F495772

General Info

Members Datasets Scaffolds Average Seq Length
1814 611 1687 263

Family's Representative Sequence

Representative Sequence 3300031251|Ga0265327_10021872|Ga0265327_100218724
Length 300
Sequence LTTFNKIVVSGYRRNNRYLDFTQLNVRLGGLGVIMARIIGVANQKGGVGKTTSAINVAASLAVLEFKTLLVDADPQANSTTGVGFDLHNITNSLYDCMVNNALAADVILKSEIPNLDIVPSHIDLVGAEIEMINYPNRENVLKGILDAVRDRYDFIIIDCSPSLGLITVNSLVASDSVIVPVQCEFFALEGLGKLLNTIKIVQSRLNPELQIEGILMTMYDGRLRLCNQVVSEVRRHFDDMVFDTIIHRNTRLSEAPSVGKPVILYDAESKGAVNYLNLAKEILQNNGMTKMSNQERIIE

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2511231000 Chryseobacterium populi CF314 Isolate Rhizosphere
3 2513020052 Flavobacterium sp. CF136 Isolate Rhizosphere
4 2519899754 Flavobacterium sp. F52 Isolate Rhizosphere
5 2523533629 Kaistella palustris DSM 21579 Isolate Rhizosphere
6 2582581278 Chryseobacterium sp. CF365 Isolate Rhizosphere
7 2582581281 Chryseobacterium sp. CF284 Isolate Rhizosphere
8 2582581282 Chryseobacterium sp. CF299 Isolate Rhizosphere
9 2582581873 Chryseobacterium sp. OV259 Isolate Rhizosphere
10 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
11 2585428045 Chryseobacterium sp. OV705 Isolate Rhizosphere
12 2585428060 Chryseobacterium sp. OV715 Isolate Rhizosphere
13 2585428061 Chryseobacterium sp. CF356 Isolate Rhizosphere
14 2585428095 Chryseobacterium sp. YR005 Isolate Rhizosphere
15 2585428115 Chryseobacterium sp. YR561 Isolate Rhizosphere
16 2585428182 Chryseobacterium sp. YR477 Isolate Rhizosphere
17 2585428183 Chryseobacterium sp. YR485 Isolate Rhizosphere
18 2585428184 Chryseobacterium sp. YR480 Isolate Rhizosphere
19 2585428185 Chryseobacterium sp. YR459 Isolate Rhizosphere
20 2585428187 Chryseobacterium sp. YR460 Isolate Rhizosphere
21 2588253712 Chryseobacterium sp. OV279 Isolate Rhizosphere
22 2588254255 Chryseobacterium sp. YR221 Isolate Rhizosphere
23 2588254257 Chryseobacterium sp. YR203 Isolate Rhizosphere
24 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
25 2643221600 Flavobacterium sp. Root186 Isolate Unclassified
26 2643221667 Flavobacterium sp. Root420 Isolate Unclassified
27 2643221716 Flavobacterium sp. Root901 Isolate Unclassified
28 2643221725 Flavobacterium sp. Root935 Isolate Unclassified
29 2728369107 Chryseobacterium kwangjuense KJ1R5 Isolate Unclassified
30 2738541273 Elizabethkingia sp. YR214 Isolate Unclassified
31 2738541278 Niastella sp. CF465 Isolate Unclassified
32 2738541279 Flavobacterium sp. GV069 Isolate Unclassified
33 2738541283 Pedobacter sp. OK701 Isolate Unclassified
34 2738541285 Flavobacterium sp. GV030 Isolate Unclassified
35 2738541302 Pedobacter sp. CF074 Isolate Unclassified
36 2738543007 Flavobacterium sp. GV063 Isolate Unclassified
37 2738543014 Elizabethkingia sp. YR191 Isolate Unclassified
38 2738543023 Pedobacter sp. OK628 Isolate Unclassified
39 2739367651 Pedobacter sp. OK291 Isolate Unclassified
40 2739367656 Pedobacter sp. CF523 Isolate Unclassified
41 2739367663 Pedobacter sp. YR510 Isolate Unclassified
42 2739367857 Flavobacterium sp. GV029 Isolate Unclassified
43 2739367858 Flavobacterium sp. GV028 Isolate Unclassified
44 2739367866 Hymenobacter sp. YR204 Isolate Unclassified
45 2739367874 Chryseobacterium sp. T16E-39 Isolate Unclassified
46 2751185877 Chryseobacterium artocarpi UTM-3 Isolate Rhizosphere
47 2765235839 Chryseobacterium indologenes AA5 Isolate Unclassified
48 2772190705 Chryseobacterium contaminans C-26 Isolate Rhizosphere
49 2775506739 Chryseobacterium sp. 1335 Isolate Unclassified
50 2802428842 Flavobacterium sp. S87F.05.LMB.W.Kidney.N Isolate Unclassified
51 2816332188 Chryseobacterium aquifrigidense 110 (version 2) Isolate Unclassified
52 2816332280 Flavobacterium johnsoniae GSE09 Isolate Unclassified
53 2818991437 Pedobacter terrae 518 Isolate Unclassified
54 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
55 2818991444 Filimonas endophytica 3197 Isolate Unclassified
56 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
57 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
58 2833640130 Mariniflexile sp. TRM1-10 Isolate Rhizosphere
59 2839989709 Pontibacter arcticus 2b14 Isolate Unclassified
60 2840677318 Chitinophaga alhagiae T22 Isolate Unclassified
61 2842083920 Chryseobacterium lathyri KCTC 22544 Isolate Rhizosphere
62 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
63 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
64 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
65 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
66 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
67 2852627209 Pedobacter sp. AK017 Isolate Rhizosphere
68 2857613821 Flavobacterium sp. R-72247 Isolate Unclassified
69 2857618242 Flavobacterium sp. R-74482 Isolate Unclassified
70 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
71 2871720351 Chryseobacterium sp. KLBC 52 Isolate Nodule
72 2881359912 Flavobacterium ustbae T13 Isolate Rhizosphere
73 2883068021 Chitinophaga rhizosphaerae T16R-86 Isolate Rhizosphere
74 2884634485 Algoriphagus kandeliae XY-J91 Isolate Unclassified
75 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
76 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
77 2889290771 Chryseobacterium sp. PvR013 Isolate Rhizosphere
78 2890737413 Parapedobacter sp. SGR-10 Isolate Rhizosphere
79 2896085136 Chitinophaga alhagiae T22 Isolate Unclassified
80 2896109856 Chitinophaga sp. SYP-B3965 Isolate Rhizosphere
81 2902048731 Pedobacter ureilyticus THG-T11 Isolate Rhizosphere
82 2903895155 Flavobacterium sp. HBTb2-11-1 Isolate Rhizosphere
83 2904419702 Flavobacterium sp. 1355 Isolate Rhizosphere
84 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
85 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
86 2904555929 Flavobacterium sp. 1750 Isolate Rhizosphere
87 2905999023 Chryseobacterium elymi KCTC 22547 Isolate Rhizosphere
88 2914759650 Rhizosphaericola mali Isolate Rhizosphere
89 2919097161 Chryseobacterium ginsenosidimutans 1394 Isolate Rhizosphere
90 2919186247 Pedobacter africanus 2697 Isolate Rhizosphere
91 2919191525 Flavobacterium sp. 2755 Isolate Rhizosphere
92 2919399522 Chryseobacterium sp. 2987 Isolate Unclassified
93 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
94 2919509842 Flavobacterium arsenatis 3773 Isolate Unclassified
95 2919683626 Flavobacterium piscis 4129 Isolate Unclassified
96 2919692658 Algoriphagus sp. 4150 Isolate Rhizosphere
97 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
98 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
99 2929150217 Flavobacterium sp. R-74510 Hybrid assembly Isolate Unclassified
100 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified
101 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
102 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
103 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
104 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
105 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere
106 2945924605 Chryseobacterium ginsenosidimutans W1I9 Isolate Rhizosphere
107 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
108 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
109 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
110 2946019816 Chryseobacterium sp. W4I1 Isolate Rhizosphere
111 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
112 2958458903 Flavobacterium anhuiense RCM74 Isolate Rhizosphere
113 2958512119 Flavobacterium sp. Sd200 Isolate Rhizosphere
114 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
115 2977243572 Chryseobacterium sp. SORGH_AS 447 Isolate Unclassified
116 2977268062 Flavobacterium sp. SORGH_AS 622 Isolate Unclassified
117 2984572630 Chryseobacterium sp. SORGH_AS909 Isolate Aerial Root
118 2984606641 Chryseobacterium sp. SORGH_AS1175 Isolate Aerial Root
119 2993372514 Chryseobacterium sp. SLBN-27 Isolate Rhizosphere
120 2993480792 Chryseobacterium nepalense SLBN-92 Isolate Rhizosphere
121 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
122 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
123 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
124 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
125 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
126 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
127 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
128 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
129 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
130 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
131 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
132 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
133 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
134 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
135 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
136 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
137 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
138 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
139 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
140 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
141 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
142 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
143 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
144 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
145 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
146 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
147 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
148 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
149 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
150 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
151 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
152 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
153 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
154 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
155 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
156 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
157 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
158 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
159 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
160 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
161 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
162 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
163 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
164 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
165 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
166 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
167 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
168 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
169 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
170 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
171 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
172 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
173 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
174 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
175 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
176 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
177 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
178 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
179 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
180 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
181 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
182 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
183 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
184 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
185 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
186 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
187 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
188 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
189 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
190 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
191 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
192 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
193 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
194 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
195 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
196 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
197 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
198 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
199 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
200 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
201 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
202 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
203 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
204 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
205 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
206 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
207 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
208 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
209 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
210 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
211 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
212 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
213 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
214 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
215 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
216 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
217 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
218 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
219 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
220 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
221 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
222 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
223 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
224 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
225 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
226 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
227 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
228 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
229 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
230 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
231 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
232 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
233 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
234 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
235 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
236 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
237 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
238 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
239 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
240 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
241 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
242 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
243 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
244 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
245 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
246 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
247 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
248 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
249 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
250 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
251 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
252 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
253 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
254 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
255 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
256 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
257 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
258 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
259 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
260 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
261 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
262 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
263 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
264 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
265 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
266 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
267 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
268 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
269 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
270 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
271 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
272 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
273 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
274 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
275 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
276 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
277 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
278 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
279 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
280 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
281 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
282 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
283 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
284 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
285 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
286 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
287 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
288 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
289 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
290 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
291 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
292 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
293 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
294 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
295 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
296 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
297 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
298 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
299 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
300 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
301 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
302 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
303 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
304 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
305 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
306 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
307 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
308 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
309 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
310 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
311 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
312 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
313 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
314 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
315 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
316 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
317 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
318 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
319 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
320 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
321 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
322 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
323 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
324 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
325 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
326 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
327 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
328 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
329 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
330 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
331 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
332 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
333 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
334 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
335 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
336 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
337 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
338 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
339 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
340 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
341 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
342 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
343 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
344 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
345 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
346 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
347 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
348 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
349 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
350 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
351 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
352 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
353 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
354 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
355 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
356 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
357 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
358 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
359 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
360 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
361 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
362 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
363 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
364 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
365 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
366 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
367 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
368 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
369 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
370 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
371 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
372 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
373 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
374 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
375 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
376 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
377 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
378 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
379 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
380 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
381 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
382 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
383 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
384 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
385 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
386 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
387 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
388 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
389 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
390 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
391 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
392 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
393 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
394 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
395 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
396 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
397 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
398 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
399 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
400 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
401 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
402 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
403 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
404 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
405 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
406 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
407 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
408 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
409 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
410 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
411 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
412 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
413 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
414 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
415 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
416 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
417 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
418 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
419 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
420 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
421 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
422 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
423 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
424 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
425 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
426 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
427 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
428 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
429 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
430 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
431 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
432 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
433 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
434 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
435 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
436 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
437 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
438 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
439 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
440 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
441 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
442 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
443 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
444 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
445 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
446 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
447 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
448 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
449 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
450 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
451 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
452 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
453 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
454 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
455 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
456 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
457 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
458 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
459 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
460 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
461 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
462 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
463 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
464 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
465 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
466 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
467 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
468 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
469 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
470 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
471 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
472 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
473 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
474 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
475 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
476 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
477 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
478 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
479 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
480 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
481 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
482 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
483 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
484 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
485 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
486 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
487 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
488 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
489 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
490 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
491 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
492 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
493 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
494 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
495 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
496 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
497 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
498 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
499 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
500 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
501 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
502 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
503 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
504 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
505 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
506 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
507 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
508 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
509 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
510 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
511 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
512 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
513 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
514 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
515 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
516 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
517 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
518 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
519 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
520 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
521 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
522 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
523 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
524 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
525 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
526 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
527 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
528 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
529 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
530 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
531 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
532 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
533 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
534 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
535 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
536 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
537 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
538 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
539 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
540 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
541 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
542 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
543 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
544 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
545 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
546 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
547 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
548 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
549 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
550 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
551 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
552 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
553 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
554 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
555 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
556 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
557 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
558 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
559 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
560 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
561 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
562 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
563 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
564 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
565 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
566 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
567 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
568 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
569 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
570 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
571 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
572 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
573 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
574 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
575 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
576 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
577 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
578 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
579 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
580 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
581 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
582 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
583 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
584 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
585 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
586 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
587 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
588 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
589 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
590 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
591 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
592 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
593 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
594 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
595 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
596 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
597 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
598 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
599 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
600 3300053726 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 endosphere Metagenome Endosphere
601 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
602 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
603 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
604 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
605 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified
606 8036736890 Flavobacterium dauae TCH3-2 Isolate Rhizosphere
607 8054307821 Flavobacterium soyae SCIV07 Isolate Rhizosphere
608 8055419101 Flavobacterium tyrosinilyticum KCTC 42726 Isolate Rhizosphere
609 8055588893 Parapedobacter lycopersici KACC 18788 Isolate Rhizosphere
610 8055592153 Flavobacterium panacis DCY106 Isolate Rhizosphere
611 8056440228 Flavobacterium hibisci THG-HG1.4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.56
Metatranscriptomes 0.5
Isolates 6.95

Biome Distribution

Category Percentage (%)
Aerial Root 0.11
Bulb 0
Endosphere 6.78
Nodule 0.28
Rhizoplane 0.99
Rhizosphere 83.79
Stem 0
Stem Tuber 0
Unclassified 8.05

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1663050 2162886007 Bacteria 482194
2 SwRhRL2b_contig_2423129 2162886007 Bacteria 1187
3 SwRhRL2b_contig_2703482 2162886007 Bacteria 3290
4 SwRhRL2b_contig_3243847 2162886007 Bacteria 2425
5 SwRhRL2b_contig_3661140 2162886007 Bacteria 2767
6 SwRhRL2b_contig_595006 2162886007 Bacteria 3181
7 SwRhRL2b_contig_829818 2162886007 Bacteria 4778
8 JGI24736J21556_1001877 3300001904 Bacteria 3745
9 JGI24740J21852_10050141 3300001979 Bacteria 1202
10 JGI24739J22299_10003467 3300001989 Bacteria 6018
11 JGI24739J22299_10064304 3300001989 Bacteria 1153
12 JGI24737J22298_10000321 3300001990 Bacteria 16053
13 JGI24737J22298_10011017 3300001990 Bacteria 2969
14 JGI24735J21928_10000003 3300002067 Bacteria 385983
15 JGI24735J21928_10003137 3300002067 Bacteria 5663
16 JGI24744J21845_10010382 3300002077 Bacteria 1907
17 JGI24751J29686_10000452 3300002459 Bacteria 12421
18 JGI25162J39368_1000203 3300002737 Bacteria 62704
19 JGI25154J39366_1000007 3300002738 Bacteria 335932
20 JGI25158J39367_1002516 3300002739 Bacteria 2963
21 JGI25157J39369_1005353 3300002741 Bacteria 2110
22 JGI25164J39214_1001360 3300002772 Bacteria 5927
23 JGI25150J39212_1000001 3300002774 Bacteria 1318726
24 JGI25151J46595_10000001 3300003187 Bacteria 887211
25 JGI25165J46597_1000728 3300003214 Bacteria 25784
26 JGI25153J46596_10000001 3300003215 Bacteria 748985
27 JGI25153J46596_10001266 3300003215 Bacteria 15183
28 rootH1_10063301 3300003316 Bacteria 4209
29 rootH1_10134510 3300003316 Bacteria 2650
30 rootH1_10149292 3300003316 Bacteria 3994
31 rootH2_10011084 3300003320 Bacteria 22647
32 rootH2_10013162 3300003320 Bacteria 43068
33 rootH2_10015381 3300003320 Bacteria 19009
34 rootH2_10045041 3300003320 Bacteria 11638
35 rootH2_10129787 3300003320 Bacteria 7276
36 rootL2_10007168 3300003322 Bacteria 8195
37 rootL2_10021621 3300003322 Bacteria 2872
38 rootL2_10038289 3300003322 Bacteria 5760
39 rootL2_10074114 3300003322 Bacteria 1744
40 rootL2_10143549 3300003322 Bacteria 3773
41 rootL2_10319714 3300003322 Bacteria 3332
42 rootH1_10007512 3300003323 Bacteria 10354
43 rootH1_10015224 3300003323 Bacteria 25733
44 rootH1_10078749 3300003323 Bacteria 4864
45 rootH1_10115746 3300003323 Bacteria 2912
46 rootH1_10120031 3300003323 Bacteria 18612
47 rootH1_10319305 3300003323 Bacteria 1176
48 JGI25160J50197_1004668 3300003354 Bacteria 5877
49 JGI25160J50197_1010918 3300003354 Bacteria 3255
50 Ga0006562J51391_1002343 3300003578 Bacteria 4752
51 Ga0006562J51391_1004923 3300003578 Bacteria 5120
52 Ga0055535_1001785 3300003761 Bacteria 9460
53 Ga0055526_1022313 3300003771 Bacteria 2158
54 Ga0055536_1000004 3300003781 Bacteria 411108
55 Ga0055534_1001279 3300003784 Bacteria 10213
56 Ga0055528_1000164 3300003790 Bacteria 55729
57 Ga0055530_10000869 3300003791 Bacteria 24868
58 Ga0055530_10007673 3300003791 Bacteria 4491
59 Ga0055531_10000085 3300003794 Bacteria 102372
60 Ga0055531_10000156 3300003794 Bacteria 78858
61 Ga0058863_10001245 3300004799 Bacteria 4009
62 Ga0058862_12212891 3300004803 Bacteria 1359
63 Ga0065165_1000010 3300005262 Bacteria 323737
64 Ga0065165_1008512 3300005262 Bacteria 4780
65 Ga0065714_10002572 3300005288 Bacteria 21257
66 Ga0065714_10003280 3300005288 Bacteria 26984
67 Ga0065714_10010985 3300005288 Bacteria 2492
68 Ga0065714_10026377 3300005288 Bacteria 898
69 Ga0065714_10078231 3300005288 Bacteria 2618
70 Ga0065714_10085630 3300005288 Bacteria 2140
71 Ga0065714_10100557 3300005288 Bacteria 1661
72 Ga0065704_10005473 3300005289 Bacteria 3457
73 Ga0065704_10070140 3300005289 Bacteria 482257
74 Ga0065704_10070251 3300005289 Bacteria 48366
75 Ga0065704_10072129 3300005289 Bacteria 9103
76 Ga0065704_10073887 3300005289 Bacteria 6700
77 Ga0065704_10074138 3300005289 Bacteria 6479
78 Ga0065704_10074182 3300005289 Bacteria 6469
79 Ga0065704_10090076 3300005289 Bacteria 2814
80 Ga0065704_10106177 3300005289 Bacteria 2090
81 Ga0065704_10110352 3300005289 Bacteria 1982
82 Ga0065712_10086352 3300005290 Bacteria 2641
83 Ga0065712_10088663 3300005290 Bacteria 2508
84 Ga0065715_10040176 3300005293 Bacteria 1317
85 Ga0065715_10117030 3300005293 Bacteria 2361
86 Ga0065715_10250221 3300005293 Unclassified 1170
87 Ga0065715_10291366 3300005293 Bacteria 1062
88 Ga0065715_10393194 3300005293 Bacteria 875
89 Ga0065707_10094480 3300005295 Bacteria 3492
90 Ga0065707_10098181 3300005295 Unclassified 3106
91 Ga0070658_10000655 3300005327 Bacteria 29871
92 Ga0070658_10013517 3300005327 Bacteria 6551
93 Ga0070658_10018406 3300005327 Bacteria 5592
94 Ga0070658_10041372 3300005327 Bacteria 3718
95 Ga0070658_10199625 3300005327 Unclassified 1687
96 Ga0070658_10335126 3300005327 Bacteria 1293
97 Ga0070658_10416509 3300005327 Unclassified 1155
98 Ga0070658_10444731 3300005327 Bacteria 1116
99 Ga0070676_10000091 3300005328 Bacteria 31424
100 Ga0070676_10189409 3300005328 Bacteria 1342
101 Ga0070676_10291635 3300005328 Bacteria 1103
102 Ga0070683_100002417 3300005329 Bacteria 14841
103 Ga0070683_100005694 3300005329 Bacteria 10408
104 Ga0070683_100016399 3300005329 Bacteria 6534
105 Ga0070683_100241764 3300005329 Bacteria 1717
106 Ga0070683_100410959 3300005329 Bacteria 1291
107 Ga0070683_100568753 3300005329 Bacteria 1084
108 Ga0070690_100062384 3300005330 Bacteria 2403
109 Ga0070690_100342684 3300005330 Bacteria 1083
110 Ga0070690_100397634 3300005330 Bacteria 1011
111 Ga0070670_100019261 3300005331 Bacteria 5853
112 Ga0070670_100070231 3300005331 Bacteria 3007
113 Ga0070670_100113045 3300005331 Bacteria 2340
114 Ga0070670_100125336 3300005331 Bacteria 2217
115 Ga0070670_100135234 3300005331 Bacteria 2130
116 Ga0070670_100179130 3300005331 Bacteria 1840
117 Ga0070670_100201775 3300005331 Bacteria 1728
118 Ga0070670_100306184 3300005331 Bacteria 1390
119 Ga0070670_100520698 3300005331 Bacteria 1059
120 Ga0070677_10007031 3300005333 Bacteria 3745
121 Ga0068869_100005770 3300005334 Bacteria 7808
122 Ga0068869_100021631 3300005334 Bacteria 4426
123 Ga0068869_100059054 3300005334 Unclassified 2807
124 Ga0068869_100066745 3300005334 Bacteria 2652
125 Ga0068869_100071113 3300005334 Bacteria 2576
126 Ga0068869_100136280 3300005334 Bacteria 1892
127 Ga0068869_100169837 3300005334 Bacteria 1703
128 Ga0068869_100179568 3300005334 Bacteria 1659
129 Ga0068869_100580421 3300005334 Bacteria 945
130 Ga0070666_10000125 3300005335 Bacteria 53673
131 Ga0070666_10001433 3300005335 Bacteria 14445
132 Ga0070666_10006591 3300005335 Bacteria 7136
133 Ga0070666_10030595 3300005335 Bacteria 3548
134 Ga0070666_10067739 3300005335 Bacteria 2424
135 Ga0070680_100007073 3300005336 Bacteria 8555
136 Ga0070680_100008794 3300005336 Bacteria 7747
137 Ga0070680_100339831 3300005336 Unclassified 1276
138 Ga0070682_100000125 3300005337 Bacteria 67243
139 Ga0070682_100000394 3300005337 Bacteria 29106
140 Ga0070682_100008503 3300005337 Bacteria 5793
141 Ga0070682_100038423 3300005337 Bacteria 2936
142 Ga0070682_100096963 3300005337 Bacteria 1940
143 Ga0070682_100146145 3300005337 Bacteria 1617
144 Ga0070682_100209980 3300005337 Bacteria 1379
145 Ga0070682_100264800 3300005337 Bacteria 1246
146 Ga0070682_100282543 3300005337 Bacteria 1210
147 Ga0070682_100401938 3300005337 Bacteria 1036
148 Ga0070682_100404658 3300005337 Bacteria 1033
149 Ga0068868_100000075 3300005338 Bacteria 58452
150 Ga0068868_100022531 3300005338 Bacteria 4756
151 Ga0068868_100032252 3300005338 Bacteria 4029
152 Ga0068868_100039548 3300005338 Bacteria 3665
153 Ga0068868_100331792 3300005338 Bacteria 1298
154 Ga0070660_100000211 3300005339 Bacteria 39121
155 Ga0070660_100004005 3300005339 Bacteria 10169
156 Ga0070660_100019733 3300005339 Bacteria 4944
157 Ga0070660_100033263 3300005339 Bacteria 3885
158 Ga0070660_100288113 3300005339 Bacteria 1345
159 Ga0070660_100327588 3300005339 Bacteria 1259
160 Ga0070689_100007698 3300005340 Bacteria 7546
161 Ga0070689_100077163 3300005340 Bacteria 2611
162 Ga0070689_100367353 3300005340 Bacteria 1210
163 Ga0070689_100470020 3300005340 Bacteria 1073
164 Ga0070691_10010843 3300005341 Bacteria 4159
165 Ga0070691_10018376 3300005341 Bacteria 3223
166 Ga0070687_100019144 3300005343 Bacteria 3181
167 Ga0070661_100066797 3300005344 Bacteria 2642
168 Ga0070661_100525792 3300005344 Bacteria 949
169 Ga0070661_100697801 3300005344 Bacteria 827
170 Ga0070668_100037019 3300005347 Bacteria 3725
171 Ga0070668_100306491 3300005347 Bacteria 1333
172 Ga0070669_100088082 3300005353 Bacteria 2323
173 Ga0070669_100504609 3300005353 Bacteria 1004
174 Ga0070675_100011402 3300005354 Bacteria 6957
175 Ga0070675_100016984 3300005354 Bacteria 5783
176 Ga0070675_100023239 3300005354 Bacteria 4954
177 Ga0070675_100033207 3300005354 Bacteria 4182
178 Ga0070675_100038097 3300005354 Bacteria 3917
179 Ga0070675_100190938 3300005354 Bacteria 1775
180 Ga0070671_100281644 3300005355 Bacteria 1414
181 Ga0070671_100332471 3300005355 Bacteria 1295
182 Ga0070671_100361708 3300005355 Bacteria 1239
183 Ga0070671_100391861 3300005355 Bacteria 1188
184 Ga0070674_100013529 3300005356 Bacteria 5047
185 Ga0070673_100000966 3300005364 Bacteria 16306
186 Ga0070673_100044349 3300005364 Bacteria 3443
187 Ga0070673_100047692 3300005364 Bacteria 3335
188 Ga0070673_100065150 3300005364 Bacteria 2905
189 Ga0070673_100068032 3300005364 Bacteria 2850
190 Ga0070673_100073365 3300005364 Bacteria 2754
191 Ga0070673_100310657 3300005364 Bacteria 1390
192 Ga0070688_100026679 3300005365 Bacteria 3434
193 Ga0070688_100074892 3300005365 Bacteria 2175
194 Ga0070688_100081383 3300005365 Bacteria 2097
195 Ga0070688_100262221 3300005365 Bacteria 1234
196 Ga0070659_100003274 3300005366 Bacteria 11522
197 Ga0070659_100005958 3300005366 Bacteria 8788
198 Ga0070659_100007003 3300005366 Bacteria 8164
199 Ga0070659_100009206 3300005366 Bacteria 7248
200 Ga0070659_100038876 3300005366 Bacteria 3712
201 Ga0070667_100000086 3300005367 Bacteria 114861
202 Ga0070667_100013104 3300005367 Bacteria 6853
203 Ga0070667_100065615 3300005367 Bacteria 3082
204 Ga0070667_100115450 3300005367 Bacteria 2331
205 Ga0070667_100187976 3300005367 Bacteria 1829
206 Ga0070667_100209267 3300005367 Bacteria 1733
207 Ga0070667_100332861 3300005367 Bacteria 1372
208 Ga0070714_100082836 3300005435 Unclassified 2796
209 Ga0070663_100502974 3300005455 Unclassified 1007
210 Ga0070678_100107619 3300005456 Bacteria 2175
211 Ga0070678_100282545 3300005456 Bacteria 1404
212 Ga0070662_100003756 3300005457 Bacteria 9504
213 Ga0070662_100007873 3300005457 Bacteria 6923
214 Ga0070662_100025036 3300005457 Bacteria 4118
215 Ga0070662_100059341 3300005457 Bacteria 2787
216 Ga0070681_10101645 3300005458 Bacteria 2820
217 Ga0070681_10135065 3300005458 Bacteria 2398
218 Ga0070681_10139966 3300005458 Bacteria 2350
219 Ga0070681_10200880 3300005458 Bacteria 1912
220 Ga0068867_100003784 3300005459 Bacteria 10649
221 Ga0068867_100005625 3300005459 Bacteria 8879
222 Ga0068867_100010240 3300005459 Bacteria 6614
223 Ga0068867_100012521 3300005459 Bacteria 6003
224 Ga0068867_100104518 3300005459 Bacteria 2168
225 Ga0068867_100285868 3300005459 Bacteria 1354
226 Ga0068867_100292040 3300005459 Bacteria 1341
227 Ga0070685_10005156 3300005466 Bacteria 6624
228 Ga0070685_10017646 3300005466 Bacteria 3824
229 Ga0070685_10394858 3300005466 Bacteria 956
230 Ga0070698_100000911 3300005471 Bacteria 32333
231 Ga0070698_100140156 3300005471 Bacteria 2370
232 Ga0070679_100003584 3300005530 Bacteria 14205
233 Ga0070679_100028081 3300005530 Bacteria 5545
234 Ga0070679_100028359 3300005530 Bacteria 5519
235 Ga0070679_100054957 3300005530 Bacteria 3965
236 Ga0070679_100085742 3300005530 Bacteria 3136
237 Ga0070679_100238729 3300005530 Bacteria 1775
238 Ga0070679_100441954 3300005530 Bacteria 1245
239 Ga0070684_100012884 3300005535 Bacteria 6721
240 Ga0070684_100031170 3300005535 Bacteria 4537
241 Ga0070684_100053969 3300005535 Bacteria 3501
242 Ga0070684_100085939 3300005535 Bacteria 2790
243 Ga0068853_100003690 3300005539 Bacteria 11749
244 Ga0068853_100004573 3300005539 Bacteria 10729
245 Ga0068853_100018812 3300005539 Bacteria 5719
246 Ga0068853_100035707 3300005539 Bacteria 4223
247 Ga0068853_100050476 3300005539 Bacteria 3579
248 Ga0068853_100081542 3300005539 Bacteria 2833
249 Ga0068853_100101004 3300005539 Bacteria 2551
250 Ga0068853_100146456 3300005539 Bacteria 2123
251 Ga0068853_100161284 3300005539 Bacteria 2023
252 Ga0068853_100241333 3300005539 Bacteria 1656
253 Ga0068853_100257644 3300005539 Bacteria 1603
254 Ga0068853_100271523 3300005539 Bacteria 1562
255 Ga0068853_100546898 3300005539 Bacteria 1096
256 Ga0070672_100030440 3300005543 Bacteria 4055
257 Ga0070672_100046118 3300005543 Bacteria 3376
258 Ga0070672_100115402 3300005543 Bacteria 2193
259 Ga0070672_100151535 3300005543 Bacteria 1918
260 Ga0070672_100165848 3300005543 Bacteria 1835
261 Ga0070672_100217348 3300005543 Bacteria 1602
262 Ga0070672_100306262 3300005543 Bacteria 1348
263 Ga0070686_100016259 3300005544 Bacteria 4324
264 Ga0070686_100040335 3300005544 Bacteria 2912
265 Ga0070686_100221822 3300005544 Bacteria 1367
266 Ga0070696_100131205 3300005546 Bacteria 1823
267 Ga0070696_100158534 3300005546 Bacteria 1666
268 Ga0070693_100022402 3300005547 Bacteria 3359
269 Ga0070693_100057609 3300005547 Bacteria 2246
270 Ga0070665_100000009 3300005548 Bacteria 562640
271 Ga0070665_100007286 3300005548 Bacteria 11248
272 Ga0070665_100007390 3300005548 Bacteria 11178
273 Ga0070665_100181811 3300005548 Bacteria 2104
274 Ga0070665_100725664 3300005548 Bacteria 1007
275 Ga0068855_100000279 3300005563 Bacteria 63112
276 Ga0068855_100001370 3300005563 Bacteria 30171
277 Ga0068855_100002137 3300005563 Bacteria 24454
278 Ga0068855_100002597 3300005563 Bacteria 22262
279 Ga0068855_100005875 3300005563 Bacteria 14974
280 Ga0068855_100032803 3300005563 Bacteria 6200
281 Ga0068855_100034861 3300005563 Bacteria 5997
282 Ga0068855_100046506 3300005563 Bacteria 5130
283 Ga0068855_100083464 3300005563 Bacteria 3701
284 Ga0068855_100206373 3300005563 Bacteria 2210
285 Ga0068855_100320880 3300005563 Bacteria 1712
286 Ga0068855_100329075 3300005563 Bacteria 1687
287 Ga0068855_100472966 3300005563 Bacteria 1365
288 Ga0068855_100476339 3300005563 Bacteria 1359
289 Ga0068855_100588981 3300005563 Bacteria 1200
290 Ga0070664_100026719 3300005564 Bacteria 4791
291 Ga0070664_100048105 3300005564 Bacteria 3604
292 Ga0070664_100110232 3300005564 Bacteria 2401
293 Ga0070664_100130951 3300005564 Bacteria 2203
294 Ga0070664_100136918 3300005564 Bacteria 2154
295 Ga0070664_100362998 3300005564 Bacteria 1319
296 Ga0068857_100002499 3300005577 Bacteria 15039
297 Ga0068857_100025412 3300005577 Bacteria 5215
298 Ga0068857_100139694 3300005577 Bacteria 2189
299 Ga0068857_100148748 3300005577 Bacteria 2120
300 Ga0068857_100192907 3300005577 Bacteria 1856
301 Ga0068857_100208774 3300005577 Bacteria 1782
302 Ga0068857_100408625 3300005577 Bacteria 1264
303 Ga0068854_100005998 3300005578 Bacteria 7696
304 Ga0068854_100061236 3300005578 Bacteria 2725
305 Ga0068854_100090507 3300005578 Bacteria 2275
306 Ga0068856_100000006 3300005614 Bacteria 223827
307 Ga0068856_100006116 3300005614 Bacteria 11815
308 Ga0068856_100007791 3300005614 Bacteria 10461
309 Ga0068856_100009483 3300005614 Bacteria 9450
310 Ga0068856_100012161 3300005614 Bacteria 8339
311 Ga0068856_100040389 3300005614 Bacteria 4583
312 Ga0068856_100065842 3300005614 Bacteria 3581
313 Ga0068856_100627842 3300005614 Bacteria 1095
314 Ga0068852_100003711 3300005616 Bacteria 10699
315 Ga0068852_100005387 3300005616 Bacteria 9148
316 Ga0068852_100005815 3300005616 Bacteria 8855
317 Ga0068852_100014561 3300005616 Bacteria 6060
318 Ga0068852_100016001 3300005616 Bacteria 5839
319 Ga0068852_100022206 3300005616 Bacteria 5085
320 Ga0068852_100084320 3300005616 Bacteria 2827
321 Ga0068852_100116263 3300005616 Bacteria 2440
322 Ga0068852_100133672 3300005616 Bacteria 2287
323 Ga0068852_100198363 3300005616 Bacteria 1898
324 Ga0068852_100221698 3300005616 Bacteria 1799
325 Ga0068852_100336275 3300005616 Bacteria 1470
326 Ga0068852_100389802 3300005616 Bacteria 1368
327 Ga0068852_100469089 3300005616 Bacteria 1249
328 Ga0068859_100000242 3300005617 Bacteria 53646
329 Ga0068859_100006439 3300005617 Bacteria 11912
330 Ga0068859_100030908 3300005617 Bacteria 5374
331 Ga0068859_100040043 3300005617 Bacteria 4703
332 Ga0068859_100062210 3300005617 Bacteria 3762
333 Ga0068859_100215791 3300005617 Bacteria 2006
334 Ga0068859_100265713 3300005617 Bacteria 1808
335 Ga0068859_100318747 3300005617 Bacteria 1648
336 Ga0068859_100356490 3300005617 Unclassified 1557
337 Ga0068859_100472068 3300005617 Bacteria 1350
338 Ga0068859_100856564 3300005617 Unclassified 995
339 Ga0068864_100001541 3300005618 Bacteria 18983
340 Ga0068864_100007898 3300005618 Bacteria 8766
341 Ga0068864_100077541 3300005618 Bacteria 2906
342 Ga0068864_100982698 3300005618 Bacteria 836
343 Ga0068866_10085725 3300005718 Unclassified 1703
344 Ga0068861_100001641 3300005719 Bacteria 14272
345 Ga0068861_100059982 3300005719 Bacteria 2914
346 Ga0068861_100265613 3300005719 Bacteria 1471
347 Ga0068861_100486783 3300005719 Bacteria 1112
348 Ga0068851_10000388 3300005834 Bacteria 19910
349 Ga0068851_10053753 3300005834 Bacteria 2051
350 Ga0068851_10149361 3300005834 Unclassified 1276
351 Ga0068870_10010288 3300005840 Bacteria 4291
352 Ga0068870_10044685 3300005840 Bacteria 2316
353 Ga0068870_10143043 3300005840 Bacteria 1401
354 Ga0068863_100016728 3300005841 Bacteria 7037
355 Ga0068863_100023474 3300005841 Bacteria 5889
356 Ga0068863_100026064 3300005841 Bacteria 5578
357 Ga0068863_100045062 3300005841 Bacteria 4186
358 Ga0068863_100083299 3300005841 Bacteria 3030
359 Ga0068863_100094027 3300005841 Bacteria 2845
360 Ga0068863_100184467 3300005841 Bacteria 2003
361 Ga0068863_100330747 3300005841 Bacteria 1481
362 Ga0068863_100418171 3300005841 Bacteria 1313
363 Ga0068863_100450024 3300005841 Bacteria 1264
364 Ga0068863_100734902 3300005841 Bacteria 982
365 Ga0068858_100000258 3300005842 Bacteria 56692
366 Ga0068858_100004144 3300005842 Bacteria 14261
367 Ga0068858_100101557 3300005842 Bacteria 2682
368 Ga0068858_100116755 3300005842 Bacteria 2494
369 Ga0068860_100000033 3300005843 Bacteria 245461
370 Ga0068860_100001856 3300005843 Bacteria 22477
371 Ga0068860_100005747 3300005843 Bacteria 12513
372 Ga0068860_100011911 3300005843 Bacteria 8572
373 Ga0068860_100016937 3300005843 Bacteria 7104
374 Ga0068860_100033498 3300005843 Bacteria 4929
375 Ga0068860_100062300 3300005843 Bacteria 3544
376 Ga0068860_100079404 3300005843 Bacteria 3120
377 Ga0068860_100155267 3300005843 Bacteria 2205
378 Ga0068860_100307810 3300005843 Bacteria 1553
379 Ga0068860_100341185 3300005843 Bacteria 1473
380 Ga0068860_100352641 3300005843 Bacteria 1448
381 Ga0068860_100405002 3300005843 Bacteria 1350
382 Ga0068860_100422195 3300005843 Bacteria 1322
383 Ga0068862_100005917 3300005844 Bacteria 10185
384 Ga0068862_100012762 3300005844 Bacteria 6953
385 Ga0068862_100510626 3300005844 Bacteria 1142
386 Ga0068862_100681511 3300005844 Bacteria 994
387 Ga0081540_1012512 3300005983 Bacteria 5578
388 Ga0075366_10003090 3300006195 Bacteria 8694
389 Ga0075366_10018956 3300006195 Bacteria 3977
390 Ga0075366_10062086 3300006195 Bacteria 2221
391 Ga0075366_10252890 3300006195 Bacteria 1075
392 Ga0097621_100001575 3300006237 Bacteria 15603
393 Ga0097621_100008800 3300006237 Bacteria 7295
394 Ga0097621_100014583 3300006237 Bacteria 5888
395 Ga0097621_100097334 3300006237 Bacteria 2471
396 Ga0097621_100101343 3300006237 Bacteria 2423
397 Ga0097621_100130648 3300006237 Bacteria 2138
398 Ga0097621_100211647 3300006237 Bacteria 1686
399 Ga0068871_100006801 3300006358 Bacteria 8129
400 Ga0068871_100018853 3300006358 Bacteria 5257
401 Ga0068871_100044596 3300006358 Bacteria 3567
402 Ga0068871_100055128 3300006358 Bacteria 3227
403 Ga0068871_100057070 3300006358 Bacteria 3175
404 Ga0068871_100212975 3300006358 Bacteria 1672
405 Ga0075428_100044297 3300006844 Bacteria 4890
406 Ga0075428_100117986 3300006844 Unclassified 2890
407 Ga0075428_100123455 3300006844 Bacteria 2818
408 Ga0075428_100154611 3300006844 Bacteria 2492
409 Ga0075428_100334092 3300006844 Bacteria 1628
410 Ga0075430_100020978 3300006846 Bacteria 5554
411 Ga0075431_100001482 3300006847 Bacteria 21685
412 Ga0075431_100012317 3300006847 Bacteria 8629
413 Ga0075429_100016041 3300006880 Bacteria 6489
414 Ga0075429_100083539 3300006880 Bacteria 2784
415 Ga0068865_100000413 3300006881 Bacteria 23842
416 Ga0068865_100045574 3300006881 Bacteria 3006
417 Ga0068865_100080466 3300006881 Bacteria 2337
418 Ga0068865_100466683 3300006881 Bacteria 1047
419 Ga0097620_100000242 3300006931 Bacteria 53646
420 Ga0097620_100006439 3300006931 Bacteria 11912
421 Ga0097620_100030908 3300006931 Bacteria 5374
422 Ga0097620_100040043 3300006931 Bacteria 4703
423 Ga0097620_100062209 3300006931 Bacteria 3762
424 Ga0097620_100215779 3300006931 Bacteria 2006
425 Ga0097620_100265705 3300006931 Bacteria 1808
426 Ga0097620_100318750 3300006931 Bacteria 1648
427 Ga0097620_100356488 3300006931 Unclassified 1557
428 Ga0097620_100472048 3300006931 Bacteria 1350
429 Ga0097620_100856659 3300006931 Unclassified 995
430 Ga0099824_1006531 3300006942 Bacteria 15947
431 Ga0079104_1000091 3300006946 Bacteria 132682
432 Ga0105251_10053494 3300009011 Bacteria 1919
433 Ga0105251_10175280 3300009011 Bacteria 966
434 Ga0105251_10220065 3300009011 Bacteria 855
435 Ga0105244_10000027 3300009036 Bacteria 207569
436 Ga0105244_10000043 3300009036 Bacteria 150556
437 Ga0105250_10023942 3300009092 Bacteria 2461
438 Ga0105240_10000023 3300009093 Bacteria 385028
439 Ga0105240_10000083 3300009093 Bacteria 192934
440 Ga0105240_10000893 3300009093 Bacteria 53349
441 Ga0105240_10001874 3300009093 Bacteria 34962
442 Ga0105240_10002999 3300009093 Bacteria 26556
443 Ga0105240_10009678 3300009093 Bacteria 13622
444 Ga0105240_10010818 3300009093 Bacteria 12778
445 Ga0105240_10028209 3300009093 Bacteria 7336
446 Ga0105240_10041223 3300009093 Bacteria 5895
447 Ga0105240_10069875 3300009093 Bacteria 4346
448 Ga0105240_10137276 3300009093 Bacteria 2928
449 Ga0105240_10137729 3300009093 Bacteria 2921
450 Ga0105240_10172201 3300009093 Bacteria 2562
451 Ga0105240_10376489 3300009093 Bacteria 1604
452 Ga0105240_10504887 3300009093 Bacteria 1344
453 Ga0105240_11077097 3300009093 Bacteria 856
454 Ga0111539_10018239 3300009094 Bacteria 8691
455 Ga0111539_10107685 3300009094 Bacteria 3271
456 Ga0111539_10108018 3300009094 Bacteria 3265
457 Ga0111539_10199617 3300009094 Bacteria 2332
458 Ga0111539_10266933 3300009094 Bacteria 1992
459 Ga0111539_10577945 3300009094 Bacteria 1309
460 Ga0105247_10017274 3300009101 Bacteria 4330
461 Ga0105247_10035946 3300009101 Bacteria 3021
462 Ga0105247_10124030 3300009101 Bacteria 1677
463 Ga0114129_10004721 3300009147 Bacteria 19243
464 Ga0114129_10460819 3300009147 Bacteria 1666
465 Ga0114129_11019806 3300009147 Bacteria 1041
466 Ga0105243_10000003 3300009148 Bacteria 712931
467 Ga0105243_10002448 3300009148 Bacteria 15512
468 Ga0105243_10225353 3300009148 Bacteria 1660
469 Ga0105243_10419084 3300009148 Bacteria 1248
470 Ga0105241_10000421 3300009174 Bacteria 31984
471 Ga0105241_10000518 3300009174 Bacteria 29032
472 Ga0105241_10014293 3300009174 Bacteria 5813
473 Ga0105241_10018754 3300009174 Bacteria 5097
474 Ga0105241_10068555 3300009174 Bacteria 2749
475 Ga0105241_10128713 3300009174 Bacteria 2047
476 Ga0105241_10157605 3300009174 Bacteria 1863
477 Ga0105242_10002451 3300009176 Bacteria 14549
478 Ga0105242_10021083 3300009176 Bacteria 5113
479 Ga0105242_10024089 3300009176 Bacteria 4805
480 Ga0105242_10104292 3300009176 Bacteria 2407
481 Ga0105242_10376113 3300009176 Bacteria 1319
482 Ga0105242_10578268 3300009176 Bacteria 1081
483 Ga0105248_10044305 3300009177 Bacteria 4990
484 Ga0105248_10049709 3300009177 Bacteria 4702
485 Ga0105248_10054666 3300009177 Bacteria 4478
486 Ga0105237_10000198 3300009545 Bacteria 85302
487 Ga0105237_10000261 3300009545 Bacteria 74745
488 Ga0105237_10003753 3300009545 Bacteria 17897
489 Ga0105237_10005184 3300009545 Bacteria 14739
490 Ga0105237_10006711 3300009545 Bacteria 12720
491 Ga0105237_10011613 3300009545 Bacteria 9319
492 Ga0105237_10015362 3300009545 Bacteria 7972
493 Ga0105237_10016324 3300009545 Bacteria 7719
494 Ga0105237_10028321 3300009545 Bacteria 5708
495 Ga0105237_10043015 3300009545 Bacteria 4553
496 Ga0105237_10062937 3300009545 Bacteria 3709
497 Ga0105237_10091762 3300009545 Bacteria 3027
498 Ga0105237_10117576 3300009545 Bacteria 2652
499 Ga0105237_10130669 3300009545 Bacteria 2505
500 Ga0105237_10160901 3300009545 Bacteria 2243
501 Ga0105237_10338924 3300009545 Bacteria 1508
502 Ga0105238_10001036 3300009551 Bacteria 28205
503 Ga0105238_10016205 3300009551 Bacteria 7542
504 Ga0105238_10060135 3300009551 Bacteria 3805
505 Ga0105238_10098443 3300009551 Bacteria 2909
506 Ga0105238_10121775 3300009551 Bacteria 2588
507 Ga0105249_10000954 3300009553 Bacteria 25555
508 Ga0105249_10006490 3300009553 Bacteria 10175
509 Ga0105249_10007639 3300009553 Bacteria 9430
510 Ga0105249_10066961 3300009553 Bacteria 3307
511 Ga0105249_10067555 3300009553 Bacteria 3294
512 Ga0105249_10079600 3300009553 Bacteria 3042
513 Ga0105249_10095798 3300009553 Bacteria 2783
514 Ga0105249_10357440 3300009553 Bacteria 1481
515 Ga0105239_10000011 3300010375 Bacteria 337500
516 Ga0105239_10001010 3300010375 Bacteria 39353
517 Ga0105239_10001043 3300010375 Bacteria 38594
518 Ga0105239_10001867 3300010375 Bacteria 27574
519 Ga0105239_10002632 3300010375 Bacteria 22682
520 Ga0105239_10003043 3300010375 Bacteria 20841
521 Ga0105239_10003144 3300010375 Bacteria 20493
522 Ga0105239_10007177 3300010375 Bacteria 12814
523 Ga0105239_10013222 3300010375 Bacteria 9172
524 Ga0105239_10019068 3300010375 Bacteria 7581
525 Ga0105239_10022265 3300010375 Bacteria 6985
526 Ga0105239_10042080 3300010375 Bacteria 5006
527 Ga0105239_10077966 3300010375 Bacteria 3646
528 Ga0105239_10146897 3300010375 Bacteria 2630
529 Ga0105239_10541619 3300010375 Bacteria 1325
530 Ga0105239_10860004 3300010375 Bacteria 1040
531 Ga0105246_10066337 3300011119 Bacteria 2527
532 Ga0105246_10637197 3300011119 Bacteria 926
533 Ga0105246_10692731 3300011119 Bacteria 892
534 Ga0157373_10000007 3300013100 Bacteria 216734
535 Ga0157373_10000044 3300013100 Bacteria 113369
536 Ga0157373_10000601 3300013100 Bacteria 27966
537 Ga0157373_10001219 3300013100 Bacteria 19688
538 Ga0157373_10003753 3300013100 Bacteria 11489
539 Ga0157373_10008405 3300013100 Bacteria 7664
540 Ga0157373_10017976 3300013100 Bacteria 5149
541 Ga0157373_10022958 3300013100 Bacteria 4524
542 Ga0157373_10063945 3300013100 Bacteria 2605
543 Ga0157373_10105138 3300013100 Bacteria 1985
544 Ga0157373_10328379 3300013100 Bacteria 1089
545 Ga0157371_10000074 3300013102 Bacteria 162988
546 Ga0157371_10000130 3300013102 Bacteria 114054
547 Ga0157371_10000164 3300013102 Bacteria 96408
548 Ga0157371_10000232 3300013102 Bacteria 79717
549 Ga0157371_10000486 3300013102 Bacteria 48340
550 Ga0157371_10001020 3300013102 Bacteria 30696
551 Ga0157371_10001267 3300013102 Bacteria 26607
552 Ga0157371_10002408 3300013102 Bacteria 17899
553 Ga0157371_10003507 3300013102 Bacteria 14179
554 Ga0157371_10003749 3300013102 Bacteria 13605
555 Ga0157371_10010866 3300013102 Bacteria 7062
556 Ga0157371_10012774 3300013102 Bacteria 6402
557 Ga0157371_10013067 3300013102 Bacteria 6322
558 Ga0157371_10013304 3300013102 Bacteria 6258
559 Ga0157371_10015935 3300013102 Bacteria 5623
560 Ga0157371_10037443 3300013102 Bacteria 3471
561 Ga0157371_10093096 3300013102 Bacteria 2135
562 Ga0157371_10094277 3300013102 Bacteria 2121
563 Ga0157371_10133763 3300013102 Bacteria 1765
564 Ga0157371_10148667 3300013102 Bacteria 1670
565 Ga0157371_10194952 3300013102 Bacteria 1451
566 Ga0157370_10000192 3300013104 Bacteria 76389
567 Ga0157370_10000290 3300013104 Bacteria 63441
568 Ga0157370_10000303 3300013104 Bacteria 61868
569 Ga0157370_10000684 3300013104 Bacteria 42223
570 Ga0157370_10001091 3300013104 Bacteria 34028
571 Ga0157370_10001177 3300013104 Bacteria 32660
572 Ga0157370_10001475 3300013104 Bacteria 29107
573 Ga0157370_10004433 3300013104 Bacteria 16087
574 Ga0157370_10004809 3300013104 Bacteria 15353
575 Ga0157370_10008143 3300013104 Bacteria 11342
576 Ga0157370_10009399 3300013104 Bacteria 10451
577 Ga0157370_10013199 3300013104 Bacteria 8520
578 Ga0157370_10018596 3300013104 Bacteria 6986
579 Ga0157370_10019497 3300013104 Bacteria 6802
580 Ga0157370_10021765 3300013104 Bacteria 6387
581 Ga0157370_10028998 3300013104 Bacteria 5437
582 Ga0157370_10033538 3300013104 Bacteria 5006
583 Ga0157370_10062936 3300013104 Bacteria 3517
584 Ga0157370_10071559 3300013104 Bacteria 3272
585 Ga0157370_10077271 3300013104 Bacteria 3136
586 Ga0157370_10084098 3300013104 Bacteria 2991
587 Ga0157370_10098497 3300013104 Bacteria 2742
588 Ga0157370_10163161 3300013104 Bacteria 2073
589 Ga0157370_10169814 3300013104 Bacteria 2028
590 Ga0157370_10230989 3300013104 Bacteria 1712
591 Ga0157370_10273470 3300013104 Bacteria 1561
592 Ga0157370_10346127 3300013104 Bacteria 1370
593 Ga0157370_10351911 3300013104 Bacteria 1358
594 Ga0157370_10361179 3300013104 Bacteria 1338
595 Ga0157370_10387886 3300013104 Bacteria 1286
596 Ga0157370_10660773 3300013104 Bacteria 955
597 Ga0157369_10000031 3300013105 Bacteria 203214
598 Ga0157369_10000731 3300013105 Bacteria 42343
599 Ga0157369_10004306 3300013105 Bacteria 16809
600 Ga0157369_10006715 3300013105 Bacteria 13276
601 Ga0157369_10018831 3300013105 Bacteria 7737
602 Ga0157369_10024012 3300013105 Bacteria 6784
603 Ga0157369_10028173 3300013105 Bacteria 6217
604 Ga0157369_10030017 3300013105 Bacteria 5999
605 Ga0157369_10083931 3300013105 Bacteria 3406
606 Ga0157369_10134553 3300013105 Bacteria 2618
607 Ga0157369_10147459 3300013105 Bacteria 2487
608 Ga0157369_10159428 3300013105 Bacteria 2382
609 Ga0157369_10196241 3300013105 Bacteria 2120
610 Ga0157369_10221855 3300013105 Bacteria 1979
611 Ga0157369_10478617 3300013105 Bacteria 1289
612 Ga0157369_10774481 3300013105 Bacteria 986
613 Ga0157369_10858837 3300013105 Bacteria 931
614 Ga0157374_10000002 3300013296 Bacteria 1054226
615 Ga0157374_10017014 3300013296 Bacteria 6401
616 Ga0157374_10037407 3300013296 Bacteria 4454
617 Ga0157374_10040398 3300013296 Bacteria 4296
618 Ga0157374_10050624 3300013296 Bacteria 3862
619 Ga0157374_10063132 3300013296 Bacteria 3474
620 Ga0157374_10131963 3300013296 Bacteria 2418
621 Ga0157374_10163274 3300013296 Bacteria 2170
622 Ga0157374_10188572 3300013296 Bacteria 2017
623 Ga0157374_10236984 3300013296 Bacteria 1794
624 Ga0157374_10477348 3300013296 Bacteria 1250
625 Ga0157378_10009151 3300013297 Bacteria 8618
626 Ga0157378_10011530 3300013297 Bacteria 7739
627 Ga0157378_10045824 3300013297 Bacteria 3887
628 Ga0157378_10118346 3300013297 Bacteria 2438
629 Ga0157378_10167778 3300013297 Bacteria 2057
630 Ga0157378_10255303 3300013297 Bacteria 1680
631 Ga0157378_10270856 3300013297 Bacteria 1633
632 Ga0157378_10376075 3300013297 Bacteria 1394
633 Ga0157378_10640381 3300013297 Bacteria 1078
634 Ga0163162_10000377 3300013306 Bacteria 40533
635 Ga0163162_10000554 3300013306 Bacteria 34569
636 Ga0163162_10001734 3300013306 Bacteria 20435
637 Ga0163162_10002043 3300013306 Bacteria 18983
638 Ga0163162_10004752 3300013306 Bacteria 13105
639 Ga0163162_10007639 3300013306 Bacteria 10532
640 Ga0163162_10011055 3300013306 Bacteria 8793
641 Ga0163162_10011263 3300013306 Bacteria 8720
642 Ga0163162_10013276 3300013306 Bacteria 8046
643 Ga0163162_10066034 3300013306 Bacteria 3666
644 Ga0163162_10078628 3300013306 Bacteria 3364
645 Ga0163162_10089334 3300013306 Bacteria 3161
646 Ga0163162_10094486 3300013306 Bacteria 3076
647 Ga0163162_10156314 3300013306 Bacteria 2401
648 Ga0163162_10192894 3300013306 Bacteria 2165
649 Ga0163162_10216962 3300013306 Bacteria 2043
650 Ga0163162_10493759 3300013306 Bacteria 1355
651 Ga0163162_10708950 3300013306 Bacteria 1128
652 Ga0163162_11140970 3300013306 Bacteria 884
653 Ga0157372_10000249 3300013307 Bacteria 59656
654 Ga0157372_10000573 3300013307 Bacteria 40317
655 Ga0157372_10001325 3300013307 Bacteria 26818
656 Ga0157372_10001734 3300013307 Bacteria 23654
657 Ga0157372_10004245 3300013307 Bacteria 15321
658 Ga0157372_10005099 3300013307 Bacteria 13964
659 Ga0157372_10029593 3300013307 Bacteria 5982
660 Ga0157372_10032861 3300013307 Bacteria 5693
661 Ga0157372_10047171 3300013307 Bacteria 4785
662 Ga0157372_10059943 3300013307 Bacteria 4258
663 Ga0157372_10062662 3300013307 Bacteria 4167
664 Ga0157372_10067907 3300013307 Bacteria 4008
665 Ga0157372_10117605 3300013307 Bacteria 3049
666 Ga0157372_10127116 3300013307 Bacteria 2931
667 Ga0157372_10128555 3300013307 Bacteria 2914
668 Ga0157372_10149478 3300013307 Bacteria 2695
669 Ga0157372_10158402 3300013307 Bacteria 2616
670 Ga0157372_10174527 3300013307 Bacteria 2488
671 Ga0157372_10195519 3300013307 Bacteria 2343
672 Ga0157372_10212172 3300013307 Bacteria 2244
673 Ga0157372_10404412 3300013307 Bacteria 1591
674 Ga0157372_10563276 3300013307 Bacteria 1328
675 Ga0157372_10639640 3300013307 Bacteria 1239
676 Ga0157372_10802402 3300013307 Bacteria 1094
677 Ga0157372_10863657 3300013307 Bacteria 1050
678 Ga0157375_10000144 3300013308 Bacteria 70151
679 Ga0157375_10000166 3300013308 Bacteria 61836
680 Ga0157375_10000989 3300013308 Bacteria 24572
681 Ga0157375_10011976 3300013308 Bacteria 7680
682 Ga0157375_10026953 3300013308 Bacteria 5364
683 Ga0157375_10028881 3300013308 Bacteria 5207
684 Ga0157375_10033870 3300013308 Bacteria 4859
685 Ga0157375_10046746 3300013308 Bacteria 4223
686 Ga0157375_10064088 3300013308 Bacteria 3658
687 Ga0157375_10096265 3300013308 Bacteria 3033
688 Ga0157375_10382077 3300013308 Bacteria 1575
689 Ga0157375_10777875 3300013308 Bacteria 1107
690 Ga0157375_10895822 3300013308 Bacteria 1031
691 Ga0163163_10000457 3300014325 Bacteria 37238
692 Ga0163163_10005245 3300014325 Bacteria 11176
693 Ga0163163_10007428 3300014325 Bacteria 9672
694 Ga0163163_10018496 3300014325 Bacteria 6525
695 Ga0163163_10042579 3300014325 Bacteria 4448
696 Ga0163163_10096264 3300014325 Bacteria 2980
697 Ga0163163_10206951 3300014325 Bacteria 2011
698 Ga0163163_10293044 3300014325 Bacteria 1679
699 Ga0163163_10429453 3300014325 Bacteria 1380
700 Ga0163163_10504567 3300014325 Bacteria 1272
701 Ga0163163_10653377 3300014325 Bacteria 1115
702 Ga0157380_10000959 3300014326 Bacteria 18260
703 Ga0157380_10042515 3300014326 Bacteria 3552
704 Ga0157380_10073518 3300014326 Bacteria 2772
705 Ga0157380_10109625 3300014326 Bacteria 2317
706 Ga0157380_10143991 3300014326 Bacteria 2051
707 Ga0157380_10215948 3300014326 Bacteria 1713
708 Ga0157380_10506599 3300014326 Bacteria 1174
709 Ga0157380_10954385 3300014326 Bacteria 888
710 Ga0182008_10000014 3300014497 Bacteria 263844
711 Ga0182008_10000447 3300014497 Bacteria 31386
712 Ga0182008_10000632 3300014497 Bacteria 25744
713 Ga0182008_10000876 3300014497 Bacteria 20916
714 Ga0182008_10004682 3300014497 Bacteria 7944
715 Ga0182008_10016574 3300014497 Bacteria 3829
716 Ga0157377_10001572 3300014745 Bacteria 9924
717 Ga0157377_10006401 3300014745 Bacteria 5614
718 Ga0157377_10026593 3300014745 Bacteria 3098
719 Ga0157377_10043294 3300014745 Bacteria 2505
720 Ga0157379_10000440 3300014968 Bacteria 33697
721 Ga0157379_10010385 3300014968 Bacteria 8111
722 Ga0157379_10016947 3300014968 Bacteria 6411
723 Ga0157379_10020609 3300014968 Bacteria 5833
724 Ga0157379_10037019 3300014968 Bacteria 4350
725 Ga0157379_10071559 3300014968 Bacteria 3102
726 Ga0157379_10129072 3300014968 Bacteria 2275
727 Ga0157379_10183456 3300014968 Bacteria 1890
728 Ga0157379_10315563 3300014968 Bacteria 1427
729 Ga0157376_10000783 3300014969 Bacteria 20773
730 Ga0157376_10001017 3300014969 Bacteria 18313
731 Ga0157376_10003603 3300014969 Bacteria 10688
732 Ga0157376_10004446 3300014969 Bacteria 9769
733 Ga0157376_10005594 3300014969 Bacteria 8793
734 Ga0157376_10019555 3300014969 Bacteria 5223
735 Ga0157376_10529869 3300014969 Bacteria 1162
736 Ga0157376_10541307 3300014969 Unclassified 1151
737 Ga0182006_1000015 3300015261 Bacteria 325938
738 Ga0182006_1000159 3300015261 Bacteria 72265
739 Ga0182006_1000697 3300015261 Bacteria 23266
740 Ga0182006_1001331 3300015261 Bacteria 15112
741 Ga0182006_1005526 3300015261 Bacteria 6005
742 Ga0182006_1005766 3300015261 Bacteria 5843
743 Ga0182006_1022598 3300015261 Bacteria 2613
744 Ga0182006_1042453 3300015261 Bacteria 1782
745 Ga0182006_1115540 3300015261 Bacteria 938
746 Ga0182006_1122512 3300015261 Bacteria 902
747 Ga0182007_10000002 3300015262 Bacteria 564661
748 Ga0182007_10046892 3300015262 Bacteria 1430
749 Ga0182005_1000131 3300015265 Bacteria 53401
750 Ga0183373_1004 3300015682 Bacteria 537398
751 Ga0163161_10000055 3300017792 Bacteria 114949
752 Ga0163161_10000310 3300017792 Bacteria 42437
753 Ga0163161_10000406 3300017792 Bacteria 36130
754 Ga0163161_10001060 3300017792 Bacteria 20831
755 Ga0163161_10001090 3300017792 Bacteria 20550
756 Ga0163161_10002554 3300017792 Bacteria 13004
757 Ga0163161_10007129 3300017792 Bacteria 7727
758 Ga0163161_10010202 3300017792 Bacteria 6503
759 Ga0163161_10012738 3300017792 Bacteria 5841
760 Ga0163161_10021681 3300017792 Bacteria 4515
761 Ga0163161_10022721 3300017792 Bacteria 4417
762 Ga0163161_10032577 3300017792 Bacteria 3722
763 Ga0163161_10033164 3300017792 Bacteria 3690
764 Ga0163161_10081658 3300017792 Bacteria 2380
765 Ga0163161_10084142 3300017792 Bacteria 2345
766 Ga0163161_10214407 3300017792 Bacteria 1488
767 Ga0163161_10248203 3300017792 Bacteria 1387
768 Ga0163161_10271733 3300017792 Bacteria 1327
769 Ga0163161_10449633 3300017792 Bacteria 1041
770 Ga0206351_10132316 3300020077 Bacteria 1139
771 Ga0206350_10385760 3300020080 Bacteria 1013
772 Ga0213876_10007839 3300021384 Bacteria 5793
773 Ga0213876_10036822 3300021384 Bacteria 2581
774 Ga0209436_100821 3300025208 Bacteria 12612
775 Ga0209436_102604 3300025208 Bacteria 5303
776 Ga0209563_105477 3300025230 Bacteria 2294
777 Ga0207427_100210 3300025231 Bacteria 53314
778 Ga0209437_100021 3300025233 Bacteria 646400
779 Ga0209437_100102 3300025233 Bacteria 224216
780 Ga0209258_100219 3300025242 Bacteria 108974
781 Ga0207425_1000002 3300025245 Bacteria 1362590
782 Ga0209646_1000002 3300025246 Bacteria 1425781
783 Ga0209646_1002231 3300025246 Bacteria 4454
784 Ga0209026_1000086 3300025250 Bacteria 185551
785 Ga0209148_1000283 3300025254 Bacteria 77780
786 Ga0209148_1010575 3300025254 Bacteria 1744
787 Ga0209129_1000002 3300025258 Bacteria 1359086
788 Ga0209129_1014317 3300025258 Bacteria 1695
789 Ga0209233_1000035 3300025261 Bacteria 568478
790 Ga0209233_1002196 3300025261 Bacteria 7314
791 Ga0209233_1019182 3300025261 Bacteria 1823
792 Ga0207666_1007757 3300025271 Bacteria 1421
793 Ga0209455_1001657 3300025272 Bacteria 9647
794 Ga0209673_1000082 3300025273 Bacteria 219716
795 Ga0209130_1002528 3300025284 Bacteria 8977
796 Ga0209675_1000095 3300025291 Bacteria 135911
797 Ga0209676_1000009 3300025292 Bacteria 981719
798 Ga0209025_1000004 3300025294 Bacteria 1361782
799 Ga0209758_1000006 3300025297 Bacteria 1359562
800 Ga0209758_1014978 3300025297 Bacteria 4058
801 Ga0209050_1000094 3300025298 Bacteria 242893
802 Ga0209050_1000555 3300025298 Bacteria 61428
803 Ga0207426_1000009 3300025302 Bacteria 797229
804 Ga0207426_1000493 3300025302 Bacteria 59050
805 Ga0207426_1000514 3300025302 Bacteria 56462
806 Ga0207426_1000883 3300025302 Bacteria 30996
807 Ga0209257_1000001 3300025304 Bacteria 2274655
808 Ga0209257_1000005 3300025304 Bacteria 1592528
809 Ga0209257_1004806 3300025304 Bacteria 10049
810 Ga0207697_10017058 3300025315 Bacteria 2986
811 Ga0207697_10025099 3300025315 Bacteria 2437
812 Ga0207656_10001383 3300025321 Bacteria 8006
813 Ga0207656_10091912 3300025321 Unclassified 1379
814 Ga0207656_10240688 3300025321 Bacteria 884
815 Ga0207696_1021549 3300025711 Bacteria 2061
816 Ga0207655_1000038 3300025728 Bacteria 348340
817 Ga0207655_1000237 3300025728 Bacteria 91108
818 Ga0207713_1029354 3300025735 Bacteria 2465
819 Ga0207682_10004258 3300025893 Bacteria 6040
820 Ga0207682_10053198 3300025893 Bacteria 1679
821 Ga0207682_10081045 3300025893 Bacteria 1391
822 Ga0207682_10127847 3300025893 Bacteria 1132
823 Ga0207710_10000635 3300025900 Bacteria 20160
824 Ga0207710_10020924 3300025900 Bacteria 2800
825 Ga0207688_10005632 3300025901 Bacteria 6813
826 Ga0207680_10000018 3300025903 Bacteria 94318
827 Ga0207680_10147108 3300025903 Bacteria 1567
828 Ga0207680_10478007 3300025903 Bacteria 886
829 Ga0207647_10000288 3300025904 Bacteria 41316
830 Ga0207647_10001469 3300025904 Bacteria 18105
831 Ga0207647_10014633 3300025904 Bacteria 5404
832 Ga0207647_10017201 3300025904 Bacteria 4920
833 Ga0207647_10175842 3300025904 Bacteria 1245
834 Ga0207645_10000355 3300025907 Bacteria 37914
835 Ga0207645_10139848 3300025907 Bacteria 1577
836 Ga0207643_10001223 3300025908 Bacteria 15180
837 Ga0207643_10025323 3300025908 Bacteria 3279
838 Ga0207705_10003765 3300025909 Bacteria 11554
839 Ga0207705_10005465 3300025909 Bacteria 9503
840 Ga0207705_10017645 3300025909 Bacteria 5108
841 Ga0207705_10056149 3300025909 Bacteria 2839
842 Ga0207705_10090771 3300025909 Bacteria 2237
843 Ga0207654_10001745 3300025911 Bacteria 11295
844 Ga0207654_10002658 3300025911 Bacteria 9074
845 Ga0207654_10010115 3300025911 Bacteria 4799
846 Ga0207654_10016563 3300025911 Bacteria 3840
847 Ga0207654_10068075 3300025911 Bacteria 2106
848 Ga0207654_10135668 3300025911 Bacteria 1563
849 Ga0207707_10006917 3300025912 Bacteria 9896
850 Ga0207707_10076027 3300025912 Bacteria 2931
851 Ga0207707_10110366 3300025912 Unclassified 2404
852 Ga0207707_10195532 3300025912 Bacteria 1764
853 Ga0207695_10000016 3300025913 Bacteria 771991
854 Ga0207695_10000092 3300025913 Bacteria 270514
855 Ga0207695_10000127 3300025913 Bacteria 227338
856 Ga0207695_10000128 3300025913 Bacteria 226098
857 Ga0207695_10001712 3300025913 Bacteria 35115
858 Ga0207695_10003683 3300025913 Bacteria 21346
859 Ga0207695_10004313 3300025913 Bacteria 19491
860 Ga0207695_10007767 3300025913 Bacteria 13580
861 Ga0207695_10077327 3300025913 Bacteria 3381
862 Ga0207695_10091282 3300025913 Bacteria 3060
863 Ga0207695_10102612 3300025913 Bacteria 2853
864 Ga0207695_10146167 3300025913 Bacteria 2308
865 Ga0207695_10316606 3300025913 Bacteria 1450
866 Ga0207671_10000036 3300025914 Bacteria 236133
867 Ga0207671_10000254 3300025914 Bacteria 79974
868 Ga0207671_10001027 3300025914 Bacteria 33973
869 Ga0207671_10002571 3300025914 Bacteria 19227
870 Ga0207671_10002688 3300025914 Bacteria 18645
871 Ga0207671_10002901 3300025914 Bacteria 17704
872 Ga0207671_10004487 3300025914 Bacteria 13301
873 Ga0207671_10009249 3300025914 Bacteria 8255
874 Ga0207671_10029553 3300025914 Bacteria 4092
875 Ga0207671_10030270 3300025914 Bacteria 4038
876 Ga0207671_10050334 3300025914 Bacteria 3085
877 Ga0207671_10059756 3300025914 Bacteria 2827
878 Ga0207671_10134946 3300025914 Bacteria 1897
879 Ga0207671_10151150 3300025914 Bacteria 1794
880 Ga0207671_10438171 3300025914 Bacteria 1040
881 Ga0207660_10010300 3300025917 Bacteria 6063
882 Ga0207660_10011293 3300025917 Bacteria 5808
883 Ga0207660_10021677 3300025917 Bacteria 4323
884 Ga0207660_10240081 3300025917 Bacteria 1427
885 Ga0207660_10282647 3300025917 Unclassified 1317
886 Ga0207660_10521411 3300025917 Bacteria 965
887 Ga0207662_10004421 3300025918 Bacteria 7392
888 Ga0207662_10073050 3300025918 Unclassified 2080
889 Ga0207657_10002233 3300025919 Bacteria 20999
890 Ga0207657_10005099 3300025919 Bacteria 13760
891 Ga0207657_10019043 3300025919 Bacteria 6531
892 Ga0207657_10054929 3300025919 Bacteria 3442
893 Ga0207649_10123079 3300025920 Unclassified 1751
894 Ga0207649_10160254 3300025920 Bacteria 1558
895 Ga0207649_10359198 3300025920 Bacteria 1080
896 Ga0207652_10000011 3300025921 Bacteria 246742
897 Ga0207652_10000944 3300025921 Bacteria 27335
898 Ga0207652_10008689 3300025921 Bacteria 8179
899 Ga0207652_10009908 3300025921 Bacteria 7668
900 Ga0207652_10014810 3300025921 Bacteria 6322
901 Ga0207652_10018660 3300025921 Bacteria 5692
902 Ga0207652_10097740 3300025921 Bacteria 2588
903 Ga0207652_10112230 3300025921 Bacteria 2419
904 Ga0207681_10150658 3300025923 Bacteria 1742
905 Ga0207681_10200845 3300025923 Bacteria 1531
906 Ga0207681_10299959 3300025923 Bacteria 1271
907 Ga0207694_10045879 3300025924 Bacteria 3377
908 Ga0207694_10055972 3300025924 Bacteria 3063
909 Ga0207694_10187288 3300025924 Bacteria 1680
910 Ga0207694_10219163 3300025924 Bacteria 1551
911 Ga0207694_10359113 3300025924 Bacteria 1207
912 Ga0207650_10023493 3300025925 Bacteria 4372
913 Ga0207650_10040596 3300025925 Bacteria 3406
914 Ga0207650_10054149 3300025925 Bacteria 2975
915 Ga0207650_10065515 3300025925 Bacteria 2723
916 Ga0207650_10069417 3300025925 Bacteria 2648
917 Ga0207650_10124097 3300025925 Bacteria 2014
918 Ga0207650_10232201 3300025925 Bacteria 1488
919 Ga0207650_10241645 3300025925 Bacteria 1460
920 Ga0207650_10302128 3300025925 Bacteria 1307
921 Ga0207659_10012489 3300025926 Bacteria 5406
922 Ga0207659_10026358 3300025926 Bacteria 3921
923 Ga0207659_10109974 3300025926 Bacteria 2093
924 Ga0207659_10349521 3300025926 Bacteria 1226
925 Ga0207644_10047981 3300025931 Bacteria 3050
926 Ga0207644_10233879 3300025931 Bacteria 1461
927 Ga0207644_10282928 3300025931 Bacteria 1332
928 Ga0207644_10456352 3300025931 Bacteria 1050
929 Ga0207644_10459907 3300025931 Bacteria 1046
930 Ga0207690_10003894 3300025932 Bacteria 8826
931 Ga0207690_10005944 3300025932 Bacteria 7226
932 Ga0207690_10023981 3300025932 Bacteria 3815
933 Ga0207690_10176607 3300025932 Bacteria 1604
934 Ga0207690_10313009 3300025932 Bacteria 1232
935 Ga0207690_10364860 3300025932 Bacteria 1145
936 Ga0207706_10019177 3300025933 Bacteria 6151
937 Ga0207706_10035734 3300025933 Bacteria 4416
938 Ga0207706_10443544 3300025933 Bacteria 1123
939 Ga0207686_10003017 3300025934 Bacteria 9072
940 Ga0207686_10270278 3300025934 Bacteria 1250
941 Ga0207686_10310355 3300025934 Bacteria 1175
942 Ga0207709_10000008 3300025935 Bacteria 713099
943 Ga0207709_10000630 3300025935 Bacteria 28876
944 Ga0207670_10118298 3300025936 Bacteria 1921
945 Ga0207670_10188460 3300025936 Bacteria 1559
946 Ga0207669_10090499 3300025937 Bacteria 1990
947 Ga0207669_10218719 3300025937 Bacteria 1396
948 Ga0207704_10013711 3300025938 Bacteria 4067
949 Ga0207704_10014771 3300025938 Bacteria 3956
950 Ga0207704_10050317 3300025938 Bacteria 2513
951 Ga0207704_10106009 3300025938 Bacteria 1887
952 Ga0207704_10124421 3300025938 Bacteria 1772
953 Ga0207691_10000037 3300025940 Bacteria 108385
954 Ga0207691_10022194 3300025940 Bacteria 5987
955 Ga0207691_10022708 3300025940 Bacteria 5915
956 Ga0207691_10049785 3300025940 Bacteria 3839
957 Ga0207691_10085689 3300025940 Bacteria 2828
958 Ga0207691_10158272 3300025940 Bacteria 1988
959 Ga0207691_10357143 3300025940 Bacteria 1250
960 Ga0207691_10407618 3300025940 Bacteria 1159
961 Ga0207711_10127665 3300025941 Bacteria 2276
962 Ga0207689_10019502 3300025942 Bacteria 5715
963 Ga0207689_10073408 3300025942 Bacteria 2810
964 Ga0207689_10074490 3300025942 Bacteria 2789
965 Ga0207689_10076209 3300025942 Bacteria 2758
966 Ga0207689_10079142 3300025942 Bacteria 2702
967 Ga0207689_10099429 3300025942 Bacteria 2390
968 Ga0207689_10128267 3300025942 Bacteria 2086
969 Ga0207689_10196597 3300025942 Bacteria 1664
970 Ga0207689_10345032 3300025942 Bacteria 1237
971 Ga0207661_10002075 3300025944 Bacteria 13781
972 Ga0207661_10002267 3300025944 Bacteria 13264
973 Ga0207661_10060182 3300025944 Bacteria 3063
974 Ga0207661_10369938 3300025944 Bacteria 1296
975 Ga0207679_10027794 3300025945 Bacteria 3917
976 Ga0207679_10059555 3300025945 Bacteria 2833
977 Ga0207679_10072076 3300025945 Unclassified 2608
978 Ga0207679_10300394 3300025945 Bacteria 1384
979 Ga0207667_10000346 3300025949 Bacteria 63247
980 Ga0207667_10000610 3300025949 Bacteria 46234
981 Ga0207667_10001317 3300025949 Bacteria 31149
982 Ga0207667_10011720 3300025949 Bacteria 10170
983 Ga0207667_10013817 3300025949 Bacteria 9224
984 Ga0207667_10052499 3300025949 Bacteria 4293
985 Ga0207667_10060056 3300025949 Bacteria 3980
986 Ga0207667_10067892 3300025949 Bacteria 3714
987 Ga0207667_10145050 3300025949 Bacteria 2444
988 Ga0207667_10214249 3300025949 Bacteria 1974
989 Ga0207667_10258199 3300025949 Bacteria 1782
990 Ga0207667_10306862 3300025949 Bacteria 1621
991 Ga0207667_10551033 3300025949 Bacteria 1166
992 Ga0207651_10001954 3300025960 Bacteria 9692
993 Ga0207651_10027337 3300025960 Bacteria 3582
994 Ga0207651_10169516 3300025960 Bacteria 1720
995 Ga0207651_10273679 3300025960 Bacteria 1392
996 Ga0207712_10031385 3300025961 Unclassified 3578
997 Ga0207712_10032827 3300025961 Bacteria 3506
998 Ga0207712_10033370 3300025961 Bacteria 3479
999 Ga0207712_10039674 3300025961 Bacteria 3227
1000 Ga0207712_10051430 3300025961 Bacteria 2881
1001 Ga0207712_10054675 3300025961 Bacteria 2805
1002 Ga0207712_10095338 3300025961 Bacteria 2200
1003 Ga0207712_10118743 3300025961 Bacteria 1997
1004 Ga0207668_10001977 3300025972 Bacteria 11985
1005 Ga0207668_10133778 3300025972 Bacteria 1897
1006 Ga0207640_10009102 3300025981 Bacteria 5545
1007 Ga0207640_10278514 3300025981 Bacteria 1312
1008 Ga0207658_10011529 3300025986 Bacteria 6017
1009 Ga0207658_10030280 3300025986 Bacteria 3830
1010 Ga0207658_10079089 3300025986 Bacteria 2514
1011 Ga0207658_10100570 3300025986 Bacteria 2264
1012 Ga0207658_10153346 3300025986 Bacteria 1880
1013 Ga0207658_10156222 3300025986 Bacteria 1864
1014 Ga0207677_10000485 3300026023 Bacteria 25909
1015 Ga0207677_10091658 3300026023 Bacteria 2211
1016 Ga0207703_10016859 3300026035 Bacteria 5696
1017 Ga0207703_10050789 3300026035 Bacteria 3358
1018 Ga0207703_10056347 3300026035 Bacteria 3201
1019 Ga0207703_10152489 3300026035 Bacteria 2016
1020 Ga0207639_10003745 3300026041 Bacteria 10237
1021 Ga0207639_10024644 3300026041 Bacteria 4357
1022 Ga0207639_10054315 3300026041 Bacteria 3061
1023 Ga0207639_10081189 3300026041 Bacteria 2568
1024 Ga0207639_10088442 3300026041 Bacteria 2472
1025 Ga0207639_10175228 3300026041 Bacteria 1820
1026 Ga0207639_10288358 3300026041 Bacteria 1446
1027 Ga0207639_10425543 3300026041 Bacteria 1201
1028 Ga0207678_10007004 3300026067 Bacteria 10008
1029 Ga0207678_10075827 3300026067 Bacteria 2880
1030 Ga0207678_10147956 3300026067 Bacteria 2005
1031 Ga0207708_10031319 3300026075 Bacteria 4037
1032 Ga0207708_10520691 3300026075 Bacteria 999
1033 Ga0207702_10000023 3300026078 Bacteria 189234
1034 Ga0207702_10005843 3300026078 Bacteria 10701
1035 Ga0207702_10028006 3300026078 Bacteria 4681
1036 Ga0207702_10131836 3300026078 Bacteria 2250
1037 Ga0207702_10209080 3300026078 Bacteria 1813
1038 Ga0207702_10535252 3300026078 Bacteria 1145
1039 Ga0207702_10693516 3300026078 Bacteria 1003
1040 Ga0207641_10000053 3300026088 Bacteria 173468
1041 Ga0207641_10004287 3300026088 Bacteria 12394
1042 Ga0207641_10015125 3300026088 Bacteria 6322
1043 Ga0207641_10031185 3300026088 Bacteria 4420
1044 Ga0207641_10158912 3300026088 Bacteria 2053
1045 Ga0207641_10282833 3300026088 Bacteria 1561
1046 Ga0207641_10324899 3300026088 Bacteria 1460
1047 Ga0207641_10584342 3300026088 Bacteria 1092
1048 Ga0207648_10002745 3300026089 Bacteria 18711
1049 Ga0207648_10002984 3300026089 Bacteria 17884
1050 Ga0207648_10021518 3300026089 Bacteria 5796
1051 Ga0207648_10080806 3300026089 Bacteria 2836
1052 Ga0207648_10152433 3300026089 Bacteria 2040
1053 Ga0207648_10284895 3300026089 Bacteria 1478
1054 Ga0207648_10292234 3300026089 Bacteria 1459
1055 Ga0207648_10302914 3300026089 Bacteria 1434
1056 Ga0207676_10007338 3300026095 Bacteria 7820
1057 Ga0207676_10012031 3300026095 Bacteria 6193
1058 Ga0207676_10051922 3300026095 Bacteria 3203
1059 Ga0207676_10069872 3300026095 Bacteria 2814
1060 Ga0207676_10142200 3300026095 Bacteria 2055
1061 Ga0207676_10166047 3300026095 Bacteria 1918
1062 Ga0207676_10543079 3300026095 Bacteria 1109
1063 Ga0207674_10021221 3300026116 Bacteria 7001
1064 Ga0207674_10027137 3300026116 Bacteria 6065
1065 Ga0207674_10035346 3300026116 Bacteria 5215
1066 Ga0207674_10059552 3300026116 Bacteria 3864
1067 Ga0207674_10092507 3300026116 Bacteria 3014
1068 Ga0207674_10105539 3300026116 Bacteria 2795
1069 Ga0207674_10155308 3300026116 Bacteria 2243
1070 Ga0207674_10212088 3300026116 Bacteria 1885
1071 Ga0207674_10249006 3300026116 Bacteria 1724
1072 Ga0207674_10311501 3300026116 Bacteria 1523
1073 Ga0207675_100000124 3300026118 Bacteria 63805
1074 Ga0207675_100040463 3300026118 Bacteria 4353
1075 Ga0207675_100169354 3300026118 Bacteria 2087
1076 Ga0207675_100190769 3300026118 Bacteria 1966
1077 Ga0207675_100372489 3300026118 Bacteria 1403
1078 Ga0207675_100473959 3300026118 Bacteria 1243
1079 Ga0207683_10086170 3300026121 Bacteria 2792
1080 Ga0207683_10170844 3300026121 Bacteria 1969
1081 Ga0207683_10279996 3300026121 Bacteria 1524
1082 Ga0207683_10386350 3300026121 Bacteria 1287
1083 Ga0207698_10001211 3300026142 Bacteria 15062
1084 Ga0207698_10003545 3300026142 Bacteria 9411
1085 Ga0207698_10011425 3300026142 Bacteria 5758
1086 Ga0207698_10033954 3300026142 Bacteria 3713
1087 Ga0207698_10046171 3300026142 Bacteria 3287
1088 Ga0207698_10054931 3300026142 Bacteria 3066
1089 Ga0207698_10065450 3300026142 Bacteria 2855
1090 Ga0207698_10205936 3300026142 Bacteria 1766
1091 Ga0207698_10287448 3300026142 Bacteria 1524
1092 Ga0207698_10287458 3300026142 Bacteria 1524
1093 Ga0209281_1000311 3300027111 Bacteria 86930
1094 Ga0209489_112096 3300027361 Bacteria 8182
1095 Ga0209995_1013121 3300027471 Bacteria 1356
1096 Ga0268266_10000014 3300028379 Bacteria 644033
1097 Ga0268266_10016598 3300028379 Bacteria 6292
1098 Ga0268266_10162530 3300028379 Bacteria 2021
1099 Ga0268266_10545080 3300028379 Bacteria 1111
1100 Ga0268265_10021116 3300028380 Bacteria 4554
1101 Ga0268265_10052714 3300028380 Bacteria 3078
1102 Ga0268264_10000013 3300028381 Bacteria 513859
1103 Ga0268264_10004442 3300028381 Bacteria 11964
1104 Ga0268264_10007626 3300028381 Bacteria 9019
1105 Ga0268264_10014664 3300028381 Bacteria 6439
1106 Ga0268264_10024660 3300028381 Bacteria 4912
1107 Ga0268264_10047358 3300028381 Bacteria 3574
1108 Ga0268264_10062030 3300028381 Bacteria 3138
1109 Ga0268264_10116919 3300028381 Bacteria 2345
1110 Ga0268264_10324998 3300028381 Bacteria 1456
1111 Ga0268264_10394012 3300028381 Bacteria 1329
1112 Ga0307517_10009441 3300028786 Bacteria 13821
1113 Ga0307515_10000002 3300028794 Bacteria 1231751
1114 Ga0307515_10000061 3300028794 Bacteria 251841
1115 Ga0307515_10000676 3300028794 Bacteria 78539
1116 Ga0307515_10001796 3300028794 Bacteria 47846
1117 Ga0307515_10228549 3300028794 Bacteria 1659
1118 Ga0307515_10364670 3300028794 Bacteria 1084
1119 Ga0265338_10000658 3300028800 Bacteria 59815
1120 Ga0265324_10046281 3300029957 Bacteria 1497
1121 Ga0307511_10001218 3300030521 Bacteria 27286
1122 Ga0316177_1046651 3300030731 Bacteria 2602
1123 Ga0316176_1106664 3300030732 Bacteria 8555
1124 Ga0316183_1171692 3300030742 Bacteria 16840
1125 Ga0316181_1177553 3300030744 Bacteria 6181
1126 Ga0316182_1148280 3300030745 Bacteria 2669
1127 Ga0265327_10000093 3300031251 Bacteria 195220
1128 Ga0265327_10000148 3300031251 Bacteria 151952
1129 Ga0265327_10003750 3300031251 Bacteria 14130
1130 Ga0265327_10021872 3300031251 Bacteria 3846
1131 Ga0265327_10022676 3300031251 Bacteria 3744
1132 Ga0265327_10024944 3300031251 Bacteria 3497
1133 Ga0265327_10089072 3300031251 Bacteria 1508
1134 Ga0265327_10101452 3300031251 Bacteria 1388
1135 Ga0265316_10201971 3300031344 Bacteria 1473
1136 Ga0307513_10072311 3300031456 Bacteria 3595
1137 Ga0307513_10139618 3300031456 Bacteria 2352
1138 Ga0307509_10034640 3300031507 Bacteria 5546
1139 Ga0307509_10039603 3300031507 Bacteria 5133
1140 Ga0307509_10060843 3300031507 Bacteria 3990
1141 Ga0307509_10193809 3300031507 Bacteria 1879
1142 Ga0307408_100000566 3300031548 Bacteria 31917
1143 Ga0307408_100000736 3300031548 Bacteria 26464
1144 Ga0307408_100000824 3300031548 Bacteria 24639
1145 Ga0307508_10001800 3300031616 Bacteria 23762
1146 Ga0307508_10209485 3300031616 Bacteria 1550
1147 Ga0316579_10062502 3300031691 Bacteria 1753
1148 Ga0265314_10028286 3300031711 Bacteria 4181
1149 Ga0316576_10004240 3300031727 Bacteria 8564
1150 Ga0316576_10030922 3300031727 Unclassified 3795
1151 Ga0316576_10054422 3300031727 Bacteria 2919
1152 Ga0316576_10092344 3300031727 Bacteria 2255
1153 Ga0316576_10103933 3300031727 Bacteria 2125
1154 Ga0316576_10325775 3300031727 Bacteria 1146
1155 Ga0316578_10016865 3300031728 Unclassified 3962
1156 Ga0316578_10069316 3300031728 Bacteria 2087
1157 Ga0316578_10107827 3300031728 Bacteria 1672
1158 Ga0307516_10004774 3300031730 Bacteria 16525
1159 Ga0307516_10220891 3300031730 Bacteria 1604
1160 Ga0307516_10295557 3300031730 Bacteria 1297
1161 Ga0307405_10000001 3300031731 Bacteria 1731270
1162 Ga0307405_10000006 3300031731 Bacteria 361477
1163 Ga0316577_10013852 3300031733 Bacteria 4420
1164 Ga0307413_10000039 3300031824 Bacteria 33762
1165 Ga0307410_10000363 3300031852 Bacteria 17675
1166 Ga0307406_10000950 3300031901 Bacteria 16237
1167 Ga0307406_10065077 3300031901 Bacteria 2368
1168 Ga0307407_10000031 3300031903 Bacteria 87995
1169 Ga0307407_10033702 3300031903 Bacteria 2796
1170 Ga0307412_10000019 3300031911 Bacteria 266611
1171 Ga0307412_10000043 3300031911 Bacteria 166562
1172 Ga0307412_10002048 3300031911 Bacteria 11186
1173 Ga0307412_10035298 3300031911 Bacteria 3193
1174 Ga0307412_10323767 3300031911 Bacteria 1227
1175 Ga0307409_100057513 3300031995 Bacteria 3014
1176 Ga0307416_100000002 3300032002 Bacteria 509907
1177 Ga0307416_100000004 3300032002 Bacteria 505535
1178 Ga0307416_100000179 3300032002 Bacteria 34391
1179 Ga0307416_100263485 3300032002 Bacteria 1686
1180 Ga0307414_10000010 3300032004 Bacteria 357863
1181 Ga0307414_10000011 3300032004 Bacteria 338253
1182 Ga0307414_10000713 3300032004 Bacteria 16976
1183 Ga0307414_10003845 3300032004 Bacteria 8076
1184 Ga0307414_10010702 3300032004 Bacteria 5341
1185 Ga0307414_10018546 3300032004 Bacteria 4288
1186 Ga0307414_10038767 3300032004 Bacteria 3203
1187 Ga0307414_10076998 3300032004 Bacteria 2426
1188 Ga0307414_10079616 3300032004 Bacteria 2392
1189 Ga0307414_10128456 3300032004 Bacteria 1963
1190 Ga0307414_10166483 3300032004 Bacteria 1757
1191 Ga0307414_10205639 3300032004 Bacteria 1605
1192 Ga0307414_10253395 3300032004 Bacteria 1465
1193 Ga0307414_10387745 3300032004 Bacteria 1210
1194 Ga0307411_10000004 3300032005 Bacteria 460327
1195 Ga0307411_10038743 3300032005 Bacteria 3010
1196 Ga0307411_10070585 3300032005 Bacteria 2364
1197 Ga0307411_10219368 3300032005 Bacteria 1474
1198 Ga0307415_100228926 3300032126 Bacteria 1496
1199 Ga0316583_10063105 3300032133 Bacteria 1298
1200 Ga0316580_10055265 3300032139 Bacteria 1221
1201 Ga0307507_10000099 3300033179 Bacteria 139532
1202 Ga0307510_10000299 3300033180 Bacteria 45822
1203 Ga0373944_0124646 3300035089 Bacteria 891
1204 Ga0373955_0088969 3300035172 Bacteria 1757
1205 Ga0373955_0258306 3300035172 Bacteria 1045
1206 Ga0316574_0050496 3300035398 Bacteria 2589
1207 Ga0316574_0098149 3300035398 Bacteria 1873
1208 Ga0373935_0500638 3300035692 Bacteria 882
1209 Ga0373937_0048314 3300036401 Bacteria 3895
1210 Ga0373937_0123286 3300036401 Bacteria 2416
1211 Ga0373937_0487459 3300036401 Bacteria 1171
1212 Ga0316582_0009025 3300036647 Bacteria 5389
1213 Ga0316582_0017395 3300036647 Unclassified 4159
1214 Ga0316582_0086359 3300036647 Bacteria 2057
1215 Ga0316582_0254760 3300036647 Bacteria 1203
1216 Ga0316584_0006014 3300036712 Bacteria 8196
1217 Ga0316584_0008100 3300036712 Bacteria 7220
1218 Ga0316584_0042576 3300036712 Bacteria 3385
1219 Ga0316584_0252682 3300036712 Bacteria 1287
1220 Ga0373925_0115794 3300037068 Bacteria 2076
1221 Ga0395899_0000177 3300037312 Bacteria 94226
1222 Ga0395899_0002106 3300037312 Bacteria 16349
1223 Ga0395899_0025305 3300037312 Bacteria 4481
1224 Ga0395899_0156961 3300037312 Bacteria 1609
1225 Ga0395900_0001729 3300037418 Bacteria 25209
1226 Ga0395900_0013551 3300037418 Bacteria 8328
1227 Ga0395900_0081265 3300037418 Unclassified 3329
1228 Ga0395900_0232663 3300037418 Bacteria 1852
1229 Ga0395900_0234292 3300037418 Bacteria 1845
1230 Ga0395898_0003753 3300037466 Bacteria 16827
1231 Ga0395898_0012532 3300037466 Bacteria 8768
1232 Ga0395898_0019133 3300037466 Bacteria 6972
1233 Ga0395898_0076279 3300037466 Bacteria 3237
1234 Ga0395898_0205045 3300037466 Bacteria 1881
1235 Ga0395898_0503099 3300037466 Bacteria 1152
1236 Ga0395905_0000003 3300037471 Bacteria 1347396
1237 Ga0395905_0001826 3300037471 Bacteria 24589
1238 Ga0395905_0073567 3300037471 Bacteria 3203
1239 Ga0395905_0208421 3300037471 Bacteria 1832
1240 Ga0395905_0293382 3300037471 Bacteria 1513
1241 Ga0395901_0006688 3300038443 Bacteria 11654
1242 Ga0395901_0007184 3300038443 Bacteria 11231
1243 Ga0395901_0012926 3300038443 Bacteria 8469
1244 Ga0395901_0021023 3300038443 Bacteria 6685
1245 Ga0395901_0244529 3300038443 Bacteria 1870
1246 Ga0400483_183977 3300039062 Bacteria 1317
1247 Ga0400483_219275 3300039062 Bacteria 32517
1248 Ga0400489_11482 3300039093 Bacteria 10842
1249 Ga0400489_54591 3300039093 Bacteria 1337
1250 Ga0436365_0480954 3300039437 Bacteria 25378
1251 Ga0436365_1569731 3300039437 Bacteria 4980
1252 Ga0436365_1768392 3300039437 Bacteria 2141
1253 Ga0436361_0728698 3300039447 Bacteria 1120
1254 Ga0439436_0012671 3300041404 Bacteria 2558
1255 Ga0439447_000262 3300041407 Bacteria 18516
1256 Ga0439466_0014367 3300041411 Bacteria 2884
1257 Ga0439465_0002739 3300041413 Bacteria 5764
1258 Ga0451791_1824324 3300041451 Bacteria 1597
1259 Ga0451807_1357051 3300041486 Bacteria 1592
1260 Ga0451841_0372109 3300041498 Bacteria 1229
1261 Ga0451855_0667465 3300041511 Bacteria 2429
1262 Ga0451855_1514386 3300041511 Bacteria 3379
1263 Ga0451853_1013762 3300041512 Bacteria 1095
1264 Ga0439431_0000810 3300041997 Bacteria 6751
1265 Ga0439431_0042653 3300041997 Bacteria 1159
1266 Ga0439442_006092 3300042002 Bacteria 2417
1267 Ga0439445_0000001 3300042004 Bacteria 97032
1268 Ga0439445_0000088 3300042004 Bacteria 14394
1269 Ga0439445_0004839 3300042004 Bacteria 3058
1270 Ga0439449_0005652 3300042007 Bacteria 4783
1271 Ga0439449_0057959 3300042007 Bacteria 1430
1272 Ga0439457_000014 3300042014 Bacteria 36364
1273 Ga0439457_026821 3300042014 Bacteria 1275
1274 Ga0450923_004999 3300042125 Bacteria 2117
1275 Ga0450898_000638 3300042134 Bacteria 4204
1276 Ga0450899_001082 3300042135 Bacteria 3097
1277 Ga0439434_0008135 3300042435 Bacteria 3074
1278 Ga0451577_0000250 3300042876 Bacteria 105934
1279 Ga0451577_0000756 3300042876 Bacteria 49287
1280 Ga0451577_0023282 3300042876 Bacteria 5649
1281 Ga0451577_0033500 3300042876 Bacteria 4631
1282 Ga0451577_0058443 3300042876 Bacteria 3438
1283 Ga0451577_0059945 3300042876 Bacteria 3393
1284 Ga0451577_0070738 3300042876 Bacteria 3111
1285 Ga0451577_0073923 3300042876 Bacteria 3041
1286 Ga0451577_0276851 3300042876 Bacteria 1520
1287 Ga0466969_0000137 3300044656 Bacteria 39423
1288 Ga0466969_0056886 3300044656 Bacteria 1908
1289 Ga0466972_0000023 3300044658 Bacteria 192679
1290 Ga0466972_0000064 3300044658 Bacteria 104558
1291 Ga0466972_0000661 3300044658 Bacteria 16620
1292 Ga0466972_0015911 3300044658 Bacteria 3761
1293 Ga0466972_0192733 3300044658 Bacteria 955
1294 Ga0453683_0000031 3300044673 Bacteria 241998
1295 Ga0453683_0000209 3300044673 Bacteria 78900
1296 Ga0453683_0002457 3300044673 Bacteria 14343
1297 Ga0453683_0014335 3300044673 Bacteria 5150
1298 Ga0453683_0025049 3300044673 Bacteria 3792
1299 Ga0453683_0042349 3300044673 Bacteria 2859
1300 Ga0453683_0129232 3300044673 Bacteria 1591
1301 Ga0453683_0172023 3300044673 Bacteria 1372
1302 Ga0453683_0194507 3300044673 Bacteria 1287
1303 Ga0466966_0000099 3300044684 Bacteria 53474
1304 Ga0466964_0189800 3300044706 Bacteria 980
1305 Ga0466964_0263090 3300044706 Unclassified 855
1306 Ga0453684_0001523 3300044712 Bacteria 64868
1307 Ga0453684_0001816 3300044712 Bacteria 56297
1308 Ga0453684_0002641 3300044712 Bacteria 42804
1309 Ga0453684_0006066 3300044712 Bacteria 23349
1310 Ga0453684_0010591 3300044712 Bacteria 15730
1311 Ga0453684_0012880 3300044712 Bacteria 13701
1312 Ga0453684_0014054 3300044712 Bacteria 12882
1313 Ga0453684_0016267 3300044712 Bacteria 11646
1314 Ga0453684_0018038 3300044712 Bacteria 10866
1315 Ga0453684_0018478 3300044712 Bacteria 10698
1316 Ga0453684_0031266 3300044712 Bacteria 7488
1317 Ga0453684_0040412 3300044712 Bacteria 6334
1318 Ga0453684_0044676 3300044712 Bacteria 5922
1319 Ga0453684_0060293 3300044712 Bacteria 4882
1320 Ga0453684_0061696 3300044712 Bacteria 4810
1321 Ga0453684_0063629 3300044712 Bacteria 4717
1322 Ga0453684_0066188 3300044712 Bacteria 4603
1323 Ga0453684_0074832 3300044712 Unclassified 4261
1324 Ga0453684_0077606 3300044712 Bacteria 4161
1325 Ga0453684_0094645 3300044712 Bacteria 3674
1326 Ga0453684_0199148 3300044712 Bacteria 2336
1327 Ga0453684_0235620 3300044712 Bacteria 2110
1328 Ga0453684_0483707 3300044712 Bacteria 1373
1329 Ga0453684_0676626 3300044712 Bacteria 1124
1330 Ga0466971_0007196 3300044719 Bacteria 4846
1331 Ga0466968_0024252 3300044735 Bacteria 2477
1332 Ga0466968_0082946 3300044735 Bacteria 1411
1333 Ga0466970_0000094 3300044765 Bacteria 37832
1334 Ga0466970_0047720 3300044765 Bacteria 2283
1335 Ga0466957_0002083 3300044842 Bacteria 10703
1336 Ga0466957_0009316 3300044842 Bacteria 5602
1337 Ga0466959_0000074 3300045049 Bacteria 65664
1338 Ga0466959_0014265 3300045049 Bacteria 5767
1339 Ga0451576_0000539 3300045051 Bacteria 81512
1340 Ga0451576_0002019 3300045051 Bacteria 32075
1341 Ga0451576_0003414 3300045051 Bacteria 21860
1342 Ga0451576_0022076 3300045051 Bacteria 6907
1343 Ga0451576_0035160 3300045051 Bacteria 5317
1344 Ga0451576_0043706 3300045051 Bacteria 4726
1345 Ga0451576_0085197 3300045051 Bacteria 3287
1346 Ga0451576_0096200 3300045051 Bacteria 3080
1347 Ga0451576_0112249 3300045051 Bacteria 2837
1348 Ga0451576_0169071 3300045051 Bacteria 2281
1349 Ga0451576_0234149 3300045051 Bacteria 1918
1350 Ga0451576_0253156 3300045051 Bacteria 1841
1351 Ga0451576_0411419 3300045051 Bacteria 1418
1352 Ga0451576_0595790 3300045051 Bacteria 1162
1353 Ga0451576_0936526 3300045051 Bacteria 908
1354 Ga0466967_0091301 3300045976 Bacteria 2768
1355 Ga0495627_000025 3300046453 Bacteria 248825
1356 Ga0495627_001544 3300046453 Bacteria 13158
1357 Ga0495627_004116 3300046453 Bacteria 6178
1358 Ga0495627_024362 3300046453 Bacteria 1973
1359 Ga0495590_0004963 3300046457 Bacteria 5312
1360 Ga0495629_0058077 3300046459 Bacteria 2705
1361 Ga0495638_0067278 3300046460 Bacteria 2200
1362 Ga0495638_0083484 3300046460 Bacteria 1935
1363 Ga0495651_0168704 3300046462 Bacteria 1561
1364 Ga0495651_0173285 3300046462 Bacteria 1534
1365 Ga0495650_0000107 3300046471 Bacteria 200864
1366 Ga0495582_0007561 3300046473 Bacteria 6011
1367 Ga0495639_0117227 3300046475 Bacteria 1268
1368 Ga0495585_0000116 3300046492 Bacteria 86272
1369 Ga0495585_0000170 3300046492 Bacteria 70224
1370 Ga0495607_0087145 3300046501 Bacteria 1700
1371 Ga0495583_0129701 3300046506 Bacteria 1056
1372 Ga0495583_0150615 3300046506 Bacteria 964
1373 Ga0495606_0002103 3300046507 Bacteria 24231
1374 Ga0495606_0009259 3300046507 Bacteria 8361
1375 Ga0495606_0011835 3300046507 Bacteria 7064
1376 Ga0495606_0012971 3300046507 Bacteria 6630
1377 Ga0495606_0020567 3300046507 Bacteria 4860
1378 Ga0495606_0037648 3300046507 Bacteria 3283
1379 Ga0495608_0229760 3300046511 Bacteria 1162
1380 Ga0495610_0000001 3300046512 Bacteria 1620061
1381 Ga0495610_0000724 3300046512 Bacteria 31376
1382 Ga0495610_0000784 3300046512 Bacteria 29827
1383 Ga0495610_0033625 3300046512 Bacteria 2648
1384 Ga0495610_0110737 3300046512 Bacteria 1217
1385 Ga0495616_0000882 3300046513 Bacteria 21777
1386 Ga0495616_0006658 3300046513 Bacteria 6974
1387 Ga0495618_0263834 3300046514 Bacteria 1078
1388 Ga0495628_0330916 3300046516 Bacteria 1123
1389 Ga0495632_0046723 3300046519 Bacteria 2150
1390 Ga0495637_0091612 3300046520 Bacteria 1198
1391 Ga0495643_0002717 3300046522 Bacteria 13619
1392 Ga0495643_0047543 3300046522 Bacteria 2323
1393 Ga0495643_0194823 3300046522 Bacteria 976
1394 Ga0495648_0016029 3300046524 Bacteria 5412
1395 Ga0495648_0023598 3300046524 Bacteria 4207
1396 Ga0495648_0045048 3300046524 Bacteria 2747
1397 Ga0495663_0000022 3300046525 Bacteria 109849
1398 Ga0495652_0122798 3300046529 Bacteria 2068
1399 Ga0495652_0170986 3300046529 Bacteria 1677
1400 Ga0495654_0000242 3300046530 Bacteria 50953
1401 Ga0495654_0044400 3300046530 Bacteria 2198
1402 Ga0495665_0084426 3300046531 Bacteria 1669
1403 Ga0495609_0000113 3300046538 Bacteria 94467
1404 Ga0495609_0001895 3300046538 Bacteria 13334
1405 Ga0495609_0074096 3300046538 Bacteria 1493
1406 Ga0495645_0084246 3300046543 Bacteria 2277
1407 Ga0495633_0000006 3300046558 Bacteria 326774
1408 Ga0495633_0000154 3300046558 Bacteria 90209
1409 Ga0495633_0000341 3300046558 Bacteria 52317
1410 Ga0495633_0014208 3300046558 Bacteria 4171
1411 Ga0495633_0020413 3300046558 Bacteria 3333
1412 Ga0495668_0000011 3300046616 Bacteria 472186
1413 Ga0495668_0000191 3300046616 Bacteria 90923
1414 Ga0495611_0001405 3300046648 Bacteria 12014
1415 Ga0495625_0000021 3300046660 Bacteria 282133
1416 Ga0495625_0000344 3300046660 Bacteria 71298
1417 Ga0495625_0003152 3300046660 Bacteria 16792
1418 Ga0495625_0014051 3300046660 Bacteria 6410
1419 Ga0495625_0014342 3300046660 Bacteria 6331
1420 Ga0495625_0069980 3300046660 Bacteria 2464
1421 Ga0495635_0356889 3300046663 Bacteria 974
1422 Ga0495661_0011479 3300046665 Bacteria 6010
1423 Ga0495647_0089909 3300046681 Bacteria 1258
1424 Ga0495658_0108891 3300046683 Bacteria 1663
1425 Ga0495671_0028196 3300046692 Bacteria 2895
1426 Ga0495649_0000009 3300046694 Bacteria 451725
1427 Ga0495660_0001836 3300046810 Bacteria 13932
1428 Ga0495660_0066210 3300046810 Bacteria 1927
1429 Ga0495581_0067456 3300047315 Bacteria 2069
1430 Ga0495636_0000077 3300047318 Bacteria 40716
1431 Ga0495674_0029758 3300047319 Bacteria 4969
1432 Ga0495672_0058796 3300047320 Bacteria 2227
1433 Ga0495672_0075978 3300047320 Bacteria 1888
1434 Ga0495687_000106 3300047443 Bacteria 128130
1435 Ga0495687_000356 3300047443 Bacteria 57396
1436 Ga0495673_0009304 3300047469 Bacteria 5446
1437 Ga0495686_0000016 3300047472 Bacteria 443701
1438 Ga0495686_0000107 3300047472 Bacteria 174386
1439 Ga0495686_0000324 3300047472 Bacteria 79635
1440 Ga0495686_0000485 3300047472 Bacteria 58800
1441 Ga0495686_0000673 3300047472 Bacteria 46191
1442 Ga0495686_0010011 3300047472 Bacteria 6774
1443 Ga0495686_0021685 3300047472 Bacteria 4260
1444 Ga0495686_0034708 3300047472 Bacteria 3247
1445 Ga0495686_0058484 3300047472 Bacteria 2403
1446 Ga0495686_0066119 3300047472 Bacteria 2235
1447 Ga0495614_0019698 3300048089 Bacteria 2919
1448 Ga0496100_0087754 3300048903 Bacteria 2116
1449 Ga0496101_0056828 3300048904 Bacteria 2829
1450 Ga0496101_0067770 3300048904 Bacteria 2607
1451 Ga0496102_0037210 3300048905 Bacteria 4389
1452 Ga0496104_0000005 3300048907 Bacteria 620360
1453 Ga0496105_0000018 3300048908 Bacteria 197208
1454 Ga0496108_0643425 3300048911 Bacteria 922
1455 Ga0496109_0023654 3300048912 Bacteria 5454
1456 Ga0496110_0069554 3300048913 Bacteria 3118
1457 Ga0496113_0121908 3300048916 Bacteria 2039
1458 Ga0496114_0006504 3300048917 Bacteria 9206
1459 Ga0496114_0344865 3300048917 Bacteria 1317
1460 Ga0496115_0067946 3300048918 Bacteria 2884
1461 Ga0496115_0341431 3300048918 Bacteria 1222
1462 Ga0496115_0427269 3300048918 Bacteria 1073
1463 Ga0496116_0000024 3300048919 Bacteria 471420
1464 Ga0496116_0000919 3300048919 Bacteria 36391
1465 Ga0496117_0000285 3300048920 Bacteria 92381
1466 Ga0496117_0042858 3300048920 Bacteria 3298
1467 Ga0496118_0003532 3300048921 Bacteria 19579
1468 Ga0496119_0000004 3300048922 Bacteria 536344
1469 Ga0496121_0000020 3300048924 Bacteria 498732
1470 Ga0496121_0215393 3300048924 Bacteria 1357
1471 Ga0496122_0000856 3300048925 Bacteria 57260
1472 Ga0496122_0001202 3300048925 Bacteria 44119
1473 Ga0496122_0001336 3300048925 Bacteria 40321
1474 Ga0496122_0003258 3300048925 Bacteria 21547
1475 Ga0496122_0016975 3300048925 Bacteria 6838
1476 Ga0496122_0106068 3300048925 Bacteria 1861
1477 Ga0496123_0002339 3300048926 Bacteria 23786
1478 Ga0496123_0008431 3300048926 Bacteria 9471
1479 Ga0496123_0010972 3300048926 Bacteria 7924
1480 Ga0496123_0032984 3300048926 Bacteria 3735
1481 Ga0496124_0001868 3300048927 Bacteria 28989
1482 Ga0496124_0170598 3300048927 Bacteria 1685
1483 Ga0496124_0443072 3300048927 Bacteria 888
1484 Ga0496125_0000018 3300048928 Bacteria 482390
1485 Ga0496125_0000552 3300048928 Bacteria 64522
1486 Ga0496125_0050649 3300048928 Bacteria 3436
1487 Ga0496125_0065533 3300048928 Bacteria 2877
1488 Ga0496126_0003667 3300048929 Bacteria 19179
1489 Ga0496126_0007711 3300048929 Bacteria 11749
1490 Ga0496126_0029217 3300048929 Bacteria 5239
1491 Ga0501309_000358 3300049129 Bacteria 3480
1492 Ga0495678_015057 3300049459 Bacteria 3573
1493 Ga0501298_012944 3300049521 Bacteria 1469
1494 Ga0501323_011008 3300049539 Bacteria 1086
1495 Ga0501323_013125 3300049539 Bacteria 1021
1496 Ga0501031_0000669 3300049568 Bacteria 20380
1497 Ga0501032_0006377 3300049569 Bacteria 8690
1498 Ga0501032_0006744 3300049569 Bacteria 8429
1499 Ga0501032_0011511 3300049569 Bacteria 6355
1500 Ga0501033_0000005 3300049570 Bacteria 379089
1501 Ga0501033_0045896 3300049570 Bacteria 3250
1502 Ga0501033_0082718 3300049570 Bacteria 2354
1503 Ga0501033_0116037 3300049570 Bacteria 1946
1504 Ga0501033_0218382 3300049570 Bacteria 1358
1505 Ga0501034_0000052 3300049571 Bacteria 207572
1506 Ga0501034_0000399 3300049571 Bacteria 73348
1507 Ga0501034_0007132 3300049571 Bacteria 11922
1508 Ga0501034_0013607 3300049571 Bacteria 8373
1509 Ga0501034_0048621 3300049571 Bacteria 4281
1510 Ga0501034_0057277 3300049571 Bacteria 3918
1511 Ga0501034_0082328 3300049571 Bacteria 3220
1512 Ga0501034_0174368 3300049571 Bacteria 2117
1513 Ga0501034_0204855 3300049571 Bacteria 1929
1514 Ga0501034_0372380 3300049571 Bacteria 1354
1515 Ga0501036_0005324 3300049572 Bacteria 10409
1516 Ga0501036_0038538 3300049572 Bacteria 4045
1517 Ga0501036_0226812 3300049572 Bacteria 1568
1518 Ga0501037_0004614 3300049573 Bacteria 10014
1519 Ga0501037_0028996 3300049573 Bacteria 4088
1520 Ga0501037_0048842 3300049573 Bacteria 3099
1521 Ga0501037_0154742 3300049573 Bacteria 1637
1522 Ga0501038_0008621 3300049574 Bacteria 9360
1523 Ga0501038_0013871 3300049574 Bacteria 7343
1524 Ga0501038_0269014 3300049574 Bacteria 1344
1525 Ga0501038_0315654 3300049574 Bacteria 1223
1526 Ga0501039_0010156 3300049575 Bacteria 7175
1527 Ga0501043_0009194 3300049579 Bacteria 7767
1528 Ga0501043_0097363 3300049579 Bacteria 2313
1529 Ga0501043_0179804 3300049579 Bacteria 1648
1530 Ga0501043_0223723 3300049579 Bacteria 1455
1531 Ga0501043_0326014 3300049579 Bacteria 1170
1532 Ga0501046_0161429 3300049580 Bacteria 1685
1533 Ga0501047_0008976 3300049581 Bacteria 9438
1534 Ga0501047_0028283 3300049581 Bacteria 5404
1535 Ga0501047_0056150 3300049581 Bacteria 3807
1536 Ga0501047_0082702 3300049581 Bacteria 3086
1537 Ga0501047_0375654 3300049581 Bacteria 1256
1538 Ga0501069_0028314 3300049585 Bacteria 3072
1539 Ga0501069_0047967 3300049585 Bacteria 2371
1540 Ga0501069_0064019 3300049585 Bacteria 2055
1541 Ga0501069_0249186 3300049585 Bacteria 1036
1542 Ga0501070_0065524 3300049586 Unclassified 3008
1543 Ga0501070_0066256 3300049586 Bacteria 2990
1544 Ga0501071_0319494 3300049587 Bacteria 1179
1545 Ga0501073_0033311 3300049589 Bacteria 3669
1546 Ga0501073_0232854 3300049589 Bacteria 1272
1547 Ga0501076_0198496 3300049592 Bacteria 1638
1548 Ga0501198_012863 3300049649 Bacteria 1261
1549 Ga0501201_000710 3300049651 Bacteria 3115
1550 Ga0501202_003897 3300049652 Bacteria 2580
1551 Ga0501217_000991 3300049661 Bacteria 5120
1552 Ga0501217_002907 3300049661 Bacteria 3427
1553 Ga0501222_001667 3300049662 Bacteria 3082
1554 Ga0501223_001698 3300049663 Bacteria 5037
1555 Ga0501223_006800 3300049663 Bacteria 2352
1556 Ga0501224_008900 3300049664 Bacteria 1466
1557 Ga0501233_060068 3300049668 Bacteria 941
1558 Ga0501235_003004 3300049669 Bacteria 3638
1559 Ga0501240_009534 3300049673 Bacteria 1271
1560 Ga0501243_017198 3300049675 Bacteria 1172
1561 Ga0501249_000012 3300049679 Bacteria 153759
1562 Ga0501249_001078 3300049679 Bacteria 5790
1563 Ga0501252_002797 3300049682 Bacteria 1761
1564 Ga0501257_001003 3300049686 Bacteria 5690
1565 Ga0501259_001336 3300049688 Bacteria 4128
1566 Ga0501261_000935 3300049690 Bacteria 3612
1567 Ga0501219_000072 3300049703 Bacteria 17183
1568 Ga0501221_001193 3300049704 Bacteria 4300
1569 Ga0501225_0002937 3300049705 Bacteria 5227
1570 Ga0501234_002922 3300049707 Bacteria 2690
1571 Ga0501245_000792 3300049708 Bacteria 3945
1572 Ga0501079_0074461 3300049741 Bacteria 2625
1573 Ga0501080_0046050 3300049742 Bacteria 4062
1574 Ga0501080_0095038 3300049742 Bacteria 2768
1575 Ga0501083_0104398 3300049744 Bacteria 1867
1576 Ga0501241_000014 3300049758 Bacteria 100728
1577 Ga0501241_007126 3300049758 Bacteria 2051
1578 Ga0501241_007683 3300049758 Bacteria 1975
1579 Ga0501241_010614 3300049758 Bacteria 1673
1580 Ga0501241_029215 3300049758 Bacteria 1037
1581 Ga0501264_001446 3300049761 Bacteria 2555
1582 Ga0501264_006301 3300049761 Bacteria 1092
1583 Ga0501266_000002 3300049763 Bacteria 459947
1584 Ga0501266_001794 3300049763 Bacteria 2720
1585 Ga0501269_000413 3300049766 Bacteria 9747
1586 Ga0501269_004616 3300049766 Bacteria 1657
1587 Ga0501280_004064 3300049776 Bacteria 2177
1588 Ga0501282_005718 3300049778 Bacteria 1332
1589 Ga0501035_0008311 3300049822 Bacteria 9666
1590 Ga0501035_0012497 3300049822 Bacteria 7844
1591 Ga0501035_0013123 3300049822 Bacteria 7646
1592 Ga0501035_0058067 3300049822 Bacteria 3449
1593 Ga0501035_0087075 3300049822 Bacteria 2753
1594 Ga0501035_0107483 3300049822 Bacteria 2446
1595 Ga0501044_0001723 3300049823 Bacteria 25593
1596 Ga0501044_0008687 3300049823 Bacteria 11117
1597 Ga0501044_0011700 3300049823 Bacteria 9506
1598 Ga0501044_0015635 3300049823 Bacteria 8174
1599 Ga0501044_0072142 3300049823 Bacteria 3511
1600 Ga0501044_0100915 3300049823 Unclassified 2904
1601 Ga0501044_0121383 3300049823 Bacteria 2614
1602 Ga0501044_0222442 3300049823 Bacteria 1838
1603 Ga0501044_0243374 3300049823 Bacteria 1742
1604 Ga0501044_0332706 3300049823 Bacteria 1441
1605 Ga0501045_0003565 3300049824 Bacteria 10689
1606 Ga0501212_000685 3300049851 Bacteria 3449
1607 Ga0501284_00059 3300050005 Bacteria 39196
1608 nmdc:mga0k408_10235_c1 3300050493 Bacteria 5069
1609 nmdc:mga0k408_102649_c1 3300050493 Bacteria 1687
1610 nmdc:mga0k408_2012_c1 3300050493 Bacteria 9069
1611 nmdc:mga0k408_96192_c1 3300050493 Bacteria 1743
1612 nmdc:mga05p37_375315_c1 3300050507 Bacteria 1668
1613 nmdc:mga09592_37236_c1 3300050508 Bacteria 4081
1614 nmdc:mga09592_45525_c1 3300050508 Bacteria 3696
1615 nmdc:mga0qj67_91800_c1 3300050509 Bacteria 2441
1616 nmdc:mga06r32_36325_c1 3300050510 Bacteria 4654
1617 nmdc:mga06r32_90944_c1 3300050510 Bacteria 2982
1618 nmdc:mga08y16_149587_c1 3300050511 Bacteria 2005
1619 nmdc:mga08y16_154457_c1 3300050511 Bacteria 2385
1620 nmdc:mga08y16_17977_c1 3300050511 Bacteria 7448
1621 nmdc:mga08y16_631759_c1 3300050511 Bacteria 1077
1622 Ga0500635_0000417 3300053080 Bacteria 12581
1623 Ga0495595_0171146 3300053084 Bacteria 1075
1624 Ga0500578_0000144 3300053086 Bacteria 85335
1625 Ga0500578_0014501 3300053086 Bacteria 5068
1626 Ga0500644_0000600 3300053088 Bacteria 13739
1627 Ga0500644_0037786 3300053088 Bacteria 1581
1628 Ga0500644_0078404 3300053088 Bacteria 1209
1629 Ga0500646_0000818 3300053090 Bacteria 8619
1630 Ga0500646_0002249 3300053090 Bacteria 5022
1631 Ga0500646_0003070 3300053090 Bacteria 4281
1632 Ga0500646_0016363 3300053090 Bacteria 1936
1633 Ga0500583_0000060 3300053092 Bacteria 68112
1634 Ga0500583_0002372 3300053092 Bacteria 5644
1635 Ga0500583_0012962 3300053092 Bacteria 3204
1636 Ga0500583_0050778 3300053092 Bacteria 1925
1637 Ga0500583_0067379 3300053092 Bacteria 1705
1638 Ga0500651_0001777 3300053093 Bacteria 11046
1639 Ga0500651_0313237 3300053093 Bacteria 898
1640 Ga0500566_0204195 3300053094 Bacteria 995
1641 Ga0500641_0000010 3300053096 Bacteria 171383
1642 Ga0500641_0000275 3300053096 Bacteria 19089
1643 Ga0500641_0001720 3300053096 Bacteria 7784
1644 Ga0500641_0037152 3300053096 Bacteria 1951
1645 Ga0500660_078635 3300053100 Bacteria 1519
1646 Ga0500555_009160 3300053103 Bacteria 2830
1647 Ga0500556_0023972 3300053104 Bacteria 1999
1648 Ga0500562_014455 3300053108 Bacteria 2021
1649 Ga0500569_000226 3300053109 Bacteria 8932
1650 Ga0500594_0005313 3300053118 Bacteria 2854
1651 Ga0500594_0012961 3300053118 Bacteria 1974
1652 Ga0500607_020375 3300053121 Bacteria 3744
1653 Ga0500618_000016 3300053125 Bacteria 164049
1654 Ga0500652_005154 3300053131 Bacteria 4093
1655 Ga0500658_0000002 3300053134 Bacteria 548440
1656 Ga0500658_0021484 3300053134 Bacteria 2445
1657 Ga0500559_0023756 3300053136 Bacteria 2603
1658 Ga0500568_0005710 3300053139 Bacteria 6381
1659 Ga0500568_0013071 3300053139 Bacteria 3797
1660 Ga0500568_0019967 3300053139 Bacteria 2906
1661 Ga0500573_0131722 3300053140 Bacteria 1384
1662 Ga0500577_0000468 3300053142 Bacteria 10461
1663 Ga0500579_133212 3300053143 Bacteria 1153
1664 Ga0500588_0014453 3300053146 Bacteria 2001
1665 Ga0500588_0059154 3300053146 Bacteria 1222
1666 Ga0500589_030117 3300053147 Bacteria 2527
1667 Ga0500590_010437 3300053148 Bacteria 4693
1668 Ga0500604_0025190 3300053151 Bacteria 1709
1669 Ga0500616_0002790 3300053153 Bacteria 14072
1670 Ga0500616_0014086 3300053153 Bacteria 4609
1671 Ga0500622_0000077 3300053156 Bacteria 108558
1672 Ga0500622_0000304 3300053156 Bacteria 50299
1673 Ga0500622_0005426 3300053156 Bacteria 7663
1674 Ga0500622_0022534 3300053156 Bacteria 3338
1675 Ga0500622_0069802 3300053156 Bacteria 1778
1676 Ga0500622_0089259 3300053156 Bacteria 1532
1677 Ga0500624_000265 3300053157 Bacteria 18286
1678 Ga0500627_0029600 3300053158 Bacteria 2285
1679 Ga0500634_0015358 3300053161 Bacteria 4065
1680 Ga0500636_0039586 3300053177 Bacteria 2789
1681 Ga0500636_0052137 3300053177 Bacteria 2404
1682 Ga0500584_048657 3300053726 Bacteria 1924
1683 Ga0500611_000033 3300053727 Bacteria 79214
1684 Ga0500645_046972 3300053730 Bacteria 1266
1685 Ga0501084_0138796 3300054114 Bacteria 2046
1686 Ga0466962_0003757 3300061719 Bacteria 7252
1687 Ga0466962_0035580 3300061719 Bacteria 2384

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300036401 Ga0373937_0487459 Ga0373937_0487459_502_1158 217
2 3300009176 Ga0105242_10376113 Ga0105242_103761132 239
3 3300047472 Ga0495686_0034708 Ga0495686_0034708_33_758 239
4 3300025932 Ga0207690_10176607 Ga0207690_101766073 241
5 3300031730 Ga0307516_10004774 Ga0307516_1000477412 241
6 3300042004 Ga0439445_0000001 Ga0439445_0000001_37720_38490 241
7 3300045051 Ga0451576_0096200 Ga0451576_0096200_2160_2939 242
8 2162886007 SwRhRL2b_contig_2703482 SwRhRL2b_0229.00004340 244
9 3300005289 Ga0065704_10074182 Ga0065704_100741825 244
10 3300009148 Ga0105243_10002448 Ga0105243_1000244818 244
11 3300025932 Ga0207690_10313009 Ga0207690_103130091 244
12 3300025935 Ga0207709_10000630 Ga0207709_100006303 244
13 3300025944 Ga0207661_10002075 Ga0207661_100020752 244
14 3300041413 Ga0439465_0002739 Ga0439465_0002739_615_1388 244
15 3300042004 Ga0439445_0000088 Ga0439445_0000088_11996_12769 244
16 3300044673 Ga0453683_0042349 Ga0453683_0042349_1953_2732 244
17 3300045051 Ga0451576_0022076 Ga0451576_0022076_199_978 244
18 3300045051 Ga0451576_0936526 Ga0451576_0936526_107_841 244
19 3300046453 Ga0495627_000025 Ga0495627_000025_204302_205075 244
20 3300046507 Ga0495606_0009259 Ga0495606_0009259_3122_3895 244
21 3300046530 Ga0495654_0000242 Ga0495654_0000242_36440_37213 244
22 3300046538 Ga0495609_0000113 Ga0495609_0000113_79658_80533 244
23 3300046558 Ga0495633_0000341 Ga0495633_0000341_37485_38258 244
24 3300046558 Ga0495633_0014208 Ga0495633_0014208_835_1608 244
25 3300046660 Ga0495625_0003152 Ga0495625_0003152_13463_14329 244
26 3300047472 Ga0495686_0021685 Ga0495686_0021685_341_1114 244
27 3300048925 Ga0496122_0000856 Ga0496122_0000856_14201_14974 244
28 3300048926 Ga0496123_0008431 Ga0496123_0008431_1313_2086 244
29 3300049758 Ga0501241_000014 Ga0501241_000014_77871_78644 244
30 3300049766 Ga0501269_000413 Ga0501269_000413_6525_7298 244
31 3300025942 Ga0207689_10128267 Ga0207689_101282672 245
32 2162886007 SwRhRL2b_contig_3661140 SwRhRL2b_0435.00001200 246
33 3300003322 rootL2_10319714 rootL2_103197143 246
34 3300003578 Ga0006562J51391_1002343 Ga0006562J51391_10023434 246
35 3300003784 Ga0055534_1001279 Ga0055534_100127911 246
36 3300005289 Ga0065704_10072129 Ga0065704_100721297 246
37 3300005337 Ga0070682_100000394 Ga0070682_10000039422 246
38 3300005339 Ga0070660_100327588 Ga0070660_1003275882 246
39 3300009036 Ga0105244_10000043 Ga0105244_1000004336 246
40 3300009092 Ga0105250_10023942 Ga0105250_100239422 246
41 3300013100 Ga0157373_10000044 Ga0157373_1000004487 246
42 3300013102 Ga0157371_10000130 Ga0157371_1000013035 246
43 3300013102 Ga0157371_10037443 Ga0157371_100374434 246
44 3300013104 Ga0157370_10000684 Ga0157370_1000068414 246
45 3300013104 Ga0157370_10004809 Ga0157370_100048092 246
46 3300013105 Ga0157369_10000731 Ga0157369_1000073126 246
47 3300013105 Ga0157369_10159428 Ga0157369_101594282 246
48 3300013308 Ga0157375_10895822 Ga0157375_108958221 246
49 3300014497 Ga0182008_10000447 Ga0182008_1000044717 246
50 3300015261 Ga0182006_1000015 Ga0182006_100001513 246
51 3300017792 Ga0163161_10010202 Ga0163161_100102022 246
52 3300017792 Ga0163161_10271733 Ga0163161_102717332 246
53 3300025291 Ga0209675_1000095 Ga0209675_1000095106 246
54 3300025711 Ga0207696_1021549 Ga0207696_10215491 246
55 3300025728 Ga0207655_1000237 Ga0207655_100023718 246
56 3300031911 Ga0307412_10000019 Ga0307412_1000001957 246
57 3300032002 Ga0307416_100000004 Ga0307416_100000004132 246
58 3300046457 Ga0495590_0004963 Ga0495590_0004963_3844_4623 246
59 3300046507 Ga0495606_0020567 Ga0495606_0020567_137_910 246
60 3300046512 Ga0495610_0000001 Ga0495610_0000001_448190_448963 246
61 3300046522 Ga0495643_0194823 Ga0495643_0194823_36_809 246
62 3300046525 Ga0495663_0000022 Ga0495663_0000022_93067_93840 246
63 3300047472 Ga0495686_0000485 Ga0495686_0000485_44429_45202 246
64 3300047472 Ga0495686_0000673 Ga0495686_0000673_11701_12504 246
65 3300048905 Ga0496102_0037210 Ga0496102_0037210_2045_2818 246
66 3300048916 Ga0496113_0121908 Ga0496113_0121908_807_1580 246
67 3300048919 Ga0496116_0000919 Ga0496116_0000919_14692_15465 246
68 3300048920 Ga0496117_0000285 Ga0496117_0000285_77120_77893 246
69 3300048921 Ga0496118_0003532 Ga0496118_0003532_4325_5098 246
70 3300048922 Ga0496119_0000004 Ga0496119_0000004_458818_459591 246
71 3300048925 Ga0496122_0001202 Ga0496122_0001202_14584_15357 246
72 3300048925 Ga0496122_0001336 Ga0496122_0001336_13852_14625 246
73 3300048925 Ga0496122_0016975 Ga0496122_0016975_90_863 246
74 3300048925 Ga0496122_0106068 Ga0496122_0106068_244_1137 246
75 3300048926 Ga0496123_0002339 Ga0496123_0002339_14696_15469 246
76 3300048926 Ga0496123_0032984 Ga0496123_0032984_2432_3205 246
77 3300048927 Ga0496124_0001868 Ga0496124_0001868_13845_14618 246
78 3300048928 Ga0496125_0000552 Ga0496125_0000552_43092_43865 246
79 3300048929 Ga0496126_0029217 Ga0496126_0029217_1052_1825 246
80 3300013104 Ga0157370_10021765 Ga0157370_100217656 247
81 3300032004 Ga0307414_10000010 Ga0307414_10000010138 247
82 3300006195 Ga0075366_10252890 Ga0075366_102528901 248
83 3300042876 Ga0451577_0000756 Ga0451577_0000756_39392_40171 249
84 3300044712 Ga0453684_0001816 Ga0453684_0001816_16127_16906 249
85 3300003316 rootH1_10149292 rootH1_101492922 250
86 3300003794 Ga0055531_10000156 Ga0055531_1000015630 250
87 3300010375 Ga0105239_10000011 Ga0105239_10000011305 250
88 3300013104 Ga0157370_10273470 Ga0157370_102734701 250
89 3300025304 Ga0209257_1000005 Ga0209257_10000051236 250
90 3300049571 Ga0501034_0013607 Ga0501034_0013607_5009_5782 250
91 iso_pu_bacteria 2833640130 2833642520 250
92 iso_pu_bacteria 2919509842 2919512835 250
93 3300003320 rootH2_10015381 rootH2_100153813 251
94 3300004799 Ga0058863_10001245 Ga0058863_100012453 251
95 3300004803 Ga0058862_12212891 Ga0058862_122128911 251
96 3300005327 Ga0070658_10335126 Ga0070658_103351262 251
97 3300005530 Ga0070679_100238729 Ga0070679_1002387292 251
98 3300009093 Ga0105240_10000083 Ga0105240_10000083157 251
99 3300009093 Ga0105240_10376489 Ga0105240_103764892 251
100 3300009545 Ga0105237_10000198 Ga0105237_1000019846 251
101 3300009545 Ga0105237_10338924 Ga0105237_103389242 251
102 3300009551 Ga0105238_10060135 Ga0105238_100601353 251
103 3300010375 Ga0105239_10003144 Ga0105239_100031449 251
104 3300025261 Ga0209233_1019182 Ga0209233_10191822 251
105 3300025911 Ga0207654_10002658 Ga0207654_1000265810 251
106 3300025913 Ga0207695_10000127 Ga0207695_10000127157 251
107 3300025914 Ga0207671_10000254 Ga0207671_1000025445 251
108 3300025917 Ga0207660_10010300 Ga0207660_100103006 251
109 3300025921 Ga0207652_10097740 Ga0207652_100977401 251
110 3300025924 Ga0207694_10055972 Ga0207694_100559723 251
111 3300025925 Ga0207650_10124097 Ga0207650_101240972 251
112 3300037312 Ga0395899_0000177 Ga0395899_0000177_8915_9724 251
113 iso_pu_bacteria 2513020052 2513232560 251
114 iso_pu_bacteria 2519899754 2520879713 251
115 iso_pu_bacteria 2643221600 2644009376 251
116 iso_pu_bacteria 2643221667 2644374120 251
117 iso_pu_bacteria 2643221716 2644643759 251
118 iso_pu_bacteria 2643221725 2644681649 251
119 iso_pu_bacteria 2738541279 2738732874 251
120 iso_pu_bacteria 2738541285 2738765412 251
121 iso_pu_bacteria 2738543007 2739214455 251
122 iso_pu_bacteria 2739367857 2740003037 251
123 iso_pu_bacteria 2739367858 2740007854 251
124 iso_pu_bacteria 2802428842 2802654724 251
125 iso_pu_bacteria 2816332280 2817413356 251
126 iso_pu_bacteria 2857613821 2857617230 251
127 iso_pu_bacteria 2857618242 2857619920 251
128 iso_pu_bacteria 2881359912 2881360159 251
129 iso_pu_bacteria 2903895155 2903898841 251
130 iso_pu_bacteria 2904419702 2904423125 251
131 iso_pu_bacteria 2904555929 2904558687 251
132 iso_pu_bacteria 2919191525 2919194410 251
133 iso_pu_bacteria 2919683626 2919684418 251
134 iso_pu_bacteria 2929150217 2929150428 251
135 iso_pu_bacteria 2958458903 2958463145 251
136 iso_pu_bacteria 2977268062 2977271890 251
137 iso_pu_bacteria 8054307821 8054311607 251
138 iso_pu_bacteria 8055419101 8055423387 251
139 iso_pu_bacteria 8055592153 8055595249 251
140 iso_pu_bacteria 8056440228 8056443334 251
141 3300003320 rootH2_10011084 rootH2_100110846 252
142 3300003320 rootH2_10013162 rootH2_100131629 252
143 3300003323 rootH1_10115746 rootH1_101157463 252
144 3300005329 Ga0070683_100005694 Ga0070683_1000056946 252
145 3300005341 Ga0070691_10018376 Ga0070691_100183762 252
146 3300005535 Ga0070684_100031170 Ga0070684_1000311706 252
147 3300005539 Ga0068853_100003690 Ga0068853_1000036906 252
148 3300005563 Ga0068855_100001370 Ga0068855_10000137010 252
149 3300005563 Ga0068855_100083464 Ga0068855_1000834642 252
150 3300005578 Ga0068854_100090507 Ga0068854_1000905072 252
151 3300005614 Ga0068856_100065842 Ga0068856_1000658422 252
152 3300005616 Ga0068852_100116263 Ga0068852_1001162632 252
153 3300005983 Ga0081540_1012512 Ga0081540_10125126 252
154 3300009093 Ga0105240_10000023 Ga0105240_10000023189 252
155 3300009093 Ga0105240_10000893 Ga0105240_1000089324 252
156 3300009093 Ga0105240_10002999 Ga0105240_1000299921 252
157 3300009093 Ga0105240_10172201 Ga0105240_101722013 252
158 3300009093 Ga0105240_10504887 Ga0105240_105048872 252
159 3300009545 Ga0105237_10000261 Ga0105237_1000026153 252
160 3300009545 Ga0105237_10091762 Ga0105237_100917622 252
161 3300009545 Ga0105237_10160901 Ga0105237_101609012 252
162 3300009551 Ga0105238_10016205 Ga0105238_100162052 252
163 3300010375 Ga0105239_10001010 Ga0105239_1000101012 252
164 3300010375 Ga0105239_10003043 Ga0105239_100030438 252
165 3300010375 Ga0105239_10019068 Ga0105239_100190682 252
166 3300010375 Ga0105239_10146897 Ga0105239_101468973 252
167 3300013104 Ga0157370_10018596 Ga0157370_100185965 252
168 3300013105 Ga0157369_10196241 Ga0157369_101962412 252
169 3300013296 Ga0157374_10000002 Ga0157374_10000002296 252
170 3300013307 Ga0157372_10001734 Ga0157372_1000173414 252
171 3300013307 Ga0157372_10004245 Ga0157372_1000424513 252
172 3300014325 Ga0163163_10042579 Ga0163163_100425792 252
173 3300014969 Ga0157376_10004446 Ga0157376_100044462 252
174 3300025913 Ga0207695_10000016 Ga0207695_10000016128 252
175 3300025913 Ga0207695_10000128 Ga0207695_10000128131 252
176 3300025913 Ga0207695_10004313 Ga0207695_100043138 252
177 3300025913 Ga0207695_10077327 Ga0207695_100773273 252
178 3300025914 Ga0207671_10002901 Ga0207671_100029013 252
179 3300025914 Ga0207671_10134946 Ga0207671_101349462 252
180 3300025924 Ga0207694_10045879 Ga0207694_100458793 252
181 3300025944 Ga0207661_10002267 Ga0207661_1000226711 252
182 3300025949 Ga0207667_10001317 Ga0207667_100013174 252
183 3300025949 Ga0207667_10067892 Ga0207667_100678922 252
184 3300025981 Ga0207640_10278514 Ga0207640_102785141 252
185 3300026041 Ga0207639_10288358 Ga0207639_102883581 252
186 3300026078 Ga0207702_10028006 Ga0207702_100280062 252
187 3300026142 Ga0207698_10205936 Ga0207698_102059362 252
188 3300031507 Ga0307509_10034640 Ga0307509_100346405 252
189 3300031727 Ga0316576_10030922 Ga0316576_100309222 252
190 3300031728 Ga0316578_10016865 Ga0316578_100168654 252
191 3300033180 Ga0307510_10000299 Ga0307510_1000029915 252
192 3300036647 Ga0316582_0017395 Ga0316582_0017395_1093_1872 252
193 3300036712 Ga0316584_0006014 Ga0316584_0006014_2798_3577 252
194 3300044706 Ga0466964_0189800 Ga0466964_0189800_153_953 252
195 3300044706 Ga0466964_0263090 Ga0466964_0263090_25_825 252
196 3300044719 Ga0466971_0007196 Ga0466971_0007196_2981_3781 252
197 3300044765 Ga0466970_0047720 Ga0466970_0047720_921_1721 252
198 3300046648 Ga0495611_0001405 Ga0495611_0001405_3027_3827 252
199 3300047472 Ga0495686_0000016 Ga0495686_0000016_190643_191443 252
200 3300049592 Ga0501076_0198496 Ga0501076_0198496_300_1094 252
201 3300053092 Ga0500583_0050778 Ga0500583_0050778_634_1434 252
202 3300053146 Ga0500588_0059154 Ga0500588_0059154_295_1095 252
203 3300061719 Ga0466962_0003757 Ga0466962_0003757_4150_4950 252
204 iso_pu_bacteria 8036736890 8036737695 252
205 3300001904 JGI24736J21556_1001877 JGI24736J21556_10018773 253
206 3300001990 JGI24737J22298_10011017 JGI24737J22298_100110174 253
207 3300002067 JGI24735J21928_10003137 JGI24735J21928_100031373 253
208 3300005366 Ga0070659_100003274 Ga0070659_1000032748 253
209 3300005577 Ga0068857_100025412 Ga0068857_1000254124 253
210 3300013100 Ga0157373_10003753 Ga0157373_1000375310 253
211 3300013102 Ga0157371_10000164 Ga0157371_1000016445 253
212 3300013104 Ga0157370_10004433 Ga0157370_1000443310 253
213 3300013104 Ga0157370_10033538 Ga0157370_100335385 253
214 3300013105 Ga0157369_10134553 Ga0157369_101345534 253
215 3300013296 Ga0157374_10163274 Ga0157374_101632742 253
216 3300013307 Ga0157372_10000249 Ga0157372_1000024911 253
217 3300013307 Ga0157372_10117605 Ga0157372_101176051 253
218 3300025261 Ga0209233_1002196 Ga0209233_10021966 253
219 3300025904 Ga0207647_10001469 Ga0207647_100014696 253
220 3300025932 Ga0207690_10005944 Ga0207690_100059449 253
221 3300026116 Ga0207674_10035346 Ga0207674_100353464 253
222 3300026116 Ga0207674_10092507 Ga0207674_100925072 253
223 3300031727 Ga0316576_10004240 Ga0316576_100042407 253
224 3300031727 Ga0316576_10092344 Ga0316576_100923441 253
225 3300031728 Ga0316578_10069316 Ga0316578_100693162 253
226 3300032139 Ga0316580_10055265 Ga0316580_100552652 253
227 3300036647 Ga0316582_0086359 Ga0316582_0086359_413_1213 253
228 3300036712 Ga0316584_0252682 Ga0316584_0252682_317_1117 253
229 3300046616 Ga0495668_0000191 Ga0495668_0000191_14774_15574 253
230 3300049571 Ga0501034_0174368 Ga0501034_0174368_129_926 253
231 3300053080 Ga0500635_0000417 Ga0500635_0000417_7734_8537 253
232 iso_pu_bacteria 2511231000 2511232051 253
233 iso_pu_bacteria 2523533629 2524004576 253
234 iso_pu_bacteria 2582581278 2585145599 253
235 iso_pu_bacteria 2582581281 2585156007 253
236 iso_pu_bacteria 2582581282 2585160069 253
237 iso_pu_bacteria 2582581873 2585426560 253
238 iso_pu_bacteria 2585428045 2587678078 253
239 iso_pu_bacteria 2585428060 2587749991 253
240 iso_pu_bacteria 2585428061 2587753825 253
241 iso_pu_bacteria 2585428115 2587942171 253
242 iso_pu_bacteria 2585428182 2588209301 253
243 iso_pu_bacteria 2585428183 2588216000 253
244 iso_pu_bacteria 2585428184 2588217460 253
245 iso_pu_bacteria 2585428185 2588222207 253
246 iso_pu_bacteria 2585428187 2588234867 253
247 iso_pu_bacteria 2588253712 2588445244 253
248 iso_pu_bacteria 2588254255 2590600104 253
249 iso_pu_bacteria 2588254257 2590610941 253
250 iso_pu_bacteria 2728369107 2729202928 253
251 iso_pu_bacteria 2739367874 2740061087 253
252 iso_pu_bacteria 2751185877 2753671631 253
253 iso_pu_bacteria 2765235839 2765576406 253
254 iso_pu_bacteria 2772190705 2772606804 253
255 iso_pu_bacteria 2775506739 2775673732 253
256 iso_pu_bacteria 2816332188 2816871846 253
257 iso_pu_bacteria 2842083920 2842085640 253
258 iso_pu_bacteria 2871720351 2871721218 253
259 iso_pu_bacteria 2889290771 2889293087 253
260 iso_pu_bacteria 2905999023 2906001720 253
261 iso_pu_bacteria 2919097161 2919097838 253
262 iso_pu_bacteria 2919399522 2919401171 253
263 iso_pu_bacteria 2945924605 2945926374 253
264 iso_pu_bacteria 2946019816 2946020296 253
265 iso_pu_bacteria 2977243572 2977247079 253
266 iso_pu_bacteria 2984572630 2984572956 253
267 iso_pu_bacteria 2984606641 2984610405 253
268 iso_pu_bacteria 2993372514 2993372618 253
269 iso_pu_bacteria 2993480792 2993483382 253
270 3300003322 rootL2_10143549 rootL2_101435495 254
271 3300005289 Ga0065704_10005473 Ga0065704_100054732 254
272 3300005293 Ga0065715_10250221 Ga0065715_102502211 254
273 3300005329 Ga0070683_100568753 Ga0070683_1005687531 254
274 3300005336 Ga0070680_100008794 Ga0070680_1000087945 254
275 3300005337 Ga0070682_100008503 Ga0070682_1000085035 254
276 3300005337 Ga0070682_100096963 Ga0070682_1000969632 254
277 3300005338 Ga0068868_100032252 Ga0068868_1000322525 254
278 3300005339 Ga0070660_100033263 Ga0070660_1000332634 254
279 3300005341 Ga0070691_10010843 Ga0070691_100108435 254
280 3300005367 Ga0070667_100332861 Ga0070667_1003328611 254
281 3300005458 Ga0070681_10139966 Ga0070681_101399662 254
282 3300005458 Ga0070681_10200880 Ga0070681_102008802 254
283 3300005530 Ga0070679_100054957 Ga0070679_1000549572 254
284 3300005530 Ga0070679_100085742 Ga0070679_1000857423 254
285 3300005539 Ga0068853_100018812 Ga0068853_1000188123 254
286 3300005539 Ga0068853_100257644 Ga0068853_1002576442 254
287 3300005539 Ga0068853_100546898 Ga0068853_1005468981 254
288 3300005547 Ga0070693_100022402 Ga0070693_1000224023 254
289 3300005548 Ga0070665_100000009 Ga0070665_100000009290 254
290 3300005563 Ga0068855_100206373 Ga0068855_1002063732 254
291 3300005564 Ga0070664_100136918 Ga0070664_1001369182 254
292 3300005577 Ga0068857_100002499 Ga0068857_10000249911 254
293 3300005578 Ga0068854_100005998 Ga0068854_1000059982 254
294 3300005614 Ga0068856_100007791 Ga0068856_1000077918 254
295 3300005614 Ga0068856_100627842 Ga0068856_1006278421 254
296 3300005616 Ga0068852_100005387 Ga0068852_1000053874 254
297 3300005616 Ga0068852_100005815 Ga0068852_10000581510 254
298 3300005616 Ga0068852_100221698 Ga0068852_1002216981 254
299 3300005841 Ga0068863_100450024 Ga0068863_1004500241 254
300 3300005843 Ga0068860_100000033 Ga0068860_10000003335 254
301 3300005843 Ga0068860_100001856 Ga0068860_10000185613 254
302 3300005843 Ga0068860_100016937 Ga0068860_1000169373 254
303 3300009093 Ga0105240_10001874 Ga0105240_1000187425 254
304 3300009093 Ga0105240_10009678 Ga0105240_100096783 254
305 3300009093 Ga0105240_10010818 Ga0105240_100108181 254
306 3300009093 Ga0105240_10069875 Ga0105240_100698756 254
307 3300009093 Ga0105240_11077097 Ga0105240_110770971 254
308 3300009148 Ga0105243_10000003 Ga0105243_10000003242 254
309 3300009174 Ga0105241_10000518 Ga0105241_1000051820 254
310 3300009174 Ga0105241_10014293 Ga0105241_100142934 254
311 3300009174 Ga0105241_10128713 Ga0105241_101287133 254
312 3300009545 Ga0105237_10003753 Ga0105237_1000375312 254
313 3300009545 Ga0105237_10011613 Ga0105237_100116139 254
314 3300009545 Ga0105237_10015362 Ga0105237_100153623 254
315 3300009551 Ga0105238_10001036 Ga0105238_1000103624 254
316 3300009551 Ga0105238_10098443 Ga0105238_100984432 254
317 3300009551 Ga0105238_10121775 Ga0105238_101217752 254
318 3300010375 Ga0105239_10022265 Ga0105239_100222656 254
319 3300010375 Ga0105239_10077966 Ga0105239_100779664 254
320 3300013100 Ga0157373_10017976 Ga0157373_100179763 254
321 3300013102 Ga0157371_10013067 Ga0157371_100130673 254
322 3300013104 Ga0157370_10001091 Ga0157370_100010918 254
323 3300013104 Ga0157370_10019497 Ga0157370_100194975 254
324 3300013105 Ga0157369_10083931 Ga0157369_100839314 254
325 3300013306 Ga0163162_10002043 Ga0163162_1000204317 254
326 3300013306 Ga0163162_10156314 Ga0163162_101563142 254
327 3300013307 Ga0157372_10000573 Ga0157372_1000057321 254
328 3300013307 Ga0157372_10029593 Ga0157372_100295937 254
329 3300013307 Ga0157372_10404412 Ga0157372_104044122 254
330 3300013308 Ga0157375_10777875 Ga0157375_107778752 254
331 3300025904 Ga0207647_10014633 Ga0207647_100146336 254
332 3300025909 Ga0207705_10003765 Ga0207705_100037657 254
333 3300025909 Ga0207705_10090771 Ga0207705_100907712 254
334 3300025911 Ga0207654_10010115 Ga0207654_100101153 254
335 3300025911 Ga0207654_10016563 Ga0207654_100165633 254
336 3300025912 Ga0207707_10006917 Ga0207707_100069179 254
337 3300025912 Ga0207707_10110366 Ga0207707_101103663 254
338 3300025913 Ga0207695_10001712 Ga0207695_1000171220 254
339 3300025913 Ga0207695_10003683 Ga0207695_1000368313 254
340 3300025913 Ga0207695_10091282 Ga0207695_100912822 254
341 3300025914 Ga0207671_10001027 Ga0207671_1000102713 254
342 3300025914 Ga0207671_10002571 Ga0207671_100025719 254
343 3300025914 Ga0207671_10030270 Ga0207671_100302705 254
344 3300025917 Ga0207660_10021677 Ga0207660_100216773 254
345 3300025919 Ga0207657_10019043 Ga0207657_100190434 254
346 3300025921 Ga0207652_10009908 Ga0207652_100099085 254
347 3300025921 Ga0207652_10014810 Ga0207652_100148102 254
348 3300025924 Ga0207694_10187288 Ga0207694_101872882 254
349 3300025924 Ga0207694_10219163 Ga0207694_102191632 254
350 3300025924 Ga0207694_10359113 Ga0207694_103591132 254
351 3300025932 Ga0207690_10364860 Ga0207690_103648601 254
352 3300025935 Ga0207709_10000008 Ga0207709_10000008332 254
353 3300025949 Ga0207667_10000610 Ga0207667_1000061032 254
354 3300025949 Ga0207667_10052499 Ga0207667_100524992 254
355 3300025949 Ga0207667_10214249 Ga0207667_102142493 254
356 3300025981 Ga0207640_10009102 Ga0207640_100091027 254
357 3300026041 Ga0207639_10003745 Ga0207639_100037453 254
358 3300026041 Ga0207639_10081189 Ga0207639_100811892 254
359 3300026078 Ga0207702_10005843 Ga0207702_100058438 254
360 3300026078 Ga0207702_10535252 Ga0207702_105352522 254
361 3300026078 Ga0207702_10693516 Ga0207702_106935161 254
362 3300026095 Ga0207676_10166047 Ga0207676_101660471 254
363 3300026116 Ga0207674_10027137 Ga0207674_100271372 254
364 3300026142 Ga0207698_10001211 Ga0207698_100012119 254
365 3300026142 Ga0207698_10011425 Ga0207698_100114252 254
366 3300026142 Ga0207698_10287448 Ga0207698_102874482 254
367 3300028379 Ga0268266_10000014 Ga0268266_10000014382 254
368 3300028381 Ga0268264_10000013 Ga0268264_1000001335 254
369 3300028381 Ga0268264_10004442 Ga0268264_100044425 254
370 3300028381 Ga0268264_10024660 Ga0268264_100246603 254
371 3300030521 Ga0307511_10001218 Ga0307511_1000121824 254
372 3300031730 Ga0307516_10220891 Ga0307516_102208912 254
373 3300032004 Ga0307414_10076998 Ga0307414_100769983 254
374 3300032004 Ga0307414_10205639 Ga0307414_102056392 254
375 3300036647 Ga0316582_0254760 Ga0316582_0254760_79_843 254
376 3300041511 Ga0451855_0667465 Ga0451855_0667465_1589_2353 254
377 3300042004 Ga0439445_0000001 Ga0439445_0000001_74498_75262 254
378 3300044658 Ga0466972_0000661 Ga0466972_0000661_175_975 254
379 3300044712 Ga0453684_0061696 Ga0453684_0061696_2787_3590 254
380 3300044735 Ga0466968_0024252 Ga0466968_0024252_404_1204 254
381 3300045051 Ga0451576_0035160 Ga0451576_0035160_2688_3452 254
382 3300045051 Ga0451576_0411419 Ga0451576_0411419_54_857 254
383 3300046524 Ga0495648_0016029 Ga0495648_0016029_3441_4241 254
384 3300047443 Ga0495687_000106 Ga0495687_000106_33316_34116 254
385 3300048928 Ga0496125_0065533 Ga0496125_0065533_2010_2807 254
386 3300049570 Ga0501033_0045896 Ga0501033_0045896_1459_2265 254
387 3300049570 Ga0501033_0116037 Ga0501033_0116037_67_873 254
388 3300049570 Ga0501033_0218382 Ga0501033_0218382_411_1211 254
389 3300049571 Ga0501034_0048621 Ga0501034_0048621_917_1717 254
390 3300049571 Ga0501034_0057277 Ga0501034_0057277_2496_3302 254
391 3300049579 Ga0501043_0223723 Ga0501043_0223723_140_904 254
392 3300049581 Ga0501047_0082702 Ga0501047_0082702_244_1044 254
393 3300049585 Ga0501069_0047967 Ga0501069_0047967_964_1764 254
394 3300049586 Ga0501070_0065524 Ga0501070_0065524_122_928 254
395 3300049586 Ga0501070_0066256 Ga0501070_0066256_1292_2092 254
396 3300049587 Ga0501071_0319494 Ga0501071_0319494_238_1038 254
397 3300049589 Ga0501073_0033311 Ga0501073_0033311_1557_2357 254
398 3300049664 Ga0501224_008900 Ga0501224_008900_595_1359 254
399 3300049741 Ga0501079_0074461 Ga0501079_0074461_1688_2488 254
400 3300049742 Ga0501080_0046050 Ga0501080_0046050_1922_2722 254
401 3300049822 Ga0501035_0008311 Ga0501035_0008311_279_1043 254
402 3300049822 Ga0501035_0058067 Ga0501035_0058067_919_1725 254
403 3300049823 Ga0501044_0100915 Ga0501044_0100915_1182_1988 254
404 3300049823 Ga0501044_0121383 Ga0501044_0121383_1564_2364 254
405 3300053088 Ga0500644_0078404 Ga0500644_0078404_337_1137 254
406 3300053092 Ga0500583_0012962 Ga0500583_0012962_352_1152 254
407 3300053139 Ga0500568_0013071 Ga0500568_0013071_2515_3315 254
408 3300053156 Ga0500622_0005426 Ga0500622_0005426_1311_2111 254
409 3300054114 Ga0501084_0138796 Ga0501084_0138796_487_1287 254
410 iso_pu_bacteria 2958512119 2958515963 254
411 2162886007 SwRhRL2b_contig_2423129 SwRhRL2b_0707.00004450 255
412 3300003320 rootH2_10045041 rootH2_100450417 255
413 3300003323 rootH1_10319305 rootH1_103193051 255
414 3300003578 Ga0006562J51391_1004923 Ga0006562J51391_10049232 255
415 3300005289 Ga0065704_10090076 Ga0065704_100900762 255
416 3300005289 Ga0065704_10106177 Ga0065704_101061772 255
417 3300005293 Ga0065715_10040176 Ga0065715_100401762 255
418 3300005293 Ga0065715_10117030 Ga0065715_101170303 255
419 3300005293 Ga0065715_10393194 Ga0065715_103931941 255
420 3300005337 Ga0070682_100282543 Ga0070682_1002825431 255
421 3300005616 Ga0068852_100198363 Ga0068852_1001983631 255
422 3300006942 Ga0099824_1006531 Ga0099824_10065315 255
423 3300006946 Ga0079104_1000091 Ga0079104_10000913 255
424 3300009011 Ga0105251_10053494 Ga0105251_100534943 255
425 3300009011 Ga0105251_10220065 Ga0105251_102200651 255
426 3300009036 Ga0105244_10000027 Ga0105244_100000273 255
427 3300009545 Ga0105237_10006711 Ga0105237_100067115 255
428 3300013100 Ga0157373_10000007 Ga0157373_1000000739 255
429 3300013102 Ga0157371_10010866 Ga0157371_100108665 255
430 3300013104 Ga0157370_10000192 Ga0157370_1000019227 255
431 3300013104 Ga0157370_10000303 Ga0157370_1000030337 255
432 3300013104 Ga0157370_10001177 Ga0157370_100011771 255
433 3300013104 Ga0157370_10084098 Ga0157370_100840983 255
434 3300013105 Ga0157369_10004306 Ga0157369_100043063 255
435 3300013308 Ga0157375_10096265 Ga0157375_100962653 255
436 3300014326 Ga0157380_10073518 Ga0157380_100735183 255
437 3300014497 Ga0182008_10000632 Ga0182008_1000063218 255
438 3300015261 Ga0182006_1001331 Ga0182006_10013318 255
439 3300015261 Ga0182006_1005526 Ga0182006_10055266 255
440 3300015261 Ga0182006_1042453 Ga0182006_10424533 255
441 3300015261 Ga0182006_1115540 Ga0182006_11155402 255
442 3300015261 Ga0182006_1122512 Ga0182006_11225122 255
443 3300017792 Ga0163161_10000055 Ga0163161_1000005555 255
444 3300017792 Ga0163161_10000406 Ga0163161_100004068 255
445 3300025728 Ga0207655_1000038 Ga0207655_10000384 255
446 3300025735 Ga0207713_1029354 Ga0207713_10293542 255
447 3300025914 Ga0207671_10009249 Ga0207671_100092495 255
448 3300027111 Ga0209281_1000311 Ga0209281_100031124 255
449 3300027361 Ga0209489_112096 Ga0209489_1120964 255
450 3300028800 Ga0265338_10000658 Ga0265338_1000065819 255
451 3300031548 Ga0307408_100000824 Ga0307408_10000082423 255
452 3300031731 Ga0307405_10000001 Ga0307405_10000001990 255
453 3300031824 Ga0307413_10000039 Ga0307413_100000399 255
454 3300031852 Ga0307410_10000363 Ga0307410_1000036318 255
455 3300031901 Ga0307406_10000950 Ga0307406_100009507 255
456 3300031901 Ga0307406_10065077 Ga0307406_100650773 255
457 3300031903 Ga0307407_10033702 Ga0307407_100337024 255
458 3300031911 Ga0307412_10035298 Ga0307412_100352982 255
459 3300032002 Ga0307416_100000179 Ga0307416_10000017910 255
460 3300032004 Ga0307414_10000011 Ga0307414_10000011159 255
461 3300032004 Ga0307414_10018546 Ga0307414_100185463 255
462 3300032004 Ga0307414_10079616 Ga0307414_100796163 255
463 3300032005 Ga0307411_10000004 Ga0307411_10000004195 255
464 3300032005 Ga0307411_10219368 Ga0307411_102193681 255
465 3300041407 Ga0439447_000262 Ga0439447_000262_8178_8945 255
466 3300041411 Ga0439466_0014367 Ga0439466_0014367_2103_2870 255
467 3300044673 Ga0453683_0194507 Ga0453683_0194507_419_1189 255
468 3300046512 Ga0495610_0110737 Ga0495610_0110737_389_1156 255
469 3300048919 Ga0496116_0000024 Ga0496116_0000024_285786_286553 255
470 3300048920 Ga0496117_0042858 Ga0496117_0042858_915_1682 255
471 3300048924 Ga0496121_0215393 Ga0496121_0215393_543_1310 255
472 3300048925 Ga0496122_0003258 Ga0496122_0003258_7680_8483 255
473 3300048926 Ga0496123_0010972 Ga0496123_0010972_4715_5518 255
474 3300048927 Ga0496124_0170598 Ga0496124_0170598_733_1500 255
475 3300048927 Ga0496124_0443072 Ga0496124_0443072_10_777 255
476 3300048928 Ga0496125_0000018 Ga0496125_0000018_193841_194608 255
477 3300048928 Ga0496125_0050649 Ga0496125_0050649_1425_2228 255
478 3300048929 Ga0496126_0007711 Ga0496126_0007711_1996_2763 255
479 3300049679 Ga0501249_000012 Ga0501249_000012_21482_22249 255
480 3300049679 Ga0501249_001078 Ga0501249_001078_4505_5272 255
481 3300049758 Ga0501241_007683 Ga0501241_007683_738_1505 255
482 3300049758 Ga0501241_029215 Ga0501241_029215_250_1017 255
483 3300049763 Ga0501266_000002 Ga0501266_000002_155751_156518 255
484 3300049766 Ga0501269_004616 Ga0501269_004616_99_866 255
485 3300049776 Ga0501280_004064 Ga0501280_004064_944_1711 255
486 3300053090 Ga0500646_0016363 Ga0500646_0016363_976_1743 255
487 3300053096 Ga0500641_0000010 Ga0500641_0000010_131157_131924 255
488 3300053096 Ga0500641_0001720 Ga0500641_0001720_4552_5319 255
489 3300053118 Ga0500594_0005313 Ga0500594_0005313_345_1112 255
490 3300053134 Ga0500658_0000002 Ga0500658_0000002_388149_388916 255
491 3300053139 Ga0500568_0005710 Ga0500568_0005710_2400_3203 255
492 3300053726 Ga0500584_048657 Ga0500584_048657_817_1584 255
493 3300005329 Ga0070683_100241764 Ga0070683_1002417642 256
494 3300005458 Ga0070681_10135065 Ga0070681_101350653 256
495 3300005577 Ga0068857_100148748 Ga0068857_1001487483 256
496 3300013100 Ga0157373_10105138 Ga0157373_101051382 256
497 3300013102 Ga0157371_10093096 Ga0157371_100930962 256
498 3300013104 Ga0157370_10163161 Ga0157370_101631612 256
499 3300013306 Ga0163162_10013276 Ga0163162_100132762 256
500 3300025912 Ga0207707_10195532 Ga0207707_101955322 256
501 3300025917 Ga0207660_10240081 Ga0207660_102400812 256
502 3300025921 Ga0207652_10008689 Ga0207652_1000868910 256
503 3300039062 Ga0400483_183977 Ga0400483_183977_373_1143 256
504 iso_pu_bacteria 2839989709 2839991201 256
505 iso_pu_bacteria 2919692658 2919694159 256
506 3300003320 rootH2_10129787 rootH2_101297875 257
507 3300003322 rootL2_10007168 rootL2_100071682 257
508 3300003323 rootH1_10120031 rootH1_101200313 257
509 3300005288 Ga0065714_10010985 Ga0065714_100109853 257
510 3300005288 Ga0065714_10078231 Ga0065714_100782313 257
511 3300005539 Ga0068853_100081542 Ga0068853_1000815422 257
512 3300005563 Ga0068855_100002137 Ga0068855_10000213714 257
513 3300005563 Ga0068855_100320880 Ga0068855_1003208802 257
514 3300006237 Ga0097621_100014583 Ga0097621_1000145838 257
515 3300009174 Ga0105241_10018754 Ga0105241_100187543 257
516 3300009545 Ga0105237_10016324 Ga0105237_100163245 257
517 3300013296 Ga0157374_10050624 Ga0157374_100506242 257
518 3300014497 Ga0182008_10016574 Ga0182008_100165743 257
519 3300015262 Ga0182007_10046892 Ga0182007_100468922 257
520 3300017792 Ga0163161_10248203 Ga0163161_102482032 257
521 3300025911 Ga0207654_10135668 Ga0207654_101356682 257
522 3300026116 Ga0207674_10021221 Ga0207674_100212215 257
523 3300028794 Ga0307515_10000061 Ga0307515_1000006145 257
524 3300028794 Ga0307515_10364670 Ga0307515_103646702 257
525 3300031456 Ga0307513_10139618 Ga0307513_101396182 257
526 3300031507 Ga0307509_10193809 Ga0307509_101938092 257
527 3300031728 Ga0316578_10107827 Ga0316578_101078272 257
528 3300031733 Ga0316577_10013852 Ga0316577_100138524 257
529 3300032004 Ga0307414_10038767 Ga0307414_100387671 257
530 3300032004 Ga0307414_10128456 Ga0307414_101284562 257
531 3300036647 Ga0316582_0009025 Ga0316582_0009025_2279_3052 257
532 3300036712 Ga0316584_0008100 Ga0316584_0008100_1581_2354 257
533 3300045051 Ga0451576_0253156 Ga0451576_0253156_71_844 257
534 3300049129 Ga0501309_000358 Ga0501309_000358_300_1073 257
535 3300049539 Ga0501323_011008 Ga0501323_011008_37_810 257
536 3300049539 Ga0501323_013125 Ga0501323_013125_205_978 257
537 3300049573 Ga0501037_0154742 Ga0501037_0154742_622_1422 257
538 3300049585 Ga0501069_0028314 Ga0501069_0028314_585_1358 257
539 3300049661 Ga0501217_002907 Ga0501217_002907_2208_2981 257
540 3300049686 Ga0501257_001003 Ga0501257_001003_2781_3554 257
541 3300049761 Ga0501264_001446 Ga0501264_001446_1358_2131 257
542 3300053139 Ga0500568_0019967 Ga0500568_0019967_1051_1824 257
543 3300053156 Ga0500622_0022534 Ga0500622_0022534_800_1573 257
544 iso_pu_bacteria 2585428095 2587867678 257
545 2162886007 SwRhRL2b_contig_3243847 SwRhRL2b_0798.00003010 258
546 2162886007 SwRhRL2b_contig_829818 SwRhRL2b_0309.00003350 258
547 3300005288 Ga0065714_10002572 Ga0065714_1000257217 258
548 3300005288 Ga0065714_10003280 Ga0065714_100032801 258
549 3300005289 Ga0065704_10070251 Ga0065704_1007025139 258
550 3300005289 Ga0065704_10073887 Ga0065704_100738876 258
551 3300013100 Ga0157373_10000601 Ga0157373_1000060121 258
552 3300013100 Ga0157373_10328379 Ga0157373_103283792 258
553 3300013102 Ga0157371_10000486 Ga0157371_1000048637 258
554 3300013102 Ga0157371_10002408 Ga0157371_100024081 258
555 3300013104 Ga0157370_10009399 Ga0157370_100093999 258
556 3300013104 Ga0157370_10028998 Ga0157370_100289984 258
557 3300013306 Ga0163162_10078628 Ga0163162_100786285 258
558 3300014497 Ga0182008_10000014 Ga0182008_10000014169 258
559 3300015261 Ga0182006_1022598 Ga0182006_10225981 258
560 3300017792 Ga0163161_10001060 Ga0163161_1000106011 258
561 3300017792 Ga0163161_10002554 Ga0163161_1000255414 258
562 3300031911 Ga0307412_10000043 Ga0307412_1000004345 258
563 3300032004 Ga0307414_10000713 Ga0307414_100007135 258
564 3300032004 Ga0307414_10387745 Ga0307414_103877451 258
565 3300032005 Ga0307411_10038743 Ga0307411_100387432 258
566 3300039062 Ga0400483_219275 Ga0400483_219275_19011_19787 258
567 3300044673 Ga0453683_0129232 Ga0453683_0129232_658_1434 258
568 3300044712 Ga0453684_0031266 Ga0453684_0031266_5815_6621 258
569 3300046453 Ga0495627_004116 Ga0495627_004116_2449_3225 258
570 3300046501 Ga0495607_0087145 Ga0495607_0087145_881_1657 258
571 3300046522 Ga0495643_0002717 Ga0495643_0002717_6022_6798 258
572 3300046660 Ga0495625_0014342 Ga0495625_0014342_3248_4024 258
573 3300053090 Ga0500646_0002249 Ga0500646_0002249_1945_2721 258
574 3300053093 Ga0500651_0001777 Ga0500651_0001777_3385_4188 258
575 3300053096 Ga0500641_0000275 Ga0500641_0000275_10781_11557 258
576 3300002774 JGI25150J39212_1000001 JGI25150J39212_1000001139 259
577 3300003187 JGI25151J46595_10000001 JGI25151J46595_10000001656 259
578 3300003215 JGI25153J46596_10000001 JGI25153J46596_10000001545 259
579 3300003781 Ga0055536_1000004 Ga0055536_1000004364 259
580 3300003791 Ga0055530_10000869 Ga0055530_100008695 259
581 3300005288 Ga0065714_10026377 Ga0065714_100263771 259
582 3300005331 Ga0070670_100201775 Ga0070670_1002017752 259
583 3300005367 Ga0070667_100187976 Ga0070667_1001879762 259
584 3300005841 Ga0068863_100734902 Ga0068863_1007349021 259
585 3300006237 Ga0097621_100001575 Ga0097621_10000157513 259
586 3300006358 Ga0068871_100006801 Ga0068871_1000068015 259
587 3300009177 Ga0105248_10054666 Ga0105248_100546664 259
588 3300009553 Ga0105249_10067555 Ga0105249_100675554 259
589 3300013100 Ga0157373_10063945 Ga0157373_100639452 259
590 3300013102 Ga0157371_10000074 Ga0157371_1000007492 259
591 3300013104 Ga0157370_10001475 Ga0157370_1000147514 259
592 3300013104 Ga0157370_10351911 Ga0157370_103519111 259
593 3300013105 Ga0157369_10000031 Ga0157369_10000031156 259
594 3300013297 Ga0157378_10009151 Ga0157378_100091514 259
595 3300013306 Ga0163162_10011055 Ga0163162_100110557 259
596 3300013306 Ga0163162_10011263 Ga0163162_100112633 259
597 3300013306 Ga0163162_10094486 Ga0163162_100944864 259
598 3300013308 Ga0157375_10000166 Ga0157375_1000016651 259
599 3300013308 Ga0157375_10026953 Ga0157375_100269534 259
600 3300014325 Ga0163163_10005245 Ga0163163_100052457 259
601 3300014968 Ga0157379_10010385 Ga0157379_100103853 259
602 3300015261 Ga0182006_1000697 Ga0182006_10006972 259
603 3300015262 Ga0182007_10000002 Ga0182007_10000002188 259
604 3300015682 Ga0183373_1004 Ga0183373_1004288 259
605 3300017792 Ga0163161_10000310 Ga0163161_1000031020 259
606 3300017792 Ga0163161_10001090 Ga0163161_1000109012 259
607 3300017792 Ga0163161_10012738 Ga0163161_100127387 259
608 3300017792 Ga0163161_10021681 Ga0163161_100216812 259
609 3300017792 Ga0163161_10022721 Ga0163161_100227216 259
610 3300017792 Ga0163161_10084142 Ga0163161_100841423 259
611 3300025245 Ga0207425_1000002 Ga0207425_10000021022 259
612 3300025258 Ga0209129_1000002 Ga0209129_10000021022 259
613 3300025292 Ga0209676_1000009 Ga0209676_1000009192 259
614 3300025294 Ga0209025_1000004 Ga0209025_1000004169 259
615 3300025297 Ga0209758_1000006 Ga0209758_1000006169 259
616 3300025298 Ga0209050_1000094 Ga0209050_1000094192 259
617 3300025903 Ga0207680_10478007 Ga0207680_104780071 259
618 3300025925 Ga0207650_10065515 Ga0207650_100655152 259
619 3300025931 Ga0207644_10047981 Ga0207644_100479813 259
620 3300025961 Ga0207712_10054675 Ga0207712_100546752 259
621 3300025986 Ga0207658_10156222 Ga0207658_101562223 259
622 3300026095 Ga0207676_10012031 Ga0207676_100120314 259
623 3300028794 Ga0307515_10228549 Ga0307515_102285492 259
624 3300030731 Ga0316177_1046651 Ga0316177_10466513 259
625 3300030732 Ga0316176_1106664 Ga0316176_11066645 259
626 3300030742 Ga0316183_1171692 Ga0316183_117169212 259
627 3300030744 Ga0316181_1177553 Ga0316181_11775534 259
628 3300030745 Ga0316182_1148280 Ga0316182_11482801 259
629 3300031731 Ga0307405_10000006 Ga0307405_10000006317 259
630 3300031903 Ga0307407_10000031 Ga0307407_1000003150 259
631 3300031911 Ga0307412_10323767 Ga0307412_103237672 259
632 3300031995 Ga0307409_100057513 Ga0307409_1000575133 259
633 3300032002 Ga0307416_100000002 Ga0307416_100000002171 259
634 3300032004 Ga0307414_10003845 Ga0307414_100038456 259
635 3300032004 Ga0307414_10010702 Ga0307414_100107025 259
636 3300032005 Ga0307411_10070585 Ga0307411_100705852 259
637 3300042876 Ga0451577_0276851 Ga0451577_0276851_574_1353 259
638 3300044712 Ga0453684_0012880 Ga0453684_0012880_12101_12880 259
639 3300044712 Ga0453684_0014054 Ga0453684_0014054_5445_6224 259
640 3300044712 Ga0453684_0063629 Ga0453684_0063629_1701_2480 259
641 3300044712 Ga0453684_0066188 Ga0453684_0066188_2341_3120 259
642 3300044712 Ga0453684_0074832 Ga0453684_0074832_3199_3978 259
643 3300045051 Ga0451576_0234149 Ga0451576_0234149_778_1557 259
644 3300046453 Ga0495627_024362 Ga0495627_024362_558_1361 259
645 3300046512 Ga0495610_0000724 Ga0495610_0000724_1686_2489 259
646 3300046512 Ga0495610_0000784 Ga0495610_0000784_17323_18126 259
647 3300046558 Ga0495633_0020413 Ga0495633_0020413_1077_1880 259
648 3300048903 Ga0496100_0087754 Ga0496100_0087754_248_1066 259
649 3300048904 Ga0496101_0056828 Ga0496101_0056828_1777_2595 259
650 3300048918 Ga0496115_0341431 Ga0496115_0341431_202_1005 259
651 3300049758 Ga0501241_010614 Ga0501241_010614_58_861 259
652 iso_pu_bacteria 2884634485 2884636827 259
653 3300005339 Ga0070660_100004005 Ga0070660_1000040058 260
654 3300005366 Ga0070659_100005958 Ga0070659_1000059583 260
655 3300009176 Ga0105242_10002451 Ga0105242_1000245111 260
656 3300013306 Ga0163162_10001734 Ga0163162_1000173414 260
657 3300013308 Ga0157375_10000144 Ga0157375_1000014432 260
658 3300014497 Ga0182008_10000876 Ga0182008_100008762 260
659 3300014968 Ga0157379_10315563 Ga0157379_103155631 260
660 3300014969 Ga0157376_10001017 Ga0157376_100010171 260
661 3300015261 Ga0182006_1000159 Ga0182006_100015951 260
662 3300025932 Ga0207690_10003894 Ga0207690_100038943 260
663 3300025938 Ga0207704_10013711 Ga0207704_100137114 260
664 3300031616 Ga0307508_10209485 Ga0307508_102094852 260
665 3300035089 Ga0373944_0124646 Ga0373944_0124646_27_812 260
666 3300035172 Ga0373955_0258306 Ga0373955_0258306_12_797 260
667 3300036401 Ga0373937_0048314 Ga0373937_0048314_1739_2524 260
668 3300037068 Ga0373925_0115794 Ga0373925_0115794_1004_1789 260
669 3300041511 Ga0451855_1514386 Ga0451855_1514386_2289_3071 260
670 3300044673 Ga0453683_0000209 Ga0453683_0000209_72198_72980 260
671 3300044673 Ga0453683_0025049 Ga0453683_0025049_53_835 260
672 3300044712 Ga0453684_0006066 Ga0453684_0006066_15356_16138 260
673 3300044712 Ga0453684_0016267 Ga0453684_0016267_8314_9096 260
674 3300044712 Ga0453684_0018038 Ga0453684_0018038_7994_8812 260
675 3300044712 Ga0453684_0044676 Ga0453684_0044676_2676_3458 260
676 3300044712 Ga0453684_0094645 Ga0453684_0094645_1235_2050 260
677 3300045051 Ga0451576_0000539 Ga0451576_0000539_17357_18139 260
678 3300045051 Ga0451576_0002019 Ga0451576_0002019_13701_14483 260
679 3300045051 Ga0451576_0003414 Ga0451576_0003414_6512_7294 260
680 3300046473 Ga0495582_0007561 Ga0495582_0007561_2964_3749 260
681 3300046531 Ga0495665_0084426 Ga0495665_0084426_584_1369 260
682 3300046663 Ga0495635_0356889 Ga0495635_0356889_11_796 260
683 3300047315 Ga0495581_0067456 Ga0495581_0067456_238_1023 260
684 3300048907 Ga0496104_0000005 Ga0496104_0000005_524185_524970 260
685 3300048908 Ga0496105_0000018 Ga0496105_0000018_91455_92240 260
686 3300049585 Ga0501069_0064019 Ga0501069_0064019_338_1162 260
687 3300053094 Ga0500566_0204195 Ga0500566_0204195_51_836 260
688 iso_pu_bacteria 2738541273 2738700581 260
689 iso_pu_bacteria 2738543014 2739254330 260
690 iso_pu_bacteria 2842903701 2842907998 260
691 3300014326 Ga0157380_10506599 Ga0157380_105065992 261
692 3300046543 Ga0495645_0084246 Ga0495645_0084246_1080_1880 261
693 iso_pu_bacteria 2585427687 2586210867 261
694 iso_pu_bacteria 2599185184 2599479453 261
695 iso_pu_bacteria 2738541283 2738756715 261
696 iso_pu_bacteria 2738541302 2738855406 261
697 iso_pu_bacteria 2738543023 2739305244 261
698 iso_pu_bacteria 2739367651 2739588166 261
699 iso_pu_bacteria 2739367656 2739614061 261
700 iso_pu_bacteria 2739367663 2739647036 261
701 iso_pu_bacteria 2818991437 2819546116 261
702 iso_pu_bacteria 2842722452 2842724027 261
703 iso_pu_bacteria 2842909656 2842912240 261
704 iso_pu_bacteria 2849281842 2849282669 261
705 iso_pu_bacteria 2852623160 2852625813 261
706 iso_pu_bacteria 2852627209 2852630938 261
707 iso_pu_bacteria 2857627736 2857629412 261
708 iso_pu_bacteria 2884933994 2884935661 261
709 iso_pu_bacteria 2890737413 2890740207 261
710 iso_pu_bacteria 2902048731 2902052209 261
711 iso_pu_bacteria 2904445276 2904446403 261
712 iso_pu_bacteria 2919186247 2919189265 261
713 iso_pu_bacteria 2919437846 2919440243 261
714 iso_pu_bacteria 2928078545 2928082241 261
715 iso_pu_bacteria 2928147474 2928149182 261
716 iso_pu_bacteria 2932082852 2932084958 261
717 iso_pu_bacteria 2939664404 2939666580 261
718 iso_pu_bacteria 2945997725 2945999213 261
719 iso_pu_bacteria 2954016120 2954021608 261
720 iso_pu_bacteria 2977232053 2977234174 261
721 iso_pu_bacteria 8055588893 8055589977 261
722 3300005546 Ga0070696_100131205 Ga0070696_1001312052 262
723 3300013102 Ga0157371_10133763 Ga0157371_101337632 262
724 3300013104 Ga0157370_10013199 Ga0157370_100131995 262
725 3300013307 Ga0157372_10047171 Ga0157372_100471715 262
726 3300025949 Ga0207667_10258199 Ga0207667_102581992 262
727 3300037418 Ga0395900_0013551 Ga0395900_0013551_7324_8115 262
728 3300045051 Ga0451576_0043706 Ga0451576_0043706_2008_2796 262
729 iso_pu_bacteria 2738541278 2738731759 262
730 iso_pu_bacteria 2818991444 2819588694 262
731 iso_pu_bacteria 2884791551 2884798177 262
732 iso_pu_bacteria 2914759650 2914759776 262
733 iso_pu_bacteria 2929154850 2929157621 262
734 3300005330 Ga0070690_100062384 Ga0070690_1000623841 263
735 3300005331 Ga0070670_100179130 Ga0070670_1001791301 263
736 3300005340 Ga0070689_100470020 Ga0070689_1004700202 263
737 3300005367 Ga0070667_100115450 Ga0070667_1001154502 263
738 3300005459 Ga0068867_100010240 Ga0068867_1000102403 263
739 3300005543 Ga0070672_100046118 Ga0070672_1000461184 263
740 3300005544 Ga0070686_100221822 Ga0070686_1002218221 263
741 3300005547 Ga0070693_100057609 Ga0070693_1000576091 263
742 3300005563 Ga0068855_100588981 Ga0068855_1005889812 263
743 3300005616 Ga0068852_100336275 Ga0068852_1003362752 263
744 3300005841 Ga0068863_100026064 Ga0068863_1000260645 263
745 3300005841 Ga0068863_100083299 Ga0068863_1000832993 263
746 3300006881 Ga0068865_100080466 Ga0068865_1000804662 263
747 3300009148 Ga0105243_10419084 Ga0105243_104190841 263
748 3300009176 Ga0105242_10104292 Ga0105242_101042923 263
749 3300009177 Ga0105248_10044305 Ga0105248_100443052 263
750 3300013105 Ga0157369_10478617 Ga0157369_104786172 263
751 3300013296 Ga0157374_10063132 Ga0157374_100631324 263
752 3300013307 Ga0157372_10149478 Ga0157372_101494782 263
753 3300013308 Ga0157375_10011976 Ga0157375_100119765 263
754 3300014969 Ga0157376_10003603 Ga0157376_100036032 263
755 3300025931 Ga0207644_10459907 Ga0207644_104599071 263
756 3300025934 Ga0207686_10270278 Ga0207686_102702782 263
757 3300025938 Ga0207704_10106009 Ga0207704_101060092 263
758 3300025940 Ga0207691_10022708 Ga0207691_100227085 263
759 3300025941 Ga0207711_10127665 Ga0207711_101276652 263
760 3300025942 Ga0207689_10073408 Ga0207689_100734084 263
761 3300025986 Ga0207658_10100570 Ga0207658_101005703 263
762 3300026035 Ga0207703_10050789 Ga0207703_100507894 263
763 3300026078 Ga0207702_10209080 Ga0207702_102090802 263
764 3300026088 Ga0207641_10158912 Ga0207641_101589123 263
765 3300026089 Ga0207648_10002984 Ga0207648_100029846 263
766 3300046681 Ga0495647_0089909 Ga0495647_0089909_83_877 263
767 iso_pu_bacteria 2739367866 2740031102 263
768 3300005563 Ga0068855_100005875 Ga0068855_10000587515 264
769 3300042876 Ga0451577_0033500 Ga0451577_0033500_2917_3711 264
770 3300044673 Ga0453683_0000031 Ga0453683_0000031_189100_189894 264
771 3300044673 Ga0453683_0002457 Ga0453683_0002457_6611_7405 264
772 3300044673 Ga0453683_0172023 Ga0453683_0172023_393_1187 264
773 3300044712 Ga0453684_0040412 Ga0453684_0040412_2962_3756 264
774 3300044712 Ga0453684_0199148 Ga0453684_0199148_522_1316 264
775 3300045051 Ga0451576_0085197 Ga0451576_0085197_1138_1932 264
776 3300045051 Ga0451576_0169071 Ga0451576_0169071_902_1696 264
777 3300001979 JGI24740J21852_10050141 JGI24740J21852_100501412 265
778 3300001990 JGI24737J22298_10000321 JGI24737J22298_100003218 265
779 3300002067 JGI24735J21928_10000003 JGI24735J21928_10000003280 265
780 3300002737 JGI25162J39368_1000203 JGI25162J39368_100020310 265
781 3300002772 JGI25164J39214_1001360 JGI25164J39214_10013602 265
782 3300003214 JGI25165J46597_1000728 JGI25165J46597_100072814 265
783 3300005288 Ga0065714_10085630 Ga0065714_100856302 265
784 3300005327 Ga0070658_10041372 Ga0070658_100413723 265
785 3300005331 Ga0070670_100520698 Ga0070670_1005206982 265
786 3300005539 Ga0068853_100101004 Ga0068853_1001010042 265
787 3300005563 Ga0068855_100000279 Ga0068855_10000027938 265
788 3300005577 Ga0068857_100408625 Ga0068857_1004086252 265
789 3300005614 Ga0068856_100000006 Ga0068856_10000000660 265
790 3300005614 Ga0068856_100012161 Ga0068856_1000121618 265
791 3300005616 Ga0068852_100389802 Ga0068852_1003898022 265
792 3300009093 Ga0105240_10028209 Ga0105240_100282097 265
793 3300009093 Ga0105240_10137276 Ga0105240_101372762 265
794 3300009545 Ga0105237_10028321 Ga0105237_100283217 265
795 3300010375 Ga0105239_10001867 Ga0105239_1000186719 265
796 3300010375 Ga0105239_10002632 Ga0105239_100026326 265
797 3300013102 Ga0157371_10012774 Ga0157371_100127746 265
798 3300013104 Ga0157370_10008143 Ga0157370_100081437 265
799 3300013104 Ga0157370_10077271 Ga0157370_100772713 265
800 3300013104 Ga0157370_10098497 Ga0157370_100984973 265
801 3300013105 Ga0157369_10030017 Ga0157369_100300175 265
802 3300013306 Ga0163162_10493759 Ga0163162_104937591 265
803 3300013306 Ga0163162_11140970 Ga0163162_111409701 265
804 3300013307 Ga0157372_10001325 Ga0157372_1000132513 265
805 3300014497 Ga0182008_10004682 Ga0182008_100046828 265
806 3300017792 Ga0163161_10007129 Ga0163161_100071296 265
807 3300020077 Ga0206351_10132316 Ga0206351_101323162 265
808 3300025230 Ga0209563_105477 Ga0209563_1054772 265
809 3300025231 Ga0207427_100210 Ga0207427_10021038 265
810 3300025233 Ga0209437_100021 Ga0209437_100021623 265
811 3300025233 Ga0209437_100102 Ga0209437_10010253 265
812 3300025254 Ga0209148_1010575 Ga0209148_10105752 265
813 3300025258 Ga0209129_1014317 Ga0209129_10143172 265
814 3300025261 Ga0209233_1000035 Ga0209233_100003514 265
815 3300025272 Ga0209455_1001657 Ga0209455_10016575 265
816 3300025904 Ga0207647_10017201 Ga0207647_100172013 265
817 3300025909 Ga0207705_10056149 Ga0207705_100561493 265
818 3300025913 Ga0207695_10102612 Ga0207695_101026123 265
819 3300025913 Ga0207695_10146167 Ga0207695_101461673 265
820 3300025914 Ga0207671_10004487 Ga0207671_100044873 265
821 3300025914 Ga0207671_10029553 Ga0207671_100295531 265
822 3300025949 Ga0207667_10000346 Ga0207667_1000034626 265
823 3300025949 Ga0207667_10013817 Ga0207667_100138176 265
824 3300026078 Ga0207702_10000023 Ga0207702_1000002344 265
825 3300026078 Ga0207702_10131836 Ga0207702_101318362 265
826 3300026116 Ga0207674_10059552 Ga0207674_100595523 265
827 3300026121 Ga0207683_10386350 Ga0207683_103863501 265
828 3300028794 Ga0307515_10000676 Ga0307515_1000067612 265
829 3300031251 Ga0265327_10022676 Ga0265327_100226764 265
830 3300031507 Ga0307509_10060843 Ga0307509_100608433 265
831 3300033179 Ga0307507_10000099 Ga0307507_1000009923 265
832 3300044712 Ga0453684_0002641 Ga0453684_0002641_21365_22165 265
833 3300044712 Ga0453684_0010591 Ga0453684_0010591_12745_13548 265
834 3300046459 Ga0495629_0058077 Ga0495629_0058077_1564_2367 265
835 3300046460 Ga0495638_0083484 Ga0495638_0083484_836_1639 265
836 3300046462 Ga0495651_0168704 Ga0495651_0168704_52_855 265
837 3300046462 Ga0495651_0173285 Ga0495651_0173285_245_1048 265
838 3300046471 Ga0495650_0000107 Ga0495650_0000107_199018_199821 265
839 3300046492 Ga0495585_0000116 Ga0495585_0000116_25426_26229 265
840 3300046492 Ga0495585_0000170 Ga0495585_0000170_30896_31699 265
841 3300046506 Ga0495583_0129701 Ga0495583_0129701_42_845 265
842 3300046506 Ga0495583_0150615 Ga0495583_0150615_80_883 265
843 3300046507 Ga0495606_0002103 Ga0495606_0002103_11774_12577 265
844 3300046507 Ga0495606_0011835 Ga0495606_0011835_5546_6349 265
845 3300046507 Ga0495606_0012971 Ga0495606_0012971_3852_4655 265
846 3300046507 Ga0495606_0037648 Ga0495606_0037648_964_1767 265
847 3300046512 Ga0495610_0033625 Ga0495610_0033625_812_1615 265
848 3300046513 Ga0495616_0000882 Ga0495616_0000882_9266_10069 265
849 3300046513 Ga0495616_0006658 Ga0495616_0006658_2844_3647 265
850 3300046514 Ga0495618_0263834 Ga0495618_0263834_60_863 265
851 3300046516 Ga0495628_0330916 Ga0495628_0330916_214_1017 265
852 3300046520 Ga0495637_0091612 Ga0495637_0091612_174_977 265
853 3300046524 Ga0495648_0023598 Ga0495648_0023598_878_1681 265
854 3300046524 Ga0495648_0045048 Ga0495648_0045048_751_1554 265
855 3300046529 Ga0495652_0122798 Ga0495652_0122798_681_1484 265
856 3300046529 Ga0495652_0170986 Ga0495652_0170986_855_1658 265
857 3300046530 Ga0495654_0044400 Ga0495654_0044400_373_1176 265
858 3300046538 Ga0495609_0001895 Ga0495609_0001895_9516_10319 265
859 3300046538 Ga0495609_0074096 Ga0495609_0074096_502_1305 265
860 3300046558 Ga0495633_0000006 Ga0495633_0000006_158511_159314 265
861 3300046616 Ga0495668_0000011 Ga0495668_0000011_20560_21363 265
862 3300046660 Ga0495625_0000021 Ga0495625_0000021_28599_29402 265
863 3300046660 Ga0495625_0000344 Ga0495625_0000344_31140_31943 265
864 3300046660 Ga0495625_0014051 Ga0495625_0014051_15_818 265
865 3300046660 Ga0495625_0069980 Ga0495625_0069980_15_818 265
866 3300046665 Ga0495661_0011479 Ga0495661_0011479_301_1104 265
867 3300046683 Ga0495658_0108891 Ga0495658_0108891_629_1432 265
868 3300046692 Ga0495671_0028196 Ga0495671_0028196_1110_1913 265
869 3300046694 Ga0495649_0000009 Ga0495649_0000009_430125_430928 265
870 3300046810 Ga0495660_0001836 Ga0495660_0001836_2630_3433 265
871 3300046810 Ga0495660_0066210 Ga0495660_0066210_951_1754 265
872 3300047443 Ga0495687_000356 Ga0495687_000356_37844_38647 265
873 3300047469 Ga0495673_0009304 Ga0495673_0009304_315_1118 265
874 3300047472 Ga0495686_0000107 Ga0495686_0000107_27671_28474 265
875 3300047472 Ga0495686_0058484 Ga0495686_0058484_1394_2197 265
876 3300048089 Ga0495614_0019698 Ga0495614_0019698_1441_2244 265
877 3300048918 Ga0496115_0067946 Ga0496115_0067946_1611_2414 265
878 3300049459 Ga0495678_015057 Ga0495678_015057_2296_3099 265
879 3300049761 Ga0501264_006301 Ga0501264_006301_34_849 265
880 3300053125 Ga0500618_000016 Ga0500618_000016_68025_68828 265
881 3300053156 Ga0500622_0089259 Ga0500622_0089259_134_937 265
882 3300053157 Ga0500624_000265 Ga0500624_000265_7247_8050 265
883 3300002077 JGI24744J21845_10010382 JGI24744J21845_100103823 266
884 3300002459 JGI24751J29686_10000452 JGI24751J29686_100004523 266
885 3300003316 rootH1_10063301 rootH1_100633013 266
886 3300003322 rootL2_10021621 rootL2_100216211 266
887 3300003323 rootH1_10015224 rootH1_1001522410 266
888 3300003354 JGI25160J50197_1010918 JGI25160J50197_10109182 266
889 3300005288 Ga0065714_10100557 Ga0065714_101005572 266
890 3300005289 Ga0065704_10110352 Ga0065704_101103521 266
891 3300005290 Ga0065712_10086352 Ga0065712_100863522 266
892 3300005290 Ga0065712_10088663 Ga0065712_100886631 266
893 3300005293 Ga0065715_10291366 Ga0065715_102913661 266
894 3300005295 Ga0065707_10094480 Ga0065707_100944802 266
895 3300005295 Ga0065707_10098181 Ga0065707_100981813 266
896 3300005327 Ga0070658_10000655 Ga0070658_100006556 266
897 3300005327 Ga0070658_10013517 Ga0070658_100135173 266
898 3300005327 Ga0070658_10018406 Ga0070658_100184064 266
899 3300005327 Ga0070658_10199625 Ga0070658_101996251 266
900 3300005327 Ga0070658_10416509 Ga0070658_104165092 266
901 3300005327 Ga0070658_10444731 Ga0070658_104447312 266
902 3300005328 Ga0070676_10000091 Ga0070676_1000009117 266
903 3300005328 Ga0070676_10189409 Ga0070676_101894092 266
904 3300005329 Ga0070683_100002417 Ga0070683_1000024175 266
905 3300005329 Ga0070683_100016399 Ga0070683_1000163994 266
906 3300005329 Ga0070683_100410959 Ga0070683_1004109591 266
907 3300005330 Ga0070690_100342684 Ga0070690_1003426842 266
908 3300005330 Ga0070690_100397634 Ga0070690_1003976341 266
909 3300005331 Ga0070670_100019261 Ga0070670_1000192615 266
910 3300005331 Ga0070670_100070231 Ga0070670_1000702312 266
911 3300005331 Ga0070670_100113045 Ga0070670_1001130452 266
912 3300005331 Ga0070670_100125336 Ga0070670_1001253363 266
913 3300005331 Ga0070670_100135234 Ga0070670_1001352342 266
914 3300005331 Ga0070670_100306184 Ga0070670_1003061841 266
915 3300005334 Ga0068869_100005770 Ga0068869_1000057708 266
916 3300005334 Ga0068869_100021631 Ga0068869_1000216315 266
917 3300005334 Ga0068869_100059054 Ga0068869_1000590543 266
918 3300005334 Ga0068869_100066745 Ga0068869_1000667452 266
919 3300005334 Ga0068869_100071113 Ga0068869_1000711131 266
920 3300005334 Ga0068869_100136280 Ga0068869_1001362802 266
921 3300005334 Ga0068869_100169837 Ga0068869_1001698371 266
922 3300005334 Ga0068869_100179568 Ga0068869_1001795682 266
923 3300005334 Ga0068869_100580421 Ga0068869_1005804211 266
924 3300005335 Ga0070666_10000125 Ga0070666_1000012539 266
925 3300005335 Ga0070666_10001433 Ga0070666_100014338 266
926 3300005335 Ga0070666_10006591 Ga0070666_100065914 266
927 3300005335 Ga0070666_10030595 Ga0070666_100305954 266
928 3300005335 Ga0070666_10067739 Ga0070666_100677392 266
929 3300005336 Ga0070680_100007073 Ga0070680_1000070735 266
930 3300005336 Ga0070680_100339831 Ga0070680_1003398311 266
931 3300005337 Ga0070682_100000125 Ga0070682_10000012529 266
932 3300005337 Ga0070682_100038423 Ga0070682_1000384233 266
933 3300005337 Ga0070682_100146145 Ga0070682_1001461452 266
934 3300005337 Ga0070682_100209980 Ga0070682_1002099802 266
935 3300005337 Ga0070682_100264800 Ga0070682_1002648002 266
936 3300005337 Ga0070682_100401938 Ga0070682_1004019382 266
937 3300005337 Ga0070682_100404658 Ga0070682_1004046581 266
938 3300005338 Ga0068868_100000075 Ga0068868_10000007532 266
939 3300005338 Ga0068868_100022531 Ga0068868_1000225317 266
940 3300005338 Ga0068868_100039548 Ga0068868_1000395484 266
941 3300005338 Ga0068868_100331792 Ga0068868_1003317922 266
942 3300005339 Ga0070660_100000211 Ga0070660_10000021116 266
943 3300005339 Ga0070660_100019733 Ga0070660_1000197332 266
944 3300005339 Ga0070660_100288113 Ga0070660_1002881131 266
945 3300005340 Ga0070689_100007698 Ga0070689_1000076982 266
946 3300005340 Ga0070689_100077163 Ga0070689_1000771633 266
947 3300005340 Ga0070689_100367353 Ga0070689_1003673532 266
948 3300005343 Ga0070687_100019144 Ga0070687_1000191442 266
949 3300005344 Ga0070661_100066797 Ga0070661_1000667975 266
950 3300005344 Ga0070661_100525792 Ga0070661_1005257921 266
951 3300005344 Ga0070661_100697801 Ga0070661_1006978011 266
952 3300005347 Ga0070668_100037019 Ga0070668_1000370192 266
953 3300005347 Ga0070668_100306491 Ga0070668_1003064912 266
954 3300005353 Ga0070669_100088082 Ga0070669_1000880823 266
955 3300005353 Ga0070669_100504609 Ga0070669_1005046091 266
956 3300005354 Ga0070675_100016984 Ga0070675_1000169843 266
957 3300005354 Ga0070675_100023239 Ga0070675_1000232395 266
958 3300005354 Ga0070675_100033207 Ga0070675_1000332074 266
959 3300005354 Ga0070675_100038097 Ga0070675_1000380974 266
960 3300005354 Ga0070675_100190938 Ga0070675_1001909382 266
961 3300005355 Ga0070671_100332471 Ga0070671_1003324711 266
962 3300005355 Ga0070671_100361708 Ga0070671_1003617082 266
963 3300005355 Ga0070671_100391861 Ga0070671_1003918612 266
964 3300005356 Ga0070674_100013529 Ga0070674_1000135296 266
965 3300005364 Ga0070673_100000966 Ga0070673_10000096615 266
966 3300005364 Ga0070673_100044349 Ga0070673_1000443494 266
967 3300005364 Ga0070673_100047692 Ga0070673_1000476922 266
968 3300005364 Ga0070673_100065150 Ga0070673_1000651502 266
969 3300005364 Ga0070673_100073365 Ga0070673_1000733652 266
970 3300005364 Ga0070673_100310657 Ga0070673_1003106571 266
971 3300005365 Ga0070688_100026679 Ga0070688_1000266793 266
972 3300005365 Ga0070688_100074892 Ga0070688_1000748922 266
973 3300005365 Ga0070688_100081383 Ga0070688_1000813831 266
974 3300005365 Ga0070688_100262221 Ga0070688_1002622211 266
975 3300005366 Ga0070659_100007003 Ga0070659_1000070038 266
976 3300005366 Ga0070659_100009206 Ga0070659_1000092067 266
977 3300005366 Ga0070659_100038876 Ga0070659_1000388763 266
978 3300005367 Ga0070667_100000086 Ga0070667_10000008693 266
979 3300005367 Ga0070667_100013104 Ga0070667_1000131043 266
980 3300005367 Ga0070667_100065615 Ga0070667_1000656153 266
981 3300005367 Ga0070667_100209267 Ga0070667_1002092672 266
982 3300005455 Ga0070663_100502974 Ga0070663_1005029741 266
983 3300005457 Ga0070662_100003756 Ga0070662_1000037563 266
984 3300005457 Ga0070662_100007873 Ga0070662_1000078736 266
985 3300005457 Ga0070662_100025036 Ga0070662_1000250363 266
986 3300005457 Ga0070662_100059341 Ga0070662_1000593412 266
987 3300005458 Ga0070681_10101645 Ga0070681_101016452 266
988 3300005459 Ga0068867_100003784 Ga0068867_1000037849 266
989 3300005459 Ga0068867_100005625 Ga0068867_1000056254 266
990 3300005459 Ga0068867_100012521 Ga0068867_1000125215 266
991 3300005459 Ga0068867_100104518 Ga0068867_1001045182 266
992 3300005459 Ga0068867_100285868 Ga0068867_1002858682 266
993 3300005459 Ga0068867_100292040 Ga0068867_1002920402 266
994 3300005466 Ga0070685_10005156 Ga0070685_100051567 266
995 3300005466 Ga0070685_10017646 Ga0070685_100176463 266
996 3300005466 Ga0070685_10394858 Ga0070685_103948581 266
997 3300005471 Ga0070698_100000911 Ga0070698_10000091134 266
998 3300005471 Ga0070698_100140156 Ga0070698_1001401563 266
999 3300005530 Ga0070679_100003584 Ga0070679_1000035844 266
1000 3300005530 Ga0070679_100028081 Ga0070679_1000280817 266
1001 3300005530 Ga0070679_100028359 Ga0070679_1000283596 266
1002 3300005530 Ga0070679_100441954 Ga0070679_1004419542 266
1003 3300005535 Ga0070684_100012884 Ga0070684_1000128847 266
1004 3300005535 Ga0070684_100053969 Ga0070684_1000539691 266
1005 3300005535 Ga0070684_100085939 Ga0070684_1000859391 266
1006 3300005539 Ga0068853_100004573 Ga0068853_1000045734 266
1007 3300005539 Ga0068853_100035707 Ga0068853_1000357074 266
1008 3300005539 Ga0068853_100050476 Ga0068853_1000504764 266
1009 3300005539 Ga0068853_100146456 Ga0068853_1001464562 266
1010 3300005539 Ga0068853_100161284 Ga0068853_1001612842 266
1011 3300005539 Ga0068853_100241333 Ga0068853_1002413332 266
1012 3300005539 Ga0068853_100271523 Ga0068853_1002715233 266
1013 3300005543 Ga0070672_100030440 Ga0070672_1000304403 266
1014 3300005543 Ga0070672_100151535 Ga0070672_1001515353 266
1015 3300005543 Ga0070672_100306262 Ga0070672_1003062621 266
1016 3300005544 Ga0070686_100040335 Ga0070686_1000403352 266
1017 3300005546 Ga0070696_100158534 Ga0070696_1001585342 266
1018 3300005548 Ga0070665_100007286 Ga0070665_1000072869 266
1019 3300005548 Ga0070665_100007390 Ga0070665_1000073903 266
1020 3300005548 Ga0070665_100181811 Ga0070665_1001818112 266
1021 3300005548 Ga0070665_100725664 Ga0070665_1007256641 266
1022 3300005563 Ga0068855_100002597 Ga0068855_10000259710 266
1023 3300005563 Ga0068855_100032803 Ga0068855_1000328033 266
1024 3300005563 Ga0068855_100034861 Ga0068855_1000348617 266
1025 3300005563 Ga0068855_100046506 Ga0068855_1000465067 266
1026 3300005563 Ga0068855_100472966 Ga0068855_1004729662 266
1027 3300005563 Ga0068855_100476339 Ga0068855_1004763391 266
1028 3300005564 Ga0070664_100026719 Ga0070664_1000267193 266
1029 3300005564 Ga0070664_100048105 Ga0070664_1000481054 266
1030 3300005564 Ga0070664_100110232 Ga0070664_1001102321 266
1031 3300005564 Ga0070664_100130951 Ga0070664_1001309512 266
1032 3300005564 Ga0070664_100362998 Ga0070664_1003629981 266
1033 3300005577 Ga0068857_100139694 Ga0068857_1001396943 266
1034 3300005577 Ga0068857_100192907 Ga0068857_1001929072 266
1035 3300005577 Ga0068857_100208774 Ga0068857_1002087742 266
1036 3300005578 Ga0068854_100061236 Ga0068854_1000612363 266
1037 3300005614 Ga0068856_100006116 Ga0068856_1000061164 266
1038 3300005614 Ga0068856_100009483 Ga0068856_1000094837 266
1039 3300005614 Ga0068856_100040389 Ga0068856_1000403894 266
1040 3300005616 Ga0068852_100003711 Ga0068852_1000037116 266
1041 3300005616 Ga0068852_100014561 Ga0068852_1000145616 266
1042 3300005616 Ga0068852_100016001 Ga0068852_1000160018 266
1043 3300005616 Ga0068852_100022206 Ga0068852_1000222065 266
1044 3300005616 Ga0068852_100084320 Ga0068852_1000843202 266
1045 3300005616 Ga0068852_100133672 Ga0068852_1001336723 266
1046 3300005616 Ga0068852_100469089 Ga0068852_1004690891 266
1047 3300005617 Ga0068859_100000242 Ga0068859_10000024245 266
1048 3300005617 Ga0068859_100006439 Ga0068859_1000064392 266
1049 3300005617 Ga0068859_100030908 Ga0068859_1000309085 266
1050 3300005617 Ga0068859_100040043 Ga0068859_1000400434 266
1051 3300005617 Ga0068859_100062210 Ga0068859_1000622103 266
1052 3300005617 Ga0068859_100215791 Ga0068859_1002157913 266
1053 3300005617 Ga0068859_100265713 Ga0068859_1002657132 266
1054 3300005617 Ga0068859_100318747 Ga0068859_1003187472 266
1055 3300005617 Ga0068859_100356490 Ga0068859_1003564902 266
1056 3300005617 Ga0068859_100472068 Ga0068859_1004720682 266
1057 3300005617 Ga0068859_100856564 Ga0068859_1008565641 266
1058 3300005618 Ga0068864_100001541 Ga0068864_1000015415 266
1059 3300005618 Ga0068864_100007898 Ga0068864_10000789811 266
1060 3300005618 Ga0068864_100077541 Ga0068864_1000775412 266
1061 3300005618 Ga0068864_100982698 Ga0068864_1009826981 266
1062 3300005718 Ga0068866_10085725 Ga0068866_100857252 266
1063 3300005719 Ga0068861_100001641 Ga0068861_1000016415 266
1064 3300005719 Ga0068861_100059982 Ga0068861_1000599823 266
1065 3300005719 Ga0068861_100486783 Ga0068861_1004867831 266
1066 3300005834 Ga0068851_10000388 Ga0068851_1000038811 266
1067 3300005834 Ga0068851_10053753 Ga0068851_100537531 266
1068 3300005834 Ga0068851_10149361 Ga0068851_101493612 266
1069 3300005840 Ga0068870_10010288 Ga0068870_100102883 266
1070 3300005840 Ga0068870_10044685 Ga0068870_100446852 266
1071 3300005841 Ga0068863_100016728 Ga0068863_1000167283 266
1072 3300005841 Ga0068863_100023474 Ga0068863_1000234745 266
1073 3300005841 Ga0068863_100045062 Ga0068863_1000450625 266
1074 3300005841 Ga0068863_100094027 Ga0068863_1000940273 266
1075 3300005841 Ga0068863_100184467 Ga0068863_1001844673 266
1076 3300005841 Ga0068863_100330747 Ga0068863_1003307472 266
1077 3300005841 Ga0068863_100418171 Ga0068863_1004181712 266
1078 3300005842 Ga0068858_100000258 Ga0068858_1000002582 266
1079 3300005842 Ga0068858_100004144 Ga0068858_1000041449 266
1080 3300005842 Ga0068858_100101557 Ga0068858_1001015572 266
1081 3300005842 Ga0068858_100116755 Ga0068858_1001167552 266
1082 3300005843 Ga0068860_100005747 Ga0068860_1000057475 266
1083 3300005843 Ga0068860_100011911 Ga0068860_10001191110 266
1084 3300005843 Ga0068860_100033498 Ga0068860_1000334985 266
1085 3300005843 Ga0068860_100062300 Ga0068860_1000623002 266
1086 3300005843 Ga0068860_100079404 Ga0068860_1000794042 266
1087 3300005843 Ga0068860_100155267 Ga0068860_1001552673 266
1088 3300005843 Ga0068860_100307810 Ga0068860_1003078102 266
1089 3300005843 Ga0068860_100341185 Ga0068860_1003411852 266
1090 3300005843 Ga0068860_100352641 Ga0068860_1003526412 266
1091 3300005843 Ga0068860_100405002 Ga0068860_1004050022 266
1092 3300005843 Ga0068860_100422195 Ga0068860_1004221952 266
1093 3300005844 Ga0068862_100005917 Ga0068862_1000059179 266
1094 3300005844 Ga0068862_100012762 Ga0068862_1000127627 266
1095 3300005844 Ga0068862_100510626 Ga0068862_1005106261 266
1096 3300005844 Ga0068862_100681511 Ga0068862_1006815111 266
1097 3300006195 Ga0075366_10003090 Ga0075366_100030906 266
1098 3300006195 Ga0075366_10018956 Ga0075366_100189565 266
1099 3300006237 Ga0097621_100008800 Ga0097621_1000088003 266
1100 3300006237 Ga0097621_100097334 Ga0097621_1000973341 266
1101 3300006237 Ga0097621_100101343 Ga0097621_1001013433 266
1102 3300006237 Ga0097621_100130648 Ga0097621_1001306482 266
1103 3300006237 Ga0097621_100211647 Ga0097621_1002116472 266
1104 3300006358 Ga0068871_100018853 Ga0068871_1000188532 266
1105 3300006358 Ga0068871_100044596 Ga0068871_1000445964 266
1106 3300006358 Ga0068871_100055128 Ga0068871_1000551284 266
1107 3300006358 Ga0068871_100057070 Ga0068871_1000570704 266
1108 3300006358 Ga0068871_100212975 Ga0068871_1002129752 266
1109 3300006844 Ga0075428_100044297 Ga0075428_1000442974 266
1110 3300006844 Ga0075428_100117986 Ga0075428_1001179862 266
1111 3300006844 Ga0075428_100123455 Ga0075428_1001234552 266
1112 3300006844 Ga0075428_100154611 Ga0075428_1001546112 266
1113 3300006844 Ga0075428_100334092 Ga0075428_1003340922 266
1114 3300006846 Ga0075430_100020978 Ga0075430_1000209784 266
1115 3300006847 Ga0075431_100001482 Ga0075431_1000014825 266
1116 3300006847 Ga0075431_100012317 Ga0075431_1000123174 266
1117 3300006880 Ga0075429_100016041 Ga0075429_1000160417 266
1118 3300006880 Ga0075429_100083539 Ga0075429_1000835392 266
1119 3300006881 Ga0068865_100000413 Ga0068865_10000041318 266
1120 3300006881 Ga0068865_100045574 Ga0068865_1000455743 266
1121 3300006881 Ga0068865_100466683 Ga0068865_1004666832 266
1122 3300006931 Ga0097620_100000242 Ga0097620_10000024214 266
1123 3300006931 Ga0097620_100006439 Ga0097620_10000643913 266
1124 3300006931 Ga0097620_100030908 Ga0097620_1000309085 266
1125 3300006931 Ga0097620_100040043 Ga0097620_1000400434 266
1126 3300006931 Ga0097620_100062209 Ga0097620_1000622093 266
1127 3300006931 Ga0097620_100215779 Ga0097620_1002157793 266
1128 3300006931 Ga0097620_100265705 Ga0097620_1002657052 266
1129 3300006931 Ga0097620_100318750 Ga0097620_1003187502 266
1130 3300006931 Ga0097620_100356488 Ga0097620_1003564882 266
1131 3300006931 Ga0097620_100472048 Ga0097620_1004720482 266
1132 3300006931 Ga0097620_100856659 Ga0097620_1008566591 266
1133 3300009011 Ga0105251_10175280 Ga0105251_101752801 266
1134 3300009093 Ga0105240_10041223 Ga0105240_100412236 266
1135 3300009093 Ga0105240_10137729 Ga0105240_101377293 266
1136 3300009094 Ga0111539_10018239 Ga0111539_100182394 266
1137 3300009094 Ga0111539_10107685 Ga0111539_101076852 266
1138 3300009094 Ga0111539_10108018 Ga0111539_101080182 266
1139 3300009094 Ga0111539_10199617 Ga0111539_101996172 266
1140 3300009094 Ga0111539_10266933 Ga0111539_102669333 266
1141 3300009094 Ga0111539_10577945 Ga0111539_105779451 266
1142 3300009101 Ga0105247_10017274 Ga0105247_100172745 266
1143 3300009101 Ga0105247_10035946 Ga0105247_100359464 266
1144 3300009101 Ga0105247_10124030 Ga0105247_101240301 266
1145 3300009147 Ga0114129_10004721 Ga0114129_100047216 266
1146 3300009147 Ga0114129_10460819 Ga0114129_104608191 266
1147 3300009147 Ga0114129_11019806 Ga0114129_110198062 266
1148 3300009148 Ga0105243_10225353 Ga0105243_102253532 266
1149 3300009174 Ga0105241_10000421 Ga0105241_100004216 266
1150 3300009174 Ga0105241_10068555 Ga0105241_100685553 266
1151 3300009174 Ga0105241_10157605 Ga0105241_101576052 266
1152 3300009176 Ga0105242_10021083 Ga0105242_100210835 266
1153 3300009176 Ga0105242_10024089 Ga0105242_100240896 266
1154 3300009176 Ga0105242_10578268 Ga0105242_105782682 266
1155 3300009177 Ga0105248_10049709 Ga0105248_100497092 266
1156 3300009545 Ga0105237_10005184 Ga0105237_1000518411 266
1157 3300009545 Ga0105237_10043015 Ga0105237_100430155 266
1158 3300009545 Ga0105237_10062937 Ga0105237_100629372 266
1159 3300009545 Ga0105237_10117576 Ga0105237_101175763 266
1160 3300009545 Ga0105237_10130669 Ga0105237_101306692 266
1161 3300009553 Ga0105249_10000954 Ga0105249_1000095422 266
1162 3300009553 Ga0105249_10006490 Ga0105249_1000649013 266
1163 3300009553 Ga0105249_10007639 Ga0105249_100076392 266
1164 3300009553 Ga0105249_10066961 Ga0105249_100669612 266
1165 3300009553 Ga0105249_10079600 Ga0105249_100796003 266
1166 3300009553 Ga0105249_10095798 Ga0105249_100957982 266
1167 3300009553 Ga0105249_10357440 Ga0105249_103574402 266
1168 3300010375 Ga0105239_10007177 Ga0105239_1000717711 266
1169 3300010375 Ga0105239_10013222 Ga0105239_100132222 266
1170 3300010375 Ga0105239_10042080 Ga0105239_100420802 266
1171 3300011119 Ga0105246_10066337 Ga0105246_100663374 266
1172 3300011119 Ga0105246_10637197 Ga0105246_106371971 266
1173 3300011119 Ga0105246_10692731 Ga0105246_106927311 266
1174 3300013100 Ga0157373_10001219 Ga0157373_1000121912 266
1175 3300013100 Ga0157373_10008405 Ga0157373_100084053 266
1176 3300013100 Ga0157373_10022958 Ga0157373_100229585 266
1177 3300013102 Ga0157371_10000232 Ga0157371_1000023220 266
1178 3300013102 Ga0157371_10001020 Ga0157371_1000102024 266
1179 3300013102 Ga0157371_10001267 Ga0157371_1000126730 266
1180 3300013102 Ga0157371_10003507 Ga0157371_100035072 266
1181 3300013102 Ga0157371_10003749 Ga0157371_1000374913 266
1182 3300013102 Ga0157371_10013304 Ga0157371_100133047 266
1183 3300013102 Ga0157371_10015935 Ga0157371_100159354 266
1184 3300013102 Ga0157371_10094277 Ga0157371_100942771 266
1185 3300013102 Ga0157371_10148667 Ga0157371_101486672 266
1186 3300013102 Ga0157371_10194952 Ga0157371_101949522 266
1187 3300013104 Ga0157370_10000290 Ga0157370_1000029034 266
1188 3300013104 Ga0157370_10062936 Ga0157370_100629365 266
1189 3300013104 Ga0157370_10071559 Ga0157370_100715591 266
1190 3300013104 Ga0157370_10169814 Ga0157370_101698142 266
1191 3300013104 Ga0157370_10230989 Ga0157370_102309892 266
1192 3300013104 Ga0157370_10346127 Ga0157370_103461271 266
1193 3300013104 Ga0157370_10361179 Ga0157370_103611791 266
1194 3300013104 Ga0157370_10387886 Ga0157370_103878861 266
1195 3300013104 Ga0157370_10660773 Ga0157370_106607731 266
1196 3300013105 Ga0157369_10006715 Ga0157369_1000671512 266
1197 3300013105 Ga0157369_10018831 Ga0157369_100188317 266
1198 3300013105 Ga0157369_10024012 Ga0157369_100240123 266
1199 3300013105 Ga0157369_10028173 Ga0157369_100281737 266
1200 3300013105 Ga0157369_10147459 Ga0157369_101474592 266
1201 3300013105 Ga0157369_10221855 Ga0157369_102218551 266
1202 3300013105 Ga0157369_10774481 Ga0157369_107744812 266
1203 3300013105 Ga0157369_10858837 Ga0157369_108588371 266
1204 3300013296 Ga0157374_10017014 Ga0157374_100170148 266
1205 3300013296 Ga0157374_10037407 Ga0157374_100374075 266
1206 3300013296 Ga0157374_10040398 Ga0157374_100403983 266
1207 3300013296 Ga0157374_10131963 Ga0157374_101319633 266
1208 3300013296 Ga0157374_10188572 Ga0157374_101885723 266
1209 3300013296 Ga0157374_10236984 Ga0157374_102369842 266
1210 3300013296 Ga0157374_10477348 Ga0157374_104773482 266
1211 3300013297 Ga0157378_10045824 Ga0157378_100458243 266
1212 3300013297 Ga0157378_10118346 Ga0157378_101183463 266
1213 3300013297 Ga0157378_10167778 Ga0157378_101677781 266
1214 3300013297 Ga0157378_10255303 Ga0157378_102553032 266
1215 3300013297 Ga0157378_10270856 Ga0157378_102708562 266
1216 3300013297 Ga0157378_10376075 Ga0157378_103760752 266
1217 3300013297 Ga0157378_10640381 Ga0157378_106403812 266
1218 3300013306 Ga0163162_10000377 Ga0163162_1000037729 266
1219 3300013306 Ga0163162_10000554 Ga0163162_1000055421 266
1220 3300013306 Ga0163162_10004752 Ga0163162_1000475210 266
1221 3300013306 Ga0163162_10007639 Ga0163162_1000763910 266
1222 3300013306 Ga0163162_10066034 Ga0163162_100660343 266
1223 3300013306 Ga0163162_10089334 Ga0163162_100893343 266
1224 3300013306 Ga0163162_10192894 Ga0163162_101928941 266
1225 3300013306 Ga0163162_10216962 Ga0163162_102169623 266
1226 3300013306 Ga0163162_10708950 Ga0163162_107089501 266
1227 3300013307 Ga0157372_10005099 Ga0157372_1000509912 266
1228 3300013307 Ga0157372_10032861 Ga0157372_100328612 266
1229 3300013307 Ga0157372_10059943 Ga0157372_100599434 266
1230 3300013307 Ga0157372_10062662 Ga0157372_100626624 266
1231 3300013307 Ga0157372_10067907 Ga0157372_100679073 266
1232 3300013307 Ga0157372_10127116 Ga0157372_101271163 266
1233 3300013307 Ga0157372_10128555 Ga0157372_101285552 266
1234 3300013307 Ga0157372_10158402 Ga0157372_101584022 266
1235 3300013307 Ga0157372_10174527 Ga0157372_101745273 266
1236 3300013307 Ga0157372_10195519 Ga0157372_101955194 266
1237 3300013307 Ga0157372_10212172 Ga0157372_102121722 266
1238 3300013307 Ga0157372_10563276 Ga0157372_105632762 266
1239 3300013307 Ga0157372_10639640 Ga0157372_106396401 266
1240 3300013307 Ga0157372_10802402 Ga0157372_108024021 266
1241 3300013307 Ga0157372_10863657 Ga0157372_108636571 266
1242 3300013308 Ga0157375_10000989 Ga0157375_1000098918 266
1243 3300013308 Ga0157375_10028881 Ga0157375_100288814 266
1244 3300013308 Ga0157375_10033870 Ga0157375_100338703 266
1245 3300013308 Ga0157375_10046746 Ga0157375_100467466 266
1246 3300013308 Ga0157375_10064088 Ga0157375_100640884 266
1247 3300013308 Ga0157375_10382077 Ga0157375_103820772 266
1248 3300014325 Ga0163163_10000457 Ga0163163_1000045710 266
1249 3300014325 Ga0163163_10007428 Ga0163163_100074289 266
1250 3300014325 Ga0163163_10018496 Ga0163163_100184961 266
1251 3300014325 Ga0163163_10096264 Ga0163163_100962642 266
1252 3300014325 Ga0163163_10206951 Ga0163163_102069512 266
1253 3300014325 Ga0163163_10293044 Ga0163163_102930441 266
1254 3300014325 Ga0163163_10429453 Ga0163163_104294531 266
1255 3300014325 Ga0163163_10504567 Ga0163163_105045671 266
1256 3300014326 Ga0157380_10000959 Ga0157380_100009599 266
1257 3300014745 Ga0157377_10001572 Ga0157377_100015728 266
1258 3300014745 Ga0157377_10006401 Ga0157377_100064013 266
1259 3300014745 Ga0157377_10026593 Ga0157377_100265933 266
1260 3300014745 Ga0157377_10043294 Ga0157377_100432943 266
1261 3300014968 Ga0157379_10000440 Ga0157379_1000044028 266
1262 3300014968 Ga0157379_10016947 Ga0157379_100169474 266
1263 3300014968 Ga0157379_10020609 Ga0157379_100206094 266
1264 3300014968 Ga0157379_10037019 Ga0157379_100370194 266
1265 3300014968 Ga0157379_10071559 Ga0157379_100715593 266
1266 3300014968 Ga0157379_10129072 Ga0157379_101290722 266
1267 3300014968 Ga0157379_10183456 Ga0157379_101834562 266
1268 3300014969 Ga0157376_10000783 Ga0157376_1000078318 266
1269 3300014969 Ga0157376_10005594 Ga0157376_100055944 266
1270 3300014969 Ga0157376_10019555 Ga0157376_100195552 266
1271 3300014969 Ga0157376_10529869 Ga0157376_105298692 266
1272 3300014969 Ga0157376_10541307 Ga0157376_105413071 266
1273 3300017792 Ga0163161_10032577 Ga0163161_100325774 266
1274 3300017792 Ga0163161_10033164 Ga0163161_100331644 266
1275 3300020080 Ga0206350_10385760 Ga0206350_103857601 266
1276 3300021384 Ga0213876_10007839 Ga0213876_100078394 266
1277 3300021384 Ga0213876_10036822 Ga0213876_100368221 266
1278 3300025246 Ga0209646_1002231 Ga0209646_10022313 266
1279 3300025271 Ga0207666_1007757 Ga0207666_10077572 266
1280 3300025302 Ga0207426_1000009 Ga0207426_1000009271 266
1281 3300025315 Ga0207697_10017058 Ga0207697_100170583 266
1282 3300025315 Ga0207697_10025099 Ga0207697_100250994 266
1283 3300025321 Ga0207656_10001383 Ga0207656_100013836 266
1284 3300025321 Ga0207656_10091912 Ga0207656_100919122 266
1285 3300025321 Ga0207656_10240688 Ga0207656_102406881 266
1286 3300025893 Ga0207682_10053198 Ga0207682_100531982 266
1287 3300025893 Ga0207682_10081045 Ga0207682_100810452 266
1288 3300025893 Ga0207682_10127847 Ga0207682_101278471 266
1289 3300025900 Ga0207710_10000635 Ga0207710_100006356 266
1290 3300025900 Ga0207710_10020924 Ga0207710_100209242 266
1291 3300025901 Ga0207688_10005632 Ga0207688_100056324 266
1292 3300025903 Ga0207680_10000018 Ga0207680_100000181 266
1293 3300025903 Ga0207680_10147108 Ga0207680_101471081 266
1294 3300025904 Ga0207647_10000288 Ga0207647_1000028820 266
1295 3300025904 Ga0207647_10175842 Ga0207647_101758422 266
1296 3300025907 Ga0207645_10000355 Ga0207645_1000035521 266
1297 3300025907 Ga0207645_10139848 Ga0207645_101398482 266
1298 3300025908 Ga0207643_10001223 Ga0207643_1000122310 266
1299 3300025908 Ga0207643_10025323 Ga0207643_100253232 266
1300 3300025909 Ga0207705_10005465 Ga0207705_100054654 266
1301 3300025909 Ga0207705_10017645 Ga0207705_100176456 266
1302 3300025911 Ga0207654_10001745 Ga0207654_100017458 266
1303 3300025911 Ga0207654_10068075 Ga0207654_100680752 266
1304 3300025912 Ga0207707_10076027 Ga0207707_100760272 266
1305 3300025913 Ga0207695_10007767 Ga0207695_100077677 266
1306 3300025913 Ga0207695_10316606 Ga0207695_103166062 266
1307 3300025914 Ga0207671_10002688 Ga0207671_1000268812 266
1308 3300025914 Ga0207671_10050334 Ga0207671_100503343 266
1309 3300025914 Ga0207671_10059756 Ga0207671_100597562 266
1310 3300025914 Ga0207671_10151150 Ga0207671_101511502 266
1311 3300025914 Ga0207671_10438171 Ga0207671_104381712 266
1312 3300025917 Ga0207660_10011293 Ga0207660_100112936 266
1313 3300025917 Ga0207660_10282647 Ga0207660_102826473 266
1314 3300025917 Ga0207660_10521411 Ga0207660_105214111 266
1315 3300025918 Ga0207662_10004421 Ga0207662_100044214 266
1316 3300025918 Ga0207662_10073050 Ga0207662_100730502 266
1317 3300025919 Ga0207657_10002233 Ga0207657_1000223314 266
1318 3300025919 Ga0207657_10005099 Ga0207657_100050996 266
1319 3300025919 Ga0207657_10054929 Ga0207657_100549294 266
1320 3300025920 Ga0207649_10123079 Ga0207649_101230792 266
1321 3300025920 Ga0207649_10160254 Ga0207649_101602542 266
1322 3300025920 Ga0207649_10359198 Ga0207649_103591981 266
1323 3300025921 Ga0207652_10000011 Ga0207652_10000011177 266
1324 3300025921 Ga0207652_10000944 Ga0207652_1000094422 266
1325 3300025921 Ga0207652_10018660 Ga0207652_100186607 266
1326 3300025921 Ga0207652_10112230 Ga0207652_101122303 266
1327 3300025923 Ga0207681_10150658 Ga0207681_101506582 266
1328 3300025923 Ga0207681_10200845 Ga0207681_102008452 266
1329 3300025923 Ga0207681_10299959 Ga0207681_102999592 266
1330 3300025925 Ga0207650_10023493 Ga0207650_100234933 266
1331 3300025925 Ga0207650_10040596 Ga0207650_100405963 266
1332 3300025925 Ga0207650_10054149 Ga0207650_100541493 266
1333 3300025925 Ga0207650_10232201 Ga0207650_102322011 266
1334 3300025925 Ga0207650_10241645 Ga0207650_102416451 266
1335 3300025925 Ga0207650_10302128 Ga0207650_103021282 266
1336 3300025926 Ga0207659_10012489 Ga0207659_100124894 266
1337 3300025926 Ga0207659_10026358 Ga0207659_100263583 266
1338 3300025926 Ga0207659_10109974 Ga0207659_101099743 266
1339 3300025926 Ga0207659_10349521 Ga0207659_103495211 266
1340 3300025931 Ga0207644_10233879 Ga0207644_102338792 266
1341 3300025931 Ga0207644_10456352 Ga0207644_104563522 266
1342 3300025932 Ga0207690_10023981 Ga0207690_100239814 266
1343 3300025933 Ga0207706_10019177 Ga0207706_100191775 266
1344 3300025933 Ga0207706_10035734 Ga0207706_100357342 266
1345 3300025933 Ga0207706_10443544 Ga0207706_104435442 266
1346 3300025934 Ga0207686_10003017 Ga0207686_100030177 266
1347 3300025934 Ga0207686_10310355 Ga0207686_103103551 266
1348 3300025936 Ga0207670_10118298 Ga0207670_101182982 266
1349 3300025936 Ga0207670_10188460 Ga0207670_101884602 266
1350 3300025937 Ga0207669_10090499 Ga0207669_100904992 266
1351 3300025937 Ga0207669_10218719 Ga0207669_102187192 266
1352 3300025938 Ga0207704_10014771 Ga0207704_100147714 266
1353 3300025938 Ga0207704_10050317 Ga0207704_100503173 266
1354 3300025938 Ga0207704_10124421 Ga0207704_101244212 266
1355 3300025940 Ga0207691_10000037 Ga0207691_1000003764 266
1356 3300025940 Ga0207691_10049785 Ga0207691_100497855 266
1357 3300025940 Ga0207691_10085689 Ga0207691_100856893 266
1358 3300025940 Ga0207691_10158272 Ga0207691_101582721 266
1359 3300025940 Ga0207691_10407618 Ga0207691_104076182 266
1360 3300025942 Ga0207689_10019502 Ga0207689_100195024 266
1361 3300025942 Ga0207689_10074490 Ga0207689_100744902 266
1362 3300025942 Ga0207689_10076209 Ga0207689_100762092 266
1363 3300025942 Ga0207689_10079142 Ga0207689_100791423 266
1364 3300025942 Ga0207689_10099429 Ga0207689_100994292 266
1365 3300025942 Ga0207689_10196597 Ga0207689_101965972 266
1366 3300025942 Ga0207689_10345032 Ga0207689_103450322 266
1367 3300025944 Ga0207661_10060182 Ga0207661_100601823 266
1368 3300025944 Ga0207661_10369938 Ga0207661_103699382 266
1369 3300025945 Ga0207679_10027794 Ga0207679_100277944 266
1370 3300025945 Ga0207679_10059555 Ga0207679_100595552 266
1371 3300025945 Ga0207679_10072076 Ga0207679_100720762 266
1372 3300025945 Ga0207679_10300394 Ga0207679_103003941 266
1373 3300025949 Ga0207667_10011720 Ga0207667_1001172010 266
1374 3300025949 Ga0207667_10060056 Ga0207667_100600564 266
1375 3300025949 Ga0207667_10306862 Ga0207667_103068622 266
1376 3300025960 Ga0207651_10001954 Ga0207651_100019545 266
1377 3300025960 Ga0207651_10027337 Ga0207651_100273375 266
1378 3300025960 Ga0207651_10169516 Ga0207651_101695162 266
1379 3300025960 Ga0207651_10273679 Ga0207651_102736792 266
1380 3300025961 Ga0207712_10031385 Ga0207712_100313851 266
1381 3300025961 Ga0207712_10032827 Ga0207712_100328273 266
1382 3300025961 Ga0207712_10033370 Ga0207712_100333703 266
1383 3300025961 Ga0207712_10039674 Ga0207712_100396742 266
1384 3300025961 Ga0207712_10051430 Ga0207712_100514302 266
1385 3300025961 Ga0207712_10095338 Ga0207712_100953382 266
1386 3300025961 Ga0207712_10118743 Ga0207712_101187432 266
1387 3300025972 Ga0207668_10001977 Ga0207668_1000197710 266
1388 3300025972 Ga0207668_10133778 Ga0207668_101337782 266
1389 3300025986 Ga0207658_10011529 Ga0207658_100115293 266
1390 3300025986 Ga0207658_10030280 Ga0207658_100302804 266
1391 3300025986 Ga0207658_10079089 Ga0207658_100790891 266
1392 3300025986 Ga0207658_10153346 Ga0207658_101533463 266
1393 3300026023 Ga0207677_10000485 Ga0207677_100004859 266
1394 3300026023 Ga0207677_10091658 Ga0207677_100916582 266
1395 3300026035 Ga0207703_10016859 Ga0207703_100168595 266
1396 3300026035 Ga0207703_10056347 Ga0207703_100563472 266
1397 3300026035 Ga0207703_10152489 Ga0207703_101524891 266
1398 3300026041 Ga0207639_10024644 Ga0207639_100246445 266
1399 3300026041 Ga0207639_10054315 Ga0207639_100543152 266
1400 3300026041 Ga0207639_10088442 Ga0207639_100884422 266
1401 3300026041 Ga0207639_10175228 Ga0207639_101752282 266
1402 3300026041 Ga0207639_10425543 Ga0207639_104255431 266
1403 3300026067 Ga0207678_10007004 Ga0207678_100070042 266
1404 3300026067 Ga0207678_10075827 Ga0207678_100758272 266
1405 3300026067 Ga0207678_10147956 Ga0207678_101479562 266
1406 3300026075 Ga0207708_10031319 Ga0207708_100313194 266
1407 3300026075 Ga0207708_10520691 Ga0207708_105206911 266
1408 3300026088 Ga0207641_10000053 Ga0207641_1000005329 266
1409 3300026088 Ga0207641_10004287 Ga0207641_100042879 266
1410 3300026088 Ga0207641_10015125 Ga0207641_100151252 266
1411 3300026088 Ga0207641_10031185 Ga0207641_100311855 266
1412 3300026088 Ga0207641_10282833 Ga0207641_102828332 266
1413 3300026088 Ga0207641_10324899 Ga0207641_103248991 266
1414 3300026088 Ga0207641_10584342 Ga0207641_105843422 266
1415 3300026089 Ga0207648_10002745 Ga0207648_1000274514 266
1416 3300026089 Ga0207648_10021518 Ga0207648_100215186 266
1417 3300026089 Ga0207648_10080806 Ga0207648_100808062 266
1418 3300026089 Ga0207648_10284895 Ga0207648_102848952 266
1419 3300026089 Ga0207648_10292234 Ga0207648_102922342 266
1420 3300026089 Ga0207648_10302914 Ga0207648_103029142 266
1421 3300026095 Ga0207676_10007338 Ga0207676_100073381 266
1422 3300026095 Ga0207676_10051922 Ga0207676_100519223 266
1423 3300026095 Ga0207676_10069872 Ga0207676_100698723 266
1424 3300026095 Ga0207676_10142200 Ga0207676_101422004 266
1425 3300026095 Ga0207676_10543079 Ga0207676_105430792 266
1426 3300026116 Ga0207674_10105539 Ga0207674_101055393 266
1427 3300026116 Ga0207674_10155308 Ga0207674_101553082 266
1428 3300026116 Ga0207674_10249006 Ga0207674_102490062 266
1429 3300026116 Ga0207674_10311501 Ga0207674_103115011 266
1430 3300026118 Ga0207675_100000124 Ga0207675_10000012439 266
1431 3300026118 Ga0207675_100040463 Ga0207675_1000404633 266
1432 3300026118 Ga0207675_100169354 Ga0207675_1001693542 266
1433 3300026118 Ga0207675_100190769 Ga0207675_1001907692 266
1434 3300026118 Ga0207675_100372489 Ga0207675_1003724891 266
1435 3300026118 Ga0207675_100473959 Ga0207675_1004739592 266
1436 3300026121 Ga0207683_10086170 Ga0207683_100861703 266
1437 3300026121 Ga0207683_10279996 Ga0207683_102799962 266
1438 3300026142 Ga0207698_10003545 Ga0207698_100035456 266
1439 3300026142 Ga0207698_10033954 Ga0207698_100339542 266
1440 3300026142 Ga0207698_10046171 Ga0207698_100461714 266
1441 3300026142 Ga0207698_10054931 Ga0207698_100549312 266
1442 3300026142 Ga0207698_10065450 Ga0207698_100654503 266
1443 3300026142 Ga0207698_10287458 Ga0207698_102874582 266
1444 3300027471 Ga0209995_1013121 Ga0209995_10131212 266
1445 3300028379 Ga0268266_10016598 Ga0268266_100165985 266
1446 3300028379 Ga0268266_10162530 Ga0268266_101625302 266
1447 3300028379 Ga0268266_10545080 Ga0268266_105450802 266
1448 3300028380 Ga0268265_10021116 Ga0268265_100211163 266
1449 3300028380 Ga0268265_10052714 Ga0268265_100527143 266
1450 3300028381 Ga0268264_10007626 Ga0268264_100076264 266
1451 3300028381 Ga0268264_10014664 Ga0268264_100146646 266
1452 3300028381 Ga0268264_10047358 Ga0268264_100473581 266
1453 3300028381 Ga0268264_10062030 Ga0268264_100620304 266
1454 3300028381 Ga0268264_10116919 Ga0268264_101169193 266
1455 3300028381 Ga0268264_10394012 Ga0268264_103940122 266
1456 3300028786 Ga0307517_10009441 Ga0307517_1000944111 266
1457 3300028794 Ga0307515_10000002 Ga0307515_10000002341 266
1458 3300028794 Ga0307515_10001796 Ga0307515_1000179643 266
1459 3300029957 Ga0265324_10046281 Ga0265324_100462811 266
1460 3300031251 Ga0265327_10000093 Ga0265327_1000009360 266
1461 3300031251 Ga0265327_10000148 Ga0265327_10000148104 266
1462 3300031251 Ga0265327_10021872 Ga0265327_100218724 266
1463 3300031251 Ga0265327_10024944 Ga0265327_100249441 266
1464 3300031251 Ga0265327_10101452 Ga0265327_101014521 266
1465 3300031456 Ga0307513_10072311 Ga0307513_100723113 266
1466 3300031507 Ga0307509_10039603 Ga0307509_100396033 266
1467 3300031548 Ga0307408_100000736 Ga0307408_10000073614 266
1468 3300031691 Ga0316579_10062502 Ga0316579_100625022 266
1469 3300031727 Ga0316576_10054422 Ga0316576_100544223 266
1470 3300031727 Ga0316576_10103933 Ga0316576_101039332 266
1471 3300031727 Ga0316576_10325775 Ga0316576_103257752 266
1472 3300031730 Ga0307516_10295557 Ga0307516_102955572 266
1473 3300032004 Ga0307414_10253395 Ga0307414_102533952 266
1474 3300032126 Ga0307415_100228926 Ga0307415_1002289262 266
1475 3300032133 Ga0316583_10063105 Ga0316583_100631052 266
1476 3300035172 Ga0373955_0088969 Ga0373955_0088969_214_1014 266
1477 3300035398 Ga0316574_0050496 Ga0316574_0050496_1540_2340 266
1478 3300035398 Ga0316574_0098149 Ga0316574_0098149_101_904 266
1479 3300035692 Ga0373935_0500638 Ga0373935_0500638_34_834 266
1480 3300036401 Ga0373937_0123286 Ga0373937_0123286_1405_2205 266
1481 3300036712 Ga0316584_0042576 Ga0316584_0042576_1138_1938 266
1482 3300037312 Ga0395899_0002106 Ga0395899_0002106_8809_9615 266
1483 3300037312 Ga0395899_0025305 Ga0395899_0025305_1256_2062 266
1484 3300037312 Ga0395899_0156961 Ga0395899_0156961_133_939 266
1485 3300037418 Ga0395900_0001729 Ga0395900_0001729_14668_15474 266
1486 3300037418 Ga0395900_0081265 Ga0395900_0081265_130_936 266
1487 3300037418 Ga0395900_0232663 Ga0395900_0232663_1017_1823 266
1488 3300037418 Ga0395900_0234292 Ga0395900_0234292_850_1650 266
1489 3300037466 Ga0395898_0003753 Ga0395898_0003753_8567_9373 266
1490 3300037466 Ga0395898_0012532 Ga0395898_0012532_827_1633 266
1491 3300037466 Ga0395898_0019133 Ga0395898_0019133_235_1041 266
1492 3300037466 Ga0395898_0076279 Ga0395898_0076279_1394_2200 266
1493 3300037466 Ga0395898_0205045 Ga0395898_0205045_244_1050 266
1494 3300037466 Ga0395898_0503099 Ga0395898_0503099_293_1099 266
1495 3300037471 Ga0395905_0001826 Ga0395905_0001826_20506_21309 266
1496 3300037471 Ga0395905_0073567 Ga0395905_0073567_2364_3170 266
1497 3300037471 Ga0395905_0208421 Ga0395905_0208421_1010_1813 266
1498 3300037471 Ga0395905_0293382 Ga0395905_0293382_419_1222 266
1499 3300038443 Ga0395901_0006688 Ga0395901_0006688_8602_9408 266
1500 3300038443 Ga0395901_0012926 Ga0395901_0012926_2124_2930 266
1501 3300038443 Ga0395901_0021023 Ga0395901_0021023_2506_3312 266
1502 3300038443 Ga0395901_0244529 Ga0395901_0244529_1035_1841 266
1503 3300039093 Ga0400489_11482 Ga0400489_11482_4329_5129 266
1504 3300039093 Ga0400489_54591 Ga0400489_54591_199_999 266
1505 3300039437 Ga0436365_0480954 Ga0436365_0480954_11064_11864 266
1506 3300039437 Ga0436365_1569731 Ga0436365_1569731_1870_2670 266
1507 3300039437 Ga0436365_1768392 Ga0436365_1768392_281_1081 266
1508 3300039447 Ga0436361_0728698 Ga0436361_0728698_220_1020 266
1509 3300041404 Ga0439436_0012671 Ga0439436_0012671_1462_2262 266
1510 3300041451 Ga0451791_1824324 Ga0451791_1824324_455_1255 266
1511 3300041486 Ga0451807_1357051 Ga0451807_1357051_327_1130 266
1512 3300041498 Ga0451841_0372109 Ga0451841_0372109_10_810 266
1513 3300041512 Ga0451853_1013762 Ga0451853_1013762_211_1011 266
1514 3300042002 Ga0439442_006092 Ga0439442_006092_695_1498 266
1515 3300042004 Ga0439445_0004839 Ga0439445_0004839_1500_2303 266
1516 3300042007 Ga0439449_0005652 Ga0439449_0005652_1658_2458 266
1517 3300042014 Ga0439457_000014 Ga0439457_000014_22041_22841 266
1518 3300042014 Ga0439457_026821 Ga0439457_026821_276_1079 266
1519 3300042125 Ga0450923_004999 Ga0450923_004999_87_890 266
1520 3300042134 Ga0450898_000638 Ga0450898_000638_133_936 266
1521 3300042135 Ga0450899_001082 Ga0450899_001082_327_1130 266
1522 3300042435 Ga0439434_0008135 Ga0439434_0008135_513_1316 266
1523 3300042876 Ga0451577_0023282 Ga0451577_0023282_3583_4383 266
1524 3300042876 Ga0451577_0058443 Ga0451577_0058443_1780_2586 266
1525 3300042876 Ga0451577_0059945 Ga0451577_0059945_1603_2406 266
1526 3300042876 Ga0451577_0070738 Ga0451577_0070738_297_1097 266
1527 3300042876 Ga0451577_0073923 Ga0451577_0073923_10_810 266
1528 3300044656 Ga0466969_0000137 Ga0466969_0000137_30012_30812 266
1529 3300044656 Ga0466969_0056886 Ga0466969_0056886_89_889 266
1530 3300044658 Ga0466972_0000023 Ga0466972_0000023_25640_26440 266
1531 3300044658 Ga0466972_0000064 Ga0466972_0000064_83869_84669 266
1532 3300044673 Ga0453683_0014335 Ga0453683_0014335_3913_4716 266
1533 3300044684 Ga0466966_0000099 Ga0466966_0000099_39225_40025 266
1534 3300044712 Ga0453684_0001523 Ga0453684_0001523_34343_35143 266
1535 3300044712 Ga0453684_0018478 Ga0453684_0018478_298_1101 266
1536 3300044712 Ga0453684_0060293 Ga0453684_0060293_2380_3180 266
1537 3300044712 Ga0453684_0077606 Ga0453684_0077606_2617_3417 266
1538 3300044712 Ga0453684_0235620 Ga0453684_0235620_758_1558 266
1539 3300044712 Ga0453684_0483707 Ga0453684_0483707_19_819 266
1540 3300044735 Ga0466968_0082946 Ga0466968_0082946_541_1341 266
1541 3300044765 Ga0466970_0000094 Ga0466970_0000094_13049_13849 266
1542 3300044842 Ga0466957_0002083 Ga0466957_0002083_3812_4612 266
1543 3300044842 Ga0466957_0009316 Ga0466957_0009316_3369_4169 266
1544 3300045049 Ga0466959_0000074 Ga0466959_0000074_7724_8524 266
1545 3300045051 Ga0451576_0112249 Ga0451576_0112249_1270_2076 266
1546 3300045976 Ga0466967_0091301 Ga0466967_0091301_1332_2132 266
1547 3300046460 Ga0495638_0067278 Ga0495638_0067278_386_1186 266
1548 3300046475 Ga0495639_0117227 Ga0495639_0117227_271_1071 266
1549 3300046511 Ga0495608_0229760 Ga0495608_0229760_182_982 266
1550 3300046522 Ga0495643_0047543 Ga0495643_0047543_1448_2251 266
1551 3300047319 Ga0495674_0029758 Ga0495674_0029758_37_837 266
1552 3300047320 Ga0495672_0058796 Ga0495672_0058796_975_1775 266
1553 3300047320 Ga0495672_0075978 Ga0495672_0075978_955_1755 266
1554 3300047472 Ga0495686_0010011 Ga0495686_0010011_5550_6353 266
1555 3300047472 Ga0495686_0066119 Ga0495686_0066119_1404_2207 266
1556 3300048911 Ga0496108_0643425 Ga0496108_0643425_73_873 266
1557 3300048912 Ga0496109_0023654 Ga0496109_0023654_900_1700 266
1558 3300048913 Ga0496110_0069554 Ga0496110_0069554_116_919 266
1559 3300048917 Ga0496114_0344865 Ga0496114_0344865_396_1196 266
1560 3300048918 Ga0496115_0427269 Ga0496115_0427269_234_1034 266
1561 3300049521 Ga0501298_012944 Ga0501298_012944_53_871 266
1562 3300049569 Ga0501032_0006744 Ga0501032_0006744_2756_3556 266
1563 3300049570 Ga0501033_0082718 Ga0501033_0082718_1080_1880 266
1564 3300049571 Ga0501034_0000399 Ga0501034_0000399_45311_46111 266
1565 3300049571 Ga0501034_0007132 Ga0501034_0007132_3435_4235 266
1566 3300049571 Ga0501034_0204855 Ga0501034_0204855_657_1457 266
1567 3300049571 Ga0501034_0372380 Ga0501034_0372380_19_819 266
1568 3300049572 Ga0501036_0038538 Ga0501036_0038538_537_1397 266
1569 3300049573 Ga0501037_0004614 Ga0501037_0004614_1962_2762 266
1570 3300049574 Ga0501038_0008621 Ga0501038_0008621_1417_2217 266
1571 3300049574 Ga0501038_0315654 Ga0501038_0315654_284_1144 266
1572 3300049579 Ga0501043_0179804 Ga0501043_0179804_661_1521 266
1573 3300049579 Ga0501043_0326014 Ga0501043_0326014_264_1064 266
1574 3300049580 Ga0501046_0161429 Ga0501046_0161429_405_1265 266
1575 3300049581 Ga0501047_0008976 Ga0501047_0008976_6862_7662 266
1576 3300049581 Ga0501047_0028283 Ga0501047_0028283_3992_4792 266
1577 3300049585 Ga0501069_0249186 Ga0501069_0249186_58_858 266
1578 3300049589 Ga0501073_0232854 Ga0501073_0232854_121_981 266
1579 3300049649 Ga0501198_012863 Ga0501198_012863_129_947 266
1580 3300049651 Ga0501201_000710 Ga0501201_000710_1494_2312 266
1581 3300049652 Ga0501202_003897 Ga0501202_003897_204_1022 266
1582 3300049661 Ga0501217_000991 Ga0501217_000991_3067_3885 266
1583 3300049662 Ga0501222_001667 Ga0501222_001667_283_1101 266
1584 3300049663 Ga0501223_001698 Ga0501223_001698_1992_2798 266
1585 3300049663 Ga0501223_006800 Ga0501223_006800_215_1033 266
1586 3300049668 Ga0501233_060068 Ga0501233_060068_39_839 266
1587 3300049669 Ga0501235_003004 Ga0501235_003004_214_1032 266
1588 3300049673 Ga0501240_009534 Ga0501240_009534_358_1176 266
1589 3300049675 Ga0501243_017198 Ga0501243_017198_121_939 266
1590 3300049682 Ga0501252_002797 Ga0501252_002797_129_947 266
1591 3300049688 Ga0501259_001336 Ga0501259_001336_467_1285 266
1592 3300049690 Ga0501261_000935 Ga0501261_000935_154_972 266
1593 3300049703 Ga0501219_000072 Ga0501219_000072_15594_16394 266
1594 3300049704 Ga0501221_001193 Ga0501221_001193_204_1022 266
1595 3300049705 Ga0501225_0002937 Ga0501225_0002937_575_1393 266
1596 3300049707 Ga0501234_002922 Ga0501234_002922_1152_1970 266
1597 3300049708 Ga0501245_000792 Ga0501245_000792_2383_3201 266
1598 3300049742 Ga0501080_0095038 Ga0501080_0095038_92_892 266
1599 3300049744 Ga0501083_0104398 Ga0501083_0104398_925_1728 266
1600 3300049758 Ga0501241_007126 Ga0501241_007126_605_1405 266
1601 3300049763 Ga0501266_001794 Ga0501266_001794_390_1208 266
1602 3300049778 Ga0501282_005718 Ga0501282_005718_35_853 266
1603 3300049822 Ga0501035_0012497 Ga0501035_0012497_3727_4527 266
1604 3300049822 Ga0501035_0107483 Ga0501035_0107483_827_1627 266
1605 3300049823 Ga0501044_0008687 Ga0501044_0008687_7537_8337 266
1606 3300049823 Ga0501044_0011700 Ga0501044_0011700_2564_3364 266
1607 3300049823 Ga0501044_0015635 Ga0501044_0015635_4044_4904 266
1608 3300049823 Ga0501044_0072142 Ga0501044_0072142_841_1641 266
1609 3300049823 Ga0501044_0243374 Ga0501044_0243374_130_936 266
1610 3300049851 Ga0501212_000685 Ga0501212_000685_1161_1979 266
1611 3300050005 Ga0501284_00059 Ga0501284_00059_2920_3720 266
1612 3300050493 nmdc:mga0k408_10235_c1 nmdc:mga0k408_10235_c1_4223_5023 266
1613 3300050493 nmdc:mga0k408_102649_c1 nmdc:mga0k408_102649_c1_634_1434 266
1614 3300050493 nmdc:mga0k408_2012_c1 nmdc:mga0k408_2012_c1_3867_4670 266
1615 3300050493 nmdc:mga0k408_96192_c1 nmdc:mga0k408_96192_c1_276_1079 266
1616 3300050507 nmdc:mga05p37_375315_c1 nmdc:mga05p37_375315_c1_185_985 266
1617 3300050508 nmdc:mga09592_37236_c1 nmdc:mga09592_37236_c1_1784_2587 266
1618 3300050508 nmdc:mga09592_45525_c1 nmdc:mga09592_45525_c1_2621_3421 266
1619 3300050509 nmdc:mga0qj67_91800_c1 nmdc:mga0qj67_91800_c1_1310_2113 266
1620 3300050510 nmdc:mga06r32_36325_c1 nmdc:mga06r32_36325_c1_772_1575 266
1621 3300050510 nmdc:mga06r32_90944_c1 nmdc:mga06r32_90944_c1_1794_2594 266
1622 3300050511 nmdc:mga08y16_149587_c1 nmdc:mga08y16_149587_c1_329_1129 266
1623 3300050511 nmdc:mga08y16_154457_c1 nmdc:mga08y16_154457_c1_1167_2030 266
1624 3300050511 nmdc:mga08y16_17977_c1 nmdc:mga08y16_17977_c1_3935_4738 266
1625 3300050511 nmdc:mga08y16_631759_c1 nmdc:mga08y16_631759_c1_220_1023 266
1626 3300053084 Ga0495595_0171146 Ga0495595_0171146_256_1056 266
1627 3300053086 Ga0500578_0000144 Ga0500578_0000144_1612_2412 266
1628 3300053086 Ga0500578_0014501 Ga0500578_0014501_3096_3896 266
1629 3300053088 Ga0500644_0037786 Ga0500644_0037786_568_1368 266
1630 3300053090 Ga0500646_0000818 Ga0500646_0000818_4545_5345 266
1631 3300053092 Ga0500583_0000060 Ga0500583_0000060_54210_55010 266
1632 3300053092 Ga0500583_0067379 Ga0500583_0067379_59_859 266
1633 3300053093 Ga0500651_0313237 Ga0500651_0313237_72_872 266
1634 3300053103 Ga0500555_009160 Ga0500555_009160_1496_2296 266
1635 3300053108 Ga0500562_014455 Ga0500562_014455_100_900 266
1636 3300053118 Ga0500594_0012961 Ga0500594_0012961_843_1643 266
1637 3300053131 Ga0500652_005154 Ga0500652_005154_3223_4023 266
1638 3300053140 Ga0500573_0131722 Ga0500573_0131722_129_929 266
1639 3300053143 Ga0500579_133212 Ga0500579_133212_324_1124 266
1640 3300053147 Ga0500589_030117 Ga0500589_030117_1110_1910 266
1641 3300053151 Ga0500604_0025190 Ga0500604_0025190_860_1660 266
1642 3300053153 Ga0500616_0002790 Ga0500616_0002790_5092_5916 266
1643 3300053156 Ga0500622_0000304 Ga0500622_0000304_29470_30270 266
1644 3300053156 Ga0500622_0069802 Ga0500622_0069802_520_1320 266
1645 3300053177 Ga0500636_0052137 Ga0500636_0052137_381_1181 266
1646 3300053727 Ga0500611_000033 Ga0500611_000033_20227_21030 266
1647 3300053730 Ga0500645_046972 Ga0500645_046972_23_823 266
1648 3300061719 Ga0466962_0035580 Ga0466962_0035580_61_861 266
1649 3300031548 Ga0307408_100000566 Ga0307408_10000056610 267
1650 3300031911 Ga0307412_10002048 Ga0307412_100020489 267
1651 3300032002 Ga0307416_100263485 Ga0307416_1002634851 267
1652 3300044712 Ga0453684_0676626 Ga0453684_0676626_220_1029 267
1653 3300045051 Ga0451576_0595790 Ga0451576_0595790_165_974 267
1654 3300049568 Ga0501031_0000669 Ga0501031_0000669_709_1524 267
1655 3300049569 Ga0501032_0006377 Ga0501032_0006377_4375_5190 267
1656 3300049569 Ga0501032_0011511 Ga0501032_0011511_925_1740 267
1657 3300049570 Ga0501033_0000005 Ga0501033_0000005_225441_226256 267
1658 3300049571 Ga0501034_0000052 Ga0501034_0000052_164189_165004 267
1659 3300049572 Ga0501036_0005324 Ga0501036_0005324_2913_3728 267
1660 3300049573 Ga0501037_0048842 Ga0501037_0048842_2242_3057 267
1661 3300049574 Ga0501038_0013871 Ga0501038_0013871_5503_6318 267
1662 3300049575 Ga0501039_0010156 Ga0501039_0010156_3165_3980 267
1663 3300049579 Ga0501043_0009194 Ga0501043_0009194_6630_7445 267
1664 3300049822 Ga0501035_0013123 Ga0501035_0013123_634_1449 267
1665 3300049823 Ga0501044_0001723 Ga0501044_0001723_5269_6084 267
1666 3300049824 Ga0501045_0003565 Ga0501045_0003565_6437_7252 267
1667 3300015261 Ga0182006_1005766 Ga0182006_10057664 268
1668 3300042876 Ga0451577_0000250 Ga0451577_0000250_42924_43736 268
1669 3300047318 Ga0495636_0000077 Ga0495636_0000077_21165_21971 268
1670 3300005543 Ga0070672_100217348 Ga0070672_1002173482 269
1671 3300014325 Ga0163163_10653377 Ga0163163_106533772 269
1672 3300014326 Ga0157380_10954385 Ga0157380_109543851 269
1673 3300025940 Ga0207691_10357143 Ga0207691_103571432 269
1674 3300028381 Ga0268264_10324998 Ga0268264_103249982 269
1675 3300031251 Ga0265327_10089072 Ga0265327_100890722 269
1676 iso_pu_bacteria 2818991442 2819573826 269
1677 iso_pu_bacteria 2818991460 2819680443 269
1678 iso_pu_bacteria 2821136567 2821137160 269
1679 iso_pu_bacteria 2840677318 2840677533 269
1680 iso_pu_bacteria 2883068021 2883072915 269
1681 iso_pu_bacteria 2896085136 2896085351 269
1682 iso_pu_bacteria 2896109856 2896115250 269
1683 iso_pu_bacteria 2904467357 2904468098 269
1684 iso_pu_bacteria 2929177148 2929182742 269
1685 iso_pu_bacteria 2929239360 2929241443 269
1686 iso_pu_bacteria 2929921140 2929923474 269
1687 iso_pu_bacteria 2945977869 2945978695 269
1688 iso_pu_bacteria 2946013367 2946015437 269
1689 iso_pu_bacteria 8003151029 8003152876 269
1690 3300003322 rootL2_10074114 rootL2_100741142 270
1691 3300005435 Ga0070714_100082836 Ga0070714_1000828362 270
1692 3300017792 Ga0163161_10449633 Ga0163161_104496332 270
1693 3300025949 Ga0207667_10551033 Ga0207667_105510332 270
1694 3300031251 Ga0265327_10003750 Ga0265327_100037507 270
1695 3300038443 Ga0395901_0007184 Ga0395901_0007184_8772_9605 270
1696 3300031616 Ga0307508_10001800 Ga0307508_100018002 271
1697 3300005563 Ga0068855_100329075 Ga0068855_1003290751 272
1698 3300005840 Ga0068870_10143043 Ga0068870_101430432 272
1699 3300025949 Ga0207667_10145050 Ga0207667_101450503 272
1700 3300026089 Ga0207648_10152433 Ga0207648_101524332 272
1701 3300026121 Ga0207683_10170844 Ga0207683_101708442 272
1702 3300031344 Ga0265316_10201971 Ga0265316_102019712 272
1703 3300031711 Ga0265314_10028286 Ga0265314_100282863 272
1704 3300032004 Ga0307414_10166483 Ga0307414_101664832 272
1705 3300037471 Ga0395905_0000003 Ga0395905_0000003_424204_425028 272
1706 3300049572 Ga0501036_0226812 Ga0501036_0226812_539_1360 272
1707 3300049573 Ga0501037_0028996 Ga0501037_0028996_40_861 272
1708 3300049579 Ga0501043_0097363 Ga0501043_0097363_1158_1979 272
1709 3300049581 Ga0501047_0375654 Ga0501047_0375654_396_1217 272
1710 3300049822 Ga0501035_0087075 Ga0501035_0087075_238_1059 272
1711 3300049823 Ga0501044_0332706 Ga0501044_0332706_437_1258 272
1712 2162886007 SwRhRL2b_contig_595006 SwRhRL2b_0826.00008180 273
1713 3300001989 JGI24739J22299_10003467 JGI24739J22299_100034677 273
1714 3300001989 JGI24739J22299_10064304 JGI24739J22299_100643041 273
1715 3300002738 JGI25154J39366_1000007 JGI25154J39366_1000007143 273
1716 3300002739 JGI25158J39367_1002516 JGI25158J39367_10025162 273
1717 3300002741 JGI25157J39369_1005353 JGI25157J39369_10053532 273
1718 3300003215 JGI25153J46596_10001266 JGI25153J46596_1000126618 273
1719 3300003316 rootH1_10134510 rootH1_101345103 273
1720 3300003322 rootL2_10038289 rootL2_100382893 273
1721 3300003323 rootH1_10007512 rootH1_100075124 273
1722 3300003323 rootH1_10078749 rootH1_100787493 273
1723 3300003354 JGI25160J50197_1004668 JGI25160J50197_10046685 273
1724 3300003761 Ga0055535_1001785 Ga0055535_10017852 273
1725 3300003771 Ga0055526_1022313 Ga0055526_10223132 273
1726 3300003790 Ga0055528_1000164 Ga0055528_100016436 273
1727 3300003791 Ga0055530_10007673 Ga0055530_100076733 273
1728 3300003794 Ga0055531_10000085 Ga0055531_1000008570 273
1729 3300005262 Ga0065165_1000010 Ga0065165_1000010123 273
1730 3300005262 Ga0065165_1008512 Ga0065165_10085122 273
1731 3300005289 Ga0065704_10074138 Ga0065704_100741385 273
1732 3300005328 Ga0070676_10291635 Ga0070676_102916352 273
1733 3300005333 Ga0070677_10007031 Ga0070677_100070314 273
1734 3300005354 Ga0070675_100011402 Ga0070675_1000114022 273
1735 3300005355 Ga0070671_100281644 Ga0070671_1002816442 273
1736 3300005364 Ga0070673_100068032 Ga0070673_1000680322 273
1737 3300005456 Ga0070678_100107619 Ga0070678_1001076193 273
1738 3300005456 Ga0070678_100282545 Ga0070678_1002825452 273
1739 3300005543 Ga0070672_100115402 Ga0070672_1001154022 273
1740 3300005543 Ga0070672_100165848 Ga0070672_1001658482 273
1741 3300005719 Ga0068861_100265613 Ga0068861_1002656132 273
1742 3300006195 Ga0075366_10062086 Ga0075366_100620862 273
1743 3300010375 Ga0105239_10541619 Ga0105239_105416192 273
1744 3300010375 Ga0105239_10860004 Ga0105239_108600041 273
1745 3300014326 Ga0157380_10042515 Ga0157380_100425152 273
1746 3300014326 Ga0157380_10109625 Ga0157380_101096252 273
1747 3300014326 Ga0157380_10143991 Ga0157380_101439912 273
1748 3300014326 Ga0157380_10215948 Ga0157380_102159482 273
1749 3300015265 Ga0182005_1000131 Ga0182005_100013129 273
1750 3300017792 Ga0163161_10081658 Ga0163161_100816582 273
1751 3300017792 Ga0163161_10214407 Ga0163161_102144072 273
1752 3300025208 Ga0209436_100821 Ga0209436_1008218 273
1753 3300025208 Ga0209436_102604 Ga0209436_1026043 273
1754 3300025242 Ga0209258_100219 Ga0209258_10021936 273
1755 3300025246 Ga0209646_1000002 Ga0209646_1000002748 273
1756 3300025250 Ga0209026_1000086 Ga0209026_100008612 273
1757 3300025254 Ga0209148_1000283 Ga0209148_10002836 273
1758 3300025273 Ga0209673_1000082 Ga0209673_100008297 273
1759 3300025284 Ga0209130_1002528 Ga0209130_10025285 273
1760 3300025297 Ga0209758_1014978 Ga0209758_10149782 273
1761 3300025298 Ga0209050_1000555 Ga0209050_100055536 273
1762 3300025302 Ga0207426_1000493 Ga0207426_100049315 273
1763 3300025302 Ga0207426_1000514 Ga0207426_100051411 273
1764 3300025302 Ga0207426_1000883 Ga0207426_100088318 273
1765 3300025304 Ga0209257_1000001 Ga0209257_10000011234 273
1766 3300025304 Ga0209257_1004806 Ga0209257_100480611 273
1767 3300025893 Ga0207682_10004258 Ga0207682_100042585 273
1768 3300025925 Ga0207650_10069417 Ga0207650_100694172 273
1769 3300025931 Ga0207644_10282928 Ga0207644_102829282 273
1770 3300025940 Ga0207691_10022194 Ga0207691_100221943 273
1771 3300041997 Ga0439431_0000810 Ga0439431_0000810_3324_4145 273
1772 3300041997 Ga0439431_0042653 Ga0439431_0042653_317_1138 273
1773 3300042007 Ga0439449_0057959 Ga0439449_0057959_471_1292 273
1774 3300044658 Ga0466972_0015911 Ga0466972_0015911_2595_3416 273
1775 3300044658 Ga0466972_0192733 Ga0466972_0192733_67_888 273
1776 3300045049 Ga0466959_0014265 Ga0466959_0014265_3702_4523 273
1777 3300046453 Ga0495627_001544 Ga0495627_001544_11067_11888 273
1778 3300046519 Ga0495632_0046723 Ga0495632_0046723_358_1179 273
1779 3300046558 Ga0495633_0000154 Ga0495633_0000154_13989_14810 273
1780 3300048904 Ga0496101_0067770 Ga0496101_0067770_751_1572 273
1781 3300048924 Ga0496121_0000020 Ga0496121_0000020_265511_266332 273
1782 3300048929 Ga0496126_0003667 Ga0496126_0003667_11034_11855 273
1783 3300049571 Ga0501034_0082328 Ga0501034_0082328_373_1194 273
1784 3300049574 Ga0501038_0269014 Ga0501038_0269014_145_969 273
1785 3300049581 Ga0501047_0056150 Ga0501047_0056150_2590_3411 273
1786 3300049823 Ga0501044_0222442 Ga0501044_0222442_305_1126 273
1787 3300053088 Ga0500644_0000600 Ga0500644_0000600_6094_6915 273
1788 3300053090 Ga0500646_0003070 Ga0500646_0003070_2242_3063 273
1789 3300053092 Ga0500583_0002372 Ga0500583_0002372_1818_2639 273
1790 3300053100 Ga0500660_078635 Ga0500660_078635_420_1241 273
1791 3300053109 Ga0500569_000226 Ga0500569_000226_5895_6716 273
1792 3300053121 Ga0500607_020375 Ga0500607_020375_2801_3622 273
1793 3300053134 Ga0500658_0021484 Ga0500658_0021484_449_1270 273
1794 3300053136 Ga0500559_0023756 Ga0500559_0023756_1548_2369 273
1795 3300053142 Ga0500577_0000468 Ga0500577_0000468_6340_7161 273
1796 3300053146 Ga0500588_0014453 Ga0500588_0014453_581_1405 273
1797 3300053148 Ga0500590_010437 Ga0500590_010437_253_1074 273
1798 3300053156 Ga0500622_0000077 Ga0500622_0000077_64529_65350 273
1799 3300053161 Ga0500634_0015358 Ga0500634_0015358_2836_3657 273
1800 3300053177 Ga0500636_0039586 Ga0500636_0039586_1292_2113 273
1801 2162886007 SwRhRL2b_contig_1663050 SwRhRL2b_0644.00005480 274
1802 3300005289 Ga0065704_10070140 Ga0065704_10070140397 274
1803 3300005544 Ga0070686_100016259 Ga0070686_1000162596 274
1804 3300010375 Ga0105239_10001043 Ga0105239_100010439 274
1805 3300013297 Ga0157378_10011530 Ga0157378_100115305 274
1806 3300025913 Ga0207695_10000092 Ga0207695_10000092186 274
1807 3300025914 Ga0207671_10000036 Ga0207671_1000003679 274
1808 3300026116 Ga0207674_10212088 Ga0207674_102120882 274
1809 3300047472 Ga0495686_0000324 Ga0495686_0000324_57498_58322 274
1810 3300048917 Ga0496114_0006504 Ga0496114_0006504_5909_6733 274
1811 3300053096 Ga0500641_0037152 Ga0500641_0037152_494_1318 274
1812 3300053104 Ga0500556_0023972 Ga0500556_0023972_708_1532 274
1813 3300053153 Ga0500616_0014086 Ga0500616_0014086_3581_4405 274
1814 3300053158 Ga0500627_0029600 Ga0500627_0029600_624_1448 274

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13614

AAA_31

AAA domain

36

212

0.99

PF01656

CbiA

CobQ/CobB/MinD/ParA nucleotide binding domain

39

263

0.95

PF02374

ArsA_ATPase

Anion-transporting ATPase

37

104

0.91

PF06564

CBP_BcsQ

Cellulose biosynthesis protein BcsQ

35

284

0.78

PF10609

ParA

NUBPL iron-transfer P-loop NTPase

34

284

0.72

PF09140

MipZ

ATPase MipZ

37

214

0.69

Structural Annotation

Top 5 Hits

ID Description Score Start End
6iud-assembly1.cif.gz_A structure of helicobacter pylori soj-adp complex bound to dna 0.9678 1 251
5ihp-assembly1.cif.gz_A crystal structure of cobyrinic acid a,c-diamide synthase from mycobacterium smegmatis with bound adp and magnesium 0.9622 1 254
5if9-assembly2.cif.gz_B crystal structure of cobyrinic acid a,c-diamide synthase from mycobacterium smegmatis with bound atp analog and magnesium 0.9621 1 254
5ihp-assembly2.cif.gz_B crystal structure of cobyrinic acid a,c-diamide synthase from mycobacterium smegmatis with bound adp and magnesium 0.962 1 254
4pfs-assembly1.cif.gz_A crystal structure of cobyrinic acid a,c-diamide synthase from mycobacterium smegmatis 0.9593 1 251
ID Description Score Start End Superfamily
af_P9WLT1_58_317_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9805 2 252 3.40.50.300
6iudB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9675 1 251 3.40.50.300
5ihpA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9622 1 254 3.40.50.300
af_Q1LVD4_80_340_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9518 1 252 3.40.50.300
2bekD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9464 1 252 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A537KQI0-F1-model_v4 ParA family protein 0.994 1 254
AF-M7Y3U8-F1-model_v4 Sporulation initiation inhibitor protein Soj 0.994 1 258
AF-A0A1V6B998-F1-model_v4 Sporulation initiation inhibitor protein Soj (EC 3.6.-.-) 0.9939 1 254 GO:0016787
AF-A0A519X162-F1-model_v4 AAA domain-containing protein 0.9936 1 253 GO:0016787
GO:0046872
AF-A0A7X8GXZ2-F1-model_v4 ParA family protein 0.9934 1 252

Feature Viewer

pLDDT pTM Quality
90.02 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map