bacteria | 625 |
| 597 | Ga0097620_100094443 | 3300006931 | Bacteria | 3043 |
| 598 | Ga0097620_100163282 | 3300006931 | Bacteria | 2306 |
| 599 | Ga0097620_100177608 | 3300006931 | Bacteria | 2211 |
| 600 | Ga0097620_100215906 | 3300006931 | Bacteria | 2005 |
| 601 | Ga0097620_100297786 | 3300006931 | Bacteria | 1706 |
| 602 | Ga0097620_100363411 | 3300006931 | Bacteria | 1543 |
| 603 | Ga0097620_100398814 | 3300006931 | Bacteria | 1472 |
| 604 | Ga0097620_100555295 | 3300006931 | Bacteria | 1243 |
| 605 | Ga0097620_100574117 | 3300006931 | Bacteria | 1221 |
| 606 | Ga0097620_100577572 | 3300006931 | Bacteria | 1218 |
| 607 | Ga0097620_101045166 | 3300006931 | Unclassified | 898 |
| 608 | Ga0097620_101280705 | 3300006931 | Bacteria | 808 |
| 609 | Ga0097620_101789156 | 3300006931 | Unclassified | 679 |
| 610 | Ga0097620_102217736 | 3300006931 | Bacteria | 606 |
| 611 | Ga0097620_102859523 | 3300006931 | Unclassified | 529 |
| 612 | Ga0075435_100030022 | 3300007076 | Bacteria | 4271 |
| 613 | Ga0075435_100035522 | 3300007076 | Bacteria | 3955 |
| 614 | Ga0075435_100219317 | 3300007076 | Bacteria | 1615 |
| 615 | Ga0075435_100705494 | 3300007076 | Bacteria | 877 |
| 616 | Ga0075435_100984479 | 3300007076 | Bacteria | 736 |
| 617 | Ga0105251_10129059 | 3300009011 | Bacteria | 1146 |
| 618 | Ga0105240_10860696 | 3300009093 | Bacteria | 978 |
| 619 | Ga0111539_10000022 | 3300009094 | Bacteria | 240838 |
| 620 | Ga0111539_10011587 | 3300009094 | Bacteria | 11064 |
| 621 | Ga0111539_10016960 | 3300009094 | Bacteria | 9014 |
| 622 | Ga0111539_10020412 | 3300009094 | Bacteria | 8159 |
| 623 | Ga0111539_10038949 | 3300009094 | Bacteria | 5733 |
| 624 | Ga0111539_10060616 | 3300009094 | Bacteria | 4484 |
| 625 | Ga0111539_10093953 | 3300009094 | Bacteria | 3523 |
| 626 | Ga0111539_10094028 | 3300009094 | Bacteria | 3521 |
| 627 | Ga0111539_10096365 | 3300009094 | Bacteria | 3475 |
| 628 | Ga0111539_10124915 | 3300009094 | Bacteria | 3016 |
| 629 | Ga0111539_10186761 | 3300009094 | Bacteria | 2420 |
| 630 | Ga0111539_10343329 | 3300009094 | Bacteria | 1738 |
| 631 | Ga0111539_10356252 | 3300009094 | Bacteria | 1703 |
| 632 | Ga0111539_10625895 | 3300009094 | Bacteria | 1253 |
| 633 | Ga0111539_10669866 | 3300009094 | Bacteria | 1208 |
| 634 | Ga0111539_11237906 | 3300009094 | Bacteria | 867 |
| 635 | Ga0111539_11561240 | 3300009094 | Unclassified | 765 |
| 636 | Ga0111539_11636433 | 3300009094 | Unclassified | 747 |
| 637 | Ga0105245_10534897 | 3300009098 | Unclassified | 1192 |
| 638 | Ga0105245_11774666 | 3300009098 | Bacteria | 670 |
| 639 | Ga0105245_12177127 | 3300009098 | Bacteria | 608 |
| 640 | Ga0105247_10491103 | 3300009101 | Unclassified | 893 |
| 641 | Ga0105247_10614382 | 3300009101 | Bacteria | 808 |
| 642 | Ga0114129_10000347 | 3300009147 | Bacteria | 53984 |
| 643 | Ga0114129_10099209 | 3300009147 | Bacteria | 4031 |
| 644 | Ga0114129_10112432 | 3300009147 | Bacteria | 3756 |
| 645 | Ga0114129_10127914 | 3300009147 | Bacteria | 3491 |
| 646 | Ga0114129_10155999 | 3300009147 | Bacteria | 3122 |
| 647 | Ga0114129_10335272 | 3300009147 | Bacteria | 2007 |
| 648 | Ga0114129_10365442 | 3300009147 | Bacteria | 1908 |
| 649 | Ga0114129_10570723 | 3300009147 | Bacteria | 1469 |
| 650 | Ga0114129_11333380 | 3300009147 | Bacteria | 888 |
| 651 | Ga0114129_12149301 | 3300009147 | Unclassified | 672 |
| 652 | Ga0114129_12289375 | 3300009147 | Unclassified | 649 |
| 653 | Ga0114129_12679517 | 3300009147 | Bacteria | 594 |
| 654 | Ga0114129_13167744 | 3300009147 | Bacteria | 536 |
| 655 | Ga0105243_10415087 | 3300009148 | Bacteria | 1254 |
| 656 | Ga0105243_10680075 | 3300009148 | Bacteria | 1001 |
| 657 | Ga0105243_10824662 | 3300009148 | Bacteria | 916 |
| 658 | Ga0105243_10851112 | 3300009148 | Bacteria | 903 |
| 659 | Ga0105243_11969759 | 3300009148 | Unclassified | 618 |
| 660 | Ga0105241_10551489 | 3300009174 | Bacteria | 1035 |
| 661 | Ga0105241_11181354 | 3300009174 | Bacteria | 724 |
| 662 | Ga0105241_12606581 | 3300009174 | Unclassified | 508 |
| 663 | Ga0105242_10017209 | 3300009176 | Bacteria | 5629 |
| 664 | Ga0105242_10233821 | 3300009176 | Bacteria | 1648 |
| 665 | Ga0105242_10541334 | 3300009176 | Bacteria | 1115 |
| 666 | Ga0105242_11159447 | 3300009176 | Bacteria | 790 |
| 667 | Ga0105242_12002415 | 3300009176 | Bacteria | 621 |
| 668 | Ga0105242_12170720 | 3300009176 | Unclassified | 600 |
| 669 | Ga0105242_12817721 | 3300009176 | Bacteria | 536 |
| 670 | Ga0105242_13043874 | 3300009176 | Bacteria | 519 |
| 671 | Ga0105248_10056636 | 3300009177 | Bacteria | 4398 |
| 672 | Ga0105248_10079088 | 3300009177 | Bacteria | 3695 |
| 673 | Ga0105248_10080672 | 3300009177 | Bacteria | 3657 |
| 674 | Ga0105248_10267172 | 3300009177 | Bacteria | 1926 |
| 675 | Ga0105248_10732259 | 3300009177 | Bacteria | 1116 |
| 676 | Ga0105248_11066436 | 3300009177 | Bacteria | 913 |
| 677 | Ga0105248_11068481 | 3300009177 | Bacteria | 912 |
| 678 | Ga0105248_11141015 | 3300009177 | Bacteria | 881 |
| 679 | Ga0105248_11429122 | 3300009177 | Bacteria | 783 |
| 680 | Ga0105248_11547317 | 3300009177 | Unclassified | 751 |
| 681 | Ga0105248_11691538 | 3300009177 | Bacteria | 717 |
| 682 | Ga0105248_12672212 | 3300009177 | Bacteria | 569 |
| 683 | Ga0105248_13092880 | 3300009177 | Unclassified | 530 |
| 684 | Ga0105248_13280198 | 3300009177 | Unclassified | 515 |
| 685 | Ga0105237_11682159 | 3300009545 | Unclassified | 642 |
| 686 | Ga0105238_10470717 | 3300009551 | Unclassified | 1255 |
| 687 | Ga0105238_10773601 | 3300009551 | Bacteria | 975 |
| 688 | Ga0105238_11049974 | 3300009551 | Bacteria | 836 |
| 689 | Ga0105238_11873331 | 3300009551 | Bacteria | 632 |
| 690 | Ga0105238_12077594 | 3300009551 | Bacteria | 602 |
| 691 | Ga0105249_10002497 | 3300009553 | Bacteria | 15920 |
| 692 | Ga0105249_10107564 | 3300009553 | Bacteria | 2632 |
| 693 | Ga0105249_10461379 | 3300009553 | Bacteria | 1310 |
| 694 | Ga0105249_10810041 | 3300009553 | Bacteria | 1001 |
| 695 | Ga0105249_11061096 | 3300009553 | Bacteria | 880 |
| 696 | Ga0105249_11090846 | 3300009553 | Bacteria | 868 |
| 697 | Ga0105249_11262717 | 3300009553 | Bacteria | 810 |
| 698 | Ga0105249_11526766 | 3300009553 | Bacteria | 740 |
| 699 | Ga0105249_12060926 | 3300009553 | Unclassified | 643 |
| 700 | Ga0105249_12522217 | 3300009553 | Bacteria | 586 |
| 701 | Ga0105249_12576532 | 3300009553 | Bacteria | 581 |
| 702 | Ga0105239_10307992 | 3300010375 | Bacteria | 1785 |
| 703 | Ga0105239_11117270 | 3300010375 | Bacteria | 907 |
| 704 | Ga0105246_10031115 | 3300011119 | Bacteria | 3529 |
| 705 | Ga0105246_10150505 | 3300011119 | Bacteria | 1761 |
| 706 | Ga0105246_10217071 | 3300011119 | Bacteria | 1497 |
| 707 | Ga0105246_10480845 | 3300011119 | Bacteria | 1051 |
| 708 | Ga0105246_11982578 | 3300011119 | Unclassified | 561 |
| 709 | Ga0157320_1021337 | 3300012481 | Unclassified | 593 |
| 710 | Ga0157371_11405210 | 3300013102 | Unclassified | 542 |
| 711 | Ga0157370_10585481 | 3300013104 | Bacteria | 1022 |
| 712 | Ga0157370_11955614 | 3300013104 | Unclassified | 526 |
| 713 | Ga0157374_10769752 | 3300013296 | Bacteria | 978 |
| 714 | Ga0157374_11494180 | 3300013296 | Bacteria | 699 |
| 715 | Ga0157374_12782376 | 3300013296 | Unclassified | 517 |
| 716 | Ga0157378_10041397 | 3300013297 | Bacteria | 4086 |
| 717 | Ga0157378_10282027 | 3300013297 | Bacteria | 1602 |
| 718 | Ga0157378_10520558 | 3300013297 | Bacteria | 1191 |
| 719 | Ga0157378_11155418 | 3300013297 | Bacteria | 813 |
| 720 | Ga0157378_11169186 | 3300013297 | Bacteria | 808 |
| 721 | Ga0157378_11454617 | 3300013297 | Bacteria | 729 |
| 722 | Ga0157378_11707885 | 3300013297 | Bacteria | 677 |
| 723 | Ga0163162_10110629 | 3300013306 | Bacteria | 2844 |
| 724 | Ga0163162_10241507 | 3300013306 | Bacteria | 1937 |
| 725 | Ga0163162_10555372 | 3300013306 | Bacteria | 1276 |
| 726 | Ga0163162_10560668 | 3300013306 | Bacteria | 1270 |
| 727 | Ga0163162_10681974 | 3300013306 | Bacteria | 1150 |
| 728 | Ga0163162_13130520 | 3300013306 | Bacteria | 531 |
| 729 | Ga0157372_10472557 | 3300013307 | Bacteria | 1462 |
| 730 | Ga0157372_12268506 | 3300013307 | Unclassified | 623 |
| 731 | Ga0157372_12691611 | 3300013307 | Unclassified | 571 |
| 732 | Ga0157375_10045218 | 3300013308 | Bacteria | 4285 |
| 733 | Ga0157375_10108054 | 3300013308 | Bacteria | 2876 |
| 734 | Ga0157375_10368902 | 3300013308 | Bacteria | 1602 |
| 735 | Ga0157375_10459187 | 3300013308 | Bacteria | 1439 |
| 736 | Ga0157375_10849380 | 3300013308 | Bacteria | 1059 |
| 737 | Ga0157375_11382986 | 3300013308 | Unclassified | 829 |
| 738 | Ga0157375_11386560 | 3300013308 | Bacteria | 828 |
| 739 | Ga0157375_11843593 | 3300013308 | Bacteria | 717 |
| 740 | Ga0163163_10139158 | 3300014325 | Bacteria | 2469 |
| 741 | Ga0163163_10151677 | 3300014325 | Bacteria | 2361 |
| 742 | Ga0163163_10151697 | 3300014325 | Bacteria | 2361 |
| 743 | Ga0163163_10280293 | 3300014325 | Bacteria | 1718 |
| 744 | Ga0163163_10297928 | 3300014325 | Bacteria | 1665 |
| 745 | Ga0163163_10413866 | 3300014325 | Bacteria | 1407 |
| 746 | Ga0163163_10417503 | 3300014325 | Bacteria | 1400 |
| 747 | Ga0163163_10580692 | 3300014325 | Bacteria | 1184 |
| 748 | Ga0163163_11440715 | 3300014325 | Unclassified | 750 |
| 749 | Ga0163163_12068736 | 3300014325 | Unclassified | 629 |
| 750 | Ga0163163_12206948 | 3300014325 | Bacteria | 610 |
| 751 | Ga0157380_10073014 | 3300014326 | Bacteria | 2781 |
| 752 | Ga0157380_10097483 | 3300014326 | Bacteria | 2440 |
| 753 | Ga0157380_10100236 | 3300014326 | Bacteria | 2411 |
| 754 | Ga0157380_10159144 | 3300014326 | Bacteria | 1961 |
| 755 | Ga0157380_10196477 | 3300014326 | Bacteria | 1786 |
| 756 | Ga0157380_10211826 | 3300014326 | Bacteria | 1727 |
| 757 | Ga0157380_10255335 | 3300014326 | Bacteria | 1589 |
| 758 | Ga0157380_10384754 | 3300014326 | Bacteria | 1325 |
| 759 | Ga0157380_10523056 | 3300014326 | Bacteria | 1157 |
| 760 | Ga0157380_10674012 | 3300014326 | Bacteria | 1035 |
| 761 | Ga0157380_11180447 | 3300014326 | Bacteria | 808 |
| 762 | Ga0157380_12017076 | 3300014326 | Bacteria | 639 |
| 763 | Ga0157380_12864853 | 3300014326 | Bacteria | 549 |
| 764 | Ga0157377_10036942 | 3300014745 | Bacteria | 2689 |
| 765 | Ga0157377_10059630 | 3300014745 | Bacteria | 2176 |
| 766 | Ga0157377_10063624 | 3300014745 | Bacteria | 2113 |
| 767 | Ga0157377_10157856 | 3300014745 | Bacteria | 1408 |
| 768 | Ga0157377_10161812 | 3300014745 | Bacteria | 1393 |
| 769 | Ga0157377_10396167 | 3300014745 | Bacteria | 939 |
| 770 | Ga0157377_10510770 | 3300014745 | Bacteria | 842 |
| 771 | Ga0157377_10800274 | 3300014745 | Bacteria | 695 |
| 772 | Ga0157379_10686136 | 3300014968 | Bacteria | 961 |
| 773 | Ga0157379_11639639 | 3300014968 | Bacteria | 629 |
| 774 | Ga0157379_11807288 | 3300014968 | Bacteria | 601 |
| 775 | Ga0157376_10342775 | 3300014969 | Bacteria | 1428 |
| 776 | Ga0157376_10342878 | 3300014969 | Bacteria | 1427 |
| 777 | Ga0157376_11944284 | 3300014969 | Bacteria | 625 |
| 778 | Ga0157376_12347706 | 3300014969 | Unclassified | 573 |
| 779 | Ga0163161_10043217 | 3300017792 | Bacteria | 3244 |
| 780 | Ga0163161_10089562 | 3300017792 | Bacteria | 2276 |
| 781 | Ga0163161_10256956 | 3300017792 | Bacteria | 1363 |
| 782 | Ga0163161_10453501 | 3300017792 | Bacteria | 1037 |
| 783 | Ga0163161_11165475 | 3300017792 | Unclassified | 665 |
| 784 | Ga0163161_11221940 | 3300017792 | Unclassified | 650 |
| 785 | Ga0163161_11735508 | 3300017792 | Bacteria | 554 |
| 786 | Ga0207666_1022593 | 3300025271 | Bacteria | 933 |
| 787 | Ga0207666_1029636 | 3300025271 | Bacteria | 835 |
| 788 | Ga0207697_10061477 | 3300025315 | Bacteria | 1563 |
| 789 | Ga0207697_10123798 | 3300025315 | Bacteria | 1114 |
| 790 | Ga0207697_10458423 | 3300025315 | Bacteria | 565 |
| 791 | Ga0207656_10042282 | 3300025321 | Bacteria | 1939 |
| 792 | Ga0207656_10173683 | 3300025321 | Bacteria | 1031 |
| 793 | Ga0207653_10047496 | 3300025885 | Bacteria | 1422 |
| 794 | Ga0207682_10008298 | 3300025893 | Bacteria | 4112 |
| 795 | Ga0207682_10022877 | 3300025893 | Bacteria | 2465 |
| 796 | Ga0207682_10032433 | 3300025893 | Bacteria | 2100 |
| 797 | Ga0207682_10094660 | 3300025893 | Bacteria | 1299 |
| 798 | Ga0207682_10175976 | 3300025893 | Bacteria | 975 |
| 799 | Ga0207682_10222777 | 3300025893 | Bacteria | 873 |
| 800 | Ga0207642_10007429 | 3300025899 | Bacteria | 3704 |
| 801 | Ga0207642_10065961 | 3300025899 | Bacteria | 1703 |
| 802 | Ga0207642_10826821 | 3300025899 | Bacteria | 590 |
| 803 | Ga0207642_11072030 | 3300025899 | Bacteria | 520 |
| 804 | Ga0207710_10550786 | 3300025900 | Unclassified | 601 |
| 805 | Ga0207710_10648649 | 3300025900 | Bacteria | 553 |
| 806 | Ga0207688_10021891 | 3300025901 | Bacteria | 3496 |
| 807 | Ga0207688_10042125 | 3300025901 | Bacteria | 2541 |
| 808 | Ga0207688_10171731 | 3300025901 | Bacteria | 1289 |
| 809 | Ga0207688_10174485 | 3300025901 | Bacteria | 1279 |
| 810 | Ga0207688_10387914 | 3300025901 | Bacteria | 865 |
| 811 | Ga0207680_10036371 | 3300025903 | Bacteria | 2835 |
| 812 | Ga0207680_10404310 | 3300025903 | Unclassified | 965 |
| 813 | Ga0207680_10678445 | 3300025903 | Bacteria | 738 |
| 814 | Ga0207680_11096015 | 3300025903 | Unclassified | 569 |
| 815 | Ga0207647_10035432 | 3300025904 | Bacteria | 3180 |
| 816 | Ga0207647_10174709 | 3300025904 | Bacteria | 1250 |
| 817 | Ga0207647_10320023 | 3300025904 | Bacteria | 881 |
| 818 | Ga0207647_10711538 | 3300025904 | Bacteria | 546 |
| 819 | Ga0207645_10006334 | 3300025907 | Bacteria | 8508 |
| 820 | Ga0207645_10041691 | 3300025907 | Bacteria | 2937 |
| 821 | Ga0207645_10105648 | 3300025907 | Bacteria | 1820 |
| 822 | Ga0207645_10130873 | 3300025907 | Bacteria | 1633 |
| 823 | Ga0207645_10238486 | 3300025907 | Bacteria | 1201 |
| 824 | Ga0207643_10000779 | 3300025908 | Bacteria | 19421 |
| 825 | Ga0207643_10006374 | 3300025908 | Bacteria | 6319 |
| 826 | Ga0207643_10019206 | 3300025908 | Bacteria | 3744 |
| 827 | Ga0207643_10067697 | 3300025908 | Bacteria | 2050 |
| 828 | Ga0207643_10117620 | 3300025908 | Bacteria | 1571 |
| 829 | Ga0207643_10271794 | 3300025908 | Bacteria | 1049 |
| 830 | Ga0207643_10451009 | 3300025908 | Bacteria | 818 |
| 831 | Ga0207643_10490467 | 3300025908 | Bacteria | 785 |
| 832 | Ga0207643_11066764 | 3300025908 | Bacteria | 522 |
| 833 | Ga0207684_10119840 | 3300025910 | Bacteria | 2256 |
| 834 | Ga0207684_10266249 | 3300025910 | Bacteria | 1479 |
| 835 | Ga0207684_10270772 | 3300025910 | Bacteria | 1465 |
| 836 | Ga0207684_10492828 | 3300025910 | Bacteria | 1051 |
| 837 | Ga0207684_10826961 | 3300025910 | Bacteria | 782 |
| 838 | Ga0207654_11014782 | 3300025911 | Bacteria | 604 |
| 839 | Ga0207707_10119861 | 3300025912 | Bacteria | 2300 |
| 840 | Ga0207707_11647363 | 3300025912 | Unclassified | 504 |
| 841 | Ga0207695_11592089 | 3300025913 | Bacteria | 534 |
| 842 | Ga0207663_10068407 | 3300025916 | Bacteria | 2280 |
| 843 | Ga0207660_10211528 | 3300025917 | Bacteria | 1519 |
| 844 | Ga0207660_10398144 | 3300025917 | Bacteria | 1109 |
| 845 | Ga0207662_10024681 | 3300025918 | Bacteria | 3459 |
| 846 | Ga0207662_10026096 | 3300025918 | Bacteria | 3369 |
| 847 | Ga0207662_10026380 | 3300025918 | Bacteria | 3351 |
| 848 | Ga0207662_10083025 | 3300025918 | Bacteria | 1958 |
| 849 | Ga0207662_10111905 | 3300025918 | Bacteria | 1703 |
| 850 | Ga0207662_10113337 | 3300025918 | Bacteria | 1693 |
| 851 | Ga0207662_10146245 | 3300025918 | Bacteria | 1500 |
| 852 | Ga0207662_10780637 | 3300025918 | Bacteria | 673 |
| 853 | Ga0207657_10287679 | 3300025919 | Bacteria | 1304 |
| 854 | Ga0207657_11123370 | 3300025919 | Bacteria | 600 |
| 855 | Ga0207649_10202158 | 3300025920 | Bacteria | 1404 |
| 856 | Ga0207649_10207324 | 3300025920 | Bacteria | 1388 |
| 857 | Ga0207649_10298647 | 3300025920 | Bacteria | 1177 |
| 858 | Ga0207649_11028301 | 3300025920 | Bacteria | 649 |
| 859 | Ga0207649_11323790 | 3300025920 | Bacteria | 570 |
| 860 | Ga0207652_10632478 | 3300025921 | Unclassified | 958 |
| 861 | Ga0207652_11294357 | 3300025921 | Unclassified | 632 |
| 862 | Ga0207646_10098457 | 3300025922 | Bacteria | 2621 |
| 863 | Ga0207646_10168958 | 3300025922 | Bacteria | 1975 |
| 864 | Ga0207646_10408629 | 3300025922 | Bacteria | 1226 |
| 865 | Ga0207646_11014694 | 3300025922 | Bacteria | 733 |
| 866 | Ga0207681_10009786 | 3300025923 | Bacteria | 5864 |
| 867 | Ga0207681_10018531 | 3300025923 | Bacteria | 4386 |
| 868 | Ga0207681_10033636 | 3300025923 | Bacteria | 3363 |
| 869 | Ga0207681_10106052 | 3300025923 | Bacteria | 2035 |
| 870 | Ga0207681_10121710 | 3300025923 | Bacteria | 1914 |
| 871 | Ga0207681_10242856 | 3300025923 | Bacteria | 1402 |
| 872 | Ga0207681_10281990 | 3300025923 | Bacteria | 1308 |
| 873 | Ga0207681_10339095 | 3300025923 | Bacteria | 1200 |
| 874 | Ga0207681_10371818 | 3300025923 | Bacteria | 1149 |
| 875 | Ga0207681_11512156 | 3300025923 | Unclassified | 563 |
| 876 | Ga0207681_11693186 | 3300025923 | Unclassified | 528 |
| 877 | Ga0207694_10394504 | 3300025924 | Bacteria | 1150 |
| 878 | Ga0207694_10524476 | 3300025924 | Bacteria | 993 |
| 879 | Ga0207650_10016401 | 3300025925 | Bacteria | 5177 |
| 880 | Ga0207650_10022979 | 3300025925 | Bacteria | 4418 |
| 881 | Ga0207650_10049788 | 3300025925 | Bacteria | 3095 |
| 882 | Ga0207650_10065531 | 3300025925 | Bacteria | 2723 |
| 883 | Ga0207650_10075185 | 3300025925 | Bacteria | 2548 |
| 884 | Ga0207650_10096722 | 3300025925 | Bacteria | 2265 |
| 885 | Ga0207650_10145737 | 3300025925 | Bacteria | 1865 |
| 886 | Ga0207650_10201161 | 3300025925 | Bacteria | 1596 |
| 887 | Ga0207650_10225381 | 3300025925 | Bacteria | 1510 |
| 888 | Ga0207650_10266136 | 3300025925 | Bacteria | 1392 |
| 889 | Ga0207650_10272464 | 3300025925 | Bacteria | 1376 |
| 890 | Ga0207650_10514616 | 3300025925 | Bacteria | 1001 |
| 891 | Ga0207650_10721752 | 3300025925 | Bacteria | 842 |
| 892 | Ga0207650_11469697 | 3300025925 | Bacteria | 579 |
| 893 | Ga0207659_10008566 | 3300025926 | Bacteria | 6358 |
| 894 | Ga0207659_10016498 | 3300025926 | Bacteria | 4807 |
| 895 | Ga0207659_10019803 | 3300025926 | Bacteria | 4436 |
| 896 | Ga0207659_10024682 | 3300025926 | Bacteria | 4031 |
| 897 | Ga0207659_10036598 | 3300025926 | Bacteria | 3401 |
| 898 | Ga0207659_10052678 | 3300025926 | Bacteria | 2900 |
| 899 | Ga0207659_10057590 | 3300025926 | Bacteria | 2787 |
| 900 | Ga0207659_10089981 | 3300025926 | Bacteria | 2290 |
| 901 | Ga0207659_10099974 | 3300025926 | Bacteria | 2185 |
| 902 | Ga0207659_10118008 | 3300025926 | Bacteria | 2029 |
| 903 | Ga0207659_10145019 | 3300025926 | Bacteria | 1848 |
| 904 | Ga0207659_10179141 | 3300025926 | Bacteria | 1678 |
| 905 | Ga0207659_10255341 | 3300025926 | Bacteria | 1424 |
| 906 | Ga0207659_10289889 | 3300025926 | Bacteria | 1341 |
| 907 | Ga0207659_10565633 | 3300025926 | Bacteria | 967 |
| 908 | Ga0207659_11122612 | 3300025926 | Bacteria | 676 |
| 909 | Ga0207659_11453423 | 3300025926 | Bacteria | 587 |
| 910 | Ga0207687_10152201 | 3300025927 | Bacteria | 1766 |
| 911 | Ga0207687_10887121 | 3300025927 | Bacteria | 763 |
| 912 | Ga0207664_10051260 | 3300025929 | Bacteria | 3258 |
| 913 | Ga0207644_10007454 | 3300025931 | Bacteria | 7134 |
| 914 | Ga0207644_10124374 | 3300025931 | Bacteria | 1967 |
| 915 | Ga0207644_10493688 | 3300025931 | Bacteria | 1009 |
| 916 | Ga0207644_10523107 | 3300025931 | Bacteria | 980 |
| 917 | Ga0207644_10567850 | 3300025931 | Bacteria | 940 |
| 918 | Ga0207644_10808070 | 3300025931 | Bacteria | 784 |
| 919 | Ga0207690_10380451 | 3300025932 | Bacteria | 1122 |
| 920 | Ga0207690_10406292 | 3300025932 | Bacteria | 1087 |
| 921 | Ga0207690_10531846 | 3300025932 | Bacteria | 954 |
| 922 | Ga0207706_10054050 | 3300025933 | Bacteria | 3545 |
| 923 | Ga0207706_10065085 | 3300025933 | Bacteria | 3210 |
| 924 | Ga0207706_10117070 | 3300025933 | Bacteria | 2344 |
| 925 | Ga0207706_10274212 | 3300025933 | Bacteria | 1472 |
| 926 | Ga0207706_10347113 | 3300025933 | Bacteria | 1291 |
| 927 | Ga0207706_10458203 | 3300025933 | Bacteria | 1103 |
| 928 | Ga0207706_10572318 | 3300025933 | Bacteria | 971 |
| 929 | Ga0207706_10655850 | 3300025933 | Bacteria | 898 |
| 930 | Ga0207706_10746583 | 3300025933 | Bacteria | 834 |
| 931 | Ga0207686_10975502 | 3300025934 | Unclassified | 687 |
| 932 | Ga0207686_10977123 | 3300025934 | Unclassified | 686 |
| 933 | Ga0207686_11273401 | 3300025934 | Unclassified | 603 |
| 934 | Ga0207709_10574696 | 3300025935 | Bacteria | 889 |
| 935 | Ga0207709_11122363 | 3300025935 | Unclassified | 646 |
| 936 | Ga0207709_11210150 | 3300025935 | Bacteria | 623 |
| 937 | Ga0207670_10028280 | 3300025936 | Bacteria | 3557 |
| 938 | Ga0207670_10095121 | 3300025936 | Bacteria | 2115 |
| 939 | Ga0207670_10105701 | 3300025936 | Bacteria | 2018 |
| 940 | Ga0207670_10155151 | 3300025936 | Bacteria | 1703 |
| 941 | Ga0207670_10192203 | 3300025936 | Bacteria | 1545 |
| 942 | Ga0207670_10218459 | 3300025936 | Bacteria | 1458 |
| 943 | Ga0207670_10239831 | 3300025936 | Bacteria | 1396 |
| 944 | Ga0207670_10395806 | 3300025936 | Bacteria | 1103 |
| 945 | Ga0207670_10502102 | 3300025936 | Bacteria | 985 |
| 946 | Ga0207670_10609363 | 3300025936 | Bacteria | 897 |
| 947 | Ga0207670_11271064 | 3300025936 | Unclassified | 624 |
| 948 | Ga0207670_11406229 | 3300025936 | Unclassified | 592 |
| 949 | Ga0207670_11658189 | 3300025936 | Unclassified | 544 |
| 950 | Ga0207670_11663909 | 3300025936 | Unclassified | 543 |
| 951 | Ga0207670_11716843 | 3300025936 | Unclassified | 534 |
| 952 | Ga0207669_10003495 | 3300025937 | Bacteria | 6796 |
| 953 | Ga0207669_10049329 | 3300025937 | Bacteria | 2508 |
| 954 | Ga0207669_10051157 | 3300025937 | Bacteria | 2473 |
| 955 | Ga0207669_10071985 | 3300025937 | Bacteria | 2175 |
| 956 | Ga0207669_10080634 | 3300025937 | Bacteria | 2082 |
| 957 | Ga0207669_10410160 | 3300025937 | Bacteria | 1063 |
| 958 | Ga0207669_10428088 | 3300025937 | Bacteria | 1043 |
| 959 | Ga0207669_10783839 | 3300025937 | Bacteria | 789 |
| 960 | Ga0207669_10846222 | 3300025937 | Bacteria | 761 |
| 961 | Ga0207669_11025628 | 3300025937 | Bacteria | 694 |
| 962 | Ga0207704_10001666 | 3300025938 | Bacteria | 9966 |
| 963 | Ga0207704_10033546 | 3300025938 | Bacteria | 2920 |
| 964 | Ga0207704_10110723 | 3300025938 | Bacteria | 1855 |
| 965 | Ga0207704_10128770 | 3300025938 | Bacteria | 1748 |
| 966 | Ga0207704_10139997 | 3300025938 | Bacteria | 1691 |
| 967 | Ga0207704_10246796 | 3300025938 | Bacteria | 1337 |
| 968 | Ga0207704_10300938 | 3300025938 | Bacteria | 1229 |
| 969 | Ga0207704_10375071 | 3300025938 | Bacteria | 1115 |
| 970 | Ga0207704_10586858 | 3300025938 | Bacteria | 910 |
| 971 | Ga0207704_11456447 | 3300025938 | Unclassified | 587 |
| 972 | Ga0207665_10899013 | 3300025939 | Bacteria | 702 |
| 973 | Ga0207691_10008380 | 3300025940 | Bacteria | 9933 |
| 974 | Ga0207691_10025426 | 3300025940 | Bacteria | 5560 |
| 975 | Ga0207691_10062682 | 3300025940 | Bacteria | 3373 |
| 976 | Ga0207691_10063187 | 3300025940 | Bacteria | 3358 |
| 977 | Ga0207691_10109315 | 3300025940 | Bacteria | 2459 |
| 978 | Ga0207691_10116984 | 3300025940 | Bacteria | 2365 |
| 979 | Ga0207691_10245721 | 3300025940 | Bacteria | 1546 |
| 980 | Ga0207691_10268896 | 3300025940 | Bacteria | 1468 |
| 981 | Ga0207691_10442543 | 3300025940 | Bacteria | 1106 |
| 982 | Ga0207691_10727437 | 3300025940 | Bacteria | 836 |
| 983 | Ga0207691_10868875 | 3300025940 | Bacteria | 756 |
| 984 | Ga0207691_11005028 | 3300025940 | Bacteria | 696 |
| 985 | Ga0207691_11658043 | 3300025940 | Unclassified | 518 |
| 986 | Ga0207711_10074530 | 3300025941 | Bacteria | 2951 |
| 987 | Ga0207711_10124168 | 3300025941 | Bacteria | 2308 |
| 988 | Ga0207711_10522571 | 3300025941 | Bacteria | 1107 |
| 989 | Ga0207711_10745590 | 3300025941 | Bacteria | 913 |
| 990 | Ga0207711_10981591 | 3300025941 | Bacteria | 784 |
| 991 | Ga0207711_11060519 | 3300025941 | Unclassified | 751 |
| 992 | Ga0207711_11144173 | 3300025941 | Bacteria | 719 |
| 993 | Ga0207689_10003297 | 3300025942 | Bacteria | 14779 |
| 994 | Ga0207689_10031671 | 3300025942 | Bacteria | 4400 |
| 995 | Ga0207689_10082951 | 3300025942 | Bacteria | 2635 |
| 996 | Ga0207689_10188716 | 3300025942 | Bacteria | 1700 |
| 997 | Ga0207689_10288734 | 3300025942 | Bacteria | 1359 |
| 998 | Ga0207689_10351151 | 3300025942 | Bacteria | 1226 |
| 999 | Ga0207689_10367272 | 3300025942 | Unclassified | 1197 |
| 1000 | Ga0207689_10627568 | 3300025942 | Bacteria | 905 |
| 1001 | Ga0207689_11758690 | 3300025942 | Unclassified | 513 |
| 1002 | Ga0207661_10375461 | 3300025944 | Bacteria | 1286 |
| 1003 | Ga0207661_10929512 | 3300025944 | Bacteria | 801 |
| 1004 | Ga0207661_11045004 | 3300025944 | Bacteria | 752 |
| 1005 | Ga0207679_10011160 | 3300025945 | Bacteria | 5804 |
| 1006 | Ga0207679_10034050 | 3300025945 | Bacteria | 3591 |
| 1007 | Ga0207679_10174994 | 3300025945 | Bacteria | 1771 |
| 1008 | Ga0207679_10412275 | 3300025945 | Bacteria | 1190 |
| 1009 | Ga0207679_10521218 | 3300025945 | Bacteria | 1063 |
| 1010 | Ga0207679_11178987 | 3300025945 | Bacteria | 703 |
| 1011 | Ga0207667_10326294 | 3300025949 | Bacteria | 1567 |
| 1012 | Ga0207667_10927006 | 3300025949 | Bacteria | 862 |
| 1013 | Ga0207651_10039797 | 3300025960 | Bacteria | 3103 |
| 1014 | Ga0207651_10050613 | 3300025960 | Bacteria | 2821 |
| 1015 | Ga0207651_10105045 | 3300025960 | Bacteria | 2106 |
| 1016 | Ga0207651_10130056 | 3300025960 | Bacteria | 1925 |
| 1017 | Ga0207651_10157351 | 3300025960 | Bacteria | 1777 |
| 1018 | Ga0207651_10164989 | 3300025960 | Bacteria | 1740 |
| 1019 | Ga0207651_10201874 | 3300025960 | Bacteria | 1594 |
| 1020 | Ga0207651_10209206 | 3300025960 | Bacteria | 1569 |
| 1021 | Ga0207651_10226377 | 3300025960 | Bacteria | 1515 |
| 1022 | Ga0207651_10527762 | 3300025960 | Bacteria | 1024 |
| 1023 | Ga0207651_10548354 | 3300025960 | Unclassified | 1005 |
| 1024 | Ga0207651_11169827 | 3300025960 | Bacteria | 690 |
| 1025 | Ga0207651_11175831 | 3300025960 | Bacteria | 688 |
| 1026 | Ga0207651_11468334 | 3300025960 | Unclassified | 614 |
| 1027 | Ga0207651_11710830 | 3300025960 | Unclassified | 566 |
| 1028 | Ga0207712_10087286 | 3300025961 | Bacteria | 2287 |
| 1029 | Ga0207712_10255450 | 3300025961 | Bacteria | 1419 |
| 1030 | Ga0207712_10568063 | 3300025961 | Bacteria | 977 |
| 1031 | Ga0207712_10968645 | 3300025961 | Bacteria | 754 |
| 1032 | Ga0207668_10104977 | 3300025972 | Bacteria | 2108 |
| 1033 | Ga0207668_10153272 | 3300025972 | Bacteria | 1787 |
| 1034 | Ga0207668_10300522 | 3300025972 | Bacteria | 1324 |
| 1035 | Ga0207668_10431638 | 3300025972 | Bacteria | 1120 |
| 1036 | Ga0207668_10778916 | 3300025972 | Bacteria | 845 |
| 1037 | Ga0207668_11588349 | 3300025972 | Bacteria | 590 |
| 1038 | Ga0207668_12048637 | 3300025972 | Bacteria | 515 |
| 1039 | Ga0207640_10102635 | 3300025981 | Bacteria | 2009 |
| 1040 | Ga0207640_10984325 | 3300025981 | Bacteria | 741 |
| 1041 | Ga0207640_11493960 | 3300025981 | Bacteria | 607 |
| 1042 | Ga0207658_10333029 | 3300025986 | Bacteria | 1317 |
| 1043 | Ga0207658_10459577 | 3300025986 | Bacteria | 1128 |
| 1044 | Ga0207658_11167469 | 3300025986 | Unclassified | 704 |
| 1045 | Ga0207658_12073336 | 3300025986 | Bacteria | 517 |
| 1046 | Ga0207658_12185527 | 3300025986 | Bacteria | 502 |
| 1047 | Ga0207677_10118297 | 3300026023 | Bacteria | 1988 |
| 1048 | Ga0207677_10374986 | 3300026023 | Bacteria | 1199 |
| 1049 | Ga0207677_11047456 | 3300026023 | Bacteria | 742 |
| 1050 | Ga0207677_11777601 | 3300026023 | Unclassified | 572 |
| 1051 | Ga0207677_11984741 | 3300026023 | Bacteria | 541 |
| 1052 | Ga0207703_10040180 | 3300026035 | Bacteria | 3742 |
| 1053 | Ga0207703_10094200 | 3300026035 | Bacteria | 2524 |
| 1054 | Ga0207703_10096653 | 3300026035 | Bacteria | 2494 |
| 1055 | Ga0207703_10216693 | 3300026035 | Bacteria | 1710 |
| 1056 | Ga0207703_10728115 | 3300026035 | Bacteria | 944 |
| 1057 | Ga0207639_10707718 | 3300026041 | Bacteria | 935 |
| 1058 | Ga0207639_10776766 | 3300026041 | Bacteria | 892 |
| 1059 | Ga0207639_10895294 | 3300026041 | Bacteria | 829 |
| 1060 | Ga0207639_10898206 | 3300026041 | Bacteria | 828 |
| 1061 | Ga0207639_11073338 | 3300026041 | Bacteria | 755 |
| 1062 | Ga0207639_11855519 | 3300026041 | Unclassified | 564 |
| 1063 | Ga0207678_10164710 | 3300026067 | Bacteria | 1893 |
| 1064 | Ga0207678_10184887 | 3300026067 | Bacteria | 1780 |
| 1065 | Ga0207678_10270276 | 3300026067 | Bacteria | 1458 |
| 1066 | Ga0207678_10778337 | 3300026067 | Bacteria | 844 |
| 1067 | Ga0207678_10985876 | 3300026067 | Unclassified | 746 |
| 1068 | Ga0207678_11040103 | 3300026067 | Bacteria | 725 |
| 1069 | Ga0207678_11709944 | 3300026067 | Bacteria | 552 |
| 1070 | Ga0207708_10033437 | 3300026075 | Bacteria | 3906 |
| 1071 | Ga0207708_10164251 | 3300026075 | Bacteria | 1755 |
| 1072 | Ga0207708_10283773 | 3300026075 | Bacteria | 1342 |
| 1073 | Ga0207708_10373188 | 3300026075 | Bacteria | 1175 |
| 1074 | Ga0207708_10578750 | 3300026075 | Bacteria | 949 |
| 1075 | Ga0207708_10600569 | 3300026075 | Bacteria | 932 |
| 1076 | Ga0207702_11135528 | 3300026078 | Bacteria | 775 |
| 1077 | Ga0207641_10023412 | 3300026088 | Bacteria | 5089 |
| 1078 | Ga0207641_10044873 | 3300026088 | Bacteria | 3719 |
| 1079 | Ga0207641_10206991 | 3300026088 | Bacteria | 1812 |
| 1080 | Ga0207641_10267522 | 3300026088 | Bacteria | 1603 |
| 1081 | Ga0207641_10339217 | 3300026088 | Bacteria | 1430 |
| 1082 | Ga0207641_10424233 | 3300026088 | Bacteria | 1281 |
| 1083 | Ga0207641_10535482 | 3300026088 | Bacteria | 1141 |
| 1084 | Ga0207641_11460470 | 3300026088 | Bacteria | 685 |
| 1085 | Ga0207641_12118841 | 3300026088 | Bacteria | 563 |
| 1086 | Ga0207641_12517398 | 3300026088 | Bacteria | 513 |
| 1087 | Ga0207648_10013253 | 3300026089 | Bacteria | 7680 |
| 1088 | Ga0207648_10031574 | 3300026089 | Bacteria | 4683 |
| 1089 | Ga0207648_10043517 | 3300026089 | Bacteria | 3941 |
| 1090 | Ga0207648_10067266 | 3300026089 | Bacteria | 3124 |
| 1091 | Ga0207648_10068907 | 3300026089 | Bacteria | 3083 |
| 1092 | Ga0207648_10400712 | 3300026089 | Unclassified | 1243 |
| 1093 | Ga0207648_10487043 | 3300026089 | Bacteria | 1127 |
| 1094 | Ga0207648_11032497 | 3300026089 | Bacteria | 770 |
| 1095 | Ga0207648_11415124 | 3300026089 | Bacteria | 654 |
| 1096 | Ga0207648_11592081 | 3300026089 | Bacteria | 614 |
| 1097 | Ga0207676_10009598 | 3300026095 | Bacteria | 6890 |
| 1098 | Ga0207676_10051943 | 3300026095 | Bacteria | 3202 |
| 1099 | Ga0207676_10094690 | 3300026095 | Bacteria | 2461 |
| 1100 | Ga0207676_10138140 | 3300026095 | Bacteria | 2082 |
| 1101 | Ga0207676_10181229 | 3300026095 | Bacteria | 1844 |
| 1102 | Ga0207676_10263177 | 3300026095 | Bacteria | 1558 |
| 1103 | Ga0207676_10642355 | 3300026095 | Unclassified | 1023 |
| 1104 | Ga0207676_10888555 | 3300026095 | Bacteria | 873 |
| 1105 | Ga0207676_11049133 | 3300026095 | Bacteria | 804 |
| 1106 | Ga0207676_11557311 | 3300026095 | Bacteria | 658 |
| 1107 | Ga0207674_10043290 | 3300026116 | Bacteria | 4643 |
| 1108 | Ga0207674_10155775 | 3300026116 | Bacteria | 2240 |
| 1109 | Ga0207674_10167293 | 3300026116 | Bacteria | 2152 |
| 1110 | Ga0207674_10167578 | 3300026116 | Bacteria | 2150 |
| 1111 | Ga0207674_10168727 | 3300026116 | Bacteria | 2142 |
| 1112 | Ga0207674_10455516 | 3300026116 | Bacteria | 1236 |
| 1113 | Ga0207674_10513872 | 3300026116 | Bacteria | 1157 |
| 1114 | Ga0207674_10705895 | 3300026116 | Bacteria | 974 |
| 1115 | Ga0207674_11174325 | 3300026116 | Bacteria | 737 |
| 1116 | Ga0207675_100081350 | 3300026118 | Bacteria | 3037 |
| 1117 | Ga0207675_100200600 | 3300026118 | Bacteria | 1916 |
| 1118 | Ga0207675_100222886 | 3300026118 | Bacteria | 1817 |
| 1119 | Ga0207675_100324227 | 3300026118 | Bacteria | 1504 |
| 1120 | Ga0207675_100421939 | 3300026118 | Archaea | 1317 |
| 1121 | Ga0207675_100646575 | 3300026118 | Bacteria | 1063 |
| 1122 | Ga0207675_100836133 | 3300026118 | Unclassified | 935 |
| 1123 | Ga0207675_101062663 | 3300026118 | Unclassified | 829 |
| 1124 | Ga0207675_101111647 | 3300026118 | Unclassified | 810 |
| 1125 | Ga0207675_101376818 | 3300026118 | Bacteria | 726 |
| 1126 | Ga0207675_101611041 | 3300026118 | Bacteria | 670 |
| 1127 | Ga0207675_101617451 | 3300026118 | Bacteria | 668 |
| 1128 | Ga0207675_101800163 | 3300026118 | Unclassified | 632 |
| 1129 | Ga0207675_101865384 | 3300026118 | Bacteria | 620 |
| 1130 | Ga0207675_102136321 | 3300026118 | Bacteria | 576 |
| 1131 | Ga0207675_102514331 | 3300026118 | Bacteria | 526 |
| 1132 | Ga0207683_10033980 | 3300026121 | Bacteria | 4430 |
| 1133 | Ga0207683_10045978 | 3300026121 | Bacteria | 3818 |
| 1134 | Ga0207683_10059237 | 3300026121 | Bacteria | 3364 |
| 1135 | Ga0207683_10107916 | 3300026121 | Bacteria | 2491 |
| 1136 | Ga0207683_10296349 | 3300026121 | Bacteria | 1479 |
| 1137 | Ga0207683_10410796 | 3300026121 | Bacteria | 1246 |
| 1138 | Ga0207683_10460454 | 3300026121 | Bacteria | 1173 |
| 1139 | Ga0207683_10868640 | 3300026121 | Bacteria | 837 |
| 1140 | Ga0207683_11532952 | 3300026121 | Bacteria | 615 |
| 1141 | Ga0207698_10390028 | 3300026142 | Bacteria | 1328 |
| 1142 | Ga0207698_10446247 | 3300026142 | Bacteria | 1248 |
| 1143 | Ga0207698_10702539 | 3300026142 | Bacteria | 1006 |
| 1144 | Ga0209969_1066160 | 3300027360 | Unclassified | 573 |
| 1145 | Ga0209984_1028427 | 3300027424 | Bacteria | 785 |
| 1146 | Ga0209995_1022168 | 3300027471 | Bacteria | 1054 |
| 1147 | Ga0210002_1056933 | 3300027617 | Unclassified | 679 |
| 1148 | Ga0209983_1131452 | 3300027665 | Unclassified | 572 |
| 1149 | Ga0209971_1034965 | 3300027682 | Bacteria | 1208 |
| 1150 | Ga0209966_1126289 | 3300027695 | Bacteria | 589 |
| 1151 | Ga0209998_10086210 | 3300027717 | Unclassified | 765 |
| 1152 | Ga0209974_10050494 | 3300027876 | Bacteria | 1397 |
| 1153 | Ga0209974_10053291 | 3300027876 | Bacteria | 1362 |
| 1154 | Ga0209974_10054945 | 3300027876 | Bacteria | 1342 |
| 1155 | Ga0207428_10000030 | 3300027907 | Bacteria | 240846 |
| 1156 | Ga0207428_10001541 | 3300027907 | Bacteria | 24114 |
| 1157 | Ga0207428_10002655 | 3300027907 | Bacteria | 17812 |
| 1158 | Ga0207428_10006221 | 3300027907 | Bacteria | 11031 |
| 1159 | Ga0207428_10007494 | 3300027907 | Bacteria | 9945 |
| 1160 | Ga0207428_10018447 | 3300027907 | Bacteria | 5959 |
| 1161 | Ga0207428_10031399 | 3300027907 | Bacteria | 4381 |
| 1162 | Ga0207428_10068173 | 3300027907 | Bacteria | 2799 |
| 1163 | Ga0207428_10070038 | 3300027907 | Bacteria | 2757 |
| 1164 | Ga0207428_10093635 | 3300027907 | Bacteria | 2330 |
| 1165 | Ga0207428_10193324 | 3300027907 | Bacteria | 1533 |
| 1166 | Ga0207428_10360338 | 3300027907 | Bacteria | 1069 |
| 1167 | Ga0207428_10458515 | 3300027907 | Bacteria | 929 |
| 1168 | Ga0207428_10977285 | 3300027907 | Bacteria | 596 |
| 1169 | Ga0207428_11260112 | 3300027907 | Unclassified | 513 |
| 1170 | Ga0268266_10059995 | 3300028379 | Bacteria | 3278 |
| 1171 | Ga0268266_10502245 | 3300028379 | Bacteria | 1158 |
| 1172 | Ga0268266_10697596 | 3300028379 | Bacteria | 978 |
| 1173 | Ga0268266_11100271 | 3300028379 | Bacteria | 769 |
| 1174 | Ga0268266_11790377 | 3300028379 | Bacteria | 589 |
| 1175 | Ga0268265_10000103 | 3300028380 | Bacteria | 106177 |
| 1176 | Ga0268265_10079624 | 3300028380 | Bacteria | 2581 |
| 1177 | Ga0268265_10178160 | 3300028380 | Bacteria | 1824 |
| 1178 | Ga0268265_10191296 | 3300028380 | Bacteria | 1767 |
| 1179 | Ga0268265_10227747 | 3300028380 | Bacteria | 1636 |
| 1180 | Ga0268265_10250137 | 3300028380 | Bacteria | 1569 |
| 1181 | Ga0268265_10369444 | 3300028380 | Bacteria | 1316 |
| 1182 | Ga0268265_10378502 | 3300028380 | Bacteria | 1301 |
| 1183 | Ga0268265_10517344 | 3300028380 | Bacteria | 1127 |
| 1184 | Ga0268265_10636172 | 3300028380 | Bacteria | 1024 |
| 1185 | Ga0268265_11193768 | 3300028380 | Bacteria | 758 |
| 1186 | Ga0268265_11298042 | 3300028380 | Unclassified | 728 |
| 1187 | Ga0268265_12160138 | 3300028380 | Unclassified | 564 |
| 1188 | Ga0268264_10143516 | 3300028381 | Bacteria | 2132 |
| 1189 | Ga0268264_10508097 | 3300028381 | Bacteria | 1176 |
| 1190 | Ga0268264_11405868 | 3300028381 | Bacteria | 708 |
| 1191 | Ga0268264_11966455 | 3300028381 | Bacteria | 594 |
| 1192 | Ga0265332_10026219 | 3300031238 | Bacteria | 2556 |
| 1193 | Ga0265320_10199563 | 3300031240 | Bacteria | 893 |
| 1194 | Ga0307408_100255993 | 3300031548 | Bacteria | 1446 |
| 1195 | Ga0307408_100299995 | 3300031548 | Bacteria | 1345 |
| 1196 | Ga0307408_100467349 | 3300031548 | Bacteria | 1098 |
| 1197 | Ga0307508_10005222 | 3300031616 | Bacteria | 12422 |
| 1198 | Ga0316575_10024684 | 3300031665 | Bacteria | 2328 |
| 1199 | Ga0316575_10050073 | 3300031665 | Bacteria | 1663 |
| 1200 | Ga0316575_10081738 | 3300031665 | Bacteria | 1303 |
| 1201 | Ga0307405_10003705 | 3300031731 | Bacteria | 7092 |
| 1202 | Ga0307405_10107432 | 3300031731 | Bacteria | 1884 |
| 1203 | Ga0307405_10976017 | 3300031731 | Unclassified | 721 |
| 1204 | Ga0307405_11409802 | 3300031731 | Bacteria | 609 |
| 1205 | Ga0307405_12072629 | 3300031731 | Bacteria | 510 |
| 1206 | Ga0307413_10030140 | 3300031824 | Bacteria | 3044 |
| 1207 | Ga0307413_10036681 | 3300031824 | Bacteria | 2825 |
| 1208 | Ga0307413_10082123 | 3300031824 | Bacteria | 2069 |
| 1209 | Ga0307413_10187723 | 3300031824 | Bacteria | 1481 |
| 1210 | Ga0307413_10969115 | 3300031824 | Bacteria | 727 |
| 1211 | Ga0307410_10009943 | 3300031852 | Bacteria | 5364 |
| 1212 | Ga0307410_10074128 | 3300031852 | Bacteria | 2369 |
| 1213 | Ga0307410_10901322 | 3300031852 | Unclassified | 757 |
| 1214 | Ga0307410_12069957 | 3300031852 | Bacteria | 509 |
| 1215 | Ga0307406_10082603 | 3300031901 | Bacteria | 2140 |
| 1216 | Ga0307406_10477974 | 3300031901 | Bacteria | 1006 |
| 1217 | Ga0307406_11720722 | 3300031901 | Bacteria | 556 |
| 1218 | Ga0307407_10002685 | 3300031903 | Bacteria | 7052 |
| 1219 | Ga0307407_10120722 | 3300031903 | Bacteria | 1661 |
| 1220 | Ga0307407_10583189 | 3300031903 | Bacteria | 830 |
| 1221 | Ga0307407_10695753 | 3300031903 | Bacteria | 765 |
| 1222 | Ga0307407_11426786 | 3300031903 | Unclassified | 546 |
| 1223 | Ga0307412_10024409 | 3300031911 | Bacteria | 3731 |
| 1224 | Ga0307412_10134377 | 3300031911 | Bacteria | 1802 |
| 1225 | Ga0307412_10317959 | 3300031911 | Bacteria | 1237 |
| 1226 | Ga0307412_12143772 | 3300031911 | Unclassified | 519 |
| 1227 | Ga0307409_100009123 | 3300031995 | Bacteria | 6075 |
| 1228 | Ga0307409_100374875 | 3300031995 | Bacteria | 1351 |
| 1229 | Ga0307409_100998458 | 3300031995 | Bacteria | 855 |
| 1230 | Ga0307409_101207696 | 3300031995 | Bacteria | 780 |
| 1231 | Ga0307409_102404317 | 3300031995 | Bacteria | 556 |
| 1232 | Ga0307409_102856080 | 3300031995 | Unclassified | 510 |
| 1233 | Ga0307416_100034468 | 3300032002 | Bacteria | 3852 |
| 1234 | Ga0307416_100040037 | 3300032002 | Bacteria | 3636 |
| 1235 | Ga0307416_100103879 | 3300032002 | Bacteria | 2482 |
| 1236 | Ga0307416_100136011 | 3300032002 | Bacteria | 2223 |
| 1237 | Ga0307416_100145482 | 3300032002 | Bacteria | 2163 |
| 1238 | Ga0307416_100344206 | 3300032002 | Bacteria | 1505 |
| 1239 | Ga0307416_100352013 | 3300032002 | Bacteria | 1491 |
| 1240 | Ga0307416_101020257 | 3300032002 | Bacteria | 931 |
| 1241 | Ga0307416_101266953 | 3300032002 | Bacteria | 843 |
| 1242 | Ga0307416_102491719 | 3300032002 | Unclassified | 616 |
| 1243 | Ga0307416_102724757 | 3300032002 | Bacteria | 591 |
| 1244 | Ga0307414_10127509 | 3300032004 | Bacteria | 1969 |
| 1245 | Ga0307411_10008339 | 3300032005 | Bacteria | 5360 |
| 1246 | Ga0307411_10022570 | 3300032005 | Bacteria | 3708 |
| 1247 | Ga0307411_10054909 | 3300032005 | Bacteria | 2618 |
| 1248 | Ga0307411_10200666 | 3300032005 | Bacteria | 1531 |
| 1249 | Ga0307411_10494320 | 3300032005 | Bacteria | 1033 |
| 1250 | Ga0307411_12078154 | 3300032005 | Bacteria | 531 |
| 1251 | Ga0307415_100000625 | 3300032126 | Bacteria | 15495 |
| 1252 | Ga0307415_100201926 | 3300032126 | Bacteria | 1578 |
| 1253 | Ga0307415_100217412 | 3300032126 | Bacteria | 1529 |
| 1254 | Ga0307415_100258590 | 3300032126 | Bacteria | 1419 |
| 1255 | Ga0316593_10037608 | 3300032168 | Bacteria | 1600 |
| 1256 | Ga0316592_1006430 | 3300033524 | Bacteria | 2263 |
| 1257 | Ga0316596_1099401 | 3300033541 | Unclassified | 786 |
| 1258 | Ga0373930_0159836 | 3300034816 | Unclassified | 569 |
| 1259 | Ga0373948_0067920 | 3300034817 | Bacteria | 794 |
| 1260 | Ga0373950_0149151 | 3300034818 | Bacteria | 534 |
| 1261 | Ga0373958_0037887 | 3300034819 | Bacteria | 974 |
| 1262 | Ga0373928_0108665 | 3300035084 | Unclassified | 731 |
| 1263 | Ga0373940_0004488 | 3300035088 | Bacteria | 2951 |
| 1264 | Ga0373940_0136852 | 3300035088 | Bacteria | 771 |
| 1265 | Ga0373941_0156680 | 3300035115 | Unclassified | 839 |
| 1266 | Ga0373945_0276235 | 3300035116 | Unclassified | 715 |
| 1267 | Ga0373960_0037560 | 3300035121 | Bacteria | 1384 |
| 1268 | Ga0373960_0095559 | 3300035121 | Bacteria | 956 |
| 1269 | Ga0373960_0326523 | 3300035121 | Unclassified | 576 |
| 1270 | Ga0373943_0263924 | 3300035170 | Bacteria | 970 |
| 1271 | Ga0373943_0438654 | 3300035170 | Bacteria | 758 |
| 1272 | Ga0373946_0452770 | 3300035171 | Bacteria | 654 |
| 1273 | Ga0373955_0250745 | 3300035172 | Bacteria | 1061 |
| 1274 | Ga0373961_0000555 | 3300035241 | Bacteria | 14114 |
| 1275 | Ga0373961_0113319 | 3300035241 | Unclassified | 891 |
| 1276 | Ga0373961_0315215 | 3300035241 | Bacteria | 582 |
| 1277 | Ga0373962_0340345 | 3300035242 | Bacteria | 540 |
| 1278 | Ga0316574_0817223 | 3300035398 | Bacteria | 567 |
| 1279 | Ga0373931_0052178 | 3300035691 | Bacteria | 2180 |
| 1280 | Ga0373931_0102003 | 3300035691 | Bacteria | 1615 |
| 1281 | Ga0373931_0263722 | 3300035691 | Bacteria | 1052 |
| 1282 | Ga0373935_0001807 | 3300035692 | Bacteria | 12023 |
| 1283 | Ga0373935_1226722 | 3300035692 | Bacteria | 559 |
| 1284 | Ga0373933_0394930 | 3300035724 | Bacteria | 902 |
| 1285 | Ga0373947_0437089 | 3300035725 | Bacteria | 885 |
| 1286 | Ga0373937_0106842 | 3300036401 | Bacteria | 2602 |
| 1287 | Ga0373937_0247931 | 3300036401 | Bacteria | 1679 |
| 1288 | Ga0316582_0115347 | 3300036647 | Bacteria | 1792 |
| 1289 | Ga0316584_0338375 | 3300036712 | Bacteria | 1082 |
| 1290 | Ga0373925_0092638 | 3300037068 | Bacteria | 2312 |
| 1291 | Ga0373925_0861154 | 3300037068 | Bacteria | 747 |
| 1292 | Ga0395900_0487190 | 3300037418 | Bacteria | 1185 |
| 1293 | Ga0395900_1301885 | 3300037418 | Bacteria | 641 |
| 1294 | Ga0395905_0447983 | 3300037471 | Bacteria | 1189 |
| 1295 | Ga0395901_0357007 | 3300038443 | Bacteria | 1508 |
| 1296 | Ga0242420_039816 | 3300038996 | Bacteria | 895 |
| 1297 | Ga0436365_0602824 | 3300039437 | Bacteria | 4946 |
| 1298 | Ga0439439_0127072 | 3300041406 | Bacteria | 714 |
| 1299 | Ga0439439_0203325 | 3300041406 | Bacteria | 576 |
| 1300 | Ga0439453_0004973 | 3300041408 | Bacteria | 2003 |
| 1301 | Ga0439453_0009260 | 3300041408 | Bacteria | 1601 |
| 1302 | Ga0451798_0441709 | 3300041458 | Bacteria | 549 |
| 1303 | Ga0451802_0036363 | 3300041460 | Unclassified | 519 |
| 1304 | Ga0451807_0925607 | 3300041486 | Bacteria | 538 |
| 1305 | Ga0451807_1500143 | 3300041486 | Bacteria | 614 |
| 1306 | Ga0451807_2617318 | 3300041486 | Bacteria | 763 |
| 1307 | Ga0451833_0021962 | 3300041491 | Bacteria | 915 |
| 1308 | Ga0451853_0405101 | 3300041512 | Bacteria | 1085 |
| 1309 | Ga0451853_1327955 | 3300041512 | Bacteria | 892 |
| 1310 | Ga0451853_3395319 | 3300041512 | Bacteria | 1090 |
| 1311 | Ga0439431_0032722 | 3300041997 | Bacteria | 1298 |
| 1312 | Ga0439433_0019173 | 3300041999 | Bacteria | 1523 |
| 1313 | Ga0439433_0054788 | 3300041999 | Bacteria | 944 |
| 1314 | Ga0439433_0198889 | 3300041999 | Bacteria | 529 |
| 1315 | Ga0439448_0238953 | 3300042005 | Bacteria | 640 |
| 1316 | Ga0439449_0158098 | 3300042007 | Bacteria | 846 |
| 1317 | Ga0439457_070943 | 3300042014 | Unclassified | 794 |
| 1318 | Ga0439463_132598 | 3300042016 | Unclassified | 645 |
| 1319 | Ga0450920_020951 | 3300042122 | Bacteria | 1261 |
| 1320 | Ga0450920_037682 | 3300042122 | Unclassified | 961 |
| 1321 | Ga0450920_054638 | 3300042122 | Unclassified | 803 |
| 1322 | Ga0450922_014190 | 3300042124 | Bacteria | 783 |
| 1323 | Ga0450923_007031 | 3300042125 | Bacteria | 1888 |
| 1324 | Ga0450923_008735 | 3300042125 | Bacteria | 1753 |
| 1325 | Ga0450888_041154 | 3300042126 | Bacteria | 643 |
| 1326 | Ga0450897_003037 | 3300042128 | Bacteria | 1314 |
| 1327 | Ga0450894_007236 | 3300042131 | Bacteria | 1432 |
| 1328 | Ga0450896_006663 | 3300042133 | Bacteria | 1585 |
| 1329 | Ga0450896_025105 | 3300042133 | Unclassified | 885 |
| 1330 | Ga0450896_027538 | 3300042133 | Unclassified | 850 |
| 1331 | Ga0450898_054103 | 3300042134 | Unclassified | 780 |
| 1332 | Ga0450898_078256 | 3300042134 | Unclassified | 670 |
| 1333 | Ga0450906_010316 | 3300042145 | Bacteria | 1768 |
| 1334 | Ga0450906_018000 | 3300042145 | Bacteria | 1270 |
| 1335 | Ga0450910_017638 | 3300042147 | Bacteria | 1064 |
| 1336 | Ga0439446_0004317 | 3300042156 | Bacteria | 3599 |
| 1337 | Ga0439446_0161567 | 3300042156 | Bacteria | 741 |
| 1338 | Ga0439446_0223750 | 3300042156 | Bacteria | 642 |
| 1339 | Ga0439446_0255413 | 3300042156 | Bacteria | 605 |
| 1340 | Ga0450908_020985 | 3300042184 | Bacteria | 1147 |
| 1341 | Ga0450908_056792 | 3300042184 | Bacteria | 684 |
| 1342 | Ga0450909_024850 | 3300042185 | Bacteria | 900 |
| 1343 | Ga0439434_0029644 | 3300042435 | Bacteria | 1659 |
| 1344 | Ga0439434_0086216 | 3300042435 | Bacteria | 1001 |
| 1345 | Ga0439434_0158538 | 3300042435 | Bacteria | 751 |
| 1346 | Ga0439434_0322730 | 3300042435 | Bacteria | 536 |
| 1347 | Ga0439434_0351369 | 3300042435 | Unclassified | 515 |
| 1348 | Ga0439435_0002870 | 3300042436 | Bacteria | 3496 |
| 1349 | Ga0439435_0037434 | 3300042436 | Bacteria | 1344 |
| 1350 | Ga0439435_0079909 | 3300042436 | Bacteria | 980 |
| 1351 | Ga0439435_0122969 | 3300042436 | Bacteria | 814 |
| 1352 | Ga0439444_0102579 | 3300042437 | Bacteria | 650 |
| 1353 | Ga0439444_0162817 | 3300042437 | Unclassified | 545 |
| 1354 | Ga0439459_0059925 | 3300042438 | Bacteria | 858 |
| 1355 | Ga0439464_0013985 | 3300042439 | Bacteria | 2155 |
| 1356 | Ga0439464_0177955 | 3300042439 | Bacteria | 673 |
| 1357 | Ga0439460_0179778 | 3300042461 | Bacteria | 715 |
| 1358 | Ga0439460_0189899 | 3300042461 | Unclassified | 697 |
| 1359 | Ga0450916_004189 | 3300042530 | Bacteria | 1618 |
| 1360 | Ga0450916_036260 | 3300042530 | Bacteria | 736 |
| 1361 | Ga0450918_017295 | 3300042531 | Bacteria | 1255 |
| 1362 | Ga0450918_072987 | 3300042531 | Bacteria | 646 |
| 1363 | Ga0451577_0002073 | 3300042876 | Bacteria | 24707 |
| 1364 | Ga0451577_0056998 | 3300042876 | Bacteria | 3484 |
| 1365 | Ga0451577_0149104 | 3300042876 | Bacteria | 2104 |
| 1366 | Ga0451577_1389650 | 3300042876 | Bacteria | 623 |
| 1367 | Ga0453683_0008308 | 3300044673 | Bacteria | 6977 |
| 1368 | Ga0453683_0087903 | 3300044673 | Bacteria | 1948 |
| 1369 | Ga0453683_0110040 | 3300044673 | Bacteria | 1732 |
| 1370 | Ga0453683_0164294 | 3300044673 | Bacteria | 1405 |
| 1371 | Ga0453683_1068325 | 3300044673 | Bacteria | 537 |
| 1372 | Ga0453684_0001302 | 3300044712 | Bacteria | 74077 |
| 1373 | Ga0453684_0005988 | 3300044712 | Bacteria | 23557 |
| 1374 | Ga0453684_0007805 | 3300044712 | Bacteria | 19520 |
| 1375 | Ga0453684_0010045 | 3300044712 | Bacteria | 16285 |
| 1376 | Ga0453684_0010202 | 3300044712 | Bacteria | 16107 |
| 1377 | Ga0453684_0015471 | 3300044712 | Bacteria | 12062 |
| 1378 | Ga0453684_0021782 | 3300044712 | Bacteria | 9550 |
| 1379 | Ga0453684_0054489 | 3300044712 | Bacteria | 5209 |
| 1380 | Ga0453684_0071623 | 3300044712 | Bacteria | 4381 |
| 1381 | Ga0453684_0073174 | 3300044712 | Bacteria | 4322 |
| 1382 | Ga0453684_0088115 | 3300044712 | Bacteria | 3844 |
| 1383 | Ga0453684_0091997 | 3300044712 | Bacteria | 3741 |
| 1384 | Ga0453684_0242226 | 3300044712 | Bacteria | 2075 |
| 1385 | Ga0453684_0664534 | 3300044712 | Bacteria | 1136 |
| 1386 | Ga0451576_0018296 | 3300045051 | Bacteria | 7684 |
| 1387 | Ga0451576_0076095 | 3300045051 | Bacteria | 3493 |
| 1388 | Ga0451576_0095658 | 3300045051 | Bacteria | 3089 |
| 1389 | Ga0451576_0224355 | 3300045051 | Bacteria | 1962 |
| 1390 | Ga0451576_0469621 | 3300045051 | Bacteria | 1321 |
| 1391 | Ga0451576_0566608 | 3300045051 | Bacteria | 1193 |
| 1392 | Ga0451576_0579185 | 3300045051 | Bacteria | 1179 |
| 1393 | Ga0451576_0710087 | 3300045051 | Bacteria | 1056 |
| 1394 | Ga0451576_1076131 | 3300045051 | Bacteria | 842 |
| 1395 | Ga0495592_0284459 | 3300046454 | Bacteria | 1080 |
| 1396 | Ga0495603_0029288 | 3300046455 | Bacteria | 3320 |
| 1397 | Ga0495603_0554194 | 3300046455 | Bacteria | 658 |
| 1398 | Ga0495603_0804499 | 3300046455 | Unclassified | 536 |
| 1399 | Ga0495629_0005673 | 3300046459 | Bacteria | 9321 |
| 1400 | Ga0495629_0073083 | 3300046459 | Bacteria | 2395 |
| 1401 | Ga0495638_0005447 | 3300046460 | Bacteria | 9462 |
| 1402 | Ga0495651_0202840 | 3300046462 | Bacteria | 1387 |
| 1403 | Ga0495653_0805965 | 3300046463 | Bacteria | 564 |
| 1404 | Ga0495639_0081925 | 3300046475 | Bacteria | 1504 |
| 1405 | Ga0495584_0019196 | 3300046491 | Bacteria | 3472 |
| 1406 | Ga0495584_0215513 | 3300046491 | Bacteria | 976 |
| 1407 | Ga0495584_0652873 | 3300046491 | Bacteria | 536 |
| 1408 | Ga0495594_0018438 | 3300046499 | Bacteria | 3696 |
| 1409 | Ga0495594_0036034 | 3300046499 | Bacteria | 2697 |
| 1410 | Ga0495594_0831214 | 3300046499 | Unclassified | 520 |
| 1411 | Ga0495616_0125094 | 3300046513 | Bacteria | 1183 |
| 1412 | Ga0495628_0271066 | 3300046516 | Bacteria | 1263 |
| 1413 | Ga0495630_1275279 | 3300046517 | Unclassified | 554 |
| 1414 | Ga0495630_1506507 | 3300046517 | Unclassified | 505 |
| 1415 | Ga0495643_0008784 | 3300046522 | Bacteria | 6366 |
| 1416 | Ga0495663_0078078 | 3300046525 | Bacteria | 1063 |
| 1417 | Ga0495642_0018422 | 3300046528 | Bacteria | 2733 |
| 1418 | Ga0495640_0239347 | 3300046533 | Bacteria | 1140 |
| 1419 | Ga0495640_0881543 | 3300046533 | Bacteria | 531 |
| 1420 | Ga0495586_0338009 | 3300046535 | Bacteria | 864 |
| 1421 | Ga0495598_0008945 | 3300046537 | Bacteria | 2349 |
| 1422 | Ga0495598_0024754 | 3300046537 | Bacteria | 1630 |
| 1423 | Ga0495598_0030392 | 3300046537 | Bacteria | 1513 |
| 1424 | Ga0495598_0213623 | 3300046537 | Bacteria | 701 |
| 1425 | Ga0495609_0029836 | 3300046538 | Bacteria | 2482 |
| 1426 | Ga0495621_0048707 | 3300046539 | Bacteria | 1510 |
| 1427 | Ga0495621_0052427 | 3300046539 | Bacteria | 1462 |
| 1428 | Ga0495621_0052707 | 3300046539 | Bacteria | 1459 |
| 1429 | Ga0495621_0064146 | 3300046539 | Bacteria | 1340 |
| 1430 | Ga0495621_0082636 | 3300046539 | Bacteria | 1200 |
| 1431 | Ga0495621_0096317 | 3300046539 | Bacteria | 1121 |
| 1432 | Ga0495621_0139639 | 3300046539 | Bacteria | 947 |
| 1433 | Ga0495621_0171725 | 3300046539 | Bacteria | 862 |
| 1434 | Ga0495621_0208537 | 3300046539 | Bacteria | 788 |
| 1435 | Ga0495621_0253335 | 3300046539 | Unclassified | 720 |
| 1436 | Ga0495621_0337705 | 3300046539 | Bacteria | 630 |
| 1437 | Ga0495597_0064623 | 3300046542 | Bacteria | 1589 |
| 1438 | Ga0495645_0850711 | 3300046543 | Unclassified | 544 |
| 1439 | Ga0495633_0128365 | 3300046558 | Bacteria | 1173 |
| 1440 | Ga0495656_0026299 | 3300046615 | Bacteria | 2316 |
| 1441 | Ga0495656_0041979 | 3300046615 | Bacteria | 1914 |
| 1442 | Ga0495668_0483698 | 3300046616 | Bacteria | 682 |
| 1443 | Ga0495634_0030778 | 3300046642 | Bacteria | 3703 |
| 1444 | Ga0495625_0565353 | 3300046660 | Bacteria | 687 |
| 1445 | Ga0495659_0002901 | 3300046664 | Bacteria | 5502 |
| 1446 | Ga0495659_0038986 | 3300046664 | Bacteria | 1688 |
| 1447 | Ga0495659_0059224 | 3300046664 | Bacteria | 1411 |
| 1448 | Ga0495659_0528250 | 3300046664 | Unclassified | 519 |
| 1449 | Ga0495588_0030049 | 3300046674 | Bacteria | 2729 |
| 1450 | Ga0495588_0144968 | 3300046674 | Bacteria | 1255 |
| 1451 | Ga0495599_0040155 | 3300046678 | Bacteria | 2939 |
| 1452 | Ga0495599_0080051 | 3300046678 | Bacteria | 2040 |
| 1453 | Ga0495599_0225211 | 3300046678 | Bacteria | 1146 |
| 1454 | Ga0495647_0091872 | 3300046681 | Bacteria | 1246 |
| 1455 | Ga0495658_0014843 | 3300046683 | Bacteria | 3987 |
| 1456 | Ga0495658_0433282 | 3300046683 | Bacteria | 839 |
| 1457 | Ga0495669_0149254 | 3300046684 | Bacteria | 1106 |
| 1458 | Ga0495613_0037336 | 3300046689 | Bacteria | 3602 |
| 1459 | Ga0495613_0086048 | 3300046689 | Bacteria | 2280 |
| 1460 | Ga0495670_0054733 | 3300046691 | Bacteria | 2000 |
| 1461 | Ga0495670_0068283 | 3300046691 | Bacteria | 1796 |
| 1462 | Ga0495670_0221863 | 3300046691 | Bacteria | 1004 |
| 1463 | Ga0495670_0255899 | 3300046691 | Bacteria | 934 |
| 1464 | Ga0495670_0289340 | 3300046691 | Bacteria | 877 |
| 1465 | Ga0495649_0458284 | 3300046694 | Bacteria | 636 |
| 1466 | Ga0495589_0165471 | 3300046794 | Bacteria | 1053 |
| 1467 | Ga0495600_0078578 | 3300046809 | Bacteria | 2155 |
| 1468 | Ga0495581_0258379 | 3300047315 | Bacteria | 1019 |
| 1469 | Ga0495581_0448746 | 3300047315 | Unclassified | 751 |
| 1470 | Ga0495636_0002384 | 3300047318 | Bacteria | 7217 |
| 1471 | Ga0495674_1127521 | 3300047319 | Unclassified | 596 |
| 1472 | Ga0495676_0037205 | 3300047321 | Bacteria | 4054 |
| 1473 | Ga0495680_0183904 | 3300047322 | Bacteria | 1507 |
| 1474 | Ga0495675_0192366 | 3300047444 | Bacteria | 1245 |
| 1475 | Ga0495677_0076298 | 3300047445 | Bacteria | 1253 |
| 1476 | Ga0495685_079173 | 3300047447 | Bacteria | 1095 |
| 1477 | Ga0495684_0178940 | 3300047471 | Bacteria | 1573 |
| 1478 | Ga0495615_0186658 | 3300048090 | Bacteria | 634 |
| 1479 | Ga0496100_0181876 | 3300048903 | Bacteria | 1521 |
| 1480 | Ga0496101_0916732 | 3300048904 | Unclassified | 690 |
| 1481 | Ga0496101_1297357 | 3300048904 | Unclassified | 569 |
| 1482 | Ga0496102_0160456 | 3300048905 | Bacteria | 2115 |
| 1483 | Ga0496103_0139475 | 3300048906 | Bacteria | 1550 |
| 1484 | Ga0496104_0014503 | 3300048907 | Bacteria | 7118 |
| 1485 | Ga0496104_1780102 | 3300048907 | Bacteria | 518 |
| 1486 | Ga0496105_0219764 | 3300048908 | Bacteria | 1547 |
| 1487 | Ga0496106_0035183 | 3300048909 | Bacteria | 3745 |
| 1488 | Ga0496106_0153574 | 3300048909 | Bacteria | 1817 |
| 1489 | Ga0496106_0593414 | 3300048909 | Bacteria | 887 |
| 1490 | Ga0496106_1387369 | 3300048909 | Unclassified | 543 |
| 1491 | Ga0496107_0537799 | 3300048910 | Unclassified | 866 |
| 1492 | Ga0496107_1115459 | 3300048910 | Bacteria | 569 |
| 1493 | Ga0496108_0038614 | 3300048911 | Bacteria | 3978 |
| 1494 | Ga0496109_0014351 | 3300048912 | Bacteria | 6893 |
| 1495 | Ga0496109_0329472 | 3300048912 | Bacteria | 1441 |
| 1496 | Ga0496109_1849440 | 3300048912 | Bacteria | 537 |
| 1497 | Ga0496110_0016128 | 3300048913 | Bacteria | 6231 |
| 1498 | Ga0496111_0104468 | 3300048914 | Bacteria | 2084 |
| 1499 | Ga0496112_0060848 | 3300048915 | Bacteria | 3721 |
| 1500 | Ga0496112_1216315 | 3300048915 | Bacteria | 670 |
| 1501 | Ga0496113_0006726 | 3300048916 | Bacteria | 7324 |
| 1502 | Ga0496113_0012466 | 3300048916 | Bacteria | 5713 |
| 1503 | Ga0496113_0867234 | 3300048916 | Bacteria | 715 |
| 1504 | Ga0496114_0147277 | 3300048917 | Bacteria | 2041 |
| 1505 | Ga0496119_0303702 | 3300048922 | Bacteria | 786 |
| 1506 | Ga0501311_044088 | 3300049527 | Unclassified | 683 |
| 1507 | Ga0501031_0129474 | 3300049568 | Bacteria | 1649 |
| 1508 | Ga0501031_0307273 | 3300049568 | Bacteria | 1027 |
| 1509 | Ga0501031_0353950 | 3300049568 | Bacteria | 950 |
| 1510 | Ga0501032_0004614 | 3300049569 | Bacteria | 10362 |
| 1511 | Ga0501032_0044742 | 3300049569 | Bacteria | 2995 |
| 1512 | Ga0501032_0097666 | 3300049569 | Bacteria | 1946 |
| 1513 | Ga0501032_0372984 | 3300049569 | Bacteria | 918 |
| 1514 | Ga0501032_0857665 | 3300049569 | Unclassified | 572 |
| 1515 | Ga0501033_0016362 | 3300049570 | Bacteria | 5616 |
| 1516 | Ga0501033_0083427 | 3300049570 | Bacteria | 2342 |
| 1517 | Ga0501033_0088983 | 3300049570 | Bacteria | 2258 |
| 1518 | Ga0501033_0237440 | 3300049570 | Bacteria | 1293 |
| 1519 | Ga0501033_0330914 | 3300049570 | Bacteria | 1069 |
| 1520 | Ga0501033_1049570 | 3300049570 | Unclassified | 543 |
| 1521 | Ga0501034_0027678 | 3300049571 | Bacteria | 5764 |
| 1522 | Ga0501034_0062327 | 3300049571 | Bacteria | 3744 |
| 1523 | Ga0501034_0098622 | 3300049571 | Bacteria | 2917 |
| 1524 | Ga0501034_1406666 | 3300049571 | Bacteria | 572 |
| 1525 | Ga0501034_1631990 | 3300049571 | Unclassified | 517 |
| 1526 | Ga0501036_0050456 | 3300049572 | Bacteria | 3523 |
| 1527 | Ga0501036_0061909 | 3300049572 | Bacteria | 3170 |
| 1528 | Ga0501036_0092819 | 3300049572 | Bacteria | 2550 |
| 1529 | Ga0501036_0318359 | 3300049572 | Bacteria | 1300 |
| 1530 | Ga0501036_0362362 | 3300049572 | Bacteria | 1210 |
| 1531 | Ga0501036_0430563 | 3300049572 | Bacteria | 1100 |
| 1532 | Ga0501036_0488804 | 3300049572 | Bacteria | 1024 |
| 1533 | Ga0501036_1260710 | 3300049572 | Unclassified | 601 |
| 1534 | Ga0501037_0127199 | 3300049573 | Bacteria | 1828 |
| 1535 | Ga0501037_0227392 | 3300049573 | Bacteria | 1310 |
| 1536 | Ga0501037_0272516 | 3300049573 | Bacteria | 1181 |
| 1537 | Ga0501037_0437465 | 3300049573 | Bacteria | 893 |
| 1538 | Ga0501038_0257721 | 3300049574 | Bacteria | 1379 |
| 1539 | Ga0501038_0445254 | 3300049574 | Bacteria | 997 |
| 1540 | Ga0501039_0048668 | 3300049575 | Bacteria | 3277 |
| 1541 | Ga0501039_0069743 | 3300049575 | Bacteria | 2730 |
| 1542 | Ga0501039_0536084 | 3300049575 | Bacteria | 919 |
| 1543 | Ga0501039_0940828 | 3300049575 | Unclassified | 672 |
| 1544 | Ga0501039_1179079 | 3300049575 | Unclassified | 593 |
| 1545 | Ga0501040_0021954 | 3300049576 | Bacteria | 4268 |
| 1546 | Ga0501040_0455924 | 3300049576 | Bacteria | 920 |
| 1547 | Ga0501040_1139639 | 3300049576 | Bacteria | 566 |
| 1548 | Ga0501040_1263328 | 3300049576 | Bacteria | 536 |
| 1549 | Ga0501041_0330668 | 3300049577 | Bacteria | 962 |
| 1550 | Ga0501041_0393779 | 3300049577 | Bacteria | 877 |
| 1551 | Ga0501041_0484357 | 3300049577 | Bacteria | 786 |
| 1552 | Ga0501041_0958238 | 3300049577 | Bacteria | 550 |
| 1553 | Ga0501041_1024403 | 3300049577 | Unclassified | 531 |
| 1554 | Ga0501041_1138995 | 3300049577 | Bacteria | 503 |
| 1555 | Ga0501042_0014342 | 3300049578 | Bacteria | 5408 |
| 1556 | Ga0501042_0098170 | 3300049578 | Bacteria | 2106 |
| 1557 | Ga0501042_0145672 | 3300049578 | Bacteria | 1707 |
| 1558 | Ga0501042_0274566 | 3300049578 | Bacteria | 1217 |
| 1559 | Ga0501042_0431742 | 3300049578 | Bacteria | 955 |
| 1560 | Ga0501042_0490304 | 3300049578 | Bacteria | 892 |
| 1561 | Ga0501042_0785860 | 3300049578 | Bacteria | 693 |
| 1562 | Ga0501043_0044028 | 3300049579 | Bacteria | 3508 |
| 1563 | Ga0501043_0170384 | 3300049579 | Bacteria | 1698 |
| 1564 | Ga0501043_0258621 | 3300049579 | Bacteria | 1340 |
| 1565 | Ga0501043_0310915 | 3300049579 | Bacteria | 1203 |
| 1566 | Ga0501043_0396308 | 3300049579 | Bacteria | 1043 |
| 1567 | Ga0501046_0080851 | 3300049580 | Bacteria | 2510 |
| 1568 | Ga0501046_0175070 | 3300049580 | Bacteria | 1607 |
| 1569 | Ga0501046_0200345 | 3300049580 | Bacteria | 1485 |
| 1570 | Ga0501046_0442130 | 3300049580 | Bacteria | 936 |
| 1571 | Ga0501046_0581355 | 3300049580 | Bacteria | 796 |
| 1572 | Ga0501047_0008209 | 3300049581 | Bacteria | 9860 |
| 1573 | Ga0501047_0042294 | 3300049581 | Bacteria | 4403 |
| 1574 | Ga0501047_0049792 | 3300049581 | Bacteria | 4044 |
| 1575 | Ga0501047_0510311 | 3300049581 | Bacteria | 1028 |
| 1576 | Ga0501047_0514223 | 3300049581 | Bacteria | 1023 |
| 1577 | Ga0501048_0031213 | 3300049582 | Bacteria | 3854 |
| 1578 | Ga0501048_0034967 | 3300049582 | Bacteria | 3620 |
| 1579 | Ga0501048_0054991 | 3300049582 | Bacteria | 2827 |
| 1580 | Ga0501048_0057217 | 3300049582 | Bacteria | 2765 |
| 1581 | Ga0501048_0926099 | 3300049582 | Bacteria | 627 |
| 1582 | Ga0501048_0986943 | 3300049582 | Bacteria | 606 |
| 1583 | Ga0501048_1408237 | 3300049582 | Bacteria | 501 |
| 1584 | Ga0501067_0039490 | 3300049583 | Bacteria | 2620 |
| 1585 | Ga0501067_0135844 | 3300049583 | Bacteria | 1369 |
| 1586 | Ga0501068_0001673 | 3300049584 | Bacteria | 11845 |
| 1587 | Ga0501068_0306694 | 3300049584 | Bacteria | 1016 |
| 1588 | Ga0501068_0896861 | 3300049584 | Unclassified | 583 |
| 1589 | Ga0501068_1079139 | 3300049584 | Bacteria | 531 |
| 1590 | Ga0501068_1139185 | 3300049584 | Bacteria | 516 |
| 1591 | Ga0501069_0005714 | 3300049585 | Bacteria | 6482 |
| 1592 | Ga0501069_0068467 | 3300049585 | Bacteria | 1986 |
| 1593 | Ga0501069_0277281 | 3300049585 | Bacteria | 981 |
| 1594 | Ga0501070_0014951 | 3300049586 | Bacteria | 6529 |
| 1595 | Ga0501070_0068084 | 3300049586 | Bacteria | 2947 |
| 1596 | Ga0501070_0156962 | 3300049586 | Bacteria | 1876 |
| 1597 | Ga0501070_0413049 | 3300049586 | Bacteria | 1090 |
| 1598 | Ga0501071_0057186 | 3300049587 | Bacteria | 2818 |
| 1599 | Ga0501071_0153379 | 3300049587 | Bacteria | 1719 |
| 1600 | Ga0501071_0209929 | 3300049587 | Bacteria | 1464 |
| 1601 | Ga0501071_0778026 | 3300049587 | Bacteria | 738 |
| 1602 | Ga0501072_0012080 | 3300049588 | Bacteria | 6597 |
| 1603 | Ga0501072_0073635 | 3300049588 | Bacteria | 2700 |
| 1604 | Ga0501072_0081681 | 3300049588 | Bacteria | 2562 |
| 1605 | Ga0501072_0088345 | 3300049588 | Bacteria | 2459 |
| 1606 | Ga0501072_0142888 | 3300049588 | Bacteria | 1908 |
| 1607 | Ga0501072_0418137 | 3300049588 | Bacteria | 1063 |
| 1608 | Ga0501072_0542708 | 3300049588 | Bacteria | 918 |
| 1609 | Ga0501072_0558607 | 3300049588 | Bacteria | 904 |
| 1610 | Ga0501072_0653561 | 3300049588 | Bacteria | 828 |
| 1611 | Ga0501072_1122208 | 3300049588 | Bacteria | 612 |
| 1612 | Ga0501072_1189370 | 3300049588 | Unclassified | 592 |
| 1613 | Ga0501073_0028887 | 3300049589 | Bacteria | 3962 |
| 1614 | Ga0501073_0036691 | 3300049589 | Bacteria | 3481 |
| 1615 | Ga0501073_0051646 | 3300049589 | Bacteria | 2879 |
| 1616 | Ga0501073_0135900 | 3300049589 | Bacteria | 1704 |
| 1617 | Ga0501073_0142718 | 3300049589 | Bacteria | 1659 |
| 1618 | Ga0501073_0184059 | 3300049589 | Bacteria | 1446 |
| 1619 | Ga0501073_1266474 | 3300049589 | Unclassified | 506 |
| 1620 | Ga0501074_0020071 | 3300049590 | Bacteria | 4856 |
| 1621 | Ga0501074_0078921 | 3300049590 | Bacteria | 2362 |
| 1622 | Ga0501074_0081910 | 3300049590 | Bacteria | 2314 |
| 1623 | Ga0501074_0164982 | 3300049590 | Bacteria | 1581 |
| 1624 | Ga0501074_0392272 | 3300049590 | Bacteria | 984 |
| 1625 | Ga0501074_1146366 | 3300049590 | Bacteria | 546 |
| 1626 | Ga0501075_0006664 | 3300049591 | Bacteria | 7962 |
| 1627 | Ga0501075_0015646 | 3300049591 | Bacteria | 5447 |
| 1628 | Ga0501075_0086472 | 3300049591 | Bacteria | 2375 |
| 1629 | Ga0501075_0094052 | 3300049591 | Bacteria | 2275 |
| 1630 | Ga0501075_0120030 | 3300049591 | Bacteria | 2001 |
| 1631 | Ga0501075_0242640 | 3300049591 | Bacteria | 1374 |
| 1632 | Ga0501075_0414241 | 3300049591 | Bacteria | 1027 |
| 1633 | Ga0501075_0548757 | 3300049591 | Bacteria | 882 |
| 1634 | Ga0501075_0615475 | 3300049591 | Bacteria | 828 |
| 1635 | Ga0501075_0623844 | 3300049591 | Bacteria | 822 |
| 1636 | Ga0501075_1054144 | 3300049591 | Bacteria | 618 |
| 1637 | Ga0501075_1063491 | 3300049591 | Unclassified | 615 |
| 1638 | Ga0501075_1490276 | 3300049591 | Bacteria | 512 |
| 1639 | Ga0501076_0030599 | 3300049592 | Bacteria | 4194 |
| 1640 | Ga0501076_0096285 | 3300049592 | Bacteria | 2384 |
| 1641 | Ga0501076_0097039 | 3300049592 | Bacteria | 2374 |
| 1642 | Ga0501076_0188263 | 3300049592 | Bacteria | 1684 |
| 1643 | Ga0501076_0426680 | 3300049592 | Bacteria | 1091 |
| 1644 | Ga0501076_0784002 | 3300049592 | Bacteria | 786 |
| 1645 | Ga0501076_1555012 | 3300049592 | Bacteria | 543 |
| 1646 | Ga0501077_0003447 | 3300049593 | Bacteria | 9494 |
| 1647 | Ga0501077_0473189 | 3300049593 | Bacteria | 803 |
| 1648 | Ga0501077_0998915 | 3300049593 | Bacteria | 538 |
| 1649 | Ga0501239_074332 | 3300049672 | Bacteria | 534 |
| 1650 | Ga0501079_0017355 | 3300049741 | Bacteria | 5497 |
| 1651 | Ga0501079_0054292 | 3300049741 | Bacteria | 3090 |
| 1652 | Ga0501079_0835370 | 3300049741 | Bacteria | 725 |
| 1653 | Ga0501079_0913027 | 3300049741 | Bacteria | 691 |
| 1654 | Ga0501079_1042750 | 3300049741 | Unclassified | 644 |
| 1655 | Ga0501079_1191539 | 3300049741 | Bacteria | 600 |
| 1656 | Ga0501080_0002929 | 3300049742 | Bacteria | 14986 |
| 1657 | Ga0501080_0081516 | 3300049742 | Bacteria | 3006 |
| 1658 | Ga0501080_0381705 | 3300049742 | Bacteria | 1269 |
| 1659 | Ga0501080_0470097 | 3300049742 | Bacteria | 1126 |
| 1660 | Ga0501080_0479753 | 3300049742 | Bacteria | 1112 |
| 1661 | Ga0501080_0527302 | 3300049742 | Bacteria | 1053 |
| 1662 | Ga0501080_0718908 | 3300049742 | Bacteria | 880 |
| 1663 | Ga0501080_0899735 | 3300049742 | Bacteria | 771 |
| 1664 | Ga0501080_0985762 | 3300049742 | Unclassified | 731 |
| 1665 | Ga0501080_1536214 | 3300049742 | Bacteria | 565 |
| 1666 | Ga0501081_0043611 | 3300049743 | Bacteria | 3077 |
| 1667 | Ga0501081_0144026 | 3300049743 | Bacteria | 1709 |
| 1668 | Ga0501081_0221862 | 3300049743 | Bacteria | 1375 |
| 1669 | Ga0501081_0821543 | 3300049743 | Bacteria | 700 |
| 1670 | Ga0501081_1172509 | 3300049743 | Unclassified | 582 |
| 1671 | Ga0501081_1275723 | 3300049743 | Bacteria | 557 |
| 1672 | Ga0501081_1517895 | 3300049743 | Unclassified | 509 |
| 1673 | Ga0501083_0001641 | 3300049744 | Bacteria | 15288 |
| 1674 | Ga0501083_0018057 | 3300049744 | Bacteria | 4917 |
| 1675 | Ga0501083_0482396 | 3300049744 | Bacteria | 807 |
| 1676 | Ga0501083_1088099 | 3300049744 | Bacteria | 520 |
| 1677 | Ga0501264_050188 | 3300049761 | Unclassified | 536 |
| 1678 | Ga0501035_0093385 | 3300049822 | Bacteria | 2647 |
| 1679 | Ga0501035_0133944 | 3300049822 | Bacteria | 2158 |
| 1680 | Ga0501035_0325801 | 3300049822 | Bacteria | 1290 |
| 1681 | Ga0501035_0556853 | 3300049822 | Bacteria | 938 |
| 1682 | Ga0501044_0363190 | 3300049823 | Bacteria | 1365 |
| 1683 | Ga0501044_0366745 | 3300049823 | Bacteria | 1357 |
| 1684 | Ga0501044_0481852 | 3300049823 | Bacteria | 1143 |
| 1685 | Ga0501045_0017615 | 3300049824 | Bacteria | 5072 |
| 1686 | Ga0501045_0283618 | 3300049824 | Bacteria | 1233 |
| 1687 | Ga0501045_0302496 | 3300049824 | Bacteria | 1190 |
| 1688 | Ga0501045_0350635 | 3300049824 | Bacteria | 1099 |
| 1689 | Ga0501045_0452346 | 3300049824 | Bacteria | 955 |
| 1690 | Ga0501045_0506155 | 3300049824 | Bacteria | 897 |
| 1691 | Ga0501045_0524142 | 3300049824 | Bacteria | 880 |
| 1692 | Ga0501045_0529824 | 3300049824 | Bacteria | 874 |
| 1693 | Ga0501045_0765585 | 3300049824 | Unclassified | 711 |
| 1694 | nmdc:mga03683_443163_c1 | 3300050489 | Bacteria | 624 |
| 1695 | nmdc:mga00v17_73139_c1 | 3300050491 | Bacteria | 2128 |
| 1696 | nmdc:mga0k408_674722_c1 | 3300050493 | Bacteria | 607 |
| 1697 | nmdc:mga06z11_188732_c1 | 3300050494 | Bacteria | 1192 |
| 1698 | nmdc:mga06z11_326994_c1 | 3300050494 | Bacteria | 915 |
| 1699 | nmdc:mga05p37_109876_c1 | 3300050507 | Bacteria | 3392 |
| 1700 | nmdc:mga05p37_118924_c1 | 3300050507 | Bacteria | 3246 |
| 1701 | nmdc:mga05p37_1750951_c1 | 3300050507 | Unclassified | 603 |
| 1702 | nmdc:mga05p37_1847883_c1 | 3300050507 | Unclassified | 580 |
| 1703 | nmdc:mga05p37_41377_c1 | 3300050507 | Bacteria | 5657 |
| 1704 | nmdc:mga05p37_46174_c1 | 3300050507 | Bacteria | 5356 |
| 1705 | nmdc:mga05p37_47256_c1 | 3300050507 | Bacteria | 5293 |
| 1706 | nmdc:mga05p37_4780_c1 | 3300050507 | Bacteria | 15829 |
| 1707 | nmdc:mga05p37_53114_c1 | 3300050507 | Bacteria | 4984 |
| 1708 | nmdc:mga05p37_57671_c1 | 3300050507 | Bacteria | 4782 |
| 1709 | nmdc:mga05p37_677596_c1 | 3300050507 | Bacteria | 1150 |
| 1710 | nmdc:mga05p37_797992_c1 | 3300050507 | Bacteria | 1033 |
| 1711 | nmdc:mga05p37_899457_c1 | 3300050507 | Bacteria | 955 |
| 1712 | nmdc:mga09592_105683_c1 | 3300050508 | Bacteria | 2414 |
| 1713 | nmdc:mga09592_1643765_c1 | 3300050508 | Unclassified | 519 |
| 1714 | nmdc:mga09592_190457_c1 | 3300050508 | Bacteria | 1775 |
| 1715 | nmdc:mga09592_503142_c1 | 3300050508 | Bacteria | 1043 |
| 1716 | nmdc:mga09592_553601_c1 | 3300050508 | Bacteria | 988 |
| 1717 | nmdc:mga09592_575050_c1 | 3300050508 | Bacteria | 967 |
| 1718 | nmdc:mga09592_62189_c1 | 3300050508 | Bacteria | 3158 |
| 1719 | nmdc:mga09592_727192_c1 | 3300050508 | Bacteria | 843 |
| 1720 | nmdc:mga09592_793782_c1 | 3300050508 | Bacteria | 801 |
| 1721 | nmdc:mga09592_865648_c1 | 3300050508 | Bacteria | 761 |
| 1722 | nmdc:mga09592_882974_c1 | 3300050508 | Bacteria | 752 |
| 1723 | nmdc:mga09592_971713_c1 | 3300050508 | Bacteria | 711 |
| 1724 | nmdc:mga0qj67_1223402_c1 | 3300050509 | Unclassified | 584 |
| 1725 | nmdc:mga0qj67_405257_c1 | 3300050509 | Bacteria | 1100 |
| 1726 | nmdc:mga0qj67_653838_c1 | 3300050509 | Bacteria | 838 |
| 1727 | nmdc:mga0qj67_696887_c1 | 3300050509 | Bacteria | 808 |
| 1728 | nmdc:mga0qj67_81878_c1 | 3300050509 | Bacteria | 2588 |
| 1729 | nmdc:mga06r32_1056133_c1 | 3300050510 | Bacteria | 763 |
| 1730 | nmdc:mga06r32_1199249_c1 | 3300050510 | Bacteria | 705 |
| 1731 | nmdc:mga06r32_1714715_c1 | 3300050510 | Bacteria | 565 |
| 1732 | nmdc:mga06r32_191283_c1 | 3300050510 | Bacteria | 2034 |
| 1733 | nmdc:mga06r32_363545_c1 | 3300050510 | Bacteria | 1431 |
| 1734 | nmdc:mga06r32_433021_c1 | 3300050510 | Bacteria | 1296 |
| 1735 | nmdc:mga06r32_5062_c1 | 3300050510 | Bacteria | 11871 |
| 1736 | nmdc:mga06r32_553473_c1 | 3300050510 | Bacteria | 1124 |
| 1737 | nmdc:mga06r32_752753_c1 | 3300050510 | Bacteria | 937 |
| 1738 | nmdc:mga08y16_1056722_c1 | 3300050511 | Bacteria | 789 |
| 1739 | nmdc:mga08y16_10892_c1 | 3300050511 | Bacteria | 9552 |
| 1740 | nmdc:mga08y16_114634_c1 | 3300050511 | Bacteria | 2806 |
| 1741 | nmdc:mga08y16_143136_c1 | 3300050511 | Bacteria | 2486 |
| 1742 | nmdc:mga08y16_1457408_c1 | 3300050511 | Unclassified | 646 |
| 1743 | nmdc:mga08y16_15360_c1 | 3300050511 | Bacteria | 8052 |
| 1744 | nmdc:mga08y16_155_c1 | 3300050511 | Bacteria | 31746 |
| 1745 | nmdc:mga08y16_1678353_c1 | 3300050511 | Bacteria | 591 |
| 1746 | nmdc:mga08y16_1713107_c1 | 3300050511 | Unclassified | 584 |
| 1747 | nmdc:mga08y16_2007610_c1 | 3300050511 | Unclassified | 527 |
| 1748 | nmdc:mga08y16_21126_c1 | 3300050511 | Bacteria | 6873 |
| 1749 | nmdc:mga08y16_237147_c1 | 3300050511 | Bacteria | 1886 |
| 1750 | nmdc:mga08y16_23754_c1 | 3300050511 | Bacteria | 6472 |
| 1751 | nmdc:mga08y16_24_c1 | 3300050511 | Bacteria | 240846 |
| 1752 | nmdc:mga08y16_436097_c1 | 3300050511 | Bacteria | 1338 |
| 1753 | nmdc:mga08y16_456982_c1 | 3300050511 | Bacteria | 1302 |
| 1754 | nmdc:mga08y16_499998_c1 | 3300050511 | Bacteria | 1235 |
| 1755 | nmdc:mga08y16_62090_c1 | 3300050511 | Bacteria | 3902 |
| 1756 | nmdc:mga08y16_83665_c1 | 3300050511 | Bacteria | 3326 |
| 1757 | nmdc:mga08y16_857_c1 | 3300050511 | Bacteria | 29190 |
| 1758 | nmdc:mga0n895_1020609_c1 | 3300050512 | Bacteria | 808 |
| 1759 | nmdc:mga0n895_1023265_c1 | 3300050512 | Bacteria | 806 |
| 1760 | nmdc:mga0n895_122638_c1 | 3300050512 | Bacteria | 2621 |
| 1761 | nmdc:mga0n895_24941_c1 | 3300050512 | Bacteria | 5643 |
| 1762 | nmdc:mga0n895_42744_c1 | 3300050512 | Bacteria | 4411 |
| 1763 | nmdc:mga0n895_453281_c1 | 3300050512 | Bacteria | 1295 |
| 1764 | nmdc:mga0n895_70978_c1 | 3300050512 | Bacteria | 3452 |
| 1765 | nmdc:mga0n895_890982_c1 | 3300050512 | Bacteria | 876 |
| 1766 | nmdc:mga0n895_915865_c1 | 3300050512 | Bacteria | 861 |
| 1767 | nmdc:mga0rr50_1261283_c1 | 3300050513 | Unclassified | 627 |
| 1768 | nmdc:mga0rr50_1428049_c1 | 3300050513 | Bacteria | 586 |
| 1769 | nmdc:mga0rr50_194483_c1 | 3300050513 | Bacteria | 1664 |
| 1770 | nmdc:mga0rr50_316460_c1 | 3300050513 | Bacteria | 1308 |
| 1771 | nmdc:mga0rr50_466778_c1 | 3300050513 | Bacteria | 1071 |
| 1772 | nmdc:mga0rr50_55978_c1 | 3300050513 | Bacteria | 2945 |
| 1773 | nmdc:mga0rr50_895615_c1 | 3300050513 | Bacteria | 757 |
| 1774 | nmdc:mga08x19_244957_c1 | 3300050514 | Bacteria | 1236 |
| 1775 | nmdc:mga0a205_101446_c1 | 3300050515 | Bacteria | 2361 |
| 1776 | nmdc:mga0a205_1042481_c1 | 3300050515 | Bacteria | 665 |
| 1777 | nmdc:mga0a205_11798_c1 | 3300050515 | Bacteria | 8064 |
| 1778 | nmdc:mga0a205_1486761_c1 | 3300050515 | Unclassified | 525 |
| 1779 | nmdc:mga0a205_26068_c1 | 3300050515 | Bacteria | 5570 |
| 1780 | nmdc:mga0a205_3001_c1 | 3300050515 | Bacteria | 14958 |
| 1781 | nmdc:mga0a205_610028_c1 | 3300050515 | Bacteria | 944 |
| 1782 | nmdc:mga0sz30_355626_c1 | 3300050516 | Unclassified | 655 |
| 1783 | Ga0495601_0056839 | 3300053077 | Bacteria | 2478 |
| 1784 | Ga0495595_0020969 | 3300053084 | Bacteria | 2850 |
| 1785 | Ga0495619_0050104 | 3300053085 | Bacteria | 2755 |
| 1786 | Ga0500646_0365488 | 3300053090 | Unclassified | 528 |
| 1787 | Ga0500651_0070019 | 3300053093 | Bacteria | 2184 |
| 1788 | Ga0500566_0229138 | 3300053094 | Bacteria | 918 |
| 1789 | Ga0500641_0005245 | 3300053096 | Bacteria | 4592 |
| 1790 | Ga0500555_000474 | 3300053103 | Bacteria | 16656 |
| 1791 | Ga0500555_187406 | 3300053103 | Unclassified | 500 |
| 1792 | Ga0500556_0017940 | 3300053104 | Bacteria | 2225 |
| 1793 | Ga0500592_002640 | 3300053116 | Bacteria | 2881 |
| 1794 | Ga0500616_0000173 | 3300053153 | Bacteria | 107646 |
| 1795 | Ga0500645_002162 | 3300053730 | Bacteria | 9009 |
| 1796 | Ga0501084_0102474 | 3300054114 | Bacteria | 2404 |
| 1797 | Ga0501084_0112746 | 3300054114 | Bacteria | 2285 |
| 1798 | Ga0501084_0201468 | 3300054114 | Bacteria | 1679 |
| 1799 | Ga0501084_0627598 | 3300054114 | Bacteria | 907 |
| 1800 | Ga0501084_0658423 | 3300054114 | Bacteria | 884 |
| 1801 | Ga0501084_0676193 | 3300054114 | Bacteria | 871 |
| 1802 | Ga0501084_1290857 | 3300054114 | Bacteria | 612 |
| 1803 | Ga0501084_1657299 | 3300054114 | Bacteria | 535 |
| 1804 | Ga0501084_1659109 | 3300054114 | Unclassified | 534 |
| 1805 | Ga0590071_000185 | 3300059421 | Bacteria | 18146 |
| 1806 | Ga0590071_006170 | 3300059421 | Bacteria | 2859 |
| 1807 | Ga0590071_057999 | 3300059421 | Bacteria | 944 |
| 1808 | Ga0590074_001499 | 3300059423 | Bacteria | 3772 |
| 1809 | Ga0590074_003905 | 3300059423 | Bacteria | 2465 |
| 1810 | Ga0590075_005471 | 3300059424 | Bacteria | 2997 |
| 1811 | Ga0590075_036305 | 3300059424 | Bacteria | 1256 |
| 1812 | Ga0590075_214664 | 3300059424 | Unclassified | 509 |
| 1813 | Ga0590077_000409 | 3300059426 | Bacteria | 12038 |
| 1814 | Ga0590077_002118 | 3300059426 | Bacteria | 4343 |
| 1815 | Ga0590077_077353 | 3300059426 | Bacteria | 764 |
| 1816 | Ga0501082_0059928 | 3300060353 | Bacteria | 3279 |
| 1817 | Ga0501082_0060712 | 3300060353 | Bacteria | 3255 |
| 1818 | Ga0501082_0063675 | 3300060353 | Bacteria | 3175 |
| 1819 | Ga0501082_0084433 | 3300060353 | Bacteria | 2739 |
| 1820 | Ga0501082_0133257 | 3300060353 | Bacteria | 2156 |
| 1821 | Ga0501082_0359409 | 3300060353 | Bacteria | 1270 |
| 1822 | Ga0501082_0480886 | 3300060353 | Bacteria | 1085 |
| 1823 | Ga0501082_1048844 | 3300060353 | Bacteria | 713 |
| 1824 | Ga0530510_0066104 | 3300061734 | Bacteria | 2621 |
| 1825 | Ga0530510_0140415 | 3300061734 | Bacteria | 1780 |
| 1826 | Ga0530510_0384027 | 3300061734 | Bacteria | 1057 |
| 1827 | Ga0530510_0547255 | 3300061734 | Bacteria | 879 |
| 1828 | Ga0530510_0682907 | 3300061734 | Unclassified | 782 |
| 1829 | Ga0530510_0838453 | 3300061734 | Bacteria | 702 |
| 1830 | Ga0530510_0933859 | 3300061734 | Bacteria | 663 |
| 1831 | Ga0530510_1145237 | 3300061734 | Unclassified | 596 |
| 1832 | Ga0530510_1201710 | 3300061734 | Bacteria | 581 |
| 1833 | Ga0530510_1203047 | 3300061734 | Bacteria | 581 |
| 1834 | Ga0530510_1286432 | 3300061734 | Bacteria | 561 |
| 1835 | Ga0307412_11181199 | |||
| 1836 | JGI24746J21847_1018452 | |||
| 1837 | JGI24750J21931_1007440 | |||
| 1838 | JGI24749J21850_1017130 | |||
| 1839 | JGI24033J26618_1013460 | |||
| 1840 | JGI24742J22300_10045979 | |||
| 1841 | JGI24751J29686_10011336 | |||
| 1842 | Ga0058859_10144798 | |||
| 1843 | Ga0058859_11738670 | |||
| 1844 | Ga0058861_11446860 | |||
| 1845 | Ga0058860_12002057 | |||
| 1846 | Ga0065714_10081807 | |||
| 1847 | Ga0065714_10361047 | |||
| 1848 | Ga0065714_10426894 | |||
| 1849 | Ga0065704_10102280 | |||
| 1850 | Ga0065704_10183591 | |||
| 1851 | Ga0065704_10206902 | |||
| 1852 | Ga0065704_10369091 | |||
| 1853 | Ga0065712_10001248 | |||
| 1854 | Ga0065712_10003550 | |||
| 1855 | Ga0065712_10007378 | |||
| 1856 | Ga0065712_10049909 | |||
| 1857 | Ga0065712_10086551 | |||
| 1858 | Ga0065712_10331248 | |||
| 1859 | Ga0065712_10784529 | |||
| 1860 | Ga0065715_10008392 | |||
| 1861 | Ga0065715_10010383 | |||
| 1862 | Ga0065715_10106703 | |||
| 1863 | Ga0065715_10336800 | |||
| 1864 | Ga0065715_10369818 | |||
| 1865 | Ga0065715_10622502 | |||
| 1866 | Ga0065715_10750970 | |||
| 1867 | Ga0065715_10869726 | |||
| 1868 | Ga0065715_11169787 | |||
| 1869 | Ga0065707_10009459 | |||
| 1870 | Ga0065707_10056515 | |||
| 1871 | Ga0065707_10060645 | |||
| 1872 | Ga0065707_10138907 | |||
| 1873 | Ga0065707_10173153 | |||
| 1874 | Ga0065707_10182556 | |||
| 1875 | Ga0065707_10186529 | |||
| 1876 | Ga0065707_10278564 | |||
| 1877 | Ga0065707_10326011 | |||
| 1878 | Ga0070658_10963565 | |||
| 1879 | Ga0070658_11195499 | |||
| 1880 | Ga0070676_10046078 | |||
| 1881 | Ga0070676_10066138 | |||
| 1882 | Ga0070676_10066427 | |||
| 1883 | Ga0070676_10125499 | |||
| 1884 | Ga0070676_10149939 | |||
| 1885 | Ga0070676_10297697 | |||
| 1886 | Ga0070676_10326103 | |||
| 1887 | Ga0070676_10465502 | |||
| 1888 | Ga0070676_11440404 | |||
| 1889 | Ga0070683_100045854 | |||
| 1890 | Ga0070683_100786914 | |||
| 1891 | Ga0070683_101399426 | |||
| 1892 | Ga0070683_101703368 | |||
| 1893 | Ga0070690_100024114 | |||
| 1894 | Ga0070690_100056265 | |||
| 1895 | Ga0070690_100058004 | |||
| 1896 | Ga0070690_100196725 | |||
| 1897 | Ga0070690_100482927 | |||
| 1898 | Ga0070690_100751155 | |||
| 1899 | Ga0070690_101109985 | |||
| 1900 | Ga0070690_101372775 | |||
| 1901 | Ga0070670_100018641 | |||
| 1902 | Ga0070670_100021447 | |||
| 1903 | Ga0070670_100050331 | |||
| 1904 | Ga0070670_100093752 | |||
| 1905 | Ga0070670_100102390 | |||
| 1906 | Ga0070670_100118076 | |||
| 1907 | Ga0070670_100214598 | |||
| 1908 | Ga0070670_100217335 | |||
| 1909 | Ga0070670_100259725 | |||
| 1910 | Ga0070670_100274762 | |||
| 1911 | Ga0070670_100590930 | |||
| 1912 | Ga0070670_100661890 | |||
| 1913 | Ga0070670_100889588 | |||
| 1914 | Ga0070670_100928772 | |||
| 1915 | Ga0070670_101380550 | |||
| 1916 | Ga0070677_10014195 | |||
| 1917 | Ga0070677_10028050 | |||
| 1918 | Ga0070677_10064898 | |||
| 1919 | Ga0070677_10188750 | |||
| 1920 | Ga0070677_10230946 | |||
| 1921 | Ga0070677_10317725 | |||
| 1922 | Ga0070677_10389593 | |||
| 1923 | Ga0070677_10486353 | |||
| 1924 | Ga0070677_10614163 | |||
| 1925 | Ga0068869_100037386 | |||
| 1926 | Ga0068869_100111756 | |||
| 1927 | Ga0068869_100168315 | |||
| 1928 | Ga0068869_100263061 | |||
| 1929 | Ga0068869_100446673 | |||
| 1930 | Ga0068869_100580908 | |||
| 1931 | Ga0068869_100966245 | |||
| 1932 | Ga0068869_101303403 | |||
| 1933 | Ga0070666_10036918 | |||
| 1934 | Ga0070666_10081248 | |||
| 1935 | Ga0070666_10158036 | |||
| 1936 | Ga0070666_10210239 | |||
| 1937 | Ga0070666_10327026 | |||
| 1938 | Ga0070666_10636161 | |||
| 1939 | Ga0070666_10815005 | |||
| 1940 | Ga0070680_100340821 | |||
| 1941 | Ga0070680_100354454 | |||
| 1942 | Ga0070680_100524897 | |||
| 1943 | Ga0070680_100808429 | |||
| 1944 | Ga0070680_101784776 | |||
| 1945 | Ga0070682_100710619 | |||
| 1946 | Ga0070682_101123057 | |||
| 1947 | Ga0070682_101299781 | |||
| 1948 | Ga0068868_100088677 | |||
| 1949 | Ga0068868_100149500 | |||
| 1950 | Ga0068868_100283184 | |||
| 1951 | Ga0068868_100355242 | |||
| 1952 | Ga0068868_100380992 | |||
| 1953 | Ga0068868_101805901 | |||
| 1954 | Ga0068868_102211889 | |||
| 1955 | Ga0070660_100971691 | |||
| 1956 | Ga0070689_100063350 | |||
| 1957 | Ga0070689_100087017 | |||
| 1958 | Ga0070689_100132175 | |||
| 1959 | Ga0070689_100145366 | |||
| 1960 | Ga0070689_100217622 | |||
| 1961 | Ga0070689_100227667 | |||
| 1962 | Ga0070689_100299583 | |||
| 1963 | Ga0070689_100328948 | |||
| 1964 | Ga0070689_100349992 | |||
| 1965 | Ga0070689_100409239 | |||
| 1966 | Ga0070689_100585490 | |||
| 1967 | Ga0070689_100597513 | |||
| 1968 | Ga0070689_100618407 | |||
| 1969 | Ga0070689_101330603 | |||
| 1970 | Ga0070689_102181286 | |||
| 1971 | Ga0070691_10429881 | |||
| 1972 | Ga0070691_10588800 | |||
| 1973 | Ga0070687_100009294 | |||
| 1974 | Ga0070687_100064511 | |||
| 1975 | Ga0070687_100068909 | |||
| 1976 | Ga0070687_100154415 | |||
| 1977 | Ga0070687_100325191 | |||
| 1978 | Ga0070687_100335092 | |||
| 1979 | Ga0070687_100679539 | |||
| 1980 | Ga0070661_100054032 | |||
| 1981 | Ga0070661_100166374 | |||
| 1982 | Ga0070661_100300423 | |||
| 1983 | Ga0070661_100616109 | |||
| 1984 | Ga0070661_100890316 | |||
| 1985 | Ga0070692_10124946 | |||
| 1986 | Ga0070692_10412887 | |||
| 1987 | Ga0070692_10658937 | |||
| 1988 | Ga0070692_10854314 | |||
| 1989 | Ga0070668_100041626 | |||
| 1990 | Ga0070668_100050799 | |||
| 1991 | Ga0070668_100131846 | |||
| 1992 | Ga0070668_100314381 | |||
| 1993 | Ga0070668_100444833 | |||
| 1994 | Ga0070668_100514748 | |||
| 1995 | Ga0070668_100891361 | |||
| 1996 | Ga0070668_101645891 | |||
| 1997 | Ga0070669_100001695 | |||
| 1998 | Ga0070669_100004188 | |||
| 1999 | Ga0070669_100054214 | |||
| 2000 | Ga0070669_100170870 | |||
| 2001 | Ga0070669_100177016 | |||
| 2002 | Ga0070669_100217306 | |||
| 2003 | Ga0070669_100459208 | |||
| 2004 | Ga0070669_100611455 | |||
| 2005 | Ga0070669_100758525 | |||
| 2006 | Ga0070669_100834094 | |||
| 2007 | Ga0070669_101016797 | |||
| 2008 | Ga0070669_101404393 | |||
| 2009 | Ga0070669_101547891 | |||
| 2010 | Ga0070669_101713945 | |||
| 2011 | Ga0070675_100015584 | |||
| 2012 | Ga0070675_100051728 | |||
| 2013 | Ga0070675_100054827 | |||
| 2014 | Ga0070675_100060492 | |||
| 2015 | Ga0070675_100061239 | |||
| 2016 | Ga0070675_100095940 | |||
| 2017 | Ga0070675_100096375 | |||
| 2018 | Ga0070675_100107421 | |||
| 2019 | Ga0070675_100124649 | |||
| 2020 | Ga0070675_100135858 | |||
| 2021 | Ga0070675_100145573 | |||
| 2022 | Ga0070675_100161027 | |||
| 2023 | Ga0070675_100194769 | |||
| 2024 | Ga0070675_100255515 | |||
| 2025 | Ga0070675_100310605 | |||
| 2026 | Ga0070675_100459749 | |||
| 2027 | Ga0070675_100940801 | |||
| 2028 | Ga0070675_100998122 | |||
| 2029 | Ga0070675_101145696 | |||
| 2030 | Ga0070675_101592946 | |||
| 2031 | Ga0070675_101670075 | |||
| 2032 | Ga0070675_102032377 | |||
| 2033 | Ga0070671_100023005 | |||
| 2034 | Ga0070671_100164618 | |||
| 2035 | Ga0070671_100220359 | |||
| 2036 | Ga0070671_100302905 | |||
| 2037 | Ga0070671_100429744 | |||
| 2038 | Ga0070671_100890876 | |||
| 2039 | Ga0070671_100932897 | |||
| 2040 | Ga0070671_101107136 | |||
| 2041 | Ga0070671_101800649 | |||
| 2042 | Ga0070674_100049213 | |||
| 2043 | Ga0070674_100203958 | |||
| 2044 | Ga0070674_100237783 | |||
| 2045 | Ga0070674_100301950 | |||
| 2046 | Ga0070674_100651683 | |||
| 2047 | Ga0070674_100784490 | |||
| 2048 | Ga0070674_101172945 | |||
| 2049 | Ga0070674_101281767 | |||
| 2050 | Ga0070674_101754680 | |||
| 2051 | Ga0070673_100004781 | |||
| 2052 | Ga0070673_100053702 | |||
| 2053 | Ga0070673_100076722 | |||
| 2054 | Ga0070673_100099675 | |||
| 2055 | Ga0070673_100149769 | |||
| 2056 | Ga0070673_100170983 | |||
| 2057 | Ga0070673_100246112 | |||
| 2058 | Ga0070673_100429437 | |||
| 2059 | Ga0070673_100770633 | |||
| 2060 | Ga0070673_100876566 | |||
| 2061 | Ga0070673_100978917 | |||
| 2062 | Ga0070673_101888936 | |||
| 2063 | Ga0070688_100009618 | |||
| 2064 | Ga0070688_100027588 | |||
| 2065 | Ga0070688_100031158 | |||
| 2066 | Ga0070688_100043135 | |||
| 2067 | Ga0070688_100069077 | |||
| 2068 | Ga0070688_100415928 | |||
| 2069 | Ga0070688_100711716 | |||
| 2070 | Ga0070688_101034941 | |||
| 2071 | Ga0070688_101225107 | |||
| 2072 | Ga0070688_101334721 | |||
| 2073 | Ga0070688_101459728 | |||
| 2074 | Ga0070688_101785077 | |||
| 2075 | Ga0070659_100479777 | |||
| 2076 | Ga0070667_100093786 | |||
| 2077 | Ga0070667_100515864 | |||
| 2078 | Ga0070667_100737417 | |||
| 2079 | Ga0070667_100891161 | |||
| 2080 | Ga0070667_100932694 | |||
| 2081 | Ga0070667_102020533 | |||
| 2082 | Ga0070703_10039292 | |||
| 2083 | Ga0070703_10350784 | |||
| 2084 | Ga0070709_10325334 | |||
| 2085 | Ga0070709_11708770 | |||
| 2086 | Ga0070714_100072180 | |||
| 2087 | Ga0070710_10631472 | |||
| 2088 | Ga0070701_10071626 | |||
| 2089 | Ga0070701_10077450 | |||
| 2090 | Ga0070701_10094914 | |||
| 2091 | Ga0070701_10265411 | |||
| 2092 | Ga0070701_11319443 | |||
| 2093 | Ga0070711_100080066 | |||
| 2094 | Ga0070705_100050319 | |||
| 2095 | Ga0070705_100080693 | |||
| 2096 | Ga0070705_100254835 | |||
| 2097 | Ga0070705_100360085 | |||
| 2098 | Ga0070705_100472577 | |||
| 2099 | Ga0070705_100800366 | |||
| 2100 | Ga0070705_100953109 | |||
| 2101 | Ga0070705_101152192 | |||
| 2102 | Ga0070700_100082208 | |||
| 2103 | Ga0070700_100102200 | |||
| 2104 | Ga0070700_100206269 | |||
| 2105 | Ga0070700_100343072 | |||
| 2106 | Ga0070700_101616157 | |||
| 2107 | Ga0070694_100041640 | |||
| 2108 | Ga0070694_100049109 | |||
| 2109 | Ga0070694_100391817 | |||
| 2110 | Ga0070694_100494101 | |||
| 2111 | Ga0070694_100714513 | |||
| 2112 | Ga0070694_100930958 | |||
| 2113 | Ga0070694_101212734 | |||
| 2114 | Ga0070694_101539681 | |||
| 2115 | Ga0070708_100142445 | |||
| 2116 | Ga0070708_100869875 | |||
| 2117 | Ga0070663_100347654 | |||
| 2118 | Ga0070663_100679774 | |||
| 2119 | Ga0070663_101277492 | |||
| 2120 | Ga0070663_101630192 | |||
| 2121 | Ga0070663_102093419 | |||
| 2122 | Ga0070678_100062889 | |||
| 2123 | Ga0070678_100136342 | |||
| 2124 | Ga0070678_100232037 | |||
| 2125 | Ga0070678_100275124 | |||
| 2126 | Ga0070678_100297794 | |||
| 2127 | Ga0070678_100348308 | |||
| 2128 | Ga0070678_100463952 | |||
| 2129 | Ga0070678_100501424 | |||
| 2130 | Ga0070678_100932795 | |||
| 2131 | Ga0070678_101151037 | |||
| 2132 | Ga0070662_100026522 | |||
| 2133 | Ga0070662_100297893 | |||
| 2134 | Ga0070662_100622989 | |||
| 2135 | Ga0070662_100669242 | |||
| 2136 | Ga0070662_100756938 | |||
| 2137 | Ga0070662_100795234 | |||
| 2138 | Ga0070662_101707090 | |||
| 2139 | Ga0070662_101710276 | |||
| 2140 | Ga0070681_11702359 | |||
| 2141 | Ga0068867_100007115 | |||
| 2142 | Ga0068867_100077745 | |||
| 2143 | Ga0068867_100117902 | |||
| 2144 | Ga0068867_100221530 | |||
| 2145 | Ga0068867_100286576 | |||
| 2146 | Ga0068867_100374425 | |||
| 2147 | Ga0068867_100759914 | |||
| 2148 | Ga0068867_101328039 | |||
| 2149 | Ga0068867_101539616 | |||
| 2150 | Ga0068867_101868940 | |||
| 2151 | Ga0068867_101954588 | |||
| 2152 | Ga0070685_10033929 | |||
| 2153 | Ga0070685_10051449 | |||
| 2154 | Ga0070685_10054882 | |||
| 2155 | Ga0070685_10341175 | |||
| 2156 | Ga0070685_10425373 | |||
| 2157 | Ga0070685_10582793 | |||
| 2158 | Ga0070685_10713423 | |||
| 2159 | Ga0070685_11075852 | |||
| 2160 | Ga0070706_100352903 | |||
| 2161 | Ga0070706_100453721 | |||
| 2162 | Ga0070706_100650535 | |||
| 2163 | Ga0070707_100108107 | |||
| 2164 | Ga0070707_100267194 | |||
| 2165 | Ga0070707_100483491 | |||
| 2166 | Ga0070698_100003045 | |||
| 2167 | Ga0070698_100048029 | |||
| 2168 | Ga0070698_100109178 | |||
| 2169 | Ga0070698_100224314 | |||
| 2170 | Ga0070698_100301721 | |||
| 2171 | Ga0070698_100316979 | |||
| 2172 | Ga0070698_100509229 | |||
| 2173 | Ga0070698_100937981 | |||
| 2174 | Ga0070698_100966352 | |||
| 2175 | Ga0070698_101188617 | |||
| 2176 | Ga0070699_100000410 | |||
| 2177 | Ga0070699_100040500 | |||
| 2178 | Ga0070699_100084034 | |||
| 2179 | Ga0070699_100113437 | |||
| 2180 | Ga0070679_101071302 | |||
| 2181 | Ga0070679_101178875 | |||
| 2182 | Ga0070684_100276538 | |||
| 2183 | Ga0070684_100375159 | |||
| 2184 | Ga0070684_100513072 | |||
| 2185 | Ga0070684_101681197 | |||
| 2186 | Ga0070684_102338093 | |||
| 2187 | Ga0070697_100048428 | |||
| 2188 | Ga0070697_100150612 | |||
| 2189 | Ga0070697_100352285 | |||
| 2190 | Ga0070697_100456897 | |||
| 2191 | Ga0070697_100738092 | |||
| 2192 | Ga0068853_100486487 | |||
| 2193 | Ga0068853_101331646 | |||
| 2194 | Ga0068853_101451471 | |||
| 2195 | Ga0068853_101505033 | |||
| 2196 | Ga0068853_101624470 | |||
| 2197 | Ga0068853_101754175 | |||
| 2198 | Ga0068853_101933491 | |||
| 2199 | Ga0070672_100010895 | |||
| 2200 | Ga0070672_100017126 | |||
| 2201 | Ga0070672_100028528 | |||
| 2202 | Ga0070672_100040121 | |||
| 2203 | Ga0070672_100089424 | |||
| 2204 | Ga0070672_100097051 | |||
| 2205 | Ga0070672_100105396 | |||
| 2206 | Ga0070672_100128201 | |||
| 2207 | Ga0070672_100196448 | |||
| 2208 | Ga0070672_100262712 | |||
| 2209 | Ga0070672_100519258 | |||
| 2210 | Ga0070672_101161992 | |||
| 2211 | Ga0070686_100033093 | |||
| 2212 | Ga0070686_100101518 | |||
| 2213 | Ga0070686_100106200 | |||
| 2214 | Ga0070686_100185638 | |||
| 2215 | Ga0070686_100195342 | |||
| 2216 | Ga0070686_100253036 | |||
| 2217 | Ga0070686_100356906 | |||
| 2218 | Ga0070686_100425832 | |||
| 2219 | Ga0070686_101126279 | |||
| 2220 | Ga0070686_101166699 | |||
| 2221 | Ga0070686_101726916 | |||
| 2222 | Ga0070695_100082054 | |||
| 2223 | Ga0070695_100491232 | |||
| 2224 | Ga0070695_100930039 | |||
| 2225 | Ga0070695_101045731 | |||
| 2226 | Ga0070696_100013777 | |||
| 2227 | Ga0070696_100019197 | |||
| 2228 | Ga0070696_100094763 | |||
| 2229 | Ga0070696_100119854 | |||
| 2230 | Ga0070696_100317539 | |||
| 2231 | Ga0070696_101114969 | |||
| 2232 | Ga0070693_100120878 | |||
| 2233 | Ga0070693_100127012 | |||
| 2234 | Ga0070693_100611803 | |||
| 2235 | Ga0070693_101631974 | |||
| 2236 | Ga0070665_100029874 | |||
| 2237 | Ga0070665_100131653 | |||
| 2238 | Ga0070665_100854492 | |||
| 2239 | Ga0070665_101052046 | |||
| 2240 | Ga0070665_101866308 | |||
| 2241 | Ga0070665_102425244 | |||
| 2242 | Ga0070704_100046141 | |||
| 2243 | Ga0070704_100414770 | |||
| 2244 | Ga0070704_100444089 | |||
| 2245 | Ga0070704_100577289 | |||
| 2246 | Ga0070704_100772165 | |||
| 2247 | Ga0070704_101327164 | |||
| 2248 | Ga0070704_101416780 | |||
| 2249 | Ga0070704_102071170 | |||
| 2250 | Ga0068855_101792482 | |||
| 2251 | Ga0070664_100006932 | |||
| 2252 | Ga0070664_100021515 | |||
| 2253 | Ga0070664_100587983 | |||
| 2254 | Ga0070664_100930181 | |||
| 2255 | Ga0070664_101495934 | |||
| 2256 | Ga0070664_101719250 | |||
| 2257 | Ga0070664_101920454 | |||
| 2258 | Ga0068857_100075415 | |||
| 2259 | Ga0068857_100135256 | |||
| 2260 | Ga0068857_100378849 | |||
| 2261 | Ga0068857_100518418 | |||
| 2262 | Ga0068857_100620944 | |||
| 2263 | Ga0068857_100655754 | |||
| 2264 | Ga0068857_100967011 | |||
| 2265 | Ga0068857_102213938 | |||
| 2266 | Ga0068854_100588839 | |||
| 2267 | Ga0068854_100956536 | |||
| 2268 | Ga0068856_100854639 | |||
| 2269 | Ga0070702_101273778 | |||
| 2270 | Ga0070702_101491565 | |||
| 2271 | Ga0070702_101533741 | |||
| 2272 | Ga0068852_100296798 | |||
| 2273 | Ga0068852_101304063 | |||
| 2274 | Ga0068852_101699304 | |||
| 2275 | Ga0068852_102696191 | |||
| 2276 | Ga0068859_100094444 | |||
| 2277 | Ga0068859_100163281 | |||
| 2278 | Ga0068859_100177615 | |||
| 2279 | Ga0068859_100215905 | |||
| 2280 | Ga0068859_100297773 | |||
| 2281 | Ga0068859_100363417 | |||
| 2282 | Ga0068859_100398784 | |||
| 2283 | Ga0068859_100555295 | |||
| 2284 | Ga0068859_100574147 | |||
| 2285 | Ga0068859_100577590 | |||
| 2286 | Ga0068859_101045159 | |||
| 2287 | Ga0068859_101280639 | |||
| 2288 | Ga0068859_101789123 | |||
| 2289 | Ga0068859_102217852 | |||
| 2290 | Ga0068859_102858845 | |||
| 2291 | Ga0068864_100017656 | |||
| 2292 | Ga0068864_100025389 | |||
| 2293 | Ga0068864_100101893 | |||
| 2294 | Ga0068864_100177479 | |||
| 2295 | Ga0068864_100565157 | |||
| 2296 | Ga0068864_100691413 | |||
| 2297 | Ga0068864_100721607 | |||
| 2298 | Ga0068864_101455232 | |||
| 2299 | Ga0068866_10049465 | |||
| 2300 | Ga0068866_10421328 | |||
| 2301 | Ga0068866_10855560 | |||
| 2302 | Ga0068861_100007625 | |||
| 2303 | Ga0068861_100051559 | |||
| 2304 | Ga0068861_100099472 | |||
| 2305 | Ga0068861_100154579 | |||
| 2306 | Ga0068861_100272989 | |||
| 2307 | Ga0068861_100307769 | |||
| 2308 | Ga0068861_100589657 | |||
| 2309 | Ga0068861_100613853 | |||
| 2310 | Ga0068861_100616500 | |||
| 2311 | Ga0068861_100717886 | |||
| 2312 | Ga0068861_100905169 | |||
| 2313 | Ga0068861_101701625 | |||
| 2314 | Ga0068851_10147928 | |||
| 2315 | Ga0068851_10450713 | |||
| 2316 | Ga0068870_10046546 | |||
| 2317 | Ga0068870_10092027 | |||
| 2318 | Ga0068870_10186931 | |||
| 2319 | Ga0068870_10209083 | |||
| 2320 | Ga0068870_10221388 | |||
| 2321 | Ga0068870_10365982 | |||
| 2322 | Ga0068870_10948933 | |||
| 2323 | Ga0068870_10975874 | |||
| 2324 | Ga0068863_100098441 | |||
| 2325 | Ga0068863_100172370 | |||
| 2326 | Ga0068863_100215365 | |||
| 2327 | Ga0068863_100767052 | |||
| 2328 | Ga0068863_100957671 | |||
| 2329 | Ga0068863_100968778 | |||
| 2330 | Ga0068863_102705671 | |||
| 2331 | Ga0068858_100067583 | |||
| 2332 | Ga0068858_100315846 | |||
| 2333 | Ga0068858_101767450 | |||
| 2334 | Ga0068860_100051780 | |||
| 2335 | Ga0068860_100100645 | |||
| 2336 | Ga0068860_100540325 | |||
| 2337 | Ga0068860_100614609 | |||
| 2338 | Ga0068860_100905906 | |||
| 2339 | Ga0068862_100005694 | |||
| 2340 | Ga0068862_100028432 | |||
| 2341 | Ga0068862_100099165 | |||
| 2342 | Ga0068862_100105656 | |||
| 2343 | Ga0068862_100176656 | |||
| 2344 | Ga0068862_100210268 | |||
| 2345 | Ga0068862_100245086 | |||
| 2346 | Ga0068862_100323771 | |||
| 2347 | Ga0068862_100379175 | |||
| 2348 | Ga0068862_100986130 | |||
| 2349 | Ga0068862_101089333 | |||
| 2350 | Ga0068862_101141762 | |||
| 2351 | Ga0068862_101569489 | |||
| 2352 | Ga0081539_10093982 | |||
| 2353 | Ga0081539_10120194 | |||
| 2354 | Ga0081539_10343290 | |||
| 2355 | Ga0075364_10395594 | |||
| 2356 | Ga0075432_10083665 | |||
| 2357 | Ga0075432_10333510 | |||
| 2358 | Ga0075362_10315248 | |||
| 2359 | Ga0075367_10153789 | |||
| 2360 | Ga0075367_10279071 | |||
| 2361 | Ga0075369_10176581 | |||
| 2362 | Ga0075366_10750146 | |||
| 2363 | Ga0097621_100041201 | |||
| 2364 | Ga0097621_100245466 | |||
| 2365 | Ga0097621_100558140 | |||
| 2366 | Ga0097621_100670793 | |||
| 2367 | Ga0097621_100720569 | |||
| 2368 | Ga0097621_100758682 | |||
| 2369 | Ga0097621_100918877 | |||
| 2370 | Ga0097621_101147201 | |||
| 2371 | Ga0068871_100138289 | |||
| 2372 | Ga0068871_100245321 | |||
| 2373 | Ga0068871_100386821 | |||
| 2374 | Ga0068871_100387839 | |||
| 2375 | Ga0068871_100725337 | |||
| 2376 | Ga0068871_100831205 | |||
| 2377 | Ga0068871_101501525 | |||
| 2378 | Ga0068871_102384753 | |||
| 2379 | Ga0075428_100050644 | |||
| 2380 | Ga0075428_100064389 | |||
| 2381 | Ga0075428_100482558 | |||
| 2382 | Ga0075428_100507780 | |||
| 2383 | Ga0075428_100903384 | |||
| 2384 | Ga0075428_101644042 | |||
| 2385 | Ga0075428_101805209 | |||
| 2386 | Ga0075428_102741668 | |||
| 2387 | Ga0075430_100051093 | |||
| 2388 | Ga0075430_100349244 | |||
| 2389 | Ga0075430_100435622 | |||
| 2390 | Ga0075430_101000877 | |||
| 2391 | Ga0075430_101109444 | |||
| 2392 | Ga0075431_100342053 | |||
| 2393 | Ga0075431_100358741 | |||
| 2394 | Ga0075431_100653711 | |||
| 2395 | Ga0075431_100878662 | |||
| 2396 | Ga0075431_101243465 | |||
| 2397 | Ga0075431_101257139 | |||
| 2398 | Ga0075431_101389606 | |||
| 2399 | Ga0075431_101424798 | |||
| 2400 | Ga0075431_101624564 | |||
| 2401 | Ga0075433_10031425 | |||
| 2402 | Ga0075433_10049363 | |||
| 2403 | Ga0075433_10094661 | |||
| 2404 | Ga0075433_10513948 | |||
| 2405 | Ga0075433_11251270 | |||
| 2406 | Ga0075434_100009524 | |||
| 2407 | Ga0075434_100041869 | |||
| 2408 | Ga0075434_100051377 | |||
| 2409 | Ga0075434_100178264 | |||
| 2410 | Ga0075434_100479684 | |||
| 2411 | Ga0075434_100486030 | |||
| 2412 | Ga0075434_100861886 | |||
| 2413 | Ga0075434_100911247 | |||
| 2414 | Ga0075429_100096662 | |||
| 2415 | Ga0075429_100103496 | |||
| 2416 | Ga0075429_100241379 | |||
| 2417 | Ga0075429_100417003 | |||
| 2418 | Ga0075429_100553917 | |||
| 2419 | Ga0075429_100623424 | |||
| 2420 | Ga0075429_100902988 | |||
| 2421 | Ga0075429_101100159 | |||
| 2422 | Ga0075429_101143629 | |||
| 2423 | Ga0068865_100029531 | |||
| 2424 | Ga0068865_100082989 | |||
| 2425 | Ga0068865_100211485 | |||
| 2426 | Ga0068865_100249052 | |||
| 2427 | Ga0068865_100390130 | |||
| 2428 | Ga0068865_100545437 | |||
| 2429 | Ga0068865_100640299 | |||
| 2430 | Ga0068865_101397575 | |||
| 2431 | Ga0097620_100094443 | |||
| 2432 | Ga0097620_100163282 | |||
| 2433 | Ga0097620_100177608 | |||
| 2434 | Ga0097620_100215906 | |||
| 2435 | Ga0097620_100297786 | |||
| 2436 | Ga0097620_100363411 | |||
| 2437 | Ga0097620_100398814 | |||
| 2438 | Ga0097620_100555295 | |||
| 2439 | Ga0097620_100574117 | |||
| 2440 | Ga0097620_100577572 | |||
| 2441 | Ga0097620_101045166 | |||
| 2442 | Ga0097620_101280705 | |||
| 2443 | Ga0097620_101789156 | |||
| 2444 | Ga0097620_102217736 | |||
| 2445 | Ga0097620_102859523 | |||
| 2446 | Ga0075435_100030022 | |||
| 2447 | Ga0075435_100035522 | |||
| 2448 | Ga0075435_100219317 | |||
| 2449 | Ga0075435_100705494 | |||
| 2450 | Ga0075435_100984479 | |||
| 2451 | Ga0105251_10129059 | |||
| 2452 | Ga0105240_10860696 | |||
| 2453 | Ga0111539_10000022 | |||
| 2454 | Ga0111539_10011587 | |||
| 2455 | Ga0111539_10016960 | |||
| 2456 | Ga0111539_10020412 | |||
| 2457 | Ga0111539_10038949 | |||
| 2458 | Ga0111539_10060616 | |||
| 2459 | Ga0111539_10093953 | |||
| 2460 | Ga0111539_10094028 | |||
| 2461 | Ga0111539_10096365 | |||
| 2462 | Ga0111539_10124915 | |||
| 2463 | Ga0111539_10186761 | |||
| 2464 | Ga0111539_10343329 | |||
| 2465 | Ga0111539_10356252 | |||
| 2466 | Ga0111539_10625895 | |||
| 2467 | Ga0111539_10669866 | |||
| 2468 | Ga0111539_11237906 | |||
| 2469 | Ga0111539_11561240 | |||
| 2470 | Ga0111539_11636433 | |||
| 2471 | Ga0105245_10534897 | |||
| 2472 | Ga0105245_11774666 | |||
| 2473 | Ga0105245_12177127 | |||
| 2474 | Ga0105247_10491103 | |||
| 2475 | Ga0105247_10614382 | |||
| 2476 | Ga0114129_10000347 | |||
| 2477 | Ga0114129_10099209 | |||
| 2478 | Ga0114129_10112432 | |||
| 2479 | Ga0114129_10127914 | |||
| 2480 | Ga0114129_10155999 | |||
| 2481 | Ga0114129_10335272 | |||
| 2482 | Ga0114129_10365442 | |||
| 2483 | Ga0114129_10570723 | |||
| 2484 | Ga0114129_11333380 | |||
| 2485 | Ga0114129_12149301 | |||
| 2486 | Ga0114129_12289375 | |||
| 2487 | Ga0114129_12679517 | |||
| 2488 | Ga0114129_13167744 | |||
| 2489 | Ga0105243_10415087 | |||
| 2490 | Ga0105243_10680075 | |||
| 2491 | Ga0105243_10824662 | |||
| 2492 | Ga0105243_10851112 | |||
| 2493 | Ga0105243_11969759 | |||
| 2494 | Ga0105241_10551489 | |||
| 2495 | Ga0105241_11181354 | |||
| 2496 | Ga0105241_12606581 | |||
| 2497 | Ga0105242_10017209 | |||
| 2498 | Ga0105242_10233821 | |||
| 2499 | Ga0105242_10541334 | |||
| 2500 | Ga0105242_11159447 | |||
| 2501 | Ga0105242_12002415 | |||
| 2502 | Ga0105242_12170720 | |||
| 2503 | Ga0105242_12817721 | |||
| 2504 | Ga0105242_13043874 | |||
| 2505 | Ga0105248_10056636 | |||
| 2506 | Ga0105248_10079088 | |||
| 2507 | Ga0105248_10080672 | |||
| 2508 | Ga0105248_10267172 | |||
| 2509 | Ga0105248_10732259 | |||
| 2510 | Ga0105248_11066436 | |||
| 2511 | Ga0105248_11068481 | |||
| 2512 | Ga0105248_11141015 | |||
| 2513 | Ga0105248_11429122 | |||
| 2514 | Ga0105248_11547317 | |||
| 2515 | Ga0105248_11691538 | |||
| 2516 | Ga0105248_12672212 | |||
| 2517 | Ga0105248_13092880 | |||
| 2518 | Ga0105248_13280198 | |||
| 2519 | Ga0105237_11682159 | |||
| 2520 | Ga0105238_10470717 | |||
| 2521 | Ga0105238_10773601 | |||
| 2522 | Ga0105238_11049974 | |||
| 2523 | Ga0105238_11873331 | |||
| 2524 | Ga0105238_12077594 | |||
| 2525 | Ga0105249_10002497 | |||
| 2526 | Ga0105249_10107564 | |||
| 2527 | Ga0105249_10461379 | |||
| 2528 | Ga0105249_10810041 | |||
| 2529 | Ga0105249_11061096 | |||
| 2530 | Ga0105249_11090846 | |||
| 2531 | Ga0105249_11262717 | |||
| 2532 | Ga0105249_11526766 | |||
| 2533 | Ga0105249_12060926 | |||
| 2534 | Ga0105249_12522217 | |||
| 2535 | Ga0105249_12576532 | |||
| 2536 | Ga0105239_10307992 | |||
| 2537 | Ga0105239_11117270 | |||
| 2538 | Ga0105246_10031115 | |||
| 2539 | Ga0105246_10150505 | |||
| 2540 | Ga0105246_10217071 | |||
| 2541 | Ga0105246_10480845 | |||
| 2542 | Ga0105246_11982578 | |||
| 2543 | Ga0157320_1021337 | |||
| 2544 | Ga0157371_11405210 | |||
| 2545 | Ga0157370_10585481 | |||
| 2546 | Ga0157370_11955614 | |||
| 2547 | Ga0157374_10769752 | |||
| 2548 | Ga0157374_11494180 | |||
| 2549 | Ga0157374_12782376 | |||
| 2550 | Ga0157378_10041397 | |||
| 2551 | Ga0157378_10282027 | |||
| 2552 | Ga0157378_10520558 | |||
| 2553 | Ga0157378_11155418 | |||
| 2554 | Ga0157378_11169186 | |||
| 2555 | Ga0157378_11454617 | |||
| 2556 | Ga0157378_11707885 | |||
| 2557 | Ga0163162_10110629 | |||
| 2558 | Ga0163162_10241507 | |||
| 2559 | Ga0163162_10555372 | |||
| 2560 | Ga0163162_10560668 | |||
| 2561 | Ga0163162_10681974 | |||
| 2562 | Ga0163162_13130520 | |||
| 2563 | Ga0157372_10472557 | |||
| 2564 | Ga0157372_12268506 | |||
| 2565 | Ga0157372_12691611 | |||
| 2566 | Ga0157375_10045218 | |||
| 2567 | Ga0157375_10108054 | |||
| 2568 | Ga0157375_10368902 | |||
| 2569 | Ga0157375_10459187 | |||
| 2570 | Ga0157375_10849380 | |||
| 2571 | Ga0157375_11382986 | |||
| 2572 | Ga0157375_11386560 | |||
| 2573 | Ga0157375_11843593 | |||
| 2574 | Ga0163163_10139158 | |||
| 2575 | Ga0163163_10151677 | |||
| 2576 | Ga0163163_10151697 | |||
| 2577 | Ga0163163_10280293 | |||
| 2578 | Ga0163163_10297928 | |||
| 2579 | Ga0163163_10413866 | |||
| 2580 | Ga0163163_10417503 | |||
| 2581 | Ga0163163_10580692 | |||
| 2582 | Ga0163163_11440715 | |||
| 2583 | Ga0163163_12068736 | |||
| 2584 | Ga0163163_12206948 | |||
| 2585 | Ga0157380_10073014 | |||
| 2586 | Ga0157380_10097483 | |||
| 2587 | Ga0157380_10100236 | |||
| 2588 | Ga0157380_10159144 | |||
| 2589 | Ga0157380_10196477 | |||
| 2590 | Ga0157380_10211826 | |||
| 2591 | Ga0157380_10255335 | |||
| 2592 | Ga0157380_10384754 | |||
| 2593 | Ga0157380_10523056 | |||
| 2594 | Ga0157380_10674012 | |||
| 2595 | Ga0157380_11180447 | |||
| 2596 | Ga0157380_12017076 | |||
| 2597 | Ga0157380_12864853 | |||
| 2598 | Ga0157377_10036942 | |||
| 2599 | Ga0157377_10059630 | |||
| 2600 | Ga0157377_10063624 | |||
| 2601 | Ga0157377_10157856 | |||
| 2602 | Ga0157377_10161812 | |||
| 2603 | Ga0157377_10396167 | |||
| 2604 | Ga0157377_10510770 | |||
| 2605 | Ga0157377_10800274 | |||
| 2606 | Ga0157379_10686136 | |||
| 2607 | Ga0157379_11639639 | |||
| 2608 | Ga0157379_11807288 | |||
| 2609 | Ga0157376_10342775 | |||
| 2610 | Ga0157376_10342878 | |||
| 2611 | Ga0157376_11944284 | |||
| 2612 | Ga0157376_12347706 | |||
| 2613 | Ga0163161_10043217 | |||
| 2614 | Ga0163161_10089562 | |||
| 2615 | Ga0163161_10256956 | |||
| 2616 | Ga0163161_10453501 | |||
| 2617 | Ga0163161_11165475 | |||
| 2618 | Ga0163161_11221940 | |||
| 2619 | Ga0163161_11735508 | |||
| 2620 | Ga0207666_1022593 | |||
| 2621 | Ga0207666_1029636 | |||
| 2622 | Ga0207697_10061477 | |||
| 2623 | Ga0207697_10123798 | |||
| 2624 | Ga0207697_10458423 | |||
| 2625 | Ga0207656_10042282 | |||
| 2626 | Ga0207656_10173683 | |||
| 2627 | Ga0207653_10047496 | |||
| 2628 | Ga0207682_10008298 | |||
| 2629 | Ga0207682_10022877 | |||
| 2630 | Ga0207682_10032433 | |||
| 2631 | Ga0207682_10094660 | |||
| 2632 | Ga0207682_10175976 | |||
| 2633 | Ga0207682_10222777 | |||
| 2634 | Ga0207642_10007429 | |||
| 2635 | Ga0207642_10065961 | |||
| 2636 | Ga0207642_10826821 | |||
| 2637 | Ga0207642_11072030 | |||
| 2638 | Ga0207710_10550786 | |||
| 2639 | Ga0207710_10648649 | |||
| 2640 | Ga0207688_10021891 | |||
| 2641 | Ga0207688_10042125 | |||
| 2642 | Ga0207688_10171731 | |||
| 2643 | Ga0207688_10174485 | |||
| 2644 | Ga0207688_10387914 | |||
| 2645 | Ga0207680_10036371 | |||
| 2646 | Ga0207680_10404310 | |||
| 2647 | Ga0207680_10678445 | |||
| 2648 | Ga0207680_11096015 | |||
| 2649 | Ga0207647_10035432 | |||
| 2650 | Ga0207647_10174709 | |||
| 2651 | Ga0207647_10320023 | |||
| 2652 | Ga0207647_10711538 | |||
| 2653 | Ga0207645_10006334 | |||
| 2654 | Ga0207645_10041691 | |||
| 2655 | Ga0207645_10105648 | |||
| 2656 | Ga0207645_10130873 | |||
| 2657 | Ga0207645_10238486 | |||
| 2658 | Ga0207643_10000779 | |||
| 2659 | Ga0207643_10006374 | |||
| 2660 | Ga0207643_10019206 | |||
| 2661 | Ga0207643_10067697 | |||
| 2662 | Ga0207643_10117620 | |||
| 2663 | Ga0207643_10271794 | |||
| 2664 | Ga0207643_10451009 | |||
| 2665 | Ga0207643_10490467 | |||
| 2666 | Ga0207643_11066764 | |||
| 2667 | Ga0207684_10119840 | |||
| 2668 | Ga0207684_10266249 | |||
| 2669 | Ga0207684_10270772 | |||
| 2670 | Ga0207684_10492828 | |||
| 2671 | Ga0207684_10826961 | |||
| 2672 | Ga0207654_11014782 | |||
| 2673 | Ga0207707_10119861 | |||
| 2674 | Ga0207707_11647363 | |||
| 2675 | Ga0207695_11592089 | |||
| 2676 | Ga0207663_10068407 | |||
| 2677 | Ga0207660_10211528 | |||
| 2678 | Ga0207660_10398144 | |||
| 2679 | Ga0207662_10024681 | |||
| 2680 | Ga0207662_10026096 | |||
| 2681 | Ga0207662_10026380 | |||
| 2682 | Ga0207662_10083025 | |||
| 2683 | Ga0207662_10111905 | |||
| 2684 | Ga0207662_10113337 | |||
| 2685 | Ga0207662_10146245 | |||
| 2686 | Ga0207662_10780637 | |||
| 2687 | Ga0207657_10287679 | |||
| 2688 | Ga0207657_11123370 | |||
| 2689 | Ga0207649_10202158 | |||
| 2690 | Ga0207649_10207324 | |||
| 2691 | Ga0207649_10298647 | |||
| 2692 | Ga0207649_11028301 | |||
| 2693 | Ga0207649_11323790 | |||
| 2694 | Ga0207652_10632478 | |||
| 2695 | Ga0207652_11294357 | |||
| 2696 | Ga0207646_10098457 | |||
| 2697 | Ga0207646_10168958 | |||
| 2698 | Ga0207646_10408629 | |||
| 2699 | Ga0207646_11014694 | |||
| 2700 | Ga0207681_10009786 | |||
| 2701 | Ga0207681_10018531 | |||
| 2702 | Ga0207681_10033636 | |||
| 2703 | Ga0207681_10106052 | |||
| 2704 | Ga0207681_10121710 | |||
| 2705 | Ga0207681_10242856 | |||
| 2706 | Ga0207681_10281990 | |||
| 2707 | Ga0207681_10339095 | |||
| 2708 | Ga0207681_10371818 | |||
| 2709 | Ga0207681_11512156 | |||
| 2710 | Ga0207681_11693186 | |||
| 2711 | Ga0207694_10394504 | |||
| 2712 | Ga0207694_10524476 | |||
| 2713 | Ga0207650_10016401 | |||
| 2714 | Ga0207650_10022979 | |||
| 2715 | Ga0207650_10049788 | |||
| 2716 | Ga0207650_10065531 | |||
| 2717 | Ga0207650_10075185 | |||
| 2718 | Ga0207650_10096722 | |||
| 2719 | Ga0207650_10145737 | |||
| 2720 | Ga0207650_10201161 | |||
| 2721 | Ga0207650_10225381 | |||
| 2722 | Ga0207650_10266136 | |||
| 2723 | Ga0207650_10272464 | |||
| 2724 | Ga0207650_10514616 | |||
| 2725 | Ga0207650_10721752 | |||
| 2726 | Ga0207650_11469697 | |||
| 2727 | Ga0207659_10008566 | |||
| 2728 | Ga0207659_10016498 | |||
| 2729 | Ga0207659_10019803 | |||
| 2730 | Ga0207659_10024682 | |||
| 2731 | Ga0207659_10036598 | |||
| 2732 | Ga0207659_10052678 | |||
| 2733 | Ga0207659_10057590 | |||
| 2734 | Ga0207659_10089981 | |||
| 2735 | Ga0207659_10099974 | |||
| 2736 | Ga0207659_10118008 | |||
| 2737 | Ga0207659_10145019 | |||
| 2738 | Ga0207659_10179141 | |||
| 2739 | Ga0207659_10255341 | |||
| 2740 | Ga0207659_10289889 | |||
| 2741 | Ga0207659_10565633 | |||
| 2742 | Ga0207659_11122612 | |||
| 2743 | Ga0207659_11453423 | |||
| 2744 | Ga0207687_10152201 | |||
| 2745 | Ga0207687_10887121 | |||
| 2746 | Ga0207664_10051260 | |||
| 2747 | Ga0207644_10007454 | |||
| 2748 | Ga0207644_10124374 | |||
| 2749 | Ga0207644_10493688 | |||
| 2750 | Ga0207644_10523107 | |||
| 2751 | Ga0207644_10567850 | |||
| 2752 | Ga0207644_10808070 | |||
| 2753 | Ga0207690_10380451 | |||
| 2754 | Ga0207690_10406292 | |||
| 2755 | Ga0207690_10531846 | |||
| 2756 | Ga0207706_10054050 | |||
| 2757 | Ga0207706_10065085 | |||
| 2758 | Ga0207706_10117070 | |||
| 2759 | Ga0207706_10274212 | |||
| 2760 | Ga0207706_10347113 | |||
| 2761 | Ga0207706_10458203 | |||
| 2762 | Ga0207706_10572318 | |||
| 2763 | Ga0207706_10655850 | |||
| 2764 | Ga0207706_10746583 | |||
| 2765 | Ga0207686_10975502 | |||
| 2766 | Ga0207686_10977123 | |||
| 2767 | Ga0207686_11273401 | |||
| 2768 | Ga0207709_10574696 | |||
| 2769 | Ga0207709_11122363 | |||
| 2770 | Ga0207709_11210150 | |||
| 2771 | Ga0207670_10028280 | |||
| 2772 | Ga0207670_10095121 | |||
| 2773 | Ga0207670_10105701 | |||
| 2774 | Ga0207670_10155151 | |||
| 2775 | Ga0207670_10192203 | |||
| 2776 | Ga0207670_10218459 | |||
| 2777 | Ga0207670_10239831 | |||
| 2778 | Ga0207670_10395806 | |||
| 2779 | Ga0207670_10502102 | |||
| 2780 | Ga0207670_10609363 | |||
| 2781 | Ga0207670_11271064 | |||
| 2782 | Ga0207670_11406229 | |||
| 2783 | Ga0207670_11658189 | |||
| 2784 | Ga0207670_11663909 | |||
| 2785 | Ga0207670_11716843 | |||
| 2786 | Ga0207669_10003495 | |||
| 2787 | Ga0207669_10049329 | |||
| 2788 | Ga0207669_10051157 | |||
| 2789 | Ga0207669_10071985 | |||
| 2790 | Ga0207669_10080634 | |||
| 2791 | Ga0207669_10410160 | |||
| 2792 | Ga0207669_10428088 | |||
| 2793 | Ga0207669_10783839 | |||
| 2794 | Ga0207669_10846222 | |||
| 2795 | Ga0207669_11025628 | |||
| 2796 | Ga0207704_10001666 | |||
| 2797 | Ga0207704_10033546 | |||
| 2798 | Ga0207704_10110723 | |||
| 2799 | Ga0207704_10128770 | |||
| 2800 | Ga0207704_10139997 | |||
| 2801 | Ga0207704_10246796 | |||
| 2802 | Ga0207704_10300938 | |||
| 2803 | Ga0207704_10375071 | |||
| 2804 | Ga0207704_10586858 | |||
| 2805 | Ga0207704_11456447 | |||
| 2806 | Ga0207665_10899013 | |||
| 2807 | Ga0207691_10008380 | |||
| 2808 | Ga0207691_10025426 | |||
| 2809 | Ga0207691_10062682 | |||
| 2810 | Ga0207691_10063187 | |||
| 2811 | Ga0207691_10109315 | |||
| 2812 | Ga0207691_10116984 | |||
| 2813 | Ga0207691_10245721 | |||
| 2814 | Ga0207691_10268896 | |||
| 2815 | Ga0207691_10442543 | |||
| 2816 | Ga0207691_10727437 | |||
| 2817 | Ga0207691_10868875 | |||
| 2818 | Ga0207691_11005028 | |||
| 2819 | Ga0207691_11658043 | |||
| 2820 | Ga0207711_10074530 | |||
| 2821 | Ga0207711_10124168 | |||
| 2822 | Ga0207711_10522571 | |||
| 2823 | Ga0207711_10745590 | |||
| 2824 | Ga0207711_10981591 | |||
| 2825 | Ga0207711_11060519 | |||
| 2826 | Ga0207711_11144173 | |||
| 2827 | Ga0207689_10003297 | |||
| 2828 | Ga0207689_10031671 | |||
| 2829 | Ga0207689_10082951 | |||
| 2830 | Ga0207689_10188716 | |||
| 2831 | Ga0207689_10288734 | |||
| 2832 | Ga0207689_10351151 | |||
| 2833 | Ga0207689_10367272 | |||
| 2834 | Ga0207689_10627568 | |||
| 2835 | Ga0207689_11758690 | |||
| 2836 | Ga0207661_10375461 | |||
| 2837 | Ga0207661_10929512 | |||
| 2838 | Ga0207661_11045004 | |||
| 2839 | Ga0207679_10011160 | |||
| 2840 | Ga0207679_10034050 | |||
| 2841 | Ga0207679_10174994 | |||
| 2842 | Ga0207679_10412275 | |||
| 2843 | Ga0207679_10521218 | |||
| 2844 | Ga0207679_11178987 | |||
| 2845 | Ga0207667_10326294 | |||
| 2846 | Ga0207667_10927006 | |||
| 2847 | Ga0207651_10039797 | |||
| 2848 | Ga0207651_10050613 | |||
| 2849 | Ga0207651_10105045 | |||
| 2850 | Ga0207651_10130056 | |||
| 2851 | Ga0207651_10157351 | |||
| 2852 | Ga0207651_10164989 | |||
| 2853 | Ga0207651_10201874 | |||
| 2854 | Ga0207651_10209206 | |||
| 2855 | Ga0207651_10226377 | |||
| 2856 | Ga0207651_10527762 | |||
| 2857 | Ga0207651_10548354 | |||
| 2858 | Ga0207651_11169827 | |||
| 2859 | Ga0207651_11175831 | |||
| 2860 | Ga0207651_11468334 | |||
| 2861 | Ga0207651_11710830 | |||
| 2862 | Ga0207712_10087286 | |||
| 2863 | Ga0207712_10255450 | |||
| 2864 | Ga0207712_10568063 | |||
| 2865 | Ga0207712_10968645 | |||
| 2866 | Ga0207668_10104977 | |||
| 2867 | Ga0207668_10153272 | |||
| 2868 | Ga0207668_10300522 | |||
| 2869 | Ga0207668_10431638 | |||
| 2870 | Ga0207668_10778916 | |||
| 2871 | Ga0207668_11588349 | |||
| 2872 | Ga0207668_12048637 | |||
| 2873 | Ga0207640_10102635 | |||
| 2874 | Ga0207640_10984325 | |||
| 2875 | Ga0207640_11493960 | |||
| 2876 | Ga0207658_10333029 | |||
| 2877 | Ga0207658_10459577 | |||
| 2878 | Ga0207658_11167469 | |||
| 2879 | Ga0207658_12073336 | |||
| 2880 | Ga0207658_12185527 | |||
| 2881 | Ga0207677_10118297 | |||
| 2882 | Ga0207677_10374986 | |||
| 2883 | Ga0207677_11047456 | |||
| 2884 | Ga0207677_11777601 | |||
| 2885 | Ga0207677_11984741 | |||
| 2886 | Ga0207703_10040180 | |||
| 2887 | Ga0207703_10094200 | |||
| 2888 | Ga0207703_10096653 | |||
| 2889 | Ga0207703_10216693 | |||
| 2890 | Ga0207703_10728115 | |||
| 2891 | Ga0207639_10707718 | |||
| 2892 | Ga0207639_10776766 | |||
| 2893 | Ga0207639_10895294 | |||
| 2894 | Ga0207639_10898206 | |||
| 2895 | Ga0207639_11073338 | |||
| 2896 | Ga0207639_11855519 | |||
| 2897 | Ga0207678_10164710 | |||
| 2898 | Ga0207678_10184887 | |||
| 2899 | Ga0207678_10270276 | |||
| 2900 | Ga0207678_10778337 | |||
| 2901 | Ga0207678_10985876 | |||
| 2902 | Ga0207678_11040103 | |||
| 2903 | Ga0207678_11709944 | |||
| 2904 | Ga0207708_10033437 | |||
| 2905 | Ga0207708_10164251 | |||
| 2906 | Ga0207708_10283773 | |||
| 2907 | Ga0207708_10373188 | |||
| 2908 | Ga0207708_10578750 | |||
| 2909 | Ga0207708_10600569 | |||
| 2910 | Ga0207702_11135528 | |||
| 2911 | Ga0207641_10023412 | |||
| 2912 | Ga0207641_10044873 | |||
| 2913 | Ga0207641_10206991 | |||
| 2914 | Ga0207641_10267522 | |||
| 2915 | Ga0207641_10339217 | |||
| 2916 | Ga0207641_10424233 | |||
| 2917 | Ga0207641_10535482 | |||
| 2918 | Ga0207641_11460470 | |||
| 2919 | Ga0207641_12118841 | |||
| 2920 | Ga0207641_12517398 | |||
| 2921 | Ga0207648_10013253 | |||
| 2922 | Ga0207648_10031574 | |||
| 2923 | Ga0207648_10043517 | |||
| 2924 | Ga0207648_10067266 | |||
| 2925 | Ga0207648_10068907 | |||
| 2926 | Ga0207648_10400712 | |||
| 2927 | Ga0207648_10487043 | |||
| 2928 | Ga0207648_11032497 | |||
| 2929 | Ga0207648_11415124 | |||
| 2930 | Ga0207648_11592081 | |||
| 2931 | Ga0207676_10009598 | |||
| 2932 | Ga0207676_10051943 | |||
| 2933 | Ga0207676_10094690 | |||
| 2934 | Ga0207676_10138140 | |||
| 2935 | Ga0207676_10181229 | |||
| 2936 | Ga0207676_10263177 | |||
| 2937 | Ga0207676_10642355 | |||
| 2938 | Ga0207676_10888555 | |||
| 2939 | Ga0207676_11049133 | |||
| 2940 | Ga0207676_11557311 | |||
| 2941 | Ga0207674_10043290 | |||
| 2942 | Ga0207674_10155775 | |||
| 2943 | Ga0207674_10167293 | |||
| 2944 | Ga0207674_10167578 | |||
| 2945 | Ga0207674_10168727 | |||
| 2946 | Ga0207674_10455516 | |||
| 2947 | Ga0207674_10513872 | |||
| 2948 | Ga0207674_10705895 | |||
| 2949 | Ga0207674_11174325 | |||
| 2950 | Ga0207675_100081350 | |||
| 2951 | Ga0207675_100200600 | |||
| 2952 | Ga0207675_100222886 | |||
| 2953 | Ga0207675_100324227 | |||
| 2954 | Ga0207675_100421939 | |||
| 2955 | Ga0207675_100646575 | |||
| 2956 | Ga0207675_100836133 | |||
| 2957 | Ga0207675_101062663 | |||
| 2958 | Ga0207675_101111647 | |||
| 2959 | Ga0207675_101376818 | |||
| 2960 | Ga0207675_101611041 | |||
| 2961 | Ga0207675_101617451 | |||
| 2962 | Ga0207675_101800163 | |||
| 2963 | Ga0207675_101865384 | |||
| 2964 | Ga0207675_102136321 | |||
| 2965 | Ga0207675_102514331 | |||
| 2966 | Ga0207683_10033980 | |||
| 2967 | Ga0207683_10045978 | |||
| 2968 | Ga0207683_10059237 | |||
| 2969 | Ga0207683_10107916 | |||
| 2970 | Ga0207683_10296349 | |||
| 2971 | Ga0207683_10410796 | |||
| 2972 | Ga0207683_10460454 | |||
| 2973 | Ga0207683_10868640 | |||
| 2974 | Ga0207683_11532952 | |||
| 2975 | Ga0207698_10390028 | |||
| 2976 | Ga0207698_10446247 | |||
| 2977 | Ga0207698_10702539 | |||
| 2978 | Ga0209969_1066160 | |||
| 2979 | Ga0209984_1028427 | |||
| 2980 | Ga0209995_1022168 | |||
| 2981 | Ga0210002_1056933 | |||
| 2982 | Ga0209983_1131452 | |||
| 2983 | Ga0209971_1034965 | |||
| 2984 | Ga0209966_1126289 | |||
| 2985 | Ga0209998_10086210 | |||
| 2986 | Ga0209974_10050494 | |||
| 2987 | Ga0209974_10053291 | |||
| 2988 | Ga0209974_10054945 | |||
| 2989 | Ga0207428_10000030 | |||
| 2990 | Ga0207428_10001541 | |||
| 2991 | Ga0207428_10002655 | |||
| 2992 | Ga0207428_10006221 | |||
| 2993 | Ga0207428_10007494 | |||
| 2994 | Ga0207428_10018447 | |||
| 2995 | Ga0207428_10031399 | |||
| 2996 | Ga0207428_10068173 | |||
| 2997 | Ga0207428_10070038 | |||
| 2998 | Ga0207428_10093635 | |||
| 2999 | Ga0207428_10193324 | |||
| 3000 | Ga0207428_10360338 | |||
| 3001 | Ga0207428_10458515 | |||
| 3002 | Ga0207428_10977285 | |||
| 3003 | Ga0207428_11260112 | |||
| 3004 | Ga0268266_10059995 | |||
| 3005 | Ga0268266_10502245 | |||
| 3006 | Ga0268266_10697596 | |||
| 3007 | Ga0268266_11100271 | |||
| 3008 | Ga0268266_11790377 | |||
| 3009 | Ga0268265_10000103 | |||
| 3010 | Ga0268265_10079624 | |||
| 3011 | Ga0268265_10178160 | |||
| 3012 | Ga0268265_10191296 | |||
| 3013 | Ga0268265_10227747 | |||
| 3014 | Ga0268265_10250137 | |||
| 3015 | Ga0268265_10369444 | |||
| 3016 | Ga0268265_10378502 | |||
| 3017 | Ga0268265_10517344 | |||
| 3018 | Ga0268265_10636172 | |||
| 3019 | Ga0268265_11193768 | |||
| 3020 | Ga0268265_11298042 | |||
| 3021 | Ga0268265_12160138 | |||
| 3022 | Ga0268264_10143516 | |||
| 3023 | Ga0268264_10508097 | |||
| 3024 | Ga0268264_11405868 | |||
| 3025 | Ga0268264_11966455 | |||
| 3026 | Ga0265332_10026219 | |||
| 3027 | Ga0265320_10199563 | |||
| 3028 | Ga0307408_100255993 | |||
| 3029 | Ga0307408_100299995 | |||
| 3030 | Ga0307408_100467349 | |||
| 3031 | Ga0307508_10005222 | |||
| 3032 | Ga0316575_10024684 | |||
| 3033 | Ga0316575_10050073 | |||
| 3034 | Ga0316575_10081738 | |||
| 3035 | Ga0307405_10003705 | |||
| 3036 | Ga0307405_10107432 | |||
| 3037 | Ga0307405_10976017 | |||
| 3038 | Ga0307405_11409802 | |||
| 3039 | Ga0307405_12072629 | |||
| 3040 | Ga0307413_10030140 | |||
| 3041 | Ga0307413_10036681 | |||
| 3042 | Ga0307413_10082123 | |||
| 3043 | Ga0307413_10187723 | |||
| 3044 | Ga0307413_10969115 | |||
| 3045 | Ga0307410_10009943 | |||
| 3046 | Ga0307410_10074128 | |||
| 3047 | Ga0307410_10901322 | |||
| 3048 | Ga0307410_12069957 | |||
| 3049 | Ga0307406_10082603 | |||
| 3050 | Ga0307406_10477974 | |||
| 3051 | Ga0307406_11720722 | |||
| 3052 | Ga0307407_10002685 | |||
| 3053 | Ga0307407_10120722 | |||
| 3054 | Ga0307407_10583189 | |||
| 3055 | Ga0307407_10695753 | |||
| 3056 | Ga0307407_11426786 | |||
| 3057 | Ga0307412_10024409 | |||
| 3058 | Ga0307412_10134377 | |||
| 3059 | Ga0307412_10317959 | |||
| 3060 | Ga0307412_12143772 | |||
| 3061 | Ga0307409_100009123 | |||
| 3062 | Ga0307409_100374875 | |||
| 3063 | Ga0307409_100998458 | |||
| 3064 | Ga0307409_101207696 | |||
| 3065 | Ga0307409_102404317 | |||
| 3066 | Ga0307409_102856080 | |||
| 3067 | Ga0307416_100034468 | |||
| 3068 | Ga0307416_100040037 | |||
| 3069 | Ga0307416_100103879 | |||
| 3070 | Ga0307416_100136011 | |||
| 3071 | Ga0307416_100145482 | |||
| 3072 | Ga0307416_100344206 | |||
| 3073 | Ga0307416_100352013 | |||
| 3074 | Ga0307416_101020257 | |||
| 3075 | Ga0307416_101266953 | |||
| 3076 | Ga0307416_102491719 | |||
| 3077 | Ga0307416_102724757 | |||
| 3078 | Ga0307414_10127509 | |||
| 3079 | Ga0307411_10008339 | |||
| 3080 | Ga0307411_10022570 | |||
| 3081 | Ga0307411_10054909 | |||
| 3082 | Ga0307411_10200666 | |||
| 3083 | Ga0307411_10494320 | |||
| 3084 | Ga0307411_12078154 | |||
| 3085 | Ga0307415_100000625 | |||
| 3086 | Ga0307415_100201926 | |||
| 3087 | Ga0307415_100217412 | |||
| 3088 | Ga0307415_100258590 | |||
| 3089 | Ga0316593_10037608 | |||
| 3090 | Ga0316592_1006430 | |||
| 3091 | Ga0316596_1099401 | |||
| 3092 | Ga0373930_0159836 | |||
| 3093 | Ga0373948_0067920 | |||
| 3094 | Ga0373950_0149151 | |||
| 3095 | Ga0373958_0037887 | |||
| 3096 | Ga0373928_0108665 | |||
| 3097 | Ga0373940_0004488 | |||
| 3098 | Ga0373940_0136852 | |||
| 3099 | Ga0373941_0156680 | |||
| 3100 | Ga0373945_0276235 | |||
| 3101 | Ga0373960_0037560 | |||
| 3102 | Ga0373960_0095559 | |||
| 3103 | Ga0373960_0326523 | |||
| 3104 | Ga0373943_0263924 | |||
| 3105 | Ga0373943_0438654 | |||
| 3106 | Ga0373946_0452770 | |||
| 3107 | Ga0373955_0250745 | |||
| 3108 | Ga0373961_0000555 | |||
| 3109 | Ga0373961_0113319 | |||
| 3110 | Ga0373961_0315215 | |||
| 3111 | Ga0373962_0340345 | |||
| 3112 | Ga0316574_0817223 | |||
| 3113 | Ga0373931_0052178 | |||
| 3114 | Ga0373931_0102003 | |||
| 3115 | Ga0373931_0263722 | |||
| 3116 | Ga0373935_0001807 | |||
| 3117 | Ga0373935_1226722 | |||
| 3118 | Ga0373933_0394930 | |||
| 3119 | Ga0373947_0437089 | |||
| 3120 | Ga0373937_0106842 | |||
| 3121 | Ga0373937_0247931 | |||
| 3122 | Ga0316582_0115347 | |||
| 3123 | Ga0316584_0338375 | |||
| 3124 | Ga0373925_0092638 | |||
| 3125 | Ga0373925_0861154 | |||
| 3126 | Ga0395900_0487190 | |||
| 3127 | Ga0395900_1301885 | |||
| 3128 | Ga0395905_0447983 | |||
| 3129 | Ga0395901_0357007 | |||
| 3130 | Ga0242420_039816 | |||
| 3131 | Ga0436365_0602824 | |||
| 3132 | Ga0439439_0127072 | |||
| 3133 | Ga0439439_0203325 | |||
| 3134 | Ga0439453_0004973 | |||
| 3135 | Ga0439453_0009260 | |||
| 3136 | Ga0451798_0441709 | |||
| 3137 | Ga0451802_0036363 | |||
| 3138 | Ga0451807_0925607 | |||
| 3139 | Ga0451807_1500143 | |||
| 3140 | Ga0451807_2617318 | |||
| 3141 | Ga0451833_0021962 | |||
| 3142 | Ga0451853_0405101 | |||
| 3143 | Ga0451853_1327955 | |||
| 3144 | Ga0451853_3395319 | |||
| 3145 | Ga0439431_0032722 | |||
| 3146 | Ga0439433_0019173 | |||
| 3147 | Ga0439433_0054788 | |||
| 3148 | Ga0439433_0198889 | |||
| 3149 | Ga0439448_0238953 | |||
| 3150 | Ga0439449_0158098 | |||
| 3151 | Ga0439457_070943 | |||
| 3152 | Ga0439463_132598 | |||
| 3153 | Ga0450920_020951 | |||
| 3154 | Ga0450920_037682 | |||
| 3155 | Ga0450920_054638 | |||
| 3156 | Ga0450922_014190 | |||
| 3157 | Ga0450923_007031 | |||
| 3158 | Ga0450923_008735 | |||
| 3159 | Ga0450888_041154 | |||
| 3160 | Ga0450897_003037 | |||
| 3161 | Ga0450894_007236 | |||
| 3162 | Ga0450896_006663 | |||
| 3163 | Ga0450896_025105 | |||
| 3164 | Ga0450896_027538 | |||
| 3165 | Ga0450898_054103 | |||
| 3166 | Ga0450898_078256 | |||
| 3167 | Ga0450906_010316 | |||
| 3168 | Ga0450906_018000 | |||
| 3169 | Ga0450910_017638 | |||
| 3170 | Ga0439446_0004317 | |||
| 3171 | Ga0439446_0161567 | |||
| 3172 | Ga0439446_0223750 | |||
| 3173 | Ga0439446_0255413 | |||
| 3174 | Ga0450908_020985 | |||
| 3175 | Ga0450908_056792 | |||
| 3176 | Ga0450909_024850 | |||
| 3177 | Ga0439434_0029644 | |||
| 3178 | Ga0439434_0086216 | |||
| 3179 | Ga0439434_0158538 | |||
| 3180 | Ga0439434_0322730 | |||
| 3181 | Ga0439434_0351369 | |||
| 3182 | Ga0439435_0002870 | |||
| 3183 | Ga0439435_0037434 | |||
| 3184 | Ga0439435_0079909 | |||
| 3185 | Ga0439435_0122969 | |||
| 3186 | Ga0439444_0102579 | |||
| 3187 | Ga0439444_0162817 | |||
| 3188 | Ga0439459_0059925 | |||
| 3189 | Ga0439464_0013985 | |||
| 3190 | Ga0439464_0177955 | |||
| 3191 | Ga0439460_0179778 | |||
| 3192 | Ga0439460_0189899 | |||
| 3193 | Ga0450916_004189 | |||
| 3194 | Ga0450916_036260 | |||
| 3195 | Ga0450918_017295 | |||
| 3196 | Ga0450918_072987 | |||
| 3197 | Ga0451577_0002073 | |||
| 3198 | Ga0451577_0056998 | |||
| 3199 | Ga0451577_0149104 | |||
| 3200 | Ga0451577_1389650 | |||
| 3201 | Ga0453683_0008308 | |||
| 3202 | Ga0453683_0087903 | |||
| 3203 | Ga0453683_0110040 | |||
| 3204 | Ga0453683_0164294 | |||
| 3205 | Ga0453683_1068325 | |||
| 3206 | Ga0453684_0001302 | |||
| 3207 | Ga0453684_0005988 | |||
| 3208 | Ga0453684_0007805 | |||
| 3209 | Ga0453684_0010045 | |||
| 3210 | Ga0453684_0010202 | |||
| 3211 | Ga0453684_0015471 | |||
| 3212 | Ga0453684_0021782 | |||
| 3213 | Ga0453684_0054489 | |||
| 3214 | Ga0453684_0071623 | |||
| 3215 | Ga0453684_0073174 | |||
| 3216 | Ga0453684_0088115 | |||
| 3217 | Ga0453684_0091997 | |||
| 3218 | Ga0453684_0242226 | |||
| 3219 | Ga0453684_0664534 | |||
| 3220 | Ga0451576_0018296 | |||
| 3221 | Ga0451576_0076095 | |||
| 3222 | Ga0451576_0095658 | |||
| 3223 | Ga0451576_0224355 | |||
| 3224 | Ga0451576_0469621 | |||
| 3225 | Ga0451576_0566608 | |||
| 3226 | Ga0451576_0579185 | |||
| 3227 | Ga0451576_0710087 | |||
| 3228 | Ga0451576_1076131 | |||
| 3229 | Ga0495592_0284459 | |||
| 3230 | Ga0495603_0029288 | |||
| 3231 | Ga0495603_0554194 | |||
| 3232 | Ga0495603_0804499 | |||
| 3233 | Ga0495629_0005673 | |||
| 3234 | Ga0495629_0073083 | |||
| 3235 | Ga0495638_0005447 | |||
| 3236 | Ga0495651_0202840 | |||
| 3237 | Ga0495653_0805965 | |||
| 3238 | Ga0495639_0081925 | |||
| 3239 | Ga0495584_0019196 | |||
| 3240 | Ga0495584_0215513 | |||
| 3241 | Ga0495584_0652873 | |||
| 3242 | Ga0495594_0018438 | |||
| 3243 | Ga0495594_0036034 | |||
| 3244 | Ga0495594_0831214 | |||
| 3245 | Ga0495616_0125094 | |||
| 3246 | Ga0495628_0271066 | |||
| 3247 | Ga0495630_1275279 | |||
| 3248 | Ga0495630_1506507 | |||
| 3249 | Ga0495643_0008784 | |||
| 3250 | Ga0495663_0078078 | |||
| 3251 | Ga0495642_0018422 | |||
| 3252 | Ga0495640_0239347 | |||
| 3253 | Ga0495640_0881543 | |||
| 3254 | Ga0495586_0338009 | |||
| 3255 | Ga0495598_0008945 | |||
| 3256 | Ga0495598_0024754 | |||
| 3257 | Ga0495598_0030392 | |||
| 3258 | Ga0495598_0213623 | |||
| 3259 | Ga0495609_0029836 | |||
| 3260 | Ga0495621_0048707 | |||
| 3261 | Ga0495621_0052427 | |||
| 3262 | Ga0495621_0052707 | |||
| 3263 | Ga0495621_0064146 | |||
| 3264 | Ga0495621_0082636 | |||
| 3265 | Ga0495621_0096317 | |||
| 3266 | Ga0495621_0139639 | |||
| 3267 | Ga0495621_0171725 | |||
| 3268 | Ga0495621_0208537 | |||
| 3269 | Ga0495621_0253335 | |||
| 3270 | Ga0495621_0337705 | |||
| 3271 | Ga0495597_0064623 | |||
| 3272 | Ga0495645_0850711 | |||
| 3273 | Ga0495633_0128365 | |||
| 3274 | Ga0495656_0026299 | |||
| 3275 | Ga0495656_0041979 | |||
| 3276 | Ga0495668_0483698 | |||
| 3277 | Ga0495634_0030778 | |||
| 3278 | Ga0495625_0565353 | |||
| 3279 | Ga0495659_0002901 | |||
| 3280 | Ga0495659_0038986 | |||
| 3281 | Ga0495659_0059224 | |||
| 3282 | Ga0495659_0528250 | |||
| 3283 | Ga0495588_0030049 | |||
| 3284 | Ga0495588_0144968 | |||
| 3285 | Ga0495599_0040155 | |||
| 3286 | Ga0495599_0080051 | |||
| 3287 | Ga0495599_0225211 | |||
| 3288 | Ga0495647_0091872 | |||
| 3289 | Ga0495658_0014843 | |||
| 3290 | Ga0495658_0433282 | |||
| 3291 | Ga0495669_0149254 | |||
| 3292 | Ga0495613_0037336 | |||
| 3293 | Ga0495613_0086048 | |||
| 3294 | Ga0495670_0054733 | |||
| 3295 | Ga0495670_0068283 | |||
| 3296 | Ga0495670_0221863 | |||
| 3297 | Ga0495670_0255899 | |||
| 3298 | Ga0495670_0289340 | |||
| 3299 | Ga0495649_0458284 | |||
| 3300 | Ga0495589_0165471 | |||
| 3301 | Ga0495600_0078578 | |||
| 3302 | Ga0495581_0258379 | |||
| 3303 | Ga0495581_0448746 | |||
| 3304 | Ga0495636_0002384 | |||
| 3305 | Ga0495674_1127521 | |||
| 3306 | Ga0495676_0037205 | |||
| 3307 | Ga0495680_0183904 | |||
| 3308 | Ga0495675_0192366 | |||
| 3309 | Ga0495677_0076298 | |||
| 3310 | Ga0495685_079173 | |||
| 3311 | Ga0495684_0178940 | |||
| 3312 | Ga0495615_0186658 | |||
| 3313 | Ga0496100_0181876 | |||
| 3314 | Ga0496101_0916732 | |||
| 3315 | Ga0496101_1297357 | |||
| 3316 | Ga0496102_0160456 | |||
| 3317 | Ga0496103_0139475 | |||
| 3318 | Ga0496104_0014503 | |||
| 3319 | Ga0496104_1780102 | |||
| 3320 | Ga0496105_0219764 | |||
| 3321 | Ga0496106_0035183 | |||
| 3322 | Ga0496106_0153574 | |||
| 3323 | Ga0496106_0593414 | |||
| 3324 | Ga0496106_1387369 | |||
| 3325 | Ga0496107_0537799 | |||
| 3326 | Ga0496107_1115459 | |||
| 3327 | Ga0496108_0038614 | |||
| 3328 | Ga0496109_0014351 | |||
| 3329 | Ga0496109_0329472 | |||
| 3330 | Ga0496109_1849440 | |||
| 3331 | Ga0496110_0016128 | |||
| 3332 | Ga0496111_0104468 | |||
| 3333 | Ga0496112_0060848 | |||
| 3334 | Ga0496112_1216315 | |||
| 3335 | Ga0496113_0006726 | |||
| 3336 | Ga0496113_0012466 | |||
| 3337 | Ga0496113_0867234 | |||
| 3338 | Ga0496114_0147277 | |||
| 3339 | Ga0496119_0303702 | |||
| 3340 | Ga0501311_044088 | |||
| 3341 | Ga0501031_0129474 | |||
| 3342 | Ga0501031_0307273 | |||
| 3343 | Ga0501031_0353950 | |||
| 3344 | Ga0501032_0004614 | |||
| 3345 | Ga0501032_0044742 | |||
| 3346 | Ga0501032_0097666 | |||
| 3347 | Ga0501032_0372984 | |||
| 3348 | Ga0501032_0857665 | |||
| 3349 | Ga0501033_0016362 | |||
| 3350 | Ga0501033_0083427 | |||
| 3351 | Ga0501033_0088983 | |||
| 3352 | Ga0501033_0237440 | |||
| 3353 | Ga0501033_0330914 | |||
| 3354 | Ga0501033_1049570 | |||
| 3355 | Ga0501034_0027678 | |||
| 3356 | Ga0501034_0062327 | |||
| 3357 | Ga0501034_0098622 | |||
| 3358 | Ga0501034_1406666 | |||
| 3359 | Ga0501034_1631990 | |||
| 3360 | Ga0501036_0050456 | |||
| 3361 | Ga0501036_0061909 | |||
| 3362 | Ga0501036_0092819 | |||
| 3363 | Ga0501036_0318359 | |||
| 3364 | Ga0501036_0362362 | |||
| 3365 | Ga0501036_0430563 | |||
| 3366 | Ga0501036_0488804 | |||
| 3367 | Ga0501036_1260710 | |||
| 3368 | Ga0501037_0127199 | |||
| 3369 | Ga0501037_0227392 | |||
| 3370 | Ga0501037_0272516 | |||
| 3371 | Ga0501037_0437465 | |||
| 3372 | Ga0501038_0257721 | |||
| 3373 | Ga0501038_0445254 | |||
| 3374 | Ga0501039_0048668 | |||
| 3375 | Ga0501039_0069743 | |||
| 3376 | Ga0501039_0536084 | |||
| 3377 | Ga0501039_0940828 | |||
| 3378 | Ga0501039_1179079 | |||
| 3379 | Ga0501040_0021954 | |||
| 3380 | Ga0501040_0455924 | |||
| 3381 | Ga0501040_1139639 | |||
| 3382 | Ga0501040_1263328 | |||
| 3383 | Ga0501041_0330668 | |||
| 3384 | Ga0501041_0393779 | |||
| 3385 | Ga0501041_0484357 | |||
| 3386 | Ga0501041_0958238 | |||
| 3387 | Ga0501041_1024403 | |||
| 3388 | Ga0501041_1138995 | |||
| 3389 | Ga0501042_0014342 | |||
| 3390 | Ga0501042_0098170 | |||
| 3391 | Ga0501042_0145672 | |||
| 3392 | Ga0501042_0274566 | |||
| 3393 | Ga0501042_0431742 | |||
| 3394 | Ga0501042_0490304 | |||
| 3395 | Ga0501042_0785860 | |||
| 3396 | Ga0501043_0044028 | |||
| 3397 | Ga0501043_0170384 | |||
| 3398 | Ga0501043_0258621 | |||
| 3399 | Ga0501043_0310915 | |||
| 3400 | Ga0501043_0396308 | |||
| 3401 | Ga0501046_0080851 | |||
| 3402 | Ga0501046_0175070 | |||
| 3403 | Ga0501046_0200345 | |||
| 3404 | Ga0501046_0442130 | |||
| 3405 | Ga0501046_0581355 | |||
| 3406 | Ga0501047_0008209 | |||
| 3407 | Ga0501047_0042294 | |||
| 3408 | Ga0501047_0049792 | |||
| 3409 | Ga0501047_0510311 | |||
| 3410 | Ga0501047_0514223 | |||
| 3411 | Ga0501048_0031213 | |||
| 3412 | Ga0501048_0034967 | |||
| 3413 | Ga0501048_0054991 | |||
| 3414 | Ga0501048_0057217 | |||
| 3415 | Ga0501048_0926099 | |||
| 3416 | Ga0501048_0986943 | |||
| 3417 | Ga0501048_1408237 | |||
| 3418 | Ga0501067_0039490 | |||
| 3419 | Ga0501067_0135844 | |||
| 3420 | Ga0501068_0001673 | |||
| 3421 | Ga0501068_0306694 | |||
| 3422 | Ga0501068_0896861 | |||
| 3423 | Ga0501068_1079139 | |||
| 3424 | Ga0501068_1139185 | |||
| 3425 | Ga0501069_0005714 | |||
| 3426 | Ga0501069_0068467 | |||
| 3427 | Ga0501069_0277281 | |||
| 3428 | Ga0501070_0014951 | |||
| 3429 | Ga0501070_0068084 | |||
| 3430 | Ga0501070_0156962 | |||
| 3431 | Ga0501070_0413049 | |||
| 3432 | Ga0501071_0057186 | |||
| 3433 | Ga0501071_0153379 | |||
| 3434 | Ga0501071_0209929 | |||
| 3435 | Ga0501071_0778026 | |||
| 3436 | Ga0501072_0012080 | |||
| 3437 | Ga0501072_0073635 | |||
| 3438 | Ga0501072_0081681 | |||
| 3439 | Ga0501072_0088345 | |||
| 3440 | Ga0501072_0142888 | |||
| 3441 | Ga0501072_0418137 | |||
| 3442 | Ga0501072_0542708 | |||
| 3443 | Ga0501072_0558607 | |||
| 3444 | Ga0501072_0653561 | |||
| 3445 | Ga0501072_1122208 | |||
| 3446 | Ga0501072_1189370 | |||
| 3447 | Ga0501073_0028887 | |||
| 3448 | Ga0501073_0036691 | |||
| 3449 | Ga0501073_0051646 | |||
| 3450 | Ga0501073_0135900 | |||
| 3451 | Ga0501073_0142718 | |||
| 3452 | Ga0501073_0184059 | |||
| 3453 | Ga0501073_1266474 | |||
| 3454 | Ga0501074_0020071 | |||
| 3455 | Ga0501074_0078921 | |||
| 3456 | Ga0501074_0081910 | |||
| 3457 | Ga0501074_0164982 | |||
| 3458 | Ga0501074_0392272 | |||
| 3459 | Ga0501074_1146366 | |||
| 3460 | Ga0501075_0006664 | |||
| 3461 | Ga0501075_0015646 | |||
| 3462 | Ga0501075_0086472 | |||
| 3463 | Ga0501075_0094052 | |||
| 3464 | Ga0501075_0120030 | |||
| 3465 | Ga0501075_0242640 | |||
| 3466 | Ga0501075_0414241 | |||
| 3467 | Ga0501075_0548757 | |||
| 3468 | Ga0501075_0615475 | |||
| 3469 | Ga0501075_0623844 | |||
| 3470 | Ga0501075_1054144 | |||
| 3471 | Ga0501075_1063491 | |||
| 3472 | Ga0501075_1490276 | |||
| 3473 | Ga0501076_0030599 | |||
| 3474 | Ga0501076_0096285 | |||
| 3475 | Ga0501076_0097039 | |||
| 3476 | Ga0501076_0188263 | |||
| 3477 | Ga0501076_0426680 | |||
| 3478 | Ga0501076_0784002 | |||
| 3479 | Ga0501076_1555012 | |||
| 3480 | Ga0501077_0003447 | |||
| 3481 | Ga0501077_0473189 | |||
| 3482 | Ga0501077_0998915 | |||
| 3483 | Ga0501239_074332 | |||
| 3484 | Ga0501079_0017355 | |||
| 3485 | Ga0501079_0054292 | |||
| 3486 | Ga0501079_0835370 | |||
| 3487 | Ga0501079_0913027 | |||
| 3488 | Ga0501079_1042750 | |||
| 3489 | Ga0501079_1191539 | |||
| 3490 | Ga0501080_0002929 | |||
| 3491 | Ga0501080_0081516 | |||
| 3492 | Ga0501080_0381705 | |||
| 3493 | Ga0501080_0470097 | |||
| 3494 | Ga0501080_0479753 | |||
| 3495 | Ga0501080_0527302 | |||
| 3496 | Ga0501080_0718908 | |||
| 3497 | Ga0501080_0899735 | |||
| 3498 | Ga0501080_0985762 | |||
| 3499 | Ga0501080_1536214 | |||
| 3500 | Ga0501081_0043611 | |||
| 3501 | Ga0501081_0144026 | |||
| 3502 | Ga0501081_0221862 | |||
| 3503 | Ga0501081_0821543 | |||
| 3504 | Ga0501081_1172509 | |||
| 3505 | Ga0501081_1275723 | |||
| 3506 | Ga0501081_1517895 | |||
| 3507 | Ga0501083_0001641 | |||
| 3508 | Ga0501083_0018057 | |||
| 3509 | Ga0501083_0482396 | |||
| 3510 | Ga0501083_1088099 | |||
| 3511 | Ga0501264_050188 | |||
| 3512 | Ga0501035_0093385 | |||
| 3513 | Ga0501035_0133944 | |||
| 3514 | Ga0501035_0325801 | |||
| 3515 | Ga0501035_0556853 | |||
| 3516 | Ga0501044_0363190 | |||
| 3517 | Ga0501044_0366745 | |||
| 3518 | Ga0501044_0481852 | |||
| 3519 | Ga0501045_0017615 | |||
| 3520 | Ga0501045_0283618 | |||
| 3521 | Ga0501045_0302496 | |||
| 3522 | Ga0501045_0350635 | |||
| 3523 | Ga0501045_0452346 | |||
| 3524 | Ga0501045_0506155 | |||
| 3525 | Ga0501045_0524142 | |||
| 3526 | Ga0501045_0529824 | |||
| 3527 | Ga0501045_0765585 | |||
| 3528 | nmdc:mga03683_443163_c1 | |||
| 3529 | nmdc:mga00v17_73139_c1 | |||
| 3530 | nmdc:mga0k408_674722_c1 | |||
| 3531 | nmdc:mga06z11_188732_c1 | |||
| 3532 | nmdc:mga06z11_326994_c1 | |||
| 3533 | nmdc:mga05p37_109876_c1 | |||
| 3534 | nmdc:mga05p37_118924_c1 | |||
| 3535 | nmdc:mga05p37_1750951_c1 | |||
| 3536 | nmdc:mga05p37_1847883_c1 | |||
| 3537 | nmdc:mga05p37_41377_c1 | |||
| 3538 | nmdc:mga05p37_46174_c1 | |||
| 3539 | nmdc:mga05p37_47256_c1 | |||
| 3540 | nmdc:mga05p37_4780_c1 | |||
| 3541 | nmdc:mga05p37_53114_c1 | |||
| 3542 | nmdc:mga05p37_57671_c1 | |||
| 3543 | nmdc:mga05p37_677596_c1 | |||
| 3544 | nmdc:mga05p37_797992_c1 | |||
| 3545 | nmdc:mga05p37_899457_c1 | |||
| 3546 | nmdc:mga09592_105683_c1 | |||
| 3547 | nmdc:mga09592_1643765_c1 | |||
| 3548 | nmdc:mga09592_190457_c1 | |||
| 3549 | nmdc:mga09592_503142_c1 | |||
| 3550 | nmdc:mga09592_553601_c1 | |||
| 3551 | nmdc:mga09592_575050_c1 | |||
| 3552 | nmdc:mga09592_62189_c1 | |||
| 3553 | nmdc:mga09592_727192_c1 | |||
| 3554 | nmdc:mga09592_793782_c1 | |||
| 3555 | nmdc:mga09592_865648_c1 | |||
| 3556 | nmdc:mga09592_882974_c1 | |||
| 3557 | nmdc:mga09592_971713_c1 | |||
| 3558 | nmdc:mga0qj67_1223402_c1 | |||
| 3559 | nmdc:mga0qj67_405257_c1 | |||
| 3560 | nmdc:mga0qj67_653838_c1 | |||
| 3561 | nmdc:mga0qj67_696887_c1 | |||
| 3562 | nmdc:mga0qj67_81878_c1 | |||
| 3563 | nmdc:mga06r32_1056133_c1 | |||
| 3564 | nmdc:mga06r32_1199249_c1 | |||
| 3565 | nmdc:mga06r32_1714715_c1 | |||
| 3566 | nmdc:mga06r32_191283_c1 | |||
| 3567 | nmdc:mga06r32_363545_c1 | |||
| 3568 | nmdc:mga06r32_433021_c1 | |||
| 3569 | nmdc:mga06r32_5062_c1 | |||
| 3570 | nmdc:mga06r32_553473_c1 | |||
| 3571 | nmdc:mga06r32_752753_c1 | |||
| 3572 | nmdc:mga08y16_1056722_c1 | |||
| 3573 | nmdc:mga08y16_10892_c1 | |||
| 3574 | nmdc:mga08y16_114634_c1 | |||
| 3575 | nmdc:mga08y16_143136_c1 | |||
| 3576 | nmdc:mga08y16_1457408_c1 | |||
| 3577 | nmdc:mga08y16_15360_c1 | |||
| 3578 | nmdc:mga08y16_155_c1 | |||
| 3579 | nmdc:mga08y16_1678353_c1 | |||
| 3580 | nmdc:mga08y16_1713107_c1 | |||
| 3581 | nmdc:mga08y16_2007610_c1 | |||
| 3582 | nmdc:mga08y16_21126_c1 | |||
| 3583 | nmdc:mga08y16_237147_c1 | |||
| 3584 | nmdc:mga08y16_23754_c1 | |||
| 3585 | nmdc:mga08y16_24_c1 | |||
| 3586 | nmdc:mga08y16_436097_c1 | |||
| 3587 | nmdc:mga08y16_456982_c1 | |||
| 3588 | nmdc:mga08y16_499998_c1 | |||
| 3589 | nmdc:mga08y16_62090_c1 | |||
| 3590 | nmdc:mga08y16_83665_c1 | |||
| 3591 | nmdc:mga08y16_857_c1 | |||
| 3592 | nmdc:mga0n895_1020609_c1 | |||
| 3593 | nmdc:mga0n895_1023265_c1 | |||
| 3594 | nmdc:mga0n895_122638_c1 | |||
| 3595 | nmdc:mga0n895_24941_c1 | |||
| 3596 | nmdc:mga0n895_42744_c1 | |||
| 3597 | nmdc:mga0n895_453281_c1 | |||
| 3598 | nmdc:mga0n895_70978_c1 | |||
| 3599 | nmdc:mga0n895_890982_c1 | |||
| 3600 | nmdc:mga0n895_915865_c1 | |||
| 3601 | nmdc:mga0rr50_1261283_c1 | |||
| 3602 | nmdc:mga0rr50_1428049_c1 | |||
| 3603 | nmdc:mga0rr50_194483_c1 | |||
| 3604 | nmdc:mga0rr50_316460_c1 | |||
| 3605 | nmdc:mga0rr50_466778_c1 | |||
| 3606 | nmdc:mga0rr50_55978_c1 | |||
| 3607 | nmdc:mga0rr50_895615_c1 | |||
| 3608 | nmdc:mga08x19_244957_c1 | |||
| 3609 | nmdc:mga0a205_101446_c1 | |||
| 3610 | nmdc:mga0a205_1042481_c1 | |||
| 3611 | nmdc:mga0a205_11798_c1 | |||
| 3612 | nmdc:mga0a205_1486761_c1 | |||
| 3613 | nmdc:mga0a205_26068_c1 | |||
| 3614 | nmdc:mga0a205_3001_c1 | |||
| 3615 | nmdc:mga0a205_610028_c1 | |||
| 3616 | nmdc:mga0sz30_355626_c1 | |||
| 3617 | Ga0495601_0056839 | |||
| 3618 | Ga0495595_0020969 | |||
| 3619 | Ga0495619_0050104 | |||
| 3620 | Ga0500646_0365488 | |||
| 3621 | Ga0500651_0070019 | |||
| 3622 | Ga0500566_0229138 | |||
| 3623 | Ga0500641_0005245 | |||
| 3624 | Ga0500555_000474 | |||
| 3625 | Ga0500555_187406 | |||
| 3626 | Ga0500556_0017940 | |||
| 3627 | Ga0500592_002640 | |||
| 3628 | Ga0500616_0000173 | |||
| 3629 | Ga0500645_002162 | |||
| 3630 | Ga0501084_0102474 | |||
| 3631 | Ga0501084_0112746 | |||
| 3632 | Ga0501084_0201468 | |||
| 3633 | Ga0501084_0627598 | |||
| 3634 | Ga0501084_0658423 | |||
| 3635 | Ga0501084_0676193 | |||
| 3636 | Ga0501084_1290857 | |||
| 3637 | Ga0501084_1657299 | |||
| 3638 | Ga0501084_1659109 | |||
| 3639 | Ga0590071_000185 | |||
| 3640 | Ga0590071_006170 | |||
| 3641 | Ga0590071_057999 | |||
| 3642 | Ga0590074_001499 | |||
| 3643 | Ga0590074_003905 | |||
| 3644 | Ga0590075_005471 | |||
| 3645 | Ga0590075_036305 | |||
| 3646 | Ga0590075_214664 | |||
| 3647 | Ga0590077_000409 | |||
| 3648 | Ga0590077_002118 | |||
| 3649 | Ga0590077_077353 | |||
| 3650 | Ga0501082_0059928 | |||
| 3651 | Ga0501082_0060712 | |||
| 3652 | Ga0501082_0063675 | |||
| 3653 | Ga0501082_0084433 | |||
| 3654 | Ga0501082_0133257 | |||
| 3655 | Ga0501082_0359409 | |||
| 3656 | Ga0501082_0480886 | |||
| 3657 | Ga0501082_1048844 | |||
| 3658 | Ga0530510_0066104 | |||
| 3659 | Ga0530510_0140415 | |||
| 3660 | Ga0530510_0384027 | |||
| 3661 | Ga0530510_0547255 | |||
| 3662 | Ga0530510_0682907 | |||
| 3663 | Ga0530510_0838453 | |||
| 3664 | Ga0530510_0933859 | |||
| 3665 | Ga0530510_1145237 | |||
| 3666 | Ga0530510_1201710 | |||
| 3667 | Ga0530510_1203047 | |||
| 3668 | Ga0530510_1286432 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7nhn-assembly1.cif.gz_W | vgal, an antibiotic resistance abcf, in complex with 70s ribosome from listeria monocytogenes | 0.9447 | 2 | 88 |
| 6tnn-assembly1.cif.gz_m | mini-rnase iii (mini-iii) bound to 50s ribosome with precursor 23s rrna | 0.9422 | 2 | 88 |
| 8cgd-assembly1.cif.gz_s | clindamycin bound to the 50s subunit | 0.9401 | 3 | 84 |
| 4v5d-assembly1.cif.gz_BX | structure of the thermus thermophilus 70s ribosome in complex with mrna, paromomycin, acylated a- and p-site trnas, and e-site trna. | 0.937 | 2 | 95 |
| 7m4z-assembly1.cif.gz_S | a. baumannii ribosome-eravacycline complex: hpf-bound 70s | 0.9317 | 2 | 88 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 6hmaR00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain | 0.9138 | 2 | 89 | 3.30.70.330 |
| 6hmaR00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain | 0.885 | 2 | 89 | 3.30.70.330 |
| 4qs3X00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain | 0.8844 | 5 | 96 | 3.30.70.330 |
| 6fu8C00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain | 0.8837 | 2 | 89 | 3.30.70.330 |
| 4garT00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain | 0.8829 | 2 | 89 | 3.30.70.330 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0S7X6A9-F1-model_v4 | Large ribosomal subunit protein uL23 | 0.9697 | 1 | 89 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-A0A7C3UQP4-F1-model_v4 | Large ribosomal subunit protein uL23 | 0.968 | 1 | 88 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-A0A7X3QGC2-F1-model_v4 | Large ribosomal subunit protein uL23m (50S ribosomal protein L23) | 0.9659 | 1 | 86 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-A0A3C0KRD0-F1-model_v4 | 50S ribosomal protein L23 | 0.9623 | 1 | 84 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-A0A2E8RYK3-F1-model_v4 | Large ribosomal subunit protein uL23 | 0.962 | 1 | 88 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 GO:1990904 |