F495722

General Info

Members Datasets Scaffolds Average Seq Length
1793 498 1708 344

Family's Representative Sequence

Representative Sequence 3300050511|nmdc:mga08y16_232187_c1|nmdc:mga08y16_232187_c1_53_1177
Length 374
Sequence MGWQRMMLRSLQGCIMAQLLFTTSLVGSYAQPDWLIDRKNLAGRFPPRVRAKELWRVAPEYLKEAQDDATVLAIRDQERAGLDVISDGEMRRESYSNRFATALEGVDIDNPGTALDRSGHPNPVPRVTGKVKRKYPVQVDDVKFLRANAQPDRAIKITVPGPFTMSQQAQNDFYQDEEEMALDYAAAVNAEIKDLFAAGADIVQVDEPYMQARPEKARKYGLKAFNAALDGVHGRLTAVHICFGYAAVIHVRPSGYSFLPEFADSPVAMVSIETAQSGLDCSVLAKLPDKRIMLGVIDLSDMNVETPETVAARIRRALPYVANGHLLVAPDCGMKYLPREVAFAKMCAMVEGTKIVRKEHGSIVDPYRPQRPPR

Samples

Sample ID Description Type Environment
1 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
2 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
3 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
4 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
5 2643221541 Sphingomonas sp. Root50 Isolate Unclassified
6 2643221606 Sphingomonas sp. Root720 Isolate Unclassified
7 2643221671 Sphingomonas sp. Root1294 Isolate Unclassified
8 2791354901 Actinophytocola xanthii 11-183 Isolate Rhizosphere
9 2836160341 Unclassified Planctomycetes Bin 134 Isolate Unclassified
10 2857542790 Achromobacter sp. R-72367 Isolate Unclassified
11 2894772417 Roseomonas oryzicola KCTC 22478 Isolate Rhizosphere
12 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
13 2929199973 Roseomonas sp. R-73070 Hybrid assembly Isolate Unclassified
14 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
15 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
16 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
17 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
18 3300000045 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere Metagenome Rhizosphere
19 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
20 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
21 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
22 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
23 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
24 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
25 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
26 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
27 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
28 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
29 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
30 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
31 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
32 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
33 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
34 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
35 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
36 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
37 3300005277 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) Metagenome Rhizosphere
38 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
39 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
40 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
41 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
42 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
43 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
44 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
45 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
46 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
47 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
48 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
49 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
50 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
51 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
52 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
53 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
54 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
55 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
56 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
57 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
58 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
59 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
60 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
61 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
62 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
63 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
64 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
65 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
66 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
67 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
68 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
69 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
70 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
71 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
72 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
73 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
74 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
75 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
76 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
77 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
78 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
79 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
80 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
81 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
82 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
83 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
84 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
85 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
86 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
87 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
88 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
89 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
90 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
91 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
92 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
93 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
94 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
95 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
96 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
97 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
98 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
99 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
100 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
101 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
102 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
103 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
104 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
105 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
106 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
107 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
108 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
109 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
110 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
111 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
112 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
113 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
114 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
115 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
116 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
117 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
118 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
119 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
120 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
121 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
122 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
123 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
124 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
125 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
126 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
127 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
128 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
129 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
130 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
131 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
132 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
133 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
134 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
135 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
136 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
137 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
138 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
139 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
140 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
141 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
142 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
143 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
144 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
145 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
146 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
147 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
148 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
149 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
150 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
151 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
152 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
153 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
154 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
155 3300012503 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R Metagenome Rhizosphere
156 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
157 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
158 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
159 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
160 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
161 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
162 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
163 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
164 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
165 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
166 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
167 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
168 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
169 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
170 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
171 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
172 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
173 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
174 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
175 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
176 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
177 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
179 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
180 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
181 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
182 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
183 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
236 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
238 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
239 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
240 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
241 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
243 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
244 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
245 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
246 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
247 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
248 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
249 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
250 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
251 3300028023 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 Metagenome Rhizosphere
252 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
253 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
254 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
255 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
256 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
257 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
258 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
259 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
260 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
261 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
262 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
263 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
264 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
265 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
266 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
267 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
268 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
269 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
270 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
271 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
272 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
273 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
274 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
275 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
276 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
277 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
278 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
279 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
280 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
281 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
282 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
283 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
284 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
285 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
286 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
287 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
288 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
289 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
290 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
291 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
292 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
293 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
294 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
295 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
296 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
297 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
298 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
299 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
300 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
301 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
302 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
303 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
304 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
305 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
306 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
307 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
308 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
309 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
310 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
311 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
312 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
313 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
314 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
315 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
316 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
317 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
318 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
319 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
320 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
321 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
322 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
323 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
324 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
325 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
326 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
327 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
328 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
329 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
330 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
331 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
332 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
333 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
334 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
335 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
336 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
337 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
338 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
339 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
340 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
341 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
342 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
343 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
344 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
345 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
346 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
347 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
348 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
349 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
350 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
351 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
352 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
353 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
354 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
355 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
356 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
357 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
358 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
359 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
360 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
361 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
362 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
363 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
364 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
365 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
366 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
367 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
368 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
369 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
370 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
371 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
372 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
373 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
374 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
375 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
376 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
377 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
378 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
379 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
380 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
381 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
382 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
383 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
384 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
385 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
386 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
387 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
388 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
389 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
390 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
391 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
392 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
393 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
394 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
395 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
396 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
397 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
398 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
399 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
400 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
401 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
402 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
403 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
404 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
405 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
406 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
407 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
408 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
409 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
410 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
411 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
412 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
413 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
414 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
415 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
416 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
417 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
418 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
419 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
420 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
421 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
422 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
423 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
424 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
425 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
426 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
427 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
428 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
429 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
430 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
431 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
432 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
433 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
434 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
435 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
436 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
437 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
438 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
439 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
440 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
441 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
442 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
443 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
444 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
445 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
446 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
447 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
448 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
449 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
450 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
451 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
452 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
453 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
454 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
455 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
456 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
457 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
458 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
459 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
460 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
461 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
462 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
463 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
464 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
465 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
466 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
467 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
468 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
469 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
470 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
471 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
472 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
473 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
474 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
475 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
476 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
477 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
478 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
479 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
480 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
481 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
482 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
483 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
484 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
485 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
486 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
487 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
488 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
489 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
490 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
491 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
492 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
493 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
494 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
495 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
496 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
497 8054472261 Pseudonocardia terrae RS11V-5 Isolate Rhizosphere
498 8055909800 Plastoroseomonas hellenica LMG 31523 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.94
Metatranscriptomes 0.28
Isolates 0.78

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.46
Nodule 0.11
Rhizoplane 5.35
Rhizosphere 89.51
Stem 0
Stem Tuber 0
Unclassified 1.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 2214781327 2209111006 Bacteria 2452
2 ARcpr5oldR_c000072 3300000041 Bacteria 18526
3 ARSoilYngRDRAFT_c00041 3300000042 Bacteria 20296
4 ARcpr5yngRDRAFT_c000026 3300000043 Bacteria 24110
5 ARSoilOldRDRAFT_c000019 3300000044 Bacteria 37577
6 ARSoilOldRDRAFT_c000214 3300000044 Bacteria 9160
7 ARCol0oldRDRAFT_c00215 3300000045 Bacteria 5346
8 ARCol0yngRDRAFT_1000004 3300000652 Bacteria 52222
9 JGI24752J21851_1006723 3300001976 Bacteria 1505
10 JGI24746J21847_1000362 3300001977 Bacteria 6636
11 JGI24747J21853_1000329 3300001978 Bacteria 2742
12 JGI24739J22299_10001029 3300001989 Bacteria 10330
13 JGI24750J21931_1001118 3300002070 Bacteria 3459
14 JGI24738J21930_10000204 3300002075 Bacteria 15817
15 JGI24749J21850_1000588 3300002076 Bacteria 5302
16 JGI24035J26624_1004583 3300002126 Bacteria 1313
17 JGI24033J26618_1001233 3300002155 Bacteria 2509
18 JGI24034J26672_10002177 3300002239 Bacteria 2670
19 JGI24742J22300_10000800 3300002244 Bacteria 4782
20 JGI25153J46596_10008839 3300003215 Bacteria 4760
21 JGI25153J46596_10038412 3300003215 Bacteria 1509
22 rootL2_10262791 3300003322 Unclassified 1381
23 JGI25404J52841_10006776 3300003659 Bacteria 2404
24 Ga0055540_1003555 3300003792 Bacteria 7457
25 Ga0055531_10009397 3300003794 Bacteria 4997
26 JGI25405J52794_10017595 3300003911 Bacteria 1421
27 Ga0065716_1001727 3300005277 Bacteria 3757
28 Ga0065715_10013903 3300005293 Bacteria 3659
29 Ga0065715_10021203 3300005293 Bacteria 1840
30 Ga0065707_10090617 3300005295 Bacteria 4104
31 Ga0065707_10109240 3300005295 Bacteria 2476
32 Ga0070658_10067625 3300005327 Bacteria 2919
33 Ga0070676_10056879 3300005328 Bacteria 2313
34 Ga0070676_10082059 3300005328 Bacteria 1958
35 Ga0070683_100001135 3300005329 Bacteria 20137
36 Ga0070683_100005380 3300005329 Bacteria 10677
37 Ga0070683_100114000 3300005329 Bacteria 2551
38 Ga0070683_100189683 3300005329 Bacteria 1952
39 Ga0070683_100189912 3300005329 Bacteria 1950
40 Ga0070683_100296257 3300005329 Bacteria 1538
41 Ga0070683_100326583 3300005329 Bacteria 1460
42 Ga0070690_100000450 3300005330 Bacteria 20638
43 Ga0070690_100038393 3300005330 Bacteria 3022
44 Ga0070690_100210249 3300005330 Bacteria 1358
45 Ga0070670_100079320 3300005331 Bacteria 2821
46 Ga0070677_10000229 3300005333 Bacteria 19338
47 Ga0068869_100000076 3300005334 Bacteria 44659
48 Ga0068869_100004650 3300005334 Bacteria 8563
49 Ga0068869_100047586 3300005334 Bacteria 3098
50 Ga0068869_100103040 3300005334 Bacteria 2162
51 Ga0068869_100283355 3300005334 Bacteria 1333
52 Ga0070666_10040728 3300005335 Bacteria 3102
53 Ga0070666_10100616 3300005335 Bacteria 1992
54 Ga0070680_100001687 3300005336 Bacteria 16185
55 Ga0070680_100001778 3300005336 Bacteria 15827
56 Ga0070680_100005289 3300005336 Bacteria 9762
57 Ga0070680_100014162 3300005336 Bacteria 6229
58 Ga0070680_100029935 3300005336 Bacteria 4371
59 Ga0070680_100031720 3300005336 Bacteria 4249
60 Ga0070680_100043928 3300005336 Bacteria 3631
61 Ga0070682_100004752 3300005337 Bacteria 7550
62 Ga0070682_100005517 3300005337 Bacteria 7041
63 Ga0070682_100052122 3300005337 Bacteria 2560
64 Ga0070682_100056011 3300005337 Bacteria 2478
65 Ga0070682_100154592 3300005337 Bacteria 1578
66 Ga0068868_100000097 3300005338 Bacteria 54209
67 Ga0068868_100056127 3300005338 Bacteria 3109
68 Ga0068868_100058913 3300005338 Bacteria 3036
69 Ga0068868_100091060 3300005338 Bacteria 2457
70 Ga0070660_100050352 3300005339 Bacteria 3205
71 Ga0070660_100057366 3300005339 Bacteria 3016
72 Ga0070660_100113675 3300005339 Bacteria 2156
73 Ga0070660_100161156 3300005339 Bacteria 1808
74 Ga0070689_100000556 3300005340 Bacteria 22329
75 Ga0070689_100101275 3300005340 Bacteria 2280
76 Ga0070689_100130549 3300005340 Bacteria 2014
77 Ga0070689_100142074 3300005340 Bacteria 1931
78 Ga0070689_100157842 3300005340 Bacteria 1832
79 Ga0070691_10006434 3300005341 Bacteria 5368
80 Ga0070691_10010376 3300005341 Bacteria 4250
81 Ga0070687_100000081 3300005343 Bacteria 31225
82 Ga0070687_100129346 3300005343 Bacteria 1456
83 Ga0070692_10000361 3300005345 Bacteria 13339
84 Ga0070692_10042153 3300005345 Bacteria 2342
85 Ga0070692_10107059 3300005345 Bacteria 1541
86 Ga0070668_100000683 3300005347 Bacteria 23113
87 Ga0070669_100000634 3300005353 Bacteria 26021
88 Ga0070669_100017336 3300005353 Bacteria 5137
89 Ga0070669_100125771 3300005353 Bacteria 1961
90 Ga0070675_100000582 3300005354 Bacteria 25039
91 Ga0070675_100049909 3300005354 Bacteria 3435
92 Ga0070675_100082781 3300005354 Bacteria 2678
93 Ga0070675_100185464 3300005354 Bacteria 1800
94 Ga0070671_100006866 3300005355 Bacteria 9115
95 Ga0070671_100015677 3300005355 Bacteria 6125
96 Ga0070671_100068146 3300005355 Bacteria 2968
97 Ga0070671_100092034 3300005355 Bacteria 2541
98 Ga0070671_100102289 3300005355 Bacteria 2404
99 Ga0070671_100111582 3300005355 Bacteria 2297
100 Ga0070674_100012128 3300005356 Bacteria 5282
101 Ga0070674_100015205 3300005356 Bacteria 4801
102 Ga0070674_100079147 3300005356 Bacteria 2344
103 Ga0070674_100148072 3300005356 Bacteria 1769
104 Ga0070673_100000366 3300005364 Bacteria 23666
105 Ga0070673_100121261 3300005364 Bacteria 2181
106 Ga0070673_100153362 3300005364 Bacteria 1953
107 Ga0070673_100459994 3300005364 Bacteria 1146
108 Ga0070688_100007425 3300005365 Bacteria 5908
109 Ga0070659_100029831 3300005366 Bacteria 4217
110 Ga0070659_100165238 3300005366 Bacteria 1811
111 Ga0070659_100329901 3300005366 Bacteria 1277
112 Ga0070667_100087240 3300005367 Bacteria 2678
113 Ga0070703_10003369 3300005406 Bacteria 4559
114 Ga0070703_10007686 3300005406 Bacteria 3030
115 Ga0070703_10010831 3300005406 Bacteria 2572
116 Ga0070709_10030915 3300005434 Bacteria 3217
117 Ga0070709_10102459 3300005434 Bacteria 1909
118 Ga0070709_10112641 3300005434 Bacteria 1831
119 Ga0070714_100010640 3300005435 Bacteria 7278
120 Ga0070714_100373510 3300005435 Bacteria 1343
121 Ga0070714_100449006 3300005435 Bacteria 1224
122 Ga0070713_100055125 3300005436 Bacteria 3302
123 Ga0070713_100300517 3300005436 Bacteria 1477
124 Ga0070710_10104697 3300005437 Bacteria 1690
125 Ga0070701_10004143 3300005438 Bacteria 5827
126 Ga0070711_100058916 3300005439 Bacteria 2664
127 Ga0070711_100121467 3300005439 Bacteria 1933
128 Ga0070705_100003727 3300005440 Bacteria 7462
129 Ga0070705_100021783 3300005440 Bacteria 3413
130 Ga0070705_100077004 3300005440 Bacteria 2036
131 Ga0070700_100000611 3300005441 Bacteria 17824
132 Ga0070700_100001484 3300005441 Bacteria 11685
133 Ga0070700_100113361 3300005441 Bacteria 1806
134 Ga0070694_100002075 3300005444 Bacteria 11895
135 Ga0070694_100006428 3300005444 Bacteria 7130
136 Ga0070694_100217378 3300005444 Bacteria 1432
137 Ga0070708_100031172 3300005445 Bacteria 4612
138 Ga0070708_100058764 3300005445 Bacteria 3427
139 Ga0070663_100003347 3300005455 Bacteria 9252
140 Ga0070663_100109644 3300005455 Bacteria 2072
141 Ga0070663_100132766 3300005455 Bacteria 1892
142 Ga0070663_100211019 3300005455 Bacteria 1520
143 Ga0070678_100023437 3300005456 Bacteria 4113
144 Ga0070678_100039982 3300005456 Bacteria 3315
145 Ga0070662_100115868 3300005457 Bacteria 2047
146 Ga0070681_10002535 3300005458 Bacteria 16746
147 Ga0070681_10003628 3300005458 Bacteria 14477
148 Ga0070681_10004773 3300005458 Bacteria 12989
149 Ga0070681_10025070 3300005458 Bacteria 6001
150 Ga0070681_10045260 3300005458 Bacteria 4403
151 Ga0070681_10215793 3300005458 Bacteria 1835
152 Ga0070681_10228157 3300005458 Bacteria 1777
153 Ga0070681_10295152 3300005458 Bacteria 1531
154 Ga0070681_10303473 3300005458 Bacteria 1506
155 Ga0068867_100000194 3300005459 Bacteria 40044
156 Ga0068867_100010360 3300005459 Bacteria 6578
157 Ga0068867_100014164 3300005459 Bacteria 5648
158 Ga0068867_100077629 3300005459 Bacteria 2496
159 Ga0070685_10092151 3300005466 Bacteria 1836
160 Ga0070685_10138051 3300005466 Bacteria 1531
161 Ga0070685_10230993 3300005466 Bacteria 1217
162 Ga0070706_100064498 3300005467 Bacteria 3386
163 Ga0070706_100307694 3300005467 Bacteria 1478
164 Ga0070707_100001910 3300005468 Bacteria 19970
165 Ga0070707_100227468 3300005468 Bacteria 1816
166 Ga0070698_100321379 3300005471 Bacteria 1478
167 Ga0070699_100026614 3300005518 Bacteria 4987
168 Ga0070699_100115797 3300005518 Bacteria 2355
169 Ga0070679_100002792 3300005530 Bacteria 15870
170 Ga0070679_100004650 3300005530 Bacteria 12669
171 Ga0070679_100006811 3300005530 Bacteria 10657
172 Ga0070679_100025920 3300005530 Bacteria 5753
173 Ga0070679_100062671 3300005530 Bacteria 3707
174 Ga0070679_100101193 3300005530 Bacteria 2868
175 Ga0070679_100144214 3300005530 Bacteria 2359
176 Ga0070684_100000334 3300005535 Bacteria 32646
177 Ga0070684_100000613 3300005535 Bacteria 24605
178 Ga0070684_100013606 3300005535 Bacteria 6566
179 Ga0070684_100046625 3300005535 Bacteria 3755
180 Ga0070684_100100939 3300005535 Bacteria 2578
181 Ga0070684_100230297 3300005535 Bacteria 1692
182 Ga0070697_100025464 3300005536 Bacteria 4719
183 Ga0070697_100112295 3300005536 Bacteria 2272
184 Ga0070697_100257468 3300005536 Bacteria 1493
185 Ga0070697_100271233 3300005536 Bacteria 1454
186 Ga0070697_100428637 3300005536 Bacteria 1150
187 Ga0068853_100062685 3300005539 Bacteria 3218
188 Ga0070672_100000261 3300005543 Bacteria 29848
189 Ga0070672_100002993 3300005543 Bacteria 10887
190 Ga0070686_100000732 3300005544 Bacteria 19074
191 Ga0070686_100057405 3300005544 Bacteria 2500
192 Ga0070695_100000206 3300005545 Bacteria 28716
193 Ga0070695_100029269 3300005545 Bacteria 3421
194 Ga0070695_100051449 3300005545 Bacteria 2643
195 Ga0070695_100121833 3300005545 Bacteria 1785
196 Ga0070696_100001279 3300005546 Bacteria 16383
197 Ga0070696_100003513 3300005546 Bacteria 10424
198 Ga0070696_100025382 3300005546 Bacteria 4029
199 Ga0070696_100044868 3300005546 Bacteria 3061
200 Ga0070693_100000241 3300005547 Bacteria 25659
201 Ga0070693_100081519 3300005547 Bacteria 1930
202 Ga0070693_100254898 3300005547 Bacteria 1164
203 Ga0070665_100000454 3300005548 Bacteria 59667
204 Ga0070665_100025882 3300005548 Bacteria 5907
205 Ga0070665_100048087 3300005548 Bacteria 4283
206 Ga0070704_100000200 3300005549 Bacteria 24792
207 Ga0070704_100001730 3300005549 Bacteria 11915
208 Ga0068855_100000075 3300005563 Bacteria 119094
209 Ga0068855_100002398 3300005563 Bacteria 23127
210 Ga0068855_100002815 3300005563 Bacteria 21413
211 Ga0068855_100004267 3300005563 Bacteria 17452
212 Ga0070664_100000892 3300005564 Bacteria 23198
213 Ga0068857_100012087 3300005577 Bacteria 7507
214 Ga0068857_100057169 3300005577 Bacteria 3462
215 Ga0068857_100209490 3300005577 Bacteria 1778
216 Ga0068854_100002291 3300005578 Bacteria 11776
217 Ga0068854_100002327 3300005578 Bacteria 11713
218 Ga0068854_100008595 3300005578 Bacteria 6573
219 Ga0068854_100021243 3300005578 Bacteria 4403
220 Ga0068856_100015609 3300005614 Bacteria 7343
221 Ga0068856_100189041 3300005614 Bacteria 2073
222 Ga0070702_100000002 3300005615 Bacteria 83999
223 Ga0070702_100000852 3300005615 Bacteria 11770
224 Ga0068852_100022151 3300005616 Bacteria 5090
225 Ga0068852_100034258 3300005616 Bacteria 4222
226 Ga0068852_100331252 3300005616 Bacteria 1481
227 Ga0068859_100000195 3300005617 Bacteria 59015
228 Ga0068859_100029966 3300005617 Bacteria 5459
229 Ga0068859_100040879 3300005617 Bacteria 4657
230 Ga0068859_100082007 3300005617 Bacteria 3268
231 Ga0068859_100131549 3300005617 Bacteria 2574
232 Ga0068859_100355055 3300005617 Bacteria 1561
233 Ga0068864_100008792 3300005618 Bacteria 8327
234 Ga0068864_100056129 3300005618 Bacteria 3403
235 Ga0068864_100080523 3300005618 Bacteria 2853
236 Ga0068864_100089571 3300005618 Bacteria 2711
237 Ga0068866_10000037 3300005718 Bacteria 50738
238 Ga0068866_10020987 3300005718 Bacteria 3001
239 Ga0068861_100000141 3300005719 Bacteria 36774
240 Ga0068861_100113622 3300005719 Bacteria 2173
241 Ga0068861_100185096 3300005719 Bacteria 1736
242 Ga0068861_100358880 3300005719 Bacteria 1281
243 Ga0068870_10012478 3300005840 Bacteria 3972
244 Ga0068870_10066878 3300005840 Bacteria 1948
245 Ga0068863_100004833 3300005841 Bacteria 13276
246 Ga0068863_100121693 3300005841 Bacteria 2489
247 Ga0068863_100287673 3300005841 Bacteria 1593
248 Ga0068858_100015675 3300005842 Bacteria 7130
249 Ga0068858_100050546 3300005842 Bacteria 3847
250 Ga0068858_100152923 3300005842 Bacteria 2170
251 Ga0068858_100210766 3300005842 Bacteria 1838
252 Ga0068858_100249103 3300005842 Bacteria 1687
253 Ga0068860_100018948 3300005843 Bacteria 6686
254 Ga0068860_100066460 3300005843 Bacteria 3425
255 Ga0068860_100263200 3300005843 Bacteria 1681
256 Ga0068862_100002874 3300005844 Bacteria 15086
257 Ga0081455_10000059 3300005937 Bacteria 119148
258 Ga0081455_10010735 3300005937 Bacteria 9264
259 Ga0081455_10014294 3300005937 Bacteria 7789
260 Ga0081455_10014509 3300005937 Bacteria 7717
261 Ga0081455_10024461 3300005937 Bacteria 5591
262 Ga0081455_10136564 3300005937 Bacteria 1910
263 Ga0081538_10001357 3300005981 Bacteria 25199
264 Ga0081538_10019051 3300005981 Bacteria 5122
265 Ga0081540_1014064 3300005983 Bacteria 5156
266 Ga0081540_1021722 3300005983 Bacteria 3811
267 Ga0081540_1039393 3300005983 Bacteria 2478
268 Ga0081539_10024806 3300005985 Bacteria 3878
269 Ga0070717_10193973 3300006028 Bacteria 1776
270 Ga0070717_10213722 3300006028 Bacteria 1693
271 Ga0070717_10281762 3300006028 Bacteria 1474
272 Ga0075365_10002398 3300006038 Bacteria 9174
273 Ga0075365_10004549 3300006038 Bacteria 7368
274 Ga0075365_10020712 3300006038 Bacteria 4084
275 Ga0075365_10230445 3300006038 Bacteria 1300
276 Ga0075368_10061938 3300006042 Bacteria 1499
277 Ga0075363_100124669 3300006048 Bacteria 1441
278 Ga0075364_10013411 3300006051 Bacteria 5037
279 Ga0075364_10029662 3300006051 Bacteria 3509
280 Ga0075364_10141587 3300006051 Bacteria 1618
281 Ga0075432_10078734 3300006058 Bacteria 1192
282 Ga0070712_100007008 3300006175 Bacteria 7026
283 Ga0070712_100034748 3300006175 Bacteria 3418
284 Ga0070712_100271964 3300006175 Bacteria 1362
285 Ga0070712_100376492 3300006175 Unclassified 1168
286 Ga0075367_10013590 3300006178 Bacteria 4382
287 Ga0075367_10167469 3300006178 Bacteria 1368
288 Ga0075367_10217053 3300006178 Bacteria 1196
289 Ga0075369_10043313 3300006186 Bacteria 1931
290 Ga0097621_100000045 3300006237 Bacteria 65278
291 Ga0097621_100002975 3300006237 Bacteria 11634
292 Ga0097621_100426102 3300006237 Bacteria 1192
293 Ga0075370_10101318 3300006353 Bacteria 1667
294 Ga0075370_10169308 3300006353 Bacteria 1284
295 Ga0068871_100000480 3300006358 Bacteria 27307
296 Ga0068871_100000753 3300006358 Bacteria 21845
297 Ga0068871_100042364 3300006358 Bacteria 3654
298 Ga0068871_100122171 3300006358 Bacteria 2201
299 Ga0068871_100203481 3300006358 Bacteria 1710
300 Ga0075428_100000887 3300006844 Bacteria 31493
301 Ga0075428_100007369 3300006844 Bacteria 12196
302 Ga0075428_100058911 3300006844 Bacteria 4206
303 Ga0075428_100394294 3300006844 Bacteria 1484
304 Ga0075428_100531556 3300006844 Bacteria 1257
305 Ga0075430_100000163 3300006846 Bacteria 43947
306 Ga0075430_100027908 3300006846 Bacteria 4795
307 Ga0075430_100036460 3300006846 Bacteria 4170
308 Ga0075430_100073342 3300006846 Bacteria 2870
309 Ga0075430_100103514 3300006846 Bacteria 2377
310 Ga0075430_100197628 3300006846 Unclassified 1670
311 Ga0075431_100000512 3300006847 Bacteria 32460
312 Ga0075431_100055380 3300006847 Bacteria 4090
313 Ga0075431_100084954 3300006847 Bacteria 3267
314 Ga0075431_100118026 3300006847 Bacteria 2737
315 Ga0075431_100294918 3300006847 Bacteria 1639
316 Ga0075431_100347094 3300006847 Bacteria 1493
317 Ga0075433_10000500 3300006852 Bacteria 25544
318 Ga0075433_10052432 3300006852 Bacteria 3554
319 Ga0075433_10099486 3300006852 Unclassified 2574
320 Ga0075433_10170887 3300006852 Bacteria 1934
321 Ga0075434_100002917 3300006871 Bacteria 15192
322 Ga0075434_100004724 3300006871 Bacteria 12317
323 Ga0075434_100020644 3300006871 Bacteria 6394
324 Ga0075434_100022354 3300006871 Bacteria 6159
325 Ga0075434_100044275 3300006871 Bacteria 4415
326 Ga0075434_100051329 3300006871 Bacteria 4099
327 Ga0075434_100064663 3300006871 Bacteria 3642
328 Ga0075434_100108133 3300006871 Bacteria 2791
329 Ga0075434_100183092 3300006871 Bacteria 2116
330 Ga0075429_100000259 3300006880 Bacteria 36776
331 Ga0075429_100072253 3300006880 Unclassified 3004
332 Ga0075429_100077138 3300006880 Bacteria 2903
333 Ga0075429_100107786 3300006880 Bacteria 2434
334 Ga0075429_100118035 3300006880 Bacteria 2319
335 Ga0075429_100199777 3300006880 Bacteria 1752
336 Ga0068865_100000176 3300006881 Bacteria 35497
337 Ga0068865_100002150 3300006881 Bacteria 11633
338 Ga0068865_100003405 3300006881 Bacteria 9518
339 Ga0068865_100246573 3300006881 Bacteria 1408
340 Ga0075436_100002996 3300006914 Bacteria 11564
341 Ga0075436_100024257 3300006914 Bacteria 4168
342 Ga0075436_100157339 3300006914 Bacteria 1601
343 Ga0075436_100213972 3300006914 Bacteria 1367
344 Ga0075436_100253720 3300006914 Bacteria 1253
345 Ga0097620_100000195 3300006931 Bacteria 59015
346 Ga0097620_100029966 3300006931 Bacteria 5459
347 Ga0097620_100040882 3300006931 Bacteria 4657
348 Ga0097620_100082003 3300006931 Bacteria 3268
349 Ga0097620_100131546 3300006931 Bacteria 2574
350 Ga0097620_100355017 3300006931 Bacteria 1561
351 Ga0075435_100000047 3300007076 Bacteria 60782
352 Ga0075435_100012013 3300007076 Bacteria 6398
353 Ga0075435_100059356 3300007076 Bacteria 3101
354 Ga0075435_100115361 3300007076 Bacteria 2236
355 Ga0075435_100142338 3300007076 Bacteria 2012
356 Ga0075435_100166004 3300007076 Bacteria 1862
357 Ga0075435_100267527 3300007076 Bacteria 1457
358 Ga0099795_10011344 3300007788 Bacteria 2661
359 Ga0099795_10062943 3300007788 Bacteria 1381
360 Ga0105250_10046950 3300009092 Bacteria 1732
361 Ga0105250_10047027 3300009092 Bacteria 1730
362 Ga0105240_10000091 3300009093 Bacteria 182507
363 Ga0105240_10020037 3300009093 Bacteria 8929
364 Ga0105240_10171309 3300009093 Bacteria 2571
365 Ga0105240_10188892 3300009093 Bacteria 2424
366 Ga0105240_10366359 3300009093 Bacteria 1631
367 Ga0111539_10002924 3300009094 Bacteria 22647
368 Ga0111539_10005603 3300009094 Bacteria 16241
369 Ga0111539_10014188 3300009094 Bacteria 9950
370 Ga0111539_10020284 3300009094 Bacteria 8189
371 Ga0111539_10086514 3300009094 Bacteria 3683
372 Ga0111539_10111705 3300009094 Bacteria 3206
373 Ga0111539_10135670 3300009094 Bacteria 2882
374 Ga0111539_10153139 3300009094 Bacteria 2698
375 Ga0111539_10239024 3300009094 Bacteria 2114
376 Ga0111539_10359240 3300009094 Bacteria 1695
377 Ga0111539_10514241 3300009094 Bacteria 1395
378 Ga0105245_10001287 3300009098 Bacteria 22612
379 Ga0105245_10001927 3300009098 Bacteria 18856
380 Ga0105245_10003390 3300009098 Bacteria 14272
381 Ga0105245_10003760 3300009098 Bacteria 13511
382 Ga0105245_10004500 3300009098 Bacteria 12321
383 Ga0105245_10006616 3300009098 Bacteria 10179
384 Ga0105245_10026379 3300009098 Bacteria 5114
385 Ga0105245_10133493 3300009098 Bacteria 2330
386 Ga0105247_10014111 3300009101 Bacteria 4792
387 Ga0105247_10026290 3300009101 Bacteria 3513
388 Ga0105247_10030362 3300009101 Bacteria 3276
389 Ga0105247_10095960 3300009101 Bacteria 1889
390 Ga0114129_10000430 3300009147 Bacteria 49930
391 Ga0114129_10059229 3300009147 Bacteria 5355
392 Ga0114129_10085098 3300009147 Bacteria 4387
393 Ga0114129_10208552 3300009147 Bacteria 2643
394 Ga0114129_10252799 3300009147 Bacteria 2365
395 Ga0114129_10331077 3300009147 Bacteria 2022
396 Ga0114129_10742768 3300009147 Bacteria 1257
397 Ga0105243_10000035 3300009148 Bacteria 177598
398 Ga0105243_10004927 3300009148 Bacteria 10459
399 Ga0105243_10014167 3300009148 Bacteria 6033
400 Ga0105243_10047513 3300009148 Bacteria 3379
401 Ga0105243_10075012 3300009148 Bacteria 2744
402 Ga0105243_10127424 3300009148 Bacteria 2155
403 Ga0105241_10010788 3300009174 Bacteria 6702
404 Ga0105241_10168711 3300009174 Bacteria 1806
405 Ga0105241_10215363 3300009174 Bacteria 1611
406 Ga0105242_10000097 3300009176 Bacteria 61646
407 Ga0105242_10001180 3300009176 Bacteria 20574
408 Ga0105242_10010724 3300009176 Bacteria 7035
409 Ga0105242_10093773 3300009176 Bacteria 2532
410 Ga0105242_10130426 3300009176 Bacteria 2169
411 Ga0105242_10137794 3300009176 Bacteria 2114
412 Ga0105242_10180980 3300009176 Bacteria 1860
413 Ga0105248_10007763 3300009177 Bacteria 11775
414 Ga0105248_10031262 3300009177 Bacteria 5950
415 Ga0105248_10231193 3300009177 Bacteria 2082
416 Ga0105237_10043106 3300009545 Bacteria 4547
417 Ga0105237_10204385 3300009545 Bacteria 1975
418 Ga0105237_10334372 3300009545 Bacteria 1519
419 Ga0105237_10412625 3300009545 Bacteria 1355
420 Ga0105237_10466684 3300009545 Bacteria 1268
421 Ga0105238_10006976 3300009551 Bacteria 11287
422 Ga0105238_10114643 3300009551 Bacteria 2674
423 Ga0105249_10000701 3300009553 Bacteria 30399
424 Ga0105249_10012758 3300009553 Bacteria 7408
425 Ga0105249_10027235 3300009553 Bacteria 5157
426 Ga0105249_10036906 3300009553 Bacteria 4434
427 Ga0105249_10076066 3300009553 Bacteria 3111
428 Ga0105249_10274100 3300009553 Bacteria 1682
429 Ga0105239_10003323 3300010375 Bacteria 19789
430 Ga0105239_10051970 3300010375 Bacteria 4493
431 Ga0105239_10272801 3300010375 Bacteria 1903
432 Ga0105239_10277639 3300010375 Bacteria 1886
433 Ga0105246_10007885 3300011119 Bacteria 6533
434 Ga0105246_10012735 3300011119 Bacteria 5256
435 Ga0157313_1001503 3300012503 Bacteria 1269
436 Ga0157371_10023911 3300013102 Bacteria 4464
437 Ga0157370_10004062 3300013104 Bacteria 16964
438 Ga0157370_10007016 3300013104 Bacteria 12302
439 Ga0157370_10090019 3300013104 Bacteria 2881
440 Ga0157369_10081244 3300013105 Bacteria 3469
441 Ga0157369_10089047 3300013105 Bacteria 3295
442 Ga0157374_10005719 3300013296 Bacteria 10489
443 Ga0157378_10000457 3300013297 Bacteria 39013
444 Ga0157378_10044768 3300013297 Bacteria 3931
445 Ga0157378_10154035 3300013297 Bacteria 2144
446 Ga0157378_10307183 3300013297 Bacteria 1537
447 Ga0163162_10031020 3300013306 Bacteria 5299
448 Ga0163162_10617573 3300013306 Bacteria 1209
449 Ga0157372_10001454 3300013307 Bacteria 25656
450 Ga0157372_10024329 3300013307 Bacteria 6577
451 Ga0157372_10272675 3300013307 Bacteria 1966
452 Ga0157372_10506431 3300013307 Bacteria 1408
453 Ga0157372_10581451 3300013307 Bacteria 1305
454 Ga0157375_10029014 3300013308 Bacteria 5196
455 Ga0157375_10086287 3300013308 Bacteria 3189
456 Ga0157375_10389881 3300013308 Bacteria 1560
457 Ga0163163_10019181 3300014325 Bacteria 6418
458 Ga0163163_10043844 3300014325 Bacteria 4388
459 Ga0163163_10052938 3300014325 Bacteria 4006
460 Ga0163163_10070587 3300014325 Bacteria 3479
461 Ga0163163_10076151 3300014325 Bacteria 3350
462 Ga0163163_10317732 3300014325 Bacteria 1611
463 Ga0163163_10401402 3300014325 Bacteria 1429
464 Ga0157380_10004561 3300014326 Bacteria 9615
465 Ga0182008_10105232 3300014497 Bacteria 1396
466 Ga0157377_10000275 3300014745 Bacteria 24793
467 Ga0157379_10011946 3300014968 Bacteria 7587
468 Ga0157379_10016744 3300014968 Bacteria 6451
469 Ga0157379_10142997 3300014968 Bacteria 2157
470 Ga0157376_10002806 3300014969 Bacteria 11899
471 Ga0157376_10003192 3300014969 Bacteria 11271
472 Ga0157376_10055282 3300014969 Bacteria 3311
473 Ga0157376_10148474 3300014969 Unclassified 2111
474 Ga0157376_10220967 3300014969 Bacteria 1754
475 Ga0163161_10005587 3300017792 Bacteria 8717
476 Ga0206350_10982270 3300020080 Bacteria 1357
477 Ga0206353_10155976 3300020082 Bacteria 5928
478 Ga0206353_11236298 3300020082 Bacteria 1314
479 Ga0213872_10012802 3300021361 Bacteria 3939
480 Ga0213872_10043811 3300021361 Bacteria 2038
481 Ga0213874_10036466 3300021377 Bacteria 1450
482 Ga0213876_10087828 3300021384 Bacteria 1646
483 Ga0213875_10000012 3300021388 Bacteria 312017
484 Ga0213875_10042248 3300021388 Bacteria 2142
485 Ga0207666_1000035 3300025271 Bacteria 27333
486 Ga0207673_1000675 3300025290 Bacteria 3624
487 Ga0209758_1000170 3300025297 Bacteria 149476
488 Ga0209758_1000244 3300025297 Bacteria 112497
489 Ga0209758_1020537 3300025297 Bacteria 3119
490 Ga0209050_1007449 3300025298 Bacteria 6132
491 Ga0209051_1001025 3300025303 Bacteria 26597
492 Ga0209257_1007708 3300025304 Bacteria 6419
493 Ga0207653_10008179 3300025885 Bacteria 3261
494 Ga0207653_10013248 3300025885 Bacteria 2581
495 Ga0207653_10037753 3300025885 Bacteria 1576
496 Ga0207682_10000048 3300025893 Bacteria 50998
497 Ga0207682_10007593 3300025893 Bacteria 4317
498 Ga0207692_10018741 3300025898 Bacteria 3113
499 Ga0207692_10151266 3300025898 Bacteria 1329
500 Ga0207710_10001310 3300025900 Bacteria 12571
501 Ga0207710_10012529 3300025900 Bacteria 3568
502 Ga0207710_10019316 3300025900 Bacteria 2907
503 Ga0207688_10005003 3300025901 Bacteria 7208
504 Ga0207688_10009840 3300025901 Bacteria 5202
505 Ga0207685_10096156 3300025905 Bacteria 1258
506 Ga0207645_10000528 3300025907 Bacteria 31825
507 Ga0207645_10120302 3300025907 Bacteria 1704
508 Ga0207643_10001540 3300025908 Bacteria 13157
509 Ga0207643_10008414 3300025908 Bacteria 5536
510 Ga0207643_10084645 3300025908 Bacteria 1841
511 Ga0207643_10164685 3300025908 Bacteria 1335
512 Ga0207684_10071822 3300025910 Bacteria 2940
513 Ga0207684_10087049 3300025910 Bacteria 2661
514 Ga0207654_10006771 3300025911 Bacteria 5765
515 Ga0207654_10031282 3300025911 Bacteria 2930
516 Ga0207707_10000502 3300025912 Bacteria 40345
517 Ga0207707_10003748 3300025912 Bacteria 13473
518 Ga0207707_10008850 3300025912 Bacteria 8744
519 Ga0207707_10025352 3300025912 Bacteria 5187
520 Ga0207707_10123592 3300025912 Bacteria 2263
521 Ga0207707_10138327 3300025912 Bacteria 2129
522 Ga0207707_10159603 3300025912 Unclassified 1971
523 Ga0207707_10208903 3300025912 Bacteria 1701
524 Ga0207707_10356089 3300025912 Bacteria 1261
525 Ga0207695_10000018 3300025913 Bacteria 766611
526 Ga0207695_10011467 3300025913 Bacteria 10731
527 Ga0207695_10035913 3300025913 Bacteria 5365
528 Ga0207695_10145392 3300025913 Bacteria 2316
529 Ga0207695_10219068 3300025913 Bacteria 1811
530 Ga0207671_10025181 3300025914 Bacteria 4470
531 Ga0207693_10025156 3300025915 Bacteria 4722
532 Ga0207693_10025657 3300025915 Bacteria 4671
533 Ga0207693_10194414 3300025915 Bacteria 1596
534 Ga0207693_10375453 3300025915 Bacteria 1112
535 Ga0207663_10035215 3300025916 Bacteria 3001
536 Ga0207663_10091527 3300025916 Bacteria 2020
537 Ga0207663_10132433 3300025916 Bacteria 1725
538 Ga0207660_10000104 3300025917 Bacteria 47254
539 Ga0207660_10003032 3300025917 Bacteria 10989
540 Ga0207660_10005522 3300025917 Bacteria 8210
541 Ga0207660_10018534 3300025917 Bacteria 4641
542 Ga0207660_10028864 3300025917 Bacteria 3800
543 Ga0207660_10116960 3300025917 Bacteria 2014
544 Ga0207660_10137083 3300025917 Bacteria 1868
545 Ga0207660_10382345 3300025917 Bacteria 1132
546 Ga0207662_10000006 3300025918 Bacteria 105457
547 Ga0207662_10014380 3300025918 Bacteria 4440
548 Ga0207662_10043826 3300025918 Bacteria 2640
549 Ga0207657_10027894 3300025919 Bacteria 5163
550 Ga0207657_10031225 3300025919 Bacteria 4828
551 Ga0207657_10107046 3300025919 Bacteria 2313
552 Ga0207657_10113254 3300025919 Bacteria 2238
553 Ga0207657_10127058 3300025919 Bacteria 2093
554 Ga0207649_10000141 3300025920 Bacteria 60047
555 Ga0207652_10001464 3300025921 Bacteria 20891
556 Ga0207652_10003727 3300025921 Bacteria 12508
557 Ga0207652_10005867 3300025921 Bacteria 9939
558 Ga0207652_10017422 3300025921 Bacteria 5879
559 Ga0207652_10029498 3300025921 Bacteria 4588
560 Ga0207652_10100723 3300025921 Bacteria 2551
561 Ga0207652_10278081 3300025921 Bacteria 1510
562 Ga0207646_10000137 3300025922 Bacteria 99650
563 Ga0207646_10047105 3300025922 Bacteria 3867
564 Ga0207681_10000545 3300025923 Bacteria 25938
565 Ga0207681_10045462 3300025923 Bacteria 2948
566 Ga0207681_10064306 3300025923 Bacteria 2533
567 Ga0207681_10228407 3300025923 Bacteria 1443
568 Ga0207694_10000018 3300025924 Bacteria 331281
569 Ga0207694_10119190 3300025924 Bacteria 2106
570 Ga0207694_10126328 3300025924 Bacteria 2046
571 Ga0207694_10189650 3300025924 Bacteria 1669
572 Ga0207650_10134417 3300025925 Bacteria 1939
573 Ga0207659_10000052 3300025926 Bacteria 79692
574 Ga0207659_10043453 3300025926 Bacteria 3156
575 Ga0207659_10206667 3300025926 Bacteria 1571
576 Ga0207659_10264548 3300025926 Bacteria 1400
577 Ga0207687_10000097 3300025927 Bacteria 64441
578 Ga0207687_10000549 3300025927 Bacteria 25211
579 Ga0207687_10001401 3300025927 Bacteria 16462
580 Ga0207687_10001417 3300025927 Bacteria 16392
581 Ga0207687_10041696 3300025927 Bacteria 3153
582 Ga0207687_10042804 3300025927 Bacteria 3118
583 Ga0207687_10130336 3300025927 Bacteria 1894
584 Ga0207687_10139411 3300025927 Bacteria 1838
585 Ga0207664_10160927 3300025929 Bacteria 1914
586 Ga0207664_10250299 3300025929 Bacteria 1546
587 Ga0207644_10003247 3300025931 Bacteria 10488
588 Ga0207644_10109178 3300025931 Bacteria 2090
589 Ga0207644_10310944 3300025931 Bacteria 1272
590 Ga0207690_10000631 3300025932 Bacteria 22647
591 Ga0207690_10038677 3300025932 Bacteria 3107
592 Ga0207706_10003987 3300025933 Bacteria 13997
593 Ga0207706_10042439 3300025933 Bacteria 4031
594 Ga0207706_10084323 3300025933 Bacteria 2794
595 Ga0207706_10205604 3300025933 Bacteria 1726
596 Ga0207686_10001277 3300025934 Bacteria 14484
597 Ga0207686_10001329 3300025934 Bacteria 14090
598 Ga0207686_10029893 3300025934 Bacteria 3219
599 Ga0207686_10124037 3300025934 Bacteria 1763
600 Ga0207686_10172311 3300025934 Bacteria 1527
601 Ga0207709_10000349 3300025935 Bacteria 47453
602 Ga0207709_10006983 3300025935 Bacteria 6311
603 Ga0207709_10029004 3300025935 Bacteria 3204
604 Ga0207709_10049000 3300025935 Bacteria 2576
605 Ga0207709_10369114 3300025935 Bacteria 1089
606 Ga0207670_10000732 3300025936 Bacteria 17257
607 Ga0207670_10004250 3300025936 Bacteria 7685
608 Ga0207670_10020985 3300025936 Bacteria 4022
609 Ga0207670_10031128 3300025936 Bacteria 3415
610 Ga0207670_10096391 3300025936 Bacteria 2103
611 Ga0207670_10127502 3300025936 Bacteria 1859
612 Ga0207669_10000547 3300025937 Bacteria 16353
613 Ga0207669_10083246 3300025937 Bacteria 2057
614 Ga0207704_10000156 3300025938 Bacteria 36588
615 Ga0207704_10002497 3300025938 Bacteria 8290
616 Ga0207665_10012727 3300025939 Bacteria 5534
617 Ga0207665_10148214 3300025939 Bacteria 1678
618 Ga0207665_10152692 3300025939 Bacteria 1655
619 Ga0207691_10002404 3300025940 Bacteria 18324
620 Ga0207691_10004241 3300025940 Bacteria 13923
621 Ga0207711_10000454 3300025941 Bacteria 42713
622 Ga0207711_10012562 3300025941 Bacteria 7036
623 Ga0207711_10026504 3300025941 Bacteria 4865
624 Ga0207711_10071359 3300025941 Bacteria 3013
625 Ga0207689_10000082 3300025942 Bacteria 76708
626 Ga0207689_10004056 3300025942 Bacteria 13304
627 Ga0207689_10024172 3300025942 Bacteria 5097
628 Ga0207689_10298817 3300025942 Bacteria 1334
629 Ga0207661_10002308 3300025944 Bacteria 13137
630 Ga0207661_10016407 3300025944 Bacteria 5464
631 Ga0207661_10094214 3300025944 Bacteria 2501
632 Ga0207661_10131308 3300025944 Bacteria 2145
633 Ga0207661_10141285 3300025944 Bacteria 2072
634 Ga0207661_10243912 3300025944 Bacteria 1595
635 Ga0207679_10000035 3300025945 Bacteria 144173
636 Ga0207679_10046971 3300025945 Bacteria 3134
637 Ga0207679_10068594 3300025945 Bacteria 2665
638 Ga0207667_10000052 3300025949 Bacteria 232415
639 Ga0207667_10003248 3300025949 Bacteria 20059
640 Ga0207667_10005548 3300025949 Bacteria 15397
641 Ga0207667_10018000 3300025949 Bacteria 7935
642 Ga0207667_10095203 3300025949 Bacteria 3074
643 Ga0207667_10266814 3300025949 Bacteria 1750
644 Ga0207651_10000180 3300025960 Bacteria 27549
645 Ga0207651_10024699 3300025960 Bacteria 3723
646 Ga0207651_10189460 3300025960 Bacteria 1639
647 Ga0207651_10295712 3300025960 Bacteria 1344
648 Ga0207712_10000807 3300025961 Bacteria 23060
649 Ga0207712_10017911 3300025961 Bacteria 4609
650 Ga0207712_10019429 3300025961 Bacteria 4437
651 Ga0207712_10047642 3300025961 Bacteria 2977
652 Ga0207712_10072273 3300025961 Bacteria 2484
653 Ga0207712_10294061 3300025961 Bacteria 1330
654 Ga0207668_10000354 3300025972 Bacteria 29853
655 Ga0207668_10165692 3300025972 Bacteria 1727
656 Ga0207668_10280672 3300025972 Bacteria 1366
657 Ga0207640_10000543 3300025981 Bacteria 22622
658 Ga0207658_10219067 3300025986 Bacteria 1600
659 Ga0207677_10002671 3300026023 Bacteria 9394
660 Ga0207677_10005782 3300026023 Bacteria 6727
661 Ga0207677_10126770 3300026023 Bacteria 1930
662 Ga0207703_10282222 3300026035 Bacteria 1509
663 Ga0207703_10326533 3300026035 Bacteria 1406
664 Ga0207639_10001973 3300026041 Bacteria 13795
665 Ga0207678_10022900 3300026067 Bacteria 5468
666 Ga0207678_10024639 3300026067 Bacteria 5256
667 Ga0207678_10064970 3300026067 Bacteria 3134
668 Ga0207678_10101335 3300026067 Bacteria 2459
669 Ga0207678_10108209 3300026067 Bacteria 2371
670 Ga0207708_10001091 3300026075 Bacteria 20347
671 Ga0207708_10001332 3300026075 Bacteria 18579
672 Ga0207708_10043028 3300026075 Bacteria 3442
673 Ga0207708_10164029 3300026075 Bacteria 1756
674 Ga0207702_10049705 3300026078 Bacteria 3539
675 Ga0207702_10097672 3300026078 Bacteria 2585
676 Ga0207702_10220899 3300026078 Bacteria 1766
677 Ga0207641_10020028 3300026088 Bacteria 5492
678 Ga0207641_10246716 3300026088 Bacteria 1666
679 Ga0207641_10259616 3300026088 Bacteria 1626
680 Ga0207648_10000300 3300026089 Bacteria 53912
681 Ga0207648_10004737 3300026089 Bacteria 13900
682 Ga0207648_10033858 3300026089 Bacteria 4505
683 Ga0207648_10074439 3300026089 Bacteria 2959
684 Ga0207648_10102759 3300026089 Bacteria 2505
685 Ga0207676_10000540 3300026095 Bacteria 31519
686 Ga0207676_10053391 3300026095 Bacteria 3163
687 Ga0207676_10065875 3300026095 Bacteria 2886
688 Ga0207674_10021996 3300026116 Bacteria 6859
689 Ga0207674_10036663 3300026116 Bacteria 5106
690 Ga0207674_10096393 3300026116 Bacteria 2943
691 Ga0207675_100000064 3300026118 Bacteria 79279
692 Ga0207675_100003150 3300026118 Bacteria 16180
693 Ga0207675_100008197 3300026118 Bacteria 9845
694 Ga0207675_100018535 3300026118 Bacteria 6493
695 Ga0207675_100036540 3300026118 Bacteria 4582
696 Ga0207675_100142185 3300026118 Bacteria 2280
697 Ga0207675_100201253 3300026118 Bacteria 1913
698 Ga0207683_10002434 3300026121 Bacteria 16238
699 Ga0207683_10007253 3300026121 Bacteria 9501
700 Ga0207683_10025530 3300026121 Bacteria 5098
701 Ga0207683_10050165 3300026121 Bacteria 3654
702 Ga0207698_10002914 3300026142 Bacteria 10222
703 Ga0207698_10026794 3300026142 Bacteria 4082
704 Ga0207698_10054792 3300026142 Bacteria 3069
705 Ga0207698_10065880 3300026142 Bacteria 2848
706 Ga0207698_10273854 3300026142 Bacteria 1557
707 Ga0207698_10515445 3300026142 Bacteria 1166
708 Ga0209179_1019661 3300027512 Bacteria 1303
709 Ga0210002_1001376 3300027617 Bacteria 3406
710 Ga0209983_1007861 3300027665 Bacteria 2182
711 Ga0209971_1003726 3300027682 Bacteria 3606
712 Ga0209966_1004125 3300027695 Bacteria 2458
713 Ga0209813_10006291 3300027866 Bacteria 2926
714 Ga0209813_10052768 3300027866 Bacteria 1276
715 Ga0209974_10011622 3300027876 Bacteria 2955
716 Ga0209974_10038060 3300027876 Bacteria 1598
717 Ga0207428_10000428 3300027907 Bacteria 51964
718 Ga0207428_10000721 3300027907 Bacteria 38142
719 Ga0207428_10003864 3300027907 Bacteria 14363
720 Ga0207428_10004005 3300027907 Bacteria 14145
721 Ga0207428_10034166 3300027907 Bacteria 4170
722 Ga0207428_10057093 3300027907 Bacteria 3100
723 Ga0207428_10083926 3300027907 Bacteria 2483
724 Ga0265357_1000537 3300028023 Bacteria 2270
725 Ga0268266_10001196 3300028379 Bacteria 32052
726 Ga0268266_10034337 3300028379 Bacteria 4314
727 Ga0268266_10352011 3300028379 Bacteria 1384
728 Ga0268265_10002724 3300028380 Bacteria 13063
729 Ga0268265_10002875 3300028380 Bacteria 12646
730 Ga0268265_10189167 3300028380 Bacteria 1776
731 Ga0268264_10000790 3300028381 Bacteria 34440
732 Ga0268264_10039631 3300028381 Bacteria 3892
733 Ga0268264_10531519 3300028381 Bacteria 1151
734 Ga0268264_10542819 3300028381 Bacteria 1139
735 Ga0265334_10004064 3300028573 Bacteria 6566
736 Ga0265338_10000014 3300028800 Bacteria 378751
737 Ga0265338_10010493 3300028800 Bacteria 10849
738 Ga0265338_10019750 3300028800 Bacteria 7124
739 Ga0265338_10025896 3300028800 Bacteria 5932
740 Ga0265338_10045613 3300028800 Bacteria 4027
741 Ga0265338_10084537 3300028800 Bacteria 2648
742 Ga0265338_10152408 3300028800 Bacteria 1795
743 Ga0265324_10042206 3300029957 Bacteria 1577
744 Ga0265760_10009107 3300031090 Bacteria 2836
745 Ga0265760_10039350 3300031090 Bacteria 1407
746 Ga0265330_10028591 3300031235 Bacteria 2511
747 Ga0265330_10044615 3300031235 Bacteria 1957
748 Ga0265332_10013930 3300031238 Bacteria 3559
749 Ga0265332_10031843 3300031238 Bacteria 2300
750 Ga0265320_10036053 3300031240 Bacteria 2503
751 Ga0265325_10000013 3300031241 Bacteria 142935
752 Ga0265325_10001165 3300031241 Bacteria 18809
753 Ga0265325_10014548 3300031241 Bacteria 4442
754 Ga0265325_10029862 3300031241 Bacteria 2927
755 Ga0265325_10048275 3300031241 Bacteria 2201
756 Ga0265329_10004865 3300031242 Bacteria 5508
757 Ga0265329_10016138 3300031242 Bacteria 2595
758 Ga0265340_10012315 3300031247 Bacteria 4520
759 Ga0265340_10052559 3300031247 Bacteria 1970
760 Ga0265340_10058996 3300031247 Bacteria 1841
761 Ga0265339_10002695 3300031249 Bacteria 12629
762 Ga0265339_10002954 3300031249 Bacteria 12016
763 Ga0265339_10013027 3300031249 Bacteria 5054
764 Ga0265339_10039551 3300031249 Bacteria 2625
765 Ga0265331_10004749 3300031250 Bacteria 8387
766 Ga0265331_10010420 3300031250 Bacteria 5146
767 Ga0265331_10014815 3300031250 Bacteria 4137
768 Ga0265316_10026462 3300031344 Bacteria 4824
769 Ga0265316_10137922 3300031344 Bacteria 1834
770 Ga0307513_10018210 3300031456 Bacteria 8399
771 Ga0265313_10001257 3300031595 Bacteria 24112
772 Ga0265313_10005447 3300031595 Bacteria 9362
773 Ga0265313_10013163 3300031595 Bacteria 4985
774 Ga0265313_10027715 3300031595 Bacteria 2961
775 Ga0265313_10036030 3300031595 Bacteria 2486
776 Ga0265314_10001589 3300031711 Bacteria 24969
777 Ga0265314_10050087 3300031711 Bacteria 2920
778 Ga0265314_10052185 3300031711 Bacteria 2843
779 Ga0265342_10001892 3300031712 Bacteria 18842
780 Ga0265342_10012601 3300031712 Bacteria 5721
781 Ga0307516_10151342 3300031730 Bacteria 2080
782 Ga0307413_10135691 3300031824 Bacteria 1692
783 Ga0307413_10261391 3300031824 Bacteria 1291
784 Ga0307413_10345277 3300031824 Bacteria 1146
785 Ga0307410_10056114 3300031852 Bacteria 2677
786 Ga0307410_10341821 3300031852 Bacteria 1193
787 Ga0307406_10044402 3300031901 Bacteria 2785
788 Ga0307406_10243332 3300031901 Bacteria 1351
789 Ga0307407_10083325 3300031903 Bacteria 1940
790 Ga0307407_10085105 3300031903 Bacteria 1923
791 Ga0307407_10098478 3300031903 Bacteria 1809
792 Ga0307409_100077166 3300031995 Bacteria 2675
793 Ga0307409_100231204 3300031995 Bacteria 1676
794 Ga0307414_10239309 3300032004 Bacteria 1502
795 Ga0307415_100005629 3300032126 Bacteria 6669
796 Ga0307415_100020123 3300032126 Bacteria 4068
797 Ga0373930_0000010 3300034816 Bacteria 18514
798 Ga0373950_0002582 3300034818 Bacteria 2504
799 Ga0373958_0000473 3300034819 Bacteria 4939
800 Ga0373959_0001728 3300034820 Bacteria 3491
801 Ga0373959_0013484 3300034820 Bacteria 1474
802 Ga0373938_0000359 3300034957 Bacteria 7275
803 Ga0373938_0000382 3300034957 Bacteria 7102
804 Ga0373938_0000560 3300034957 Bacteria 6004
805 Ga0373926_0038599 3300035083 Bacteria 1701
806 Ga0373928_0000051 3300035084 Bacteria 20569
807 Ga0373928_0011735 3300035084 Bacteria 1739
808 Ga0373929_0001601 3300035085 Bacteria 4297
809 Ga0373940_0000473 3300035088 Bacteria 6212
810 Ga0373940_0020018 3300035088 Bacteria 1696
811 Ga0373949_0000971 3300035090 Bacteria 8901
812 Ga0373951_0006787 3300035091 Bacteria 2613
813 Ga0373952_0005036 3300035092 Bacteria 2407
814 Ga0373932_0000029 3300035112 Bacteria 39605
815 Ga0373932_0004506 3300035112 Bacteria 3290
816 Ga0373936_0002692 3300035113 Bacteria 6639
817 Ga0373936_0044697 3300035113 Bacteria 1782
818 Ga0373936_0048363 3300035113 Bacteria 1717
819 Ga0373936_0057170 3300035113 Unclassified 1586
820 Ga0373939_0001168 3300035114 Bacteria 6431
821 Ga0373939_0001351 3300035114 Bacteria 5941
822 Ga0373939_0006735 3300035114 Bacteria 2774
823 Ga0373939_0023213 3300035114 Bacteria 1717
824 Ga0373941_0006937 3300035115 Bacteria 2752
825 Ga0373941_0008310 3300035115 Bacteria 2572
826 Ga0373941_0008669 3300035115 Bacteria 2534
827 Ga0373945_0011303 3300035116 Bacteria 2952
828 Ga0373945_0039511 3300035116 Bacteria 1701
829 Ga0373953_0000827 3300035117 Bacteria 8650
830 Ga0373953_0001056 3300035117 Bacteria 7786
831 Ga0373953_0003061 3300035117 Bacteria 5134
832 Ga0373953_0070247 3300035117 Bacteria 1444
833 Ga0373953_0095190 3300035117 Unclassified 1249
834 Ga0373953_0151283 3300035117 Bacteria 995
835 Ga0373954_0014467 3300035118 Bacteria 3517
836 Ga0373954_0014997 3300035118 Bacteria 3460
837 Ga0373954_0015153 3300035118 Bacteria 3444
838 Ga0373954_0027386 3300035118 Bacteria 2616
839 Ga0373957_0003712 3300035120 Bacteria 4565
840 Ga0373957_0009241 3300035120 Bacteria 3220
841 Ga0373957_0085808 3300035120 Bacteria 1246
842 Ga0373960_0000286 3300035121 Bacteria 9632
843 Ga0373960_0000460 3300035121 Bacteria 8020
844 Ga0373943_0001351 3300035170 Bacteria 11069
845 Ga0373943_0004919 3300035170 Bacteria 6036
846 Ga0373943_0007025 3300035170 Bacteria 5049
847 Ga0373943_0008340 3300035170 Bacteria 4652
848 Ga0373943_0009175 3300035170 Bacteria 4433
849 Ga0373943_0022363 3300035170 Bacteria 2929
850 Ga0373943_0036556 3300035170 Bacteria 2352
851 Ga0373943_0038371 3300035170 Bacteria 2303
852 Ga0373943_0046601 3300035170 Bacteria 2116
853 Ga0373946_0005065 3300035171 Bacteria 4746
854 Ga0373946_0005952 3300035171 Bacteria 4420
855 Ga0373955_0000302 3300035172 Bacteria 20381
856 Ga0373955_0000550 3300035172 Bacteria 15911
857 Ga0373955_0055427 3300035172 Bacteria 2171
858 Ga0373955_0095433 3300035172 Bacteria 1701
859 Ga0373955_0158784 3300035172 Bacteria 1333
860 Ga0373942_0001638 3300035207 Bacteria 5696
861 Ga0373942_0018126 3300035207 Bacteria 1743
862 Ga0373961_0002909 3300035241 Bacteria 4340
863 Ga0373961_0012170 3300035241 Bacteria 2149
864 Ga0373961_0018596 3300035241 Bacteria 1816
865 Ga0373962_0002954 3300035242 Bacteria 4078
866 Ga0373962_0003826 3300035242 Bacteria 3616
867 Ga0373924_0010170 3300035410 Bacteria 3464
868 Ga0373924_0021173 3300035410 Bacteria 2535
869 Ga0373924_0022451 3300035410 Bacteria 2467
870 Ga0373924_0028268 3300035410 Bacteria 2234
871 Ga0373924_0037358 3300035410 Bacteria 1977
872 Ga0373931_0001234 3300035691 Bacteria 10924
873 Ga0373931_0002280 3300035691 Bacteria 8478
874 Ga0373931_0065846 3300035691 Bacteria 1964
875 Ga0373931_0109932 3300035691 Bacteria 1563
876 Ga0373935_0000053 3300035692 Bacteria 46838
877 Ga0373935_0000626 3300035692 Bacteria 18561
878 Ga0373935_0012816 3300035692 Bacteria 5050
879 Ga0373935_0038215 3300035692 Bacteria 3005
880 Ga0373927_0001416 3300035695 Bacteria 18089
881 Ga0373927_0005225 3300035695 Bacteria 8983
882 Ga0373927_0019729 3300035695 Bacteria 4420
883 Ga0373927_0050260 3300035695 Bacteria 2695
884 Ga0373927_0066100 3300035695 Bacteria 2339
885 Ga0373927_0111531 3300035695 Bacteria 1782
886 Ga0373927_0292782 3300035695 Bacteria 1071
887 Ga0373933_0000674 3300035724 Bacteria 21160
888 Ga0373933_0004463 3300035724 Bacteria 7674
889 Ga0373933_0014362 3300035724 Bacteria 4403
890 Ga0373933_0022154 3300035724 Bacteria 3615
891 Ga0373933_0119576 3300035724 Bacteria 1649
892 Ga0373947_0000828 3300035725 Bacteria 18664
893 Ga0373947_0002037 3300035725 Bacteria 12339
894 Ga0373947_0002468 3300035725 Bacteria 11128
895 Ga0373947_0006648 3300035725 Bacteria 6711
896 Ga0373947_0029938 3300035725 Bacteria 3195
897 Ga0373947_0079872 3300035725 Bacteria 2022
898 Ga0373947_0097514 3300035725 Bacteria 1842
899 Ga0373937_0000030 3300036401 Bacteria 122176
900 Ga0373937_0000597 3300036401 Bacteria 31969
901 Ga0373937_0003491 3300036401 Bacteria 13223
902 Ga0373937_0019719 3300036401 Bacteria 6039
903 Ga0373937_0088737 3300036401 Bacteria 2863
904 Ga0373937_0127022 3300036401 Bacteria 2379
905 Ga0373937_0144323 3300036401 Bacteria 2228
906 Ga0373937_0149710 3300036401 Bacteria 2186
907 Ga0373937_0212309 3300036401 Bacteria 1821
908 Ga0373937_0231436 3300036401 Bacteria 1741
909 Ga0373937_0298529 3300036401 Bacteria 1522
910 Ga0373937_0299236 3300036401 Unclassified 1520
911 Ga0373937_0378549 3300036401 Bacteria 1342
912 Ga0373925_0000002 3300037068 Bacteria 368879
913 Ga0373925_0000069 3300037068 Bacteria 108796
914 Ga0373925_0030651 3300037068 Bacteria 3948
915 Ga0373925_0040549 3300037068 Bacteria 3447
916 Ga0373925_0073492 3300037068 Bacteria 2588
917 Ga0373925_0106928 3300037068 Bacteria 2157
918 Ga0373925_0142515 3300037068 Bacteria 1877
919 Ga0373925_0154424 3300037068 Bacteria 1804
920 Ga0373925_0220852 3300037068 Bacteria 1512
921 Ga0436364_0802445 3300037853 Bacteria 29188
922 Ga0436364_0854666 3300037853 Unclassified 3079
923 Ga0436364_1245108 3300037853 Bacteria 2059
924 Ga0436364_1488005 3300037853 Bacteria 2609
925 Ga0436365_0360373 3300039437 Bacteria 3802
926 Ga0436365_1419315 3300039437 Bacteria 1669
927 Ga0436365_1648142 3300039437 Bacteria 1467
928 Ga0436360_0949519 3300039438 Bacteria 1531
929 Ga0436360_1171127 3300039438 Bacteria 3563
930 Ga0436361_0587873 3300039447 Bacteria 8225
931 Ga0436361_0925015 3300039447 Bacteria 2856
932 Ga0436363_1341155 3300039450 Bacteria 1776
933 Ga0436362_1038272 3300039453 Bacteria 1299
934 Ga0439453_0009017 3300041408 Bacteria 1617
935 Ga0451853_1016073 3300041512 Bacteria 1257
936 Ga0439455_0030746 3300042012 Bacteria 1334
937 Ga0450920_019614 3300042122 Bacteria 1299
938 Ga0439435_0001485 3300042436 Bacteria 4357
939 Ga0451577_0036724 3300042876 Bacteria 4411
940 Ga0466969_0005103 3300044656 Bacteria 6982
941 Ga0466965_0043234 3300044683 Bacteria 2224
942 Ga0466963_0011909 3300044694 Bacteria 5311
943 Ga0466963_0013805 3300044694 Bacteria 4972
944 Ga0466963_0078525 3300044694 Bacteria 2232
945 Ga0466963_0099354 3300044694 Bacteria 1990
946 Ga0466963_0151807 3300044694 Bacteria 1609
947 Ga0466963_0188751 3300044694 Bacteria 1440
948 Ga0466964_0065578 3300044706 Bacteria 1522
949 Ga0453684_0110281 3300044712 Bacteria 3345
950 Ga0466971_0095615 3300044719 Bacteria 1362
951 Ga0466970_0105336 3300044765 Bacteria 1538
952 Ga0466957_0006402 3300044842 Bacteria 6649
953 Ga0466957_0040381 3300044842 Bacteria 2818
954 Ga0466960_0002189 3300044901 Bacteria 7298
955 Ga0466960_0011892 3300044901 Bacteria 3660
956 Ga0466959_0041124 3300045049 Bacteria 3413
957 Ga0466959_0083864 3300045049 Bacteria 2294
958 Ga0451576_0030430 3300045051 Bacteria 5770
959 Ga0451576_0033888 3300045051 Bacteria 5426
960 Ga0451576_0210842 3300045051 Bacteria 2029
961 Ga0466958_0031768 3300045836 Bacteria 3138
962 Ga0466958_0190781 3300045836 Bacteria 1303
963 Ga0466967_0002394 3300045976 Bacteria 11635
964 Ga0466967_0029513 3300045976 Bacteria 4590
965 Ga0466967_0086244 3300045976 Bacteria 2844
966 Ga0466967_0157769 3300045976 Bacteria 2127
967 Ga0466967_0279107 3300045976 Bacteria 1602
968 Ga0466967_0326164 3300045976 Bacteria 1482
969 Ga0466967_0341970 3300045976 Bacteria 1447
970 Ga0466967_0415083 3300045976 Bacteria 1311
971 Ga0495592_0000046 3300046454 Bacteria 117345
972 Ga0495592_0000188 3300046454 Bacteria 54485
973 Ga0495592_0006154 3300046454 Bacteria 8923
974 Ga0495592_0019255 3300046454 Bacteria 5193
975 Ga0495592_0032536 3300046454 Bacteria 3934
976 Ga0495592_0082313 3300046454 Bacteria 2326
977 Ga0495592_0257037 3300046454 Bacteria 1152
978 Ga0495603_0016187 3300046455 Bacteria 4511
979 Ga0495603_0032275 3300046455 Bacteria 3151
980 Ga0495603_0079516 3300046455 Bacteria 1922
981 Ga0495629_0005868 3300046459 Bacteria 9154
982 Ga0495629_0038526 3300046459 Bacteria 3366
983 Ga0495629_0042647 3300046459 Bacteria 3187
984 Ga0495629_0052522 3300046459 Bacteria 2852
985 Ga0495629_0194206 3300046459 Bacteria 1404
986 Ga0495638_0025682 3300046460 Bacteria 3826
987 Ga0495641_0025340 3300046461 Bacteria 2912
988 Ga0495651_0002648 3300046462 Bacteria 13876
989 Ga0495651_0004774 3300046462 Bacteria 10373
990 Ga0495651_0004884 3300046462 Bacteria 10254
991 Ga0495651_0009517 3300046462 Bacteria 7463
992 Ga0495651_0015269 3300046462 Bacteria 5937
993 Ga0495651_0077320 3300046462 Bacteria 2519
994 Ga0495651_0114436 3300046462 Bacteria 1990
995 Ga0495653_0000006 3300046463 Bacteria 363285
996 Ga0495653_0000198 3300046463 Bacteria 49009
997 Ga0495653_0032923 3300046463 Bacteria 4111
998 Ga0495653_0098076 3300046463 Bacteria 2128
999 Ga0495650_0018768 3300046471 Bacteria 3428
1000 Ga0495580_0015113 3300046472 Bacteria 5841
1001 Ga0495580_0035505 3300046472 Bacteria 3585
1002 Ga0495580_0042603 3300046472 Bacteria 3233
1003 Ga0495580_0133640 3300046472 Bacteria 1720
1004 Ga0495582_0066941 3300046473 Unclassified 1984
1005 Ga0495582_0095460 3300046473 Bacteria 1661
1006 Ga0495582_0145791 3300046473 Bacteria 1343
1007 Ga0495639_0005510 3300046475 Bacteria 5449
1008 Ga0495639_0085464 3300046475 Unclassified 1474
1009 Ga0495662_0000442 3300046476 Bacteria 18626
1010 Ga0495662_0002321 3300046476 Bacteria 9592
1011 Ga0495662_0002559 3300046476 Bacteria 9184
1012 Ga0495662_0037664 3300046476 Bacteria 2336
1013 Ga0495662_0045724 3300046476 Bacteria 2113
1014 Ga0495664_0000002 3300046477 Bacteria 625183
1015 Ga0495664_0000292 3300046477 Bacteria 23928
1016 Ga0495664_0007103 3300046477 Bacteria 6205
1017 Ga0495664_0093085 3300046477 Bacteria 1813
1018 Ga0495664_0114731 3300046477 Bacteria 1627
1019 Ga0495584_0012274 3300046491 Unclassified 4375
1020 Ga0495584_0061122 3300046491 Bacteria 1894
1021 Ga0495594_0062434 3300046499 Bacteria 2063
1022 Ga0495594_0064841 3300046499 Bacteria 2025
1023 Ga0495594_0078170 3300046499 Bacteria 1846
1024 Ga0495607_0011493 3300046501 Bacteria 5891
1025 Ga0495606_0000235 3300046507 Bacteria 98069
1026 Ga0495608_0000006 3300046511 Bacteria 324334
1027 Ga0495608_0000009 3300046511 Bacteria 266614
1028 Ga0495608_0038217 3300046511 Bacteria 3224
1029 Ga0495608_0048409 3300046511 Bacteria 2825
1030 Ga0495608_0179704 3300046511 Bacteria 1339
1031 Ga0495618_0000005 3300046514 Bacteria 230421
1032 Ga0495618_0000282 3300046514 Bacteria 36848
1033 Ga0495618_0002551 3300046514 Bacteria 11665
1034 Ga0495618_0003926 3300046514 Bacteria 9176
1035 Ga0495618_0020118 3300046514 Bacteria 4109
1036 Ga0495618_0023173 3300046514 Bacteria 3837
1037 Ga0495618_0025585 3300046514 Bacteria 3663
1038 Ga0495618_0171452 3300046514 Bacteria 1381
1039 Ga0495628_0000002 3300046516 Bacteria 589399
1040 Ga0495628_0021637 3300046516 Bacteria 5287
1041 Ga0495628_0070394 3300046516 Bacteria 2727
1042 Ga0495630_0002442 3300046517 Bacteria 12855
1043 Ga0495630_0002475 3300046517 Bacteria 12805
1044 Ga0495630_0004276 3300046517 Bacteria 10016
1045 Ga0495630_0055096 3300046517 Bacteria 2979
1046 Ga0495630_0057839 3300046517 Bacteria 2906
1047 Ga0495630_0073754 3300046517 Bacteria 2570
1048 Ga0495630_0144950 3300046517 Bacteria 1806
1049 Ga0495630_0162095 3300046517 Bacteria 1703
1050 Ga0495630_0205726 3300046517 Bacteria 1502
1051 Ga0495630_0327618 3300046517 Bacteria 1171
1052 Ga0495637_0055657 3300046520 Bacteria 1640
1053 Ga0495643_0214084 3300046522 Bacteria 918
1054 Ga0495644_0003568 3300046523 Bacteria 6144
1055 Ga0495644_0044248 3300046523 Bacteria 1675
1056 Ga0495666_0030836 3300046526 Bacteria 2629
1057 Ga0495666_0083921 3300046526 Bacteria 1505
1058 Ga0495652_0000004 3300046529 Bacteria 588877
1059 Ga0495652_0023812 3300046529 Bacteria 5425
1060 Ga0495652_0026042 3300046529 Bacteria 5169
1061 Ga0495652_0028177 3300046529 Bacteria 4946
1062 Ga0495652_0029237 3300046529 Bacteria 4842
1063 Ga0495652_0035851 3300046529 Bacteria 4316
1064 Ga0495652_0054075 3300046529 Bacteria 3420
1065 Ga0495652_0131851 3300046529 Bacteria 1977
1066 Ga0495652_0145726 3300046529 Bacteria 1856
1067 Ga0495665_0008886 3300046531 Bacteria 5450
1068 Ga0495665_0011193 3300046531 Bacteria 4857
1069 Ga0495665_0024369 3300046531 Bacteria 3250
1070 Ga0495665_0039097 3300046531 Bacteria 2528
1071 Ga0495640_0000005 3300046533 Bacteria 318271
1072 Ga0495640_0000007 3300046533 Bacteria 265481
1073 Ga0495640_0002721 3300046533 Bacteria 14211
1074 Ga0495640_0011879 3300046533 Bacteria 6677
1075 Ga0495640_0023762 3300046533 Bacteria 4460
1076 Ga0495640_0048972 3300046533 Bacteria 2916
1077 Ga0495640_0051947 3300046533 Bacteria 2815
1078 Ga0495640_0143295 3300046533 Bacteria 1539
1079 Ga0495586_0018105 3300046535 Bacteria 3747
1080 Ga0495586_0035602 3300046535 Bacteria 2675
1081 Ga0495586_0066723 3300046535 Bacteria 1962
1082 Ga0495587_0000007 3300046536 Bacteria 290788
1083 Ga0495587_0000031 3300046536 Bacteria 126721
1084 Ga0495587_0003732 3300046536 Bacteria 10104
1085 Ga0495587_0028606 3300046536 Bacteria 3388
1086 Ga0495587_0030822 3300046536 Bacteria 3251
1087 Ga0495587_0066006 3300046536 Bacteria 2112
1088 Ga0495587_0233739 3300046536 Bacteria 1036
1089 Ga0495621_0009048 3300046539 Bacteria 3008
1090 Ga0495645_0000003 3300046543 Bacteria 570133
1091 Ga0495645_0008661 3300046543 Bacteria 7105
1092 Ga0495645_0058355 3300046543 Bacteria 2800
1093 Ga0495645_0092021 3300046543 Bacteria 2166
1094 Ga0495622_0001438 3300046557 Bacteria 12019
1095 Ga0495622_0012565 3300046557 Bacteria 3923
1096 Ga0495633_0002841 3300046558 Bacteria 11923
1097 Ga0495667_0000002 3300046559 Bacteria 437535
1098 Ga0495667_0003122 3300046559 Bacteria 11114
1099 Ga0495667_0005910 3300046559 Bacteria 8281
1100 Ga0495667_0062649 3300046559 Bacteria 2436
1101 Ga0495656_0002668 3300046615 Bacteria 5954
1102 Ga0495668_0005202 3300046616 Bacteria 8927
1103 Ga0495634_0000110 3300046642 Bacteria 68101
1104 Ga0495634_0001824 3300046642 Bacteria 18403
1105 Ga0495634_0010842 3300046642 Bacteria 6663
1106 Ga0495634_0018741 3300046642 Bacteria 4923
1107 Ga0495634_0019508 3300046642 Bacteria 4816
1108 Ga0495634_0047464 3300046642 Bacteria 2893
1109 Ga0495634_0168093 3300046642 Unclassified 1379
1110 Ga0495625_0004506 3300046660 Bacteria 13141
1111 Ga0495635_0000022 3300046663 Bacteria 160907
1112 Ga0495635_0000289 3300046663 Bacteria 32189
1113 Ga0495635_0000545 3300046663 Bacteria 23993
1114 Ga0495635_0008146 3300046663 Bacteria 7321
1115 Ga0495635_0018363 3300046663 Bacteria 4880
1116 Ga0495635_0090052 3300046663 Bacteria 2099
1117 Ga0495635_0240248 3300046663 Unclassified 1222
1118 Ga0495659_0008016 3300046664 Bacteria 3352
1119 Ga0495661_0137361 3300046665 Unclassified 1333
1120 Ga0495588_0027486 3300046674 Bacteria 2843
1121 Ga0495588_0080788 3300046674 Bacteria 1697
1122 Ga0495588_0101591 3300046674 Bacteria 1511
1123 Ga0495588_0110873 3300046674 Bacteria 1445
1124 Ga0495657_0000276 3300046675 Bacteria 46295
1125 Ga0495657_0000781 3300046675 Bacteria 28299
1126 Ga0495657_0003468 3300046675 Bacteria 12862
1127 Ga0495657_0004587 3300046675 Bacteria 11026
1128 Ga0495657_0013572 3300046675 Bacteria 6006
1129 Ga0495657_0073241 3300046675 Bacteria 2232
1130 Ga0495657_0116582 3300046675 Unclassified 1686
1131 Ga0495599_0000001 3300046678 Bacteria 537563
1132 Ga0495599_0000241 3300046678 Bacteria 34529
1133 Ga0495599_0002704 3300046678 Bacteria 10353
1134 Ga0495599_0024646 3300046678 Bacteria 3762
1135 Ga0495599_0085890 3300046678 Bacteria 1965
1136 Ga0495623_0000094 3300046679 Bacteria 53328
1137 Ga0495623_0008537 3300046679 Bacteria 6654
1138 Ga0495623_0010464 3300046679 Bacteria 6005
1139 Ga0495646_0000007 3300046680 Bacteria 236764
1140 Ga0495646_0000025 3300046680 Bacteria 106144
1141 Ga0495646_0006972 3300046680 Bacteria 7175
1142 Ga0495646_0028980 3300046680 Bacteria 3463
1143 Ga0495647_0001586 3300046681 Bacteria 7024
1144 Ga0495647_0004252 3300046681 Bacteria 4637
1145 Ga0495647_0017104 3300046681 Bacteria 2561
1146 Ga0495658_0011495 3300046683 Bacteria 4454
1147 Ga0495658_0020633 3300046683 Bacteria 3461
1148 Ga0495658_0058036 3300046683 Bacteria 2213
1149 Ga0495658_0138285 3300046683 Bacteria 1488
1150 Ga0495669_0063128 3300046684 Bacteria 1680
1151 Ga0495613_0013528 3300046689 Bacteria 6058
1152 Ga0495613_0076804 3300046689 Bacteria 2430
1153 Ga0495613_0136543 3300046689 Bacteria 1754
1154 Ga0495624_0002983 3300046690 Bacteria 12660
1155 Ga0495624_0021000 3300046690 Bacteria 4335
1156 Ga0495624_0051240 3300046690 Bacteria 2613
1157 Ga0495624_0053649 3300046690 Bacteria 2544
1158 Ga0495624_0070243 3300046690 Bacteria 2180
1159 Ga0495670_0001519 3300046691 Bacteria 11328
1160 Ga0495589_0037919 3300046794 Bacteria 2414
1161 Ga0495600_0000033 3300046809 Bacteria 83590
1162 Ga0495600_0001041 3300046809 Bacteria 15003
1163 Ga0495600_0003534 3300046809 Bacteria 9197
1164 Ga0495600_0036195 3300046809 Bacteria 3207
1165 Ga0495581_0005463 3300047315 Bacteria 7354
1166 Ga0495581_0014639 3300047315 Bacteria 4548
1167 Ga0495581_0032717 3300047315 Bacteria 3011
1168 Ga0495604_0000005 3300047317 Bacteria 424516
1169 Ga0495604_0001595 3300047317 Bacteria 18675
1170 Ga0495604_0003208 3300047317 Bacteria 13065
1171 Ga0495604_0007187 3300047317 Bacteria 8821
1172 Ga0495604_0062814 3300047317 Bacteria 2835
1173 Ga0495604_0112733 3300047317 Bacteria 1981
1174 Ga0495604_0221676 3300047317 Bacteria 1302
1175 Ga0495674_0000003 3300047319 Bacteria 562126
1176 Ga0495674_0000996 3300047319 Bacteria 27247
1177 Ga0495674_0006865 3300047319 Bacteria 10893
1178 Ga0495674_0025703 3300047319 Bacteria 5393
1179 Ga0495674_0035370 3300047319 Bacteria 4507
1180 Ga0495674_0076929 3300047319 Bacteria 2870
1181 Ga0495674_0078508 3300047319 Bacteria 2836
1182 Ga0495674_0081250 3300047319 Bacteria 2780
1183 Ga0495674_0216934 3300047319 Bacteria 1583
1184 Ga0495674_0331247 3300047319 Bacteria 1239
1185 Ga0495676_0088280 3300047321 Bacteria 2326
1186 Ga0495676_0095089 3300047321 Bacteria 2218
1187 Ga0495680_0000091 3300047322 Bacteria 81622
1188 Ga0495680_0002558 3300047322 Bacteria 18561
1189 Ga0495680_0012986 3300047322 Bacteria 7291
1190 Ga0495680_0082397 3300047322 Bacteria 2428
1191 Ga0495680_0083274 3300047322 Bacteria 2412
1192 Ga0495675_0000064 3300047444 Bacteria 74132
1193 Ga0495675_0001624 3300047444 Bacteria 13521
1194 Ga0495675_0022611 3300047444 Bacteria 4009
1195 Ga0495675_0028598 3300047444 Bacteria 3554
1196 Ga0495675_0077361 3300047444 Bacteria 2096
1197 Ga0495675_0123113 3300047444 Bacteria 1614
1198 Ga0495685_022451 3300047447 Bacteria 2172
1199 Ga0495684_0000035 3300047471 Bacteria 107768
1200 Ga0495684_0000405 3300047471 Bacteria 35298
1201 Ga0495684_0017721 3300047471 Bacteria 5484
1202 Ga0495684_0018466 3300047471 Bacteria 5373
1203 Ga0495684_0026809 3300047471 Bacteria 4428
1204 Ga0495684_0147037 3300047471 Bacteria 1764
1205 Ga0495684_0172454 3300047471 Bacteria 1608
1206 Ga0495686_0000741 3300047472 Bacteria 43528
1207 Ga0495593_0000184 3300047673 Bacteria 32427
1208 Ga0495593_0003150 3300047673 Bacteria 9905
1209 Ga0495602_0000027 3300048088 Bacteria 145010
1210 Ga0495602_0000029 3300048088 Bacteria 142344
1211 Ga0495602_0012633 3300048088 Bacteria 8662
1212 Ga0495602_0025265 3300048088 Bacteria 5750
1213 Ga0495602_0130000 3300048088 Bacteria 2010
1214 Ga0495602_0165725 3300048088 Bacteria 1720
1215 Ga0495602_0301828 3300048088 Bacteria 1171
1216 Ga0495614_0014077 3300048089 Bacteria 3507
1217 Ga0496100_0010368 3300048903 Bacteria 5272
1218 Ga0496100_0031225 3300048903 Bacteria 3310
1219 Ga0496100_0124859 3300048903 Bacteria 1805
1220 Ga0496101_0000218 3300048904 Bacteria 42932
1221 Ga0496101_0002910 3300048904 Bacteria 10536
1222 Ga0496101_0025198 3300048904 Bacteria 4124
1223 Ga0496101_0083446 3300048904 Bacteria 2365
1224 Ga0496101_0227704 3300048904 Bacteria 1448
1225 Ga0496102_0013854 3300048905 Bacteria 6997
1226 Ga0496102_0044546 3300048905 Bacteria 4027
1227 Ga0496102_0058487 3300048905 Bacteria 3523
1228 Ga0496102_0104350 3300048905 Bacteria 2636
1229 Ga0496102_0275635 3300048905 Bacteria 1585
1230 Ga0496102_0282620 3300048905 Bacteria 1564
1231 Ga0496103_0005048 3300048906 Bacteria 7961
1232 Ga0496103_0020228 3300048906 Bacteria 3998
1233 Ga0496103_0043028 3300048906 Bacteria 2780
1234 Ga0496104_0000079 3300048907 Bacteria 98874
1235 Ga0496104_0007271 3300048907 Bacteria 9771
1236 Ga0496104_0012241 3300048907 Bacteria 7711
1237 Ga0496105_0000225 3300048908 Bacteria 38002
1238 Ga0496105_0002363 3300048908 Bacteria 13671
1239 Ga0496105_0004861 3300048908 Bacteria 10144
1240 Ga0496105_0022493 3300048908 Bacteria 5106
1241 Ga0496105_0026740 3300048908 Bacteria 4710
1242 Ga0496105_0031651 3300048908 Bacteria 4337
1243 Ga0496105_0058639 3300048908 Bacteria 3177
1244 Ga0496105_0270530 3300048908 Bacteria 1372
1245 Ga0496106_0004035 3300048909 Bacteria 10966
1246 Ga0496106_0004371 3300048909 Bacteria 10498
1247 Ga0496106_0013164 3300048909 Bacteria 6104
1248 Ga0496106_0017965 3300048909 Bacteria 5231
1249 Ga0496106_0082901 3300048909 Bacteria 2465
1250 Ga0496106_0087444 3300048909 Bacteria 2401
1251 Ga0496107_0003226 3300048910 Bacteria 10857
1252 Ga0496107_0005134 3300048910 Bacteria 8932
1253 Ga0496107_0065792 3300048910 Bacteria 2628
1254 Ga0496108_0002378 3300048911 Bacteria 15052
1255 Ga0496108_0009724 3300048911 Bacteria 7795
1256 Ga0496108_0013499 3300048911 Bacteria 6665
1257 Ga0496108_0033422 3300048911 Bacteria 4273
1258 Ga0496108_0047716 3300048911 Bacteria 3580
1259 Ga0496108_0114586 3300048911 Bacteria 2308
1260 Ga0496108_0190531 3300048911 Bacteria 1777
1261 Ga0496109_0000431 3300048912 Bacteria 36569
1262 Ga0496109_0000979 3300048912 Bacteria 23633
1263 Ga0496109_0006256 3300048912 Bacteria 10013
1264 Ga0496109_0034098 3300048912 Bacteria 4582
1265 Ga0496109_0080820 3300048912 Bacteria 2995
1266 Ga0496109_0099924 3300048912 Bacteria 2691
1267 Ga0496109_0100135 3300048912 Bacteria 2688
1268 Ga0496109_0307911 3300048912 Bacteria 1494
1269 Ga0496110_0000404 3300048913 Bacteria 29292
1270 Ga0496110_0003688 3300048913 Bacteria 11788
1271 Ga0496110_0005542 3300048913 Bacteria 9910
1272 Ga0496110_0012010 3300048913 Bacteria 7115
1273 Ga0496110_0019330 3300048913 Bacteria 5730
1274 Ga0496110_0033215 3300048913 Bacteria 4461
1275 Ga0496110_0063037 3300048913 Bacteria 3275
1276 Ga0496110_0069683 3300048913 Bacteria 3115
1277 Ga0496110_0123647 3300048913 Bacteria 2333
1278 Ga0496110_0150105 3300048913 Bacteria 2110
1279 Ga0496110_0175997 3300048913 Bacteria 1942
1280 Ga0496110_0200105 3300048913 Bacteria 1815
1281 Ga0496110_0377474 3300048913 Bacteria 1292
1282 Ga0496111_0001811 3300048914 Bacteria 12555
1283 Ga0496111_0018492 3300048914 Bacteria 4829
1284 Ga0496111_0028971 3300048914 Bacteria 3928
1285 Ga0496111_0044048 3300048914 Bacteria 3208
1286 Ga0496111_0086679 3300048914 Bacteria 2291
1287 Ga0496111_0131576 3300048914 Bacteria 1851
1288 Ga0496111_0144696 3300048914 Bacteria 1762
1289 Ga0496112_0037614 3300048915 Bacteria 4723
1290 Ga0496112_0066533 3300048915 Bacteria 3556
1291 Ga0496112_0072980 3300048915 Bacteria 3393
1292 Ga0496112_0129803 3300048915 Bacteria 2491
1293 Ga0496112_0301700 3300048915 Bacteria 1547
1294 Ga0496113_0036794 3300048916 Bacteria 3588
1295 Ga0496113_0050969 3300048916 Bacteria 3088
1296 Ga0496113_0060630 3300048916 Bacteria 2853
1297 Ga0496113_0191055 3300048916 Bacteria 1625
1298 Ga0496113_0238978 3300048916 Bacteria 1449
1299 Ga0496114_0000984 3300048917 Bacteria 21329
1300 Ga0496114_0005533 3300048917 Bacteria 9897
1301 Ga0496114_0019273 3300048917 Bacteria 5527
1302 Ga0496114_0041936 3300048917 Bacteria 3792
1303 Ga0496114_0079080 3300048917 Bacteria 2775
1304 Ga0496114_0237038 3300048917 Bacteria 1604
1305 Ga0496115_0008122 3300048918 Bacteria 7756
1306 Ga0496115_0016833 3300048918 Bacteria 5574
1307 Ga0496115_0024668 3300048918 Bacteria 4677
1308 Ga0496115_0024867 3300048918 Bacteria 4658
1309 Ga0496115_0028299 3300048918 Bacteria 4391
1310 Ga0496115_0029345 3300048918 Bacteria 4319
1311 Ga0496115_0144524 3300048918 Bacteria 1963
1312 Ga0496121_0109319 3300048924 Bacteria 2113
1313 Ga0496121_0223572 3300048924 Bacteria 1324
1314 Ga0496124_0000007 3300048927 Bacteria 883534
1315 Ga0496126_0166664 3300048929 Bacteria 1879
1316 Ga0501031_0020750 3300049568 Bacteria 4283
1317 Ga0501031_0070670 3300049568 Bacteria 2274
1318 Ga0501031_0085848 3300049568 Bacteria 2052
1319 Ga0501032_0015061 3300049569 Bacteria 5462
1320 Ga0501032_0016234 3300049569 Bacteria 5238
1321 Ga0501032_0038717 3300049569 Bacteria 3245
1322 Ga0501032_0072812 3300049569 Bacteria 2289
1323 Ga0501033_0027706 3300049570 Bacteria 4260
1324 Ga0501033_0066643 3300049570 Bacteria 2647
1325 Ga0501033_0216233 3300049570 Bacteria 1365
1326 Ga0501034_0001160 3300049571 Bacteria 36511
1327 Ga0501034_0005371 3300049571 Bacteria 14024
1328 Ga0501034_0008354 3300049571 Bacteria 10949
1329 Ga0501034_0025323 3300049571 Bacteria 6040
1330 Ga0501034_0028499 3300049571 Bacteria 5683
1331 Ga0501034_0041843 3300049571 Bacteria 4636
1332 Ga0501034_0044598 3300049571 Bacteria 4483
1333 Ga0501034_0127525 3300049571 Bacteria 2529
1334 Ga0501034_0143035 3300049571 Bacteria 2370
1335 Ga0501036_0003666 3300049572 Bacteria 12287
1336 Ga0501036_0009460 3300049572 Bacteria 8017
1337 Ga0501036_0011640 3300049572 Bacteria 7293
1338 Ga0501036_0052138 3300049572 Bacteria 3464
1339 Ga0501036_0074633 3300049572 Bacteria 2868
1340 Ga0501036_0101514 3300049572 Bacteria 2434
1341 Ga0501036_0102565 3300049572 Bacteria 2420
1342 Ga0501036_0198365 3300049572 Bacteria 1688
1343 Ga0501037_0012447 3300049573 Bacteria 6267
1344 Ga0501037_0015609 3300049573 Bacteria 5589
1345 Ga0501037_0033088 3300049573 Bacteria 3819
1346 Ga0501037_0059131 3300049573 Bacteria 2796
1347 Ga0501038_0003531 3300049574 Bacteria 14553
1348 Ga0501038_0014002 3300049574 Bacteria 7310
1349 Ga0501038_0109396 3300049574 Bacteria 2290
1350 Ga0501038_0172003 3300049574 Bacteria 1753
1351 Ga0501038_0204301 3300049574 Bacteria 1584
1352 Ga0501038_0265642 3300049574 Bacteria 1354
1353 Ga0501039_0007290 3300049575 Bacteria 8424
1354 Ga0501039_0016919 3300049575 Bacteria 5589
1355 Ga0501039_0020033 3300049575 Bacteria 5127
1356 Ga0501039_0035193 3300049575 Bacteria 3864
1357 Ga0501039_0038161 3300049575 Bacteria 3711
1358 Ga0501039_0047643 3300049575 Bacteria 3313
1359 Ga0501039_0058789 3300049575 Bacteria 2978
1360 Ga0501039_0341802 3300049575 Bacteria 1176
1361 Ga0501040_0032965 3300049576 Bacteria 3507
1362 Ga0501040_0075300 3300049576 Bacteria 2333
1363 Ga0501040_0121335 3300049576 Bacteria 1834
1364 Ga0501041_0005970 3300049577 Bacteria 7124
1365 Ga0501041_0013474 3300049577 Bacteria 4848
1366 Ga0501041_0018919 3300049577 Bacteria 4104
1367 Ga0501041_0055164 3300049577 Bacteria 2425
1368 Ga0501041_0067768 3300049577 Bacteria 2188
1369 Ga0501042_0009911 3300049578 Bacteria 6366
1370 Ga0501042_0010513 3300049578 Bacteria 6210
1371 Ga0501042_0055099 3300049578 Bacteria 2837
1372 Ga0501042_0057961 3300049578 Bacteria 2764
1373 Ga0501042_0080813 3300049578 Bacteria 2329
1374 Ga0501042_0134393 3300049578 Bacteria 1783
1375 Ga0501042_0173542 3300049578 Bacteria 1555
1376 Ga0501043_0002821 3300049579 Bacteria 14532
1377 Ga0501043_0004264 3300049579 Bacteria 11645
1378 Ga0501043_0092288 3300049579 Bacteria 2380
1379 Ga0501043_0120354 3300049579 Bacteria 2058
1380 Ga0501043_0186081 3300049579 Bacteria 1617
1381 Ga0501046_0002832 3300049580 Bacteria 16136
1382 Ga0501046_0015650 3300049580 Bacteria 6369
1383 Ga0501046_0034079 3300049580 Bacteria 4111
1384 Ga0501046_0085141 3300049580 Bacteria 2437
1385 Ga0501047_0001508 3300049581 Bacteria 22710
1386 Ga0501047_0003796 3300049581 Bacteria 14208
1387 Ga0501047_0008653 3300049581 Bacteria 9614
1388 Ga0501047_0048749 3300049581 Bacteria 4090
1389 Ga0501047_0081802 3300049581 Bacteria 3104
1390 Ga0501047_0107822 3300049581 Bacteria 2667
1391 Ga0501047_0153318 3300049581 Bacteria 2179
1392 Ga0501047_0293002 3300049581 Unclassified 1471
1393 Ga0501047_0331077 3300049581 Bacteria 1361
1394 Ga0501048_0000151 3300049582 Bacteria 42561
1395 Ga0501048_0004933 3300049582 Bacteria 10178
1396 Ga0501048_0016788 3300049582 Bacteria 5396
1397 Ga0501048_0035256 3300049582 Bacteria 3602
1398 Ga0501048_0106815 3300049582 Bacteria 1976
1399 Ga0501048_0124371 3300049582 Bacteria 1823
1400 Ga0501048_0191809 3300049582 Bacteria 1448
1401 Ga0501048_0202461 3300049582 Bacteria 1407
1402 Ga0501048_0205115 3300049582 Bacteria 1398
1403 Ga0501067_0000397 3300049583 Bacteria 23743
1404 Ga0501067_0001165 3300049583 Bacteria 14278
1405 Ga0501067_0001753 3300049583 Bacteria 11933
1406 Ga0501067_0026107 3300049583 Bacteria 3237
1407 Ga0501067_0072465 3300049583 Bacteria 1908
1408 Ga0501068_0011361 3300049584 Bacteria 5025
1409 Ga0501068_0111094 3300049584 Bacteria 1704
1410 Ga0501068_0155246 3300049584 Bacteria 1440
1411 Ga0501068_0156172 3300049584 Bacteria 1436
1412 Ga0501069_0018766 3300049585 Bacteria 3735
1413 Ga0501069_0026965 3300049585 Bacteria 3147
1414 Ga0501069_0039611 3300049585 Bacteria 2604
1415 Ga0501069_0068643 3300049585 Bacteria 1984
1416 Ga0501070_0006477 3300049586 Bacteria 9967
1417 Ga0501070_0014067 3300049586 Bacteria 6737
1418 Ga0501070_0017302 3300049586 Bacteria 6053
1419 Ga0501070_0051290 3300049586 Bacteria 3425
1420 Ga0501070_0052874 3300049586 Bacteria 3370
1421 Ga0501070_0079554 3300049586 Bacteria 2712
1422 Ga0501070_0086715 3300049586 Bacteria 2591
1423 Ga0501070_0113346 3300049586 Bacteria 2241
1424 Ga0501070_0122600 3300049586 Bacteria 2148
1425 Ga0501070_0147075 3300049586 Bacteria 1945
1426 Ga0501070_0262090 3300049586 Unclassified 1413
1427 Ga0501071_0006146 3300049587 Bacteria 7780
1428 Ga0501071_0010823 3300049587 Bacteria 6119
1429 Ga0501071_0016580 3300049587 Bacteria 5068
1430 Ga0501071_0031661 3300049587 Bacteria 3751
1431 Ga0501071_0087628 3300049587 Bacteria 2284
1432 Ga0501071_0105785 3300049587 Bacteria 2077
1433 Ga0501071_0114554 3300049587 Bacteria 1994
1434 Ga0501071_0139416 3300049587 Bacteria 1805
1435 Ga0501071_0182725 3300049587 Bacteria 1571
1436 Ga0501071_0204364 3300049587 Bacteria 1484
1437 Ga0501072_0007105 3300049588 Bacteria 8497
1438 Ga0501072_0010510 3300049588 Bacteria 7047
1439 Ga0501072_0018525 3300049588 Bacteria 5364
1440 Ga0501072_0022482 3300049588 Bacteria 4892
1441 Ga0501072_0032318 3300049588 Bacteria 4098
1442 Ga0501072_0035535 3300049588 Bacteria 3903
1443 Ga0501072_0035808 3300049588 Bacteria 3889
1444 Ga0501072_0051585 3300049588 Bacteria 3239
1445 Ga0501072_0055631 3300049588 Bacteria 3118
1446 Ga0501072_0161565 3300049588 Bacteria 1787
1447 Ga0501072_0219358 3300049588 Bacteria 1516
1448 Ga0501073_0001397 3300049589 Bacteria 17807
1449 Ga0501073_0004253 3300049589 Bacteria 10736
1450 Ga0501073_0005109 3300049589 Bacteria 9842
1451 Ga0501073_0005419 3300049589 Bacteria 9555
1452 Ga0501073_0039837 3300049589 Bacteria 3328
1453 Ga0501073_0065821 3300049589 Bacteria 2526
1454 Ga0501073_0178092 3300049589 Bacteria 1471
1455 Ga0501074_0001516 3300049590 Bacteria 15686
1456 Ga0501074_0003476 3300049590 Bacteria 11182
1457 Ga0501074_0018041 3300049590 Bacteria 5126
1458 Ga0501074_0026879 3300049590 Bacteria 4171
1459 Ga0501074_0042415 3300049590 Bacteria 3292
1460 Ga0501074_0051109 3300049590 Bacteria 2983
1461 Ga0501074_0083226 3300049590 Bacteria 2294
1462 Ga0501074_0106364 3300049590 Bacteria 2008
1463 Ga0501074_0156722 3300049590 Bacteria 1626
1464 Ga0501074_0183225 3300049590 Bacteria 1493
1465 Ga0501075_0001865 3300049591 Bacteria 13895
1466 Ga0501075_0010178 3300049591 Bacteria 6602
1467 Ga0501075_0051007 3300049591 Bacteria 3111
1468 Ga0501075_0103506 3300049591 Bacteria 2163
1469 Ga0501076_0011334 3300049592 Bacteria 6638
1470 Ga0501076_0024149 3300049592 Bacteria 4695
1471 Ga0501076_0025859 3300049592 Bacteria 4544
1472 Ga0501076_0027671 3300049592 Bacteria 4397
1473 Ga0501076_0036253 3300049592 Bacteria 3863
1474 Ga0501076_0050972 3300049592 Bacteria 3275
1475 Ga0501076_0113793 3300049592 Bacteria 2189
1476 Ga0501076_0129312 3300049592 Bacteria 2048
1477 Ga0501076_0192682 3300049592 Bacteria 1664
1478 Ga0501076_0359728 3300049592 Bacteria 1196
1479 Ga0501077_0005310 3300049593 Bacteria 7831
1480 Ga0501077_0022082 3300049593 Bacteria 4030
1481 Ga0501077_0032564 3300049593 Bacteria 3318
1482 Ga0501077_0122637 3300049593 Bacteria 1647
1483 Ga0501079_0000619 3300049741 Bacteria 23573
1484 Ga0501079_0011070 3300049741 Bacteria 6879
1485 Ga0501079_0014520 3300049741 Bacteria 6007
1486 Ga0501079_0023851 3300049741 Bacteria 4694
1487 Ga0501079_0058080 3300049741 Bacteria 2985
1488 Ga0501079_0083003 3300049741 Bacteria 2479
1489 Ga0501079_0093255 3300049741 Bacteria 2333
1490 Ga0501079_0188325 3300049741 Bacteria 1610
1491 Ga0501080_0000130 3300049742 Bacteria 53465
1492 Ga0501080_0004495 3300049742 Bacteria 12429
1493 Ga0501080_0005741 3300049742 Bacteria 11101
1494 Ga0501080_0007639 3300049742 Bacteria 9778
1495 Ga0501080_0011826 3300049742 Bacteria 7997
1496 Ga0501080_0046995 3300049742 Bacteria 4018
1497 Ga0501080_0049611 3300049742 Bacteria 3906
1498 Ga0501080_0075692 3300049742 Bacteria 3130
1499 Ga0501080_0163581 3300049742 Bacteria 2054
1500 Ga0501080_0264378 3300049742 Bacteria 1567
1501 Ga0501081_0012526 3300049743 Bacteria 5577
1502 Ga0501081_0033644 3300049743 Bacteria 3484
1503 Ga0501081_0083469 3300049743 Bacteria 2240
1504 Ga0501081_0094116 3300049743 Bacteria 2111
1505 Ga0501081_0101546 3300049743 Bacteria 2034
1506 Ga0501081_0109321 3300049743 Bacteria 1961
1507 Ga0501081_0233682 3300049743 Bacteria 1340
1508 Ga0501081_0275695 3300049743 Bacteria 1231
1509 Ga0501081_0362415 3300049743 Bacteria 1069
1510 Ga0501083_0003052 3300049744 Bacteria 11638
1511 Ga0501083_0004739 3300049744 Bacteria 9609
1512 Ga0501083_0047509 3300049744 Bacteria 2900
1513 Ga0501083_0058203 3300049744 Bacteria 2586
1514 Ga0501083_0062365 3300049744 Bacteria 2487
1515 Ga0501083_0062602 3300049744 Bacteria 2482
1516 Ga0501083_0063315 3300049744 Bacteria 2467
1517 Ga0501083_0088092 3300049744 Bacteria 2053
1518 Ga0501083_0097448 3300049744 Bacteria 1940
1519 Ga0501083_0138920 3300049744 Bacteria 1591
1520 Ga0501083_0147272 3300049744 Bacteria 1542
1521 Ga0501083_0153386 3300049744 Bacteria 1508
1522 Ga0501083_0242849 3300049744 Bacteria 1173
1523 Ga0501269_005849 3300049766 Bacteria 1480
1524 Ga0501035_0032177 3300049822 Bacteria 4773
1525 Ga0501035_0037832 3300049822 Bacteria 4367
1526 Ga0501035_0042958 3300049822 Bacteria 4074
1527 Ga0501035_0130658 3300049822 Bacteria 2189
1528 Ga0501035_0210373 3300049822 Bacteria 1664
1529 Ga0501035_0234685 3300049822 Bacteria 1562
1530 Ga0501035_0298136 3300049822 Bacteria 1359
1531 Ga0501044_0000057 3300049823 Bacteria 136472
1532 Ga0501044_0000636 3300049823 Bacteria 42394
1533 Ga0501044_0006986 3300049823 Bacteria 12419
1534 Ga0501044_0035670 3300049823 Bacteria 5207
1535 Ga0501044_0091429 3300049823 Bacteria 3070
1536 Ga0501044_0131314 3300049823 Bacteria 2498
1537 Ga0501044_0133734 3300049823 Bacteria 2472
1538 Ga0501044_0291707 3300049823 Bacteria 1562
1539 Ga0501045_0011025 3300049824 Bacteria 6336
1540 Ga0501045_0025250 3300049824 Bacteria 4270
1541 Ga0501045_0045589 3300049824 Bacteria 3192
1542 Ga0501045_0057631 3300049824 Bacteria 2843
1543 Ga0501045_0170613 3300049824 Bacteria 1620
1544 Ga0501045_0222066 3300049824 Bacteria 1407
1545 nmdc:mga03n38_47109_c1 3300050490 Bacteria 1906
1546 nmdc:mga00v17_3113_c1 3300050491 Bacteria 5080
1547 nmdc:mga00v17_46850_c1 3300050491 Bacteria 2617
1548 nmdc:mga0yw44_10989_c1 3300050492 Bacteria 4648
1549 nmdc:mga0yw44_196203_c1 3300050492 Bacteria 1332
1550 nmdc:mga0yw44_205810_c1 3300050492 Bacteria 1301
1551 nmdc:mga0yw44_518_c1 3300050492 Bacteria 13808
1552 nmdc:mga0k408_31173_c1 3300050493 Bacteria 3042
1553 nmdc:mga04h51_20217_c1 3300050495 Bacteria 1984
1554 nmdc:mga05p37_113639_c1 3300050507 Bacteria 3329
1555 nmdc:mga05p37_141262_c1 3300050507 Bacteria 2950
1556 nmdc:mga05p37_1829_c1 3300050507 Bacteria 24804
1557 nmdc:mga05p37_218872_c1 3300050507 Bacteria 2299
1558 nmdc:mga05p37_250885_c1 3300050507 Bacteria 2123
1559 nmdc:mga05p37_517529_c1 3300050507 Bacteria 1366
1560 nmdc:mga09592_128941_c1 3300050508 Bacteria 2175
1561 nmdc:mga09592_189506_c1 3300050508 Bacteria 1780
1562 nmdc:mga09592_34632_c1 3300050508 Bacteria 4221
1563 nmdc:mga09592_665_c1 3300050508 Bacteria 26260
1564 nmdc:mga09592_70931_c1 3300050508 Bacteria 2957
1565 nmdc:mga0qj67_128_c1 3300050509 Bacteria 50095
1566 nmdc:mga0qj67_159193_c1 3300050509 Bacteria 1833
1567 nmdc:mga0qj67_368758_c1 3300050509 Bacteria 1160
1568 nmdc:mga0qj67_96091_c1 3300050509 Bacteria 2386
1569 nmdc:mga06r32_201244_c1 3300050510 Bacteria 1979
1570 nmdc:mga06r32_211253_c1 3300050510 Bacteria 1928
1571 nmdc:mga06r32_373217_c1 3300050510 Bacteria 1409
1572 nmdc:mga06r32_47339_c1 3300050510 Unclassified 4107
1573 nmdc:mga06r32_8458_c1 3300050510 Bacteria 9273
1574 nmdc:mga08y16_14006_c1 3300050511 Bacteria 8441
1575 nmdc:mga08y16_147581_c1 3300050511 Bacteria 2445
1576 nmdc:mga08y16_225542_c1 3300050511 Bacteria 1939
1577 nmdc:mga08y16_232187_c1 3300050511 Bacteria 1908
1578 nmdc:mga08y16_25662_c1 3300050511 Bacteria 6218
1579 nmdc:mga08y16_2695_c1 3300050511 Bacteria 18225
1580 nmdc:mga08y16_311078_c1 3300050511 Bacteria 1622
1581 nmdc:mga08y16_319496_c1 3300050511 Bacteria 1599
1582 nmdc:mga08y16_3376_c1 3300050511 Bacteria 16552
1583 nmdc:mga08y16_43429_c1 3300050511 Bacteria 4710
1584 nmdc:mga08y16_69875_c1 3300050511 Bacteria 3660
1585 nmdc:mga08y16_87078_c1 3300050511 Bacteria 3255
1586 nmdc:mga0n895_12777_c1 3300050512 Bacteria 7541
1587 nmdc:mga0n895_144070_c1 3300050512 Bacteria 2412
1588 nmdc:mga0n895_150972_c1 3300050512 Bacteria 2354
1589 nmdc:mga0n895_152535_c1 3300050512 Bacteria 2341
1590 nmdc:mga0n895_1662_c1 3300050512 Bacteria 16791
1591 nmdc:mga0n895_212771_c1 3300050512 Bacteria 1963
1592 nmdc:mga0n895_212817_c1 3300050512 Bacteria 1963
1593 nmdc:mga0n895_25762_c1 3300050512 Bacteria 5561
1594 nmdc:mga0n895_30713_c1 3300050512 Bacteria 5137
1595 nmdc:mga0n895_42015_c1 3300050512 Bacteria 4447
1596 nmdc:mga0n895_613259_c1 3300050512 Bacteria 1089
1597 nmdc:mga0n895_755685_c1 3300050512 Bacteria 965
1598 nmdc:mga0rr50_122982_c1 3300050513 Bacteria 2068
1599 nmdc:mga0rr50_127352_c1 3300050513 Bacteria 2035
1600 nmdc:mga0rr50_160579_c1 3300050513 Bacteria 1824
1601 nmdc:mga0rr50_280446_c1 3300050513 Bacteria 1390
1602 nmdc:mga0rr50_359_c1 3300050513 Bacteria 24852
1603 nmdc:mga0rr50_47798_c1 3300050513 Bacteria 3159
1604 nmdc:mga0rr50_6403_c1 3300050513 Bacteria 7163
1605 nmdc:mga08x19_1000_c1 3300050514 Bacteria 17670
1606 nmdc:mga08x19_314327_c1 3300050514 Bacteria 1089
1607 nmdc:mga08x19_65951_c1 3300050514 Bacteria 2352
1608 nmdc:mga08x19_76345_c1 3300050514 Bacteria 2192
1609 nmdc:mga0a205_152846_c1 3300050515 Bacteria 2207
1610 nmdc:mga0a205_15943_c1 3300050515 Bacteria 7030
1611 nmdc:mga0a205_34768_c1 3300050515 Bacteria 4836
1612 Ga0495601_0000008 3300053077 Bacteria 362152
1613 Ga0495601_0000010 3300053077 Bacteria 266222
1614 Ga0495601_0002242 3300053077 Bacteria 10893
1615 Ga0495601_0002289 3300053077 Bacteria 10799
1616 Ga0495601_0002422 3300053077 Bacteria 10592
1617 Ga0495601_0004361 3300053077 Bacteria 8172
1618 Ga0495601_0007888 3300053077 Bacteria 6271
1619 Ga0495601_0040636 3300053077 Bacteria 2913
1620 Ga0495601_0048388 3300053077 Bacteria 2677
1621 Ga0495601_0067998 3300053077 Bacteria 2270
1622 Ga0495601_0122218 3300053077 Bacteria 1691
1623 Ga0495612_0000026 3300053078 Bacteria 111627
1624 Ga0495612_0000112 3300053078 Bacteria 34503
1625 Ga0495612_0000348 3300053078 Bacteria 18650
1626 Ga0495612_0002861 3300053078 Bacteria 7141
1627 Ga0495612_0008235 3300053078 Bacteria 4234
1628 Ga0495612_0011660 3300053078 Bacteria 3542
1629 Ga0495612_0030080 3300053078 Bacteria 2188
1630 Ga0495612_0034541 3300053078 Bacteria 2048
1631 Ga0495612_0039819 3300053078 Bacteria 1913
1632 Ga0495612_0072008 3300053078 Bacteria 1442
1633 Ga0495595_0000024 3300053084 Bacteria 108008
1634 Ga0495595_0001784 3300053084 Bacteria 8386
1635 Ga0495595_0006272 3300053084 Bacteria 4843
1636 Ga0495595_0011344 3300053084 Bacteria 3723
1637 Ga0495595_0015850 3300053084 Bacteria 3218
1638 Ga0495595_0058099 3300053084 Bacteria 1805
1639 Ga0495619_0000002 3300053085 Bacteria 530226
1640 Ga0495619_0000639 3300053085 Bacteria 23071
1641 Ga0495619_0003971 3300053085 Bacteria 9485
1642 Ga0495619_0005083 3300053085 Bacteria 8358
1643 Ga0495619_0007246 3300053085 Bacteria 7025
1644 Ga0495619_0009760 3300053085 Bacteria 6051
1645 Ga0495619_0010357 3300053085 Bacteria 5870
1646 Ga0495619_0014040 3300053085 Bacteria 5053
1647 Ga0495619_0015356 3300053085 Bacteria 4845
1648 Ga0495619_0034643 3300053085 Bacteria 3283
1649 Ga0495619_0057178 3300053085 Bacteria 2587
1650 Ga0495619_0063009 3300053085 Bacteria 2469
1651 Ga0495619_0083557 3300053085 Bacteria 2154
1652 Ga0500643_001606 3300053087 Bacteria 12705
1653 Ga0500643_011611 3300053087 Bacteria 3200
1654 Ga0500641_0001457 3300053096 Bacteria 8435
1655 Ga0500641_0005976 3300053096 Bacteria 4309
1656 Ga0500556_0000522 3300053104 Bacteria 26239
1657 Ga0500562_005243 3300053108 Bacteria 3256
1658 Ga0500562_012346 3300053108 Bacteria 2173
1659 Ga0500593_002098 3300053117 Bacteria 7238
1660 Ga0500595_010227 3300053119 Bacteria 3738
1661 Ga0500608_018897 3300053122 Bacteria 3152
1662 Ga0500642_0000007 3300053130 Bacteria 294238
1663 Ga0500568_0000916 3300053139 Bacteria 20348
1664 Ga0500568_0071648 3300053139 Bacteria 1326
1665 Ga0500577_0090498 3300053142 Bacteria 1235
1666 Ga0500604_0000011 3300053151 Bacteria 104892
1667 Ga0500616_0000123 3300053153 Bacteria 140214
1668 Ga0500616_0001606 3300053153 Bacteria 21050
1669 Ga0500616_0003880 3300053153 Bacteria 10997
1670 Ga0500616_0008707 3300053153 Bacteria 6264
1671 Ga0500616_0055484 3300053153 Bacteria 2072
1672 Ga0500616_0071653 3300053153 Bacteria 1764
1673 Ga0500627_0023201 3300053158 Bacteria 2527
1674 Ga0500645_000637 3300053730 Bacteria 22300
1675 Ga0500587_000693 3300053739 Bacteria 4297
1676 Ga0501084_0026368 3300054114 Bacteria 4849
1677 Ga0501084_0045457 3300054114 Bacteria 3676
1678 Ga0501084_0051527 3300054114 Bacteria 3445
1679 Ga0501084_0052444 3300054114 Bacteria 3413
1680 Ga0501084_0058284 3300054114 Bacteria 3231
1681 Ga0501084_0068538 3300054114 Bacteria 2970
1682 Ga0501084_0118518 3300054114 Bacteria 2225
1683 Ga0501084_0131836 3300054114 Bacteria 2104
1684 Ga0501084_0141473 3300054114 Bacteria 2026
1685 Ga0501084_0215684 3300054114 Bacteria 1619
1686 Ga0501082_0007416 3300060353 Bacteria 9465
1687 Ga0501082_0009032 3300060353 Bacteria 8597
1688 Ga0501082_0009184 3300060353 Bacteria 8527
1689 Ga0501082_0009328 3300060353 Bacteria 8459
1690 Ga0501082_0021675 3300060353 Bacteria 5539
1691 Ga0501082_0031208 3300060353 Bacteria 4594
1692 Ga0501082_0041611 3300060353 Bacteria 3961
1693 Ga0501082_0082013 3300060353 Bacteria 2783
1694 Ga0501082_0151353 3300060353 Bacteria 2015
1695 Ga0501082_0168027 3300060353 Bacteria 1906
1696 Ga0501082_0189049 3300060353 Bacteria 1792
1697 Ga0501082_0198589 3300060353 Bacteria 1745
1698 Ga0501082_0330858 3300060353 Bacteria 1327
1699 Ga0466962_0030677 3300061719 Bacteria 2575
1700 Ga0530510_0000189 3300061734 Bacteria 37823
1701 Ga0530510_0023795 3300061734 Bacteria 4366
1702 Ga0530510_0028519 3300061734 Bacteria 4003
1703 Ga0530510_0063434 3300061734 Bacteria 2675
1704 Ga0530510_0067569 3300061734 Bacteria 2593
1705 Ga0530510_0122995 3300061734 Bacteria 1906
1706 Ga0530510_0141567 3300061734 Bacteria 1772
1707 Ga0530510_0281519 3300061734 Bacteria 1242
1708 Ga0530510_0302197 3300061734 Bacteria 1197

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053139 Ga0500568_0071648 Ga0500568_0071648_561_1313 247
2 3300050512 nmdc:mga0n895_755685_c1 nmdc:mga0n895_755685_c1_112_942 268
3 3300046522 Ga0495643_0214084 Ga0495643_0214084_14_862 269
4 3300014969 Ga0157376_10148474 Ga0157376_101484742 303
5 3300035117 Ga0373953_0151283 Ga0373953_0151283_21_941 303
6 3300046473 Ga0495582_0145791 Ga0495582_0145791_414_1328 303
7 3300046536 Ga0495587_0233739 Ga0495587_0233739_28_948 303
8 3300047471 Ga0495684_0172454 Ga0495684_0172454_60_980 303
9 3300049592 Ga0501076_0359728 Ga0501076_0359728_13_996 314
10 3300049743 Ga0501081_0275695 Ga0501081_0275695_169_1152 314
11 3300006178 Ga0075367_10217053 Ga0075367_102170531 327
12 3300053096 Ga0500641_0001457 Ga0500641_0001457_6590_7618 327
13 3300005617 Ga0068859_100082007 Ga0068859_1000820072 328
14 3300005843 Ga0068860_100018948 Ga0068860_1000189488 328
15 3300006931 Ga0097620_100082003 Ga0097620_1000820032 328
16 3300053119 Ga0500595_010227 Ga0500595_010227_2377_3405 328
17 3300005435 Ga0070714_100010640 Ga0070714_1000106404 329
18 3300025939 Ga0207665_10012727 Ga0207665_100127273 329
19 3300028023 Ga0265357_1000537 Ga0265357_10005372 330
20 3300045836 Ga0466958_0190781 Ga0466958_0190781_75_1100 330
21 3300048913 Ga0496110_0123647 Ga0496110_0123647_747_1793 330
22 3300003322 rootL2_10262791 rootL2_102627912 331
23 3300005466 Ga0070685_10092151 Ga0070685_100921511 331
24 3300005468 Ga0070707_100001910 Ga0070707_1000019109 331
25 3300009553 Ga0105249_10076066 Ga0105249_100760663 331
26 3300021377 Ga0213874_10036466 Ga0213874_100364661 331
27 3300025922 Ga0207646_10000137 Ga0207646_100001379 331
28 3300050507 nmdc:mga05p37_141262_c1 nmdc:mga05p37_141262_c1_1788_2906 331
29 3300009098 Ga0105245_10026379 Ga0105245_100263792 332
30 3300013297 Ga0157378_10044768 Ga0157378_100447682 332
31 3300025927 Ga0207687_10139411 Ga0207687_101394112 332
32 3300031090 Ga0265760_10009107 Ga0265760_100091071 332
33 3300036401 Ga0373937_0149710 Ga0373937_0149710_585_1628 332
34 3300036401 Ga0373937_0298529 Ga0373937_0298529_127_1164 332
35 3300049585 Ga0501069_0039611 Ga0501069_0039611_864_1862 332
36 3300053085 Ga0495619_0007246 Ga0495619_0007246_5448_6485 332
37 3300061734 Ga0530510_0302197 Ga0530510_0302197_80_1078 332
38 3300005366 Ga0070659_100165238 Ga0070659_1001652382 333
39 3300005617 Ga0068859_100029966 Ga0068859_1000299664 333
40 3300005840 Ga0068870_10066878 Ga0068870_100668782 333
41 3300006358 Ga0068871_100122171 Ga0068871_1001221713 333
42 3300006931 Ga0097620_100029966 Ga0097620_1000299664 333
43 3300014325 Ga0163163_10076151 Ga0163163_100761515 333
44 3300014969 Ga0157376_10220967 Ga0157376_102209671 333
45 3300025908 Ga0207643_10084645 Ga0207643_100846453 333
46 3300025944 Ga0207661_10141285 Ga0207661_101412852 333
47 3300048912 Ga0496109_0099924 Ga0496109_0099924_630_1631 333
48 3300048914 Ga0496111_0044048 Ga0496111_0044048_1333_2340 333
49 3300048916 Ga0496113_0060630 Ga0496113_0060630_319_1320 333
50 3300048917 Ga0496114_0079080 Ga0496114_0079080_787_1788 333
51 3300005329 Ga0070683_100189912 Ga0070683_1001899122 334
52 3300005436 Ga0070713_100055125 Ga0070713_1000551252 334
53 3300005563 Ga0068855_100002398 Ga0068855_10000239815 334
54 3300005842 Ga0068858_100050546 Ga0068858_1000505464 334
55 3300006852 Ga0075433_10099486 Ga0075433_100994862 334
56 3300006880 Ga0075429_100072253 Ga0075429_1000722532 334
57 3300006880 Ga0075429_100118035 Ga0075429_1001180352 334
58 3300009098 Ga0105245_10003760 Ga0105245_1000376012 334
59 3300009545 Ga0105237_10204385 Ga0105237_102043852 334
60 3300021388 Ga0213875_10000012 Ga0213875_1000001264 334
61 3300025913 Ga0207695_10011467 Ga0207695_100114676 334
62 3300025927 Ga0207687_10000549 Ga0207687_1000054922 334
63 3300025941 Ga0207711_10000454 Ga0207711_1000045439 334
64 3300025949 Ga0207667_10018000 Ga0207667_100180008 334
65 3300025961 Ga0207712_10019429 Ga0207712_100194295 334
66 3300026078 Ga0207702_10049705 Ga0207702_100497052 334
67 3300035118 Ga0373954_0014997 Ga0373954_0014997_383_1393 334
68 3300035724 Ga0373933_0014362 Ga0373933_0014362_17_1021 334
69 3300036401 Ga0373937_0019719 Ga0373937_0019719_2002_3012 334
70 3300037853 Ga0436364_0802445 Ga0436364_0802445_23003_24031 334
71 3300044842 Ga0466957_0040381 Ga0466957_0040381_1024_2028 334
72 3300046471 Ga0495650_0018768 Ga0495650_0018768_1801_2829 334
73 3300046529 Ga0495652_0131851 Ga0495652_0131851_675_1682 334
74 3300048905 Ga0496102_0104350 Ga0496102_0104350_1606_2619 334
75 3300048914 Ga0496111_0131576 Ga0496111_0131576_25_1029 334
76 3300049572 Ga0501036_0198365 Ga0501036_0198365_246_1250 334
77 3300049574 Ga0501038_0204301 Ga0501038_0204301_184_1188 334
78 3300049577 Ga0501041_0013474 Ga0501041_0013474_211_1215 334
79 3300049578 Ga0501042_0080813 Ga0501042_0080813_624_1628 334
80 3300050508 nmdc:mga09592_128941_c1 nmdc:mga09592_128941_c1_1089_2099 334
81 3300050508 nmdc:mga09592_34632_c1 nmdc:mga09592_34632_c1_3002_4012 334
82 3300050510 nmdc:mga06r32_47339_c1 nmdc:mga06r32_47339_c1_1871_2881 334
83 3300050511 nmdc:mga08y16_225542_c1 nmdc:mga08y16_225542_c1_261_1265 334
84 3300061719 Ga0466962_0030677 Ga0466962_0030677_740_1744 334
85 3300061734 Ga0530510_0281519 Ga0530510_0281519_196_1200 334
86 3300006028 Ga0070717_10193973 Ga0070717_101939732 335
87 3300013104 Ga0157370_10004062 Ga0157370_100040628 335
88 3300039437 Ga0436365_0360373 Ga0436365_0360373_2233_3267 335
89 3300039438 Ga0436360_1171127 Ga0436360_1171127_2178_3212 335
90 3300005459 Ga0068867_100077629 Ga0068867_1000776292 336
91 3300009094 Ga0111539_10005603 Ga0111539_1000560317 336
92 3300009147 Ga0114129_10252799 Ga0114129_102527992 336
93 3300031901 Ga0307406_10044402 Ga0307406_100444022 336
94 3300031903 Ga0307407_10085105 Ga0307407_100851051 336
95 3300032126 Ga0307415_100005629 Ga0307415_1000056295 336
96 3300045976 Ga0466967_0326164 Ga0466967_0326164_293_1309 336
97 3300047472 Ga0495686_0000741 Ga0495686_0000741_7312_8346 336
98 3300049568 Ga0501031_0070670 Ga0501031_0070670_45_1061 336
99 3300049572 Ga0501036_0011640 Ga0501036_0011640_1150_2187 336
100 3300049578 Ga0501042_0134393 Ga0501042_0134393_625_1662 336
101 3300049582 Ga0501048_0202461 Ga0501048_0202461_196_1212 336
102 3300049587 Ga0501071_0182725 Ga0501071_0182725_251_1267 336
103 3300049591 Ga0501075_0010178 Ga0501075_0010178_3998_5035 336
104 3300049743 Ga0501081_0101546 Ga0501081_0101546_651_1667 336
105 3300049743 Ga0501081_0362415 Ga0501081_0362415_18_1037 336
106 3300050507 nmdc:mga05p37_250885_c1 nmdc:mga05p37_250885_c1_1057_2070 336
107 3300050510 nmdc:mga06r32_201244_c1 nmdc:mga06r32_201244_c1_335_1348 336
108 3300054114 Ga0501084_0215684 Ga0501084_0215684_318_1334 336
109 3300061734 Ga0530510_0122995 Ga0530510_0122995_585_1601 336
110 3300005329 Ga0070683_100114000 Ga0070683_1001140002 337
111 3300049574 Ga0501038_0172003 Ga0501038_0172003_582_1610 337
112 3300049577 Ga0501041_0067768 Ga0501041_0067768_88_1113 337
113 3300049582 Ga0501048_0191809 Ga0501048_0191809_120_1148 337
114 3300049743 Ga0501081_0083469 Ga0501081_0083469_249_1277 337
115 3300049824 Ga0501045_0170613 Ga0501045_0170613_501_1529 337
116 iso_pu_bacteria 2510917026 2511169698 337
117 iso_pu_bacteria 2585427633 2585994201 337
118 iso_pu_bacteria 2585427634 2585998719 337
119 iso_pu_bacteria 2919171160 2919172234 337
120 3300005548 Ga0070665_100000454 Ga0070665_1000004549 338
121 3300006175 Ga0070712_100271964 Ga0070712_1002719642 338
122 3300009094 Ga0111539_10359240 Ga0111539_103592402 338
123 3300009545 Ga0105237_10412625 Ga0105237_104126252 338
124 3300009553 Ga0105249_10036906 Ga0105249_100369064 338
125 3300010375 Ga0105239_10003323 Ga0105239_100033235 338
126 3300011119 Ga0105246_10007885 Ga0105246_100078852 338
127 3300013307 Ga0157372_10001454 Ga0157372_100014545 338
128 3300014968 Ga0157379_10016744 Ga0157379_100167443 338
129 3300025935 Ga0207709_10029004 Ga0207709_100290042 338
130 3300028379 Ga0268266_10001196 Ga0268266_100011962 338
131 3300044694 Ga0466963_0151807 Ga0466963_0151807_269_1285 338
132 3300044694 Ga0466963_0188751 Ga0466963_0188751_22_1047 338
133 3300045051 Ga0451576_0030430 Ga0451576_0030430_1061_2077 338
134 3300045976 Ga0466967_0279107 Ga0466967_0279107_319_1335 338
135 3300048904 Ga0496101_0025198 Ga0496101_0025198_678_1715 338
136 3300048905 Ga0496102_0058487 Ga0496102_0058487_1818_2855 338
137 3300048906 Ga0496103_0043028 Ga0496103_0043028_924_1940 338
138 3300048909 Ga0496106_0017965 Ga0496106_0017965_1674_2711 338
139 3300048910 Ga0496107_0005134 Ga0496107_0005134_1902_2939 338
140 3300048913 Ga0496110_0012010 Ga0496110_0012010_2080_3096 338
141 3300048913 Ga0496110_0069683 Ga0496110_0069683_522_1538 338
142 3300048915 Ga0496112_0072980 Ga0496112_0072980_593_1609 338
143 3300048918 Ga0496115_0016833 Ga0496115_0016833_718_1755 338
144 3300049568 Ga0501031_0020750 Ga0501031_0020750_2860_3882 338
145 3300049569 Ga0501032_0015061 Ga0501032_0015061_2213_3235 338
146 3300049570 Ga0501033_0066643 Ga0501033_0066643_1504_2526 338
147 3300049572 Ga0501036_0052138 Ga0501036_0052138_1893_2915 338
148 3300049578 Ga0501042_0010513 Ga0501042_0010513_219_1271 338
149 3300049578 Ga0501042_0055099 Ga0501042_0055099_1172_2194 338
150 3300049580 Ga0501046_0002832 Ga0501046_0002832_13911_14933 338
151 3300049581 Ga0501047_0048749 Ga0501047_0048749_1301_2323 338
152 3300049585 Ga0501069_0018766 Ga0501069_0018766_2593_3615 338
153 3300049586 Ga0501070_0052874 Ga0501070_0052874_1237_2259 338
154 3300049589 Ga0501073_0001397 Ga0501073_0001397_2326_3348 338
155 3300049590 Ga0501074_0001516 Ga0501074_0001516_12593_13615 338
156 3300049742 Ga0501080_0046995 Ga0501080_0046995_2553_3575 338
157 3300049744 Ga0501083_0147272 Ga0501083_0147272_80_1132 338
158 3300049822 Ga0501035_0042958 Ga0501035_0042958_1559_2581 338
159 3300049823 Ga0501044_0133734 Ga0501044_0133734_44_1066 338
160 3300050511 nmdc:mga08y16_311078_c1 nmdc:mga08y16_311078_c1_292_1308 338
161 3300053085 Ga0495619_0083557 Ga0495619_0083557_19_1035 338
162 3300005295 Ga0065707_10109240 Ga0065707_101092402 339
163 3300005329 Ga0070683_100296257 Ga0070683_1002962572 339
164 3300005535 Ga0070684_100046625 Ga0070684_1000466252 339
165 3300006058 Ga0075432_10078734 Ga0075432_100787342 339
166 3300006844 Ga0075428_100000887 Ga0075428_10000088713 339
167 3300006846 Ga0075430_100073342 Ga0075430_1000733422 339
168 3300006880 Ga0075429_100000259 Ga0075429_10000025924 339
169 3300009147 Ga0114129_10000430 Ga0114129_1000043033 339
170 3300009176 Ga0105242_10137794 Ga0105242_101377942 339
171 3300020080 Ga0206350_10982270 Ga0206350_109822702 339
172 3300020082 Ga0206353_11236298 Ga0206353_112362982 339
173 3300027907 Ga0207428_10000721 Ga0207428_1000072121 339
174 3300028800 Ga0265338_10045613 Ga0265338_100456133 339
175 3300031240 Ga0265320_10036053 Ga0265320_100360532 339
176 3300031241 Ga0265325_10014548 Ga0265325_100145485 339
177 3300031247 Ga0265340_10012315 Ga0265340_100123152 339
178 3300031249 Ga0265339_10039551 Ga0265339_100395512 339
179 3300031595 Ga0265313_10027715 Ga0265313_100277152 339
180 3300031824 Ga0307413_10135691 Ga0307413_101356912 339
181 3300035088 Ga0373940_0020018 Ga0373940_0020018_107_1126 339
182 3300035113 Ga0373936_0048363 Ga0373936_0048363_335_1363 339
183 3300035114 Ga0373939_0006735 Ga0373939_0006735_1607_2626 339
184 3300035115 Ga0373941_0008669 Ga0373941_0008669_657_1676 339
185 3300035170 Ga0373943_0038371 Ga0373943_0038371_155_1183 339
186 3300035410 Ga0373924_0028268 Ga0373924_0028268_80_1099 339
187 3300035691 Ga0373931_0001234 Ga0373931_0001234_7300_8319 339
188 3300035725 Ga0373947_0097514 Ga0373947_0097514_207_1328 339
189 3300039437 Ga0436365_1419315 Ga0436365_1419315_497_1516 339
190 3300041512 Ga0451853_1016073 Ga0451853_1016073_73_1095 339
191 3300044694 Ga0466963_0078525 Ga0466963_0078525_747_1766 339
192 3300044694 Ga0466963_0099354 Ga0466963_0099354_631_1650 339
193 3300044706 Ga0466964_0065578 Ga0466964_0065578_318_1337 339
194 3300044719 Ga0466971_0095615 Ga0466971_0095615_99_1118 339
195 3300044842 Ga0466957_0006402 Ga0466957_0006402_389_1408 339
196 3300045836 Ga0466958_0031768 Ga0466958_0031768_524_1543 339
197 3300046455 Ga0495603_0032275 Ga0495603_0032275_1021_2142 339
198 3300046523 Ga0495644_0044248 Ga0495644_0044248_401_1420 339
199 3300046526 Ga0495666_0083921 Ga0495666_0083921_452_1471 339
200 3300046533 Ga0495640_0023762 Ga0495640_0023762_2610_3638 339
201 3300046674 Ga0495588_0110873 Ga0495588_0110873_72_1091 339
202 3300047321 Ga0495676_0088280 Ga0495676_0088280_1123_2244 339
203 3300049571 Ga0501034_0025323 Ga0501034_0025323_2583_3614 339
204 3300049581 Ga0501047_0153318 Ga0501047_0153318_598_1629 339
205 3300049583 Ga0501067_0000397 Ga0501067_0000397_2836_3867 339
206 3300049583 Ga0501067_0001165 Ga0501067_0001165_3087_4118 339
207 3300049584 Ga0501068_0011361 Ga0501068_0011361_505_1536 339
208 3300049585 Ga0501069_0068643 Ga0501069_0068643_452_1483 339
209 3300049586 Ga0501070_0017302 Ga0501070_0017302_4030_5061 339
210 3300049586 Ga0501070_0051290 Ga0501070_0051290_283_1314 339
211 3300049586 Ga0501070_0262090 Ga0501070_0262090_27_1052 339
212 3300049587 Ga0501071_0016580 Ga0501071_0016580_3962_4993 339
213 3300049587 Ga0501071_0114554 Ga0501071_0114554_845_1876 339
214 3300049588 Ga0501072_0018525 Ga0501072_0018525_3969_5000 339
215 3300049589 Ga0501073_0004253 Ga0501073_0004253_738_1769 339
216 3300049590 Ga0501074_0003476 Ga0501074_0003476_3377_4408 339
217 3300049590 Ga0501074_0183225 Ga0501074_0183225_149_1180 339
218 3300049593 Ga0501077_0022082 Ga0501077_0022082_1234_2265 339
219 3300049741 Ga0501079_0058080 Ga0501079_0058080_1322_2353 339
220 3300049742 Ga0501080_0005741 Ga0501080_0005741_9854_10885 339
221 3300049742 Ga0501080_0011826 Ga0501080_0011826_6488_7519 339
222 3300049744 Ga0501083_0004739 Ga0501083_0004739_597_1628 339
223 3300049744 Ga0501083_0097448 Ga0501083_0097448_210_1241 339
224 3300049823 Ga0501044_0091429 Ga0501044_0091429_1559_2578 339
225 3300050507 nmdc:mga05p37_1829_c1 nmdc:mga05p37_1829_c1_2725_3744 339
226 3300050508 nmdc:mga09592_665_c1 nmdc:mga09592_665_c1_3229_4248 339
227 3300050511 nmdc:mga08y16_14006_c1 nmdc:mga08y16_14006_c1_6181_7200 339
228 3300053108 Ga0500562_012346 Ga0500562_012346_422_1471 339
229 3300053151 Ga0500604_0000011 Ga0500604_0000011_84873_85892 339
230 3300054114 Ga0501084_0026368 Ga0501084_0026368_3257_4288 339
231 3300060353 Ga0501082_0041611 Ga0501082_0041611_404_1435 339
232 3300060353 Ga0501082_0151353 Ga0501082_0151353_716_1747 339
233 iso_pu_bacteria 2643221541 2643731883 339
234 iso_pu_bacteria 2643221606 2644041790 339
235 iso_pu_bacteria 2643221671 2644394567 339
236 iso_pu_bacteria 2857542790 2857543762 339
237 iso_pu_bacteria 2929199973 2929200102 339
238 iso_pu_bacteria 8055909800 8055912263 339
239 3300003659 JGI25404J52841_10006776 JGI25404J52841_100067762 340
240 3300005330 Ga0070690_100000450 Ga0070690_10000045014 340
241 3300005334 Ga0068869_100000076 Ga0068869_10000007621 340
242 3300005336 Ga0070680_100001687 Ga0070680_10000168720 340
243 3300005337 Ga0070682_100052122 Ga0070682_1000521223 340
244 3300005337 Ga0070682_100056011 Ga0070682_1000560112 340
245 3300005338 Ga0068868_100000097 Ga0068868_10000009748 340
246 3300005339 Ga0070660_100050352 Ga0070660_1000503525 340
247 3300005340 Ga0070689_100000556 Ga0070689_1000005567 340
248 3300005340 Ga0070689_100142074 Ga0070689_1001420742 340
249 3300005341 Ga0070691_10006434 Ga0070691_100064342 340
250 3300005343 Ga0070687_100000081 Ga0070687_10000008122 340
251 3300005343 Ga0070687_100129346 Ga0070687_1001293462 340
252 3300005355 Ga0070671_100111582 Ga0070671_1001115822 340
253 3300005356 Ga0070674_100148072 Ga0070674_1001480722 340
254 3300005406 Ga0070703_10003369 Ga0070703_100033693 340
255 3300005434 Ga0070709_10030915 Ga0070709_100309152 340
256 3300005435 Ga0070714_100373510 Ga0070714_1003735101 340
257 3300005436 Ga0070713_100300517 Ga0070713_1003005171 340
258 3300005440 Ga0070705_100003727 Ga0070705_1000037273 340
259 3300005441 Ga0070700_100000611 Ga0070700_1000006114 340
260 3300005444 Ga0070694_100006428 Ga0070694_1000064283 340
261 3300005456 Ga0070678_100039982 Ga0070678_1000399823 340
262 3300005458 Ga0070681_10004773 Ga0070681_1000477313 340
263 3300005459 Ga0068867_100000194 Ga0068867_10000019432 340
264 3300005466 Ga0070685_10230993 Ga0070685_102309931 340
265 3300005467 Ga0070706_100307694 Ga0070706_1003076941 340
266 3300005468 Ga0070707_100227468 Ga0070707_1002274682 340
267 3300005471 Ga0070698_100321379 Ga0070698_1003213791 340
268 3300005518 Ga0070699_100026614 Ga0070699_1000266144 340
269 3300005530 Ga0070679_100002792 Ga0070679_10000279213 340
270 3300005535 Ga0070684_100000613 Ga0070684_10000061313 340
271 3300005536 Ga0070697_100257468 Ga0070697_1002574681 340
272 3300005536 Ga0070697_100271233 Ga0070697_1002712331 340
273 3300005536 Ga0070697_100428637 Ga0070697_1004286371 340
274 3300005544 Ga0070686_100000732 Ga0070686_10000073222 340
275 3300005545 Ga0070695_100000206 Ga0070695_10000020614 340
276 3300005546 Ga0070696_100001279 Ga0070696_1000012793 340
277 3300005546 Ga0070696_100003513 Ga0070696_1000035133 340
278 3300005547 Ga0070693_100000241 Ga0070693_10000024121 340
279 3300005549 Ga0070704_100000200 Ga0070704_1000002005 340
280 3300005563 Ga0068855_100004267 Ga0068855_10000426714 340
281 3300005577 Ga0068857_100209490 Ga0068857_1002094902 340
282 3300005578 Ga0068854_100002327 Ga0068854_1000023273 340
283 3300005614 Ga0068856_100015609 Ga0068856_1000156096 340
284 3300005615 Ga0070702_100000002 Ga0070702_10000000268 340
285 3300005617 Ga0068859_100000195 Ga0068859_10000019564 340
286 3300005618 Ga0068864_100056129 Ga0068864_1000561292 340
287 3300005718 Ga0068866_10000037 Ga0068866_1000003748 340
288 3300005719 Ga0068861_100000141 Ga0068861_1000001413 340
289 3300005719 Ga0068861_100358880 Ga0068861_1003588801 340
290 3300005841 Ga0068863_100121693 Ga0068863_1001216931 340
291 3300005842 Ga0068858_100015675 Ga0068858_1000156755 340
292 3300005844 Ga0068862_100002874 Ga0068862_10000287412 340
293 3300005937 Ga0081455_10014294 Ga0081455_100142942 340
294 3300005981 Ga0081538_10019051 Ga0081538_100190512 340
295 3300005983 Ga0081540_1014064 Ga0081540_10140643 340
296 3300005983 Ga0081540_1021722 Ga0081540_10217222 340
297 3300005985 Ga0081539_10024806 Ga0081539_100248062 340
298 3300006028 Ga0070717_10213722 Ga0070717_102137222 340
299 3300006028 Ga0070717_10281762 Ga0070717_102817622 340
300 3300006175 Ga0070712_100007008 Ga0070712_1000070084 340
301 3300006237 Ga0097621_100000045 Ga0097621_10000004512 340
302 3300006358 Ga0068871_100000480 Ga0068871_10000048012 340
303 3300006852 Ga0075433_10000500 Ga0075433_1000050017 340
304 3300006871 Ga0075434_100004724 Ga0075434_1000047243 340
305 3300006881 Ga0068865_100000176 Ga0068865_10000017619 340
306 3300006914 Ga0075436_100002996 Ga0075436_1000029969 340
307 3300006914 Ga0075436_100157339 Ga0075436_1001573392 340
308 3300006914 Ga0075436_100213972 Ga0075436_1002139721 340
309 3300006931 Ga0097620_100000195 Ga0097620_1000001953 340
310 3300007076 Ga0075435_100000047 Ga0075435_10000004731 340
311 3300007076 Ga0075435_100166004 Ga0075435_1001660042 340
312 3300007788 Ga0099795_10062943 Ga0099795_100629431 340
313 3300009092 Ga0105250_10046950 Ga0105250_100469502 340
314 3300009093 Ga0105240_10000091 Ga0105240_10000091193 340
315 3300009094 Ga0111539_10086514 Ga0111539_100865142 340
316 3300009094 Ga0111539_10111705 Ga0111539_101117052 340
317 3300009098 Ga0105245_10001927 Ga0105245_100019275 340
318 3300009101 Ga0105247_10030362 Ga0105247_100303622 340
319 3300009147 Ga0114129_10059229 Ga0114129_100592294 340
320 3300009148 Ga0105243_10000035 Ga0105243_10000035192 340
321 3300009174 Ga0105241_10010788 Ga0105241_100107887 340
322 3300009176 Ga0105242_10000097 Ga0105242_1000009722 340
323 3300009176 Ga0105242_10130426 Ga0105242_101304262 340
324 3300009551 Ga0105238_10006976 Ga0105238_100069769 340
325 3300009553 Ga0105249_10000701 Ga0105249_100007019 340
326 3300010375 Ga0105239_10051970 Ga0105239_100519702 340
327 3300013105 Ga0157369_10089047 Ga0157369_100890473 340
328 3300013297 Ga0157378_10000457 Ga0157378_1000045722 340
329 3300013307 Ga0157372_10272675 Ga0157372_102726752 340
330 3300013308 Ga0157375_10389881 Ga0157375_103898812 340
331 3300014969 Ga0157376_10003192 Ga0157376_1000319213 340
332 3300021361 Ga0213872_10012802 Ga0213872_100128023 340
333 3300021384 Ga0213876_10087828 Ga0213876_100878282 340
334 3300025908 Ga0207643_10008414 Ga0207643_100084144 340
335 3300025910 Ga0207684_10087049 Ga0207684_100870492 340
336 3300025911 Ga0207654_10006771 Ga0207654_100067716 340
337 3300025912 Ga0207707_10356089 Ga0207707_103560891 340
338 3300025915 Ga0207693_10025156 Ga0207693_100251563 340
339 3300025915 Ga0207693_10375453 Ga0207693_103754531 340
340 3300025917 Ga0207660_10003032 Ga0207660_100030324 340
341 3300025918 Ga0207662_10000006 Ga0207662_1000000642 340
342 3300025918 Ga0207662_10014380 Ga0207662_100143804 340
343 3300025919 Ga0207657_10113254 Ga0207657_101132542 340
344 3300025921 Ga0207652_10005867 Ga0207652_100058676 340
345 3300025922 Ga0207646_10047105 Ga0207646_100471053 340
346 3300025926 Ga0207659_10043453 Ga0207659_100434532 340
347 3300025927 Ga0207687_10001417 Ga0207687_100014177 340
348 3300025929 Ga0207664_10160927 Ga0207664_101609272 340
349 3300025931 Ga0207644_10109178 Ga0207644_101091781 340
350 3300025933 Ga0207706_10042439 Ga0207706_100424391 340
351 3300025934 Ga0207686_10001277 Ga0207686_1000127710 340
352 3300025934 Ga0207686_10124037 Ga0207686_101240372 340
353 3300025936 Ga0207670_10000732 Ga0207670_100007323 340
354 3300025936 Ga0207670_10020985 Ga0207670_100209853 340
355 3300025938 Ga0207704_10002497 Ga0207704_100024977 340
356 3300025942 Ga0207689_10000082 Ga0207689_1000008264 340
357 3300025944 Ga0207661_10094214 Ga0207661_100942142 340
358 3300025949 Ga0207667_10005548 Ga0207667_1000554812 340
359 3300025960 Ga0207651_10189460 Ga0207651_101894602 340
360 3300026023 Ga0207677_10002671 Ga0207677_100026714 340
361 3300026067 Ga0207678_10024639 Ga0207678_100246392 340
362 3300026067 Ga0207678_10101335 Ga0207678_101013352 340
363 3300026075 Ga0207708_10001332 Ga0207708_100013324 340
364 3300026078 Ga0207702_10097672 Ga0207702_100976723 340
365 3300026089 Ga0207648_10000300 Ga0207648_1000030013 340
366 3300026095 Ga0207676_10065875 Ga0207676_100658752 340
367 3300026118 Ga0207675_100000064 Ga0207675_10000006421 340
368 3300026118 Ga0207675_100018535 Ga0207675_1000185351 340
369 3300026121 Ga0207683_10025530 Ga0207683_100255302 340
370 3300027512 Ga0209179_1019661 Ga0209179_10196611 340
371 3300027907 Ga0207428_10034166 Ga0207428_100341665 340
372 3300028380 Ga0268265_10002875 Ga0268265_100028759 340
373 3300028381 Ga0268264_10000790 Ga0268264_1000079014 340
374 3300031238 Ga0265332_10013930 Ga0265332_100139302 340
375 3300031242 Ga0265329_10004865 Ga0265329_100048652 340
376 3300031249 Ga0265339_10013027 Ga0265339_100130271 340
377 3300031250 Ga0265331_10010420 Ga0265331_100104202 340
378 3300031456 Ga0307513_10018210 Ga0307513_100182105 340
379 3300031712 Ga0265342_10001892 Ga0265342_1000189217 340
380 3300035117 Ga0373953_0001056 Ga0373953_0001056_1305_2330 340
381 3300035118 Ga0373954_0015153 Ga0373954_0015153_851_1876 340
382 3300035120 Ga0373957_0085808 Ga0373957_0085808_119_1144 340
383 3300035170 Ga0373943_0001351 Ga0373943_0001351_536_1558 340
384 3300035170 Ga0373943_0009175 Ga0373943_0009175_3097_4122 340
385 3300035170 Ga0373943_0046601 Ga0373943_0046601_791_1816 340
386 3300035171 Ga0373946_0005952 Ga0373946_0005952_481_1506 340
387 3300035172 Ga0373955_0000550 Ga0373955_0000550_12021_13046 340
388 3300035172 Ga0373955_0095433 Ga0373955_0095433_444_1481 340
389 3300035410 Ga0373924_0021173 Ga0373924_0021173_879_1904 340
390 3300035691 Ga0373931_0109932 Ga0373931_0109932_232_1263 340
391 3300035692 Ga0373935_0000626 Ga0373935_0000626_11948_12973 340
392 3300035695 Ga0373927_0001416 Ga0373927_0001416_11443_12468 340
393 3300035695 Ga0373927_0050260 Ga0373927_0050260_1262_2284 340
394 3300035695 Ga0373927_0111531 Ga0373927_0111531_441_1463 340
395 3300035724 Ga0373933_0000674 Ga0373933_0000674_15046_16071 340
396 3300035724 Ga0373933_0004463 Ga0373933_0004463_1232_2269 340
397 3300035725 Ga0373947_0002468 Ga0373947_0002468_9906_10931 340
398 3300035725 Ga0373947_0029938 Ga0373947_0029938_332_1354 340
399 3300035725 Ga0373947_0079872 Ga0373947_0079872_300_1322 340
400 3300036401 Ga0373937_0000597 Ga0373937_0000597_12015_13040 340
401 3300037068 Ga0373925_0000069 Ga0373925_0000069_107422_108447 340
402 3300037068 Ga0373925_0154424 Ga0373925_0154424_446_1468 340
403 3300039437 Ga0436365_1648142 Ga0436365_1648142_346_1374 340
404 3300039447 Ga0436361_0925015 Ga0436361_0925015_910_1932 340
405 3300046454 Ga0495592_0000188 Ga0495592_0000188_11988_13013 340
406 3300046459 Ga0495629_0052522 Ga0495629_0052522_322_1347 340
407 3300046460 Ga0495638_0025682 Ga0495638_0025682_2541_3563 340
408 3300046462 Ga0495651_0004774 Ga0495651_0004774_5557_6582 340
409 3300046463 Ga0495653_0000198 Ga0495653_0000198_41138_42163 340
410 3300046463 Ga0495653_0098076 Ga0495653_0098076_261_1286 340
411 3300046472 Ga0495580_0015113 Ga0495580_0015113_2085_3107 340
412 3300046472 Ga0495580_0042603 Ga0495580_0042603_1862_2899 340
413 3300046476 Ga0495662_0002321 Ga0495662_0002321_2497_3522 340
414 3300046477 Ga0495664_0000002 Ga0495664_0000002_440062_441087 340
415 3300046477 Ga0495664_0000292 Ga0495664_0000292_6559_7584 340
416 3300046511 Ga0495608_0000009 Ga0495608_0000009_39348_40373 340
417 3300046514 Ga0495618_0000005 Ga0495618_0000005_217421_218446 340
418 3300046514 Ga0495618_0002551 Ga0495618_0002551_1830_2855 340
419 3300046514 Ga0495618_0020118 Ga0495618_0020118_374_1405 340
420 3300046514 Ga0495618_0025585 Ga0495618_0025585_986_2011 340
421 3300046516 Ga0495628_0000002 Ga0495628_0000002_404447_405472 340
422 3300046517 Ga0495630_0002475 Ga0495630_0002475_6767_7792 340
423 3300046529 Ga0495652_0000004 Ga0495652_0000004_183411_184436 340
424 3300046529 Ga0495652_0054075 Ga0495652_0054075_2089_3114 340
425 3300046533 Ga0495640_0000005 Ga0495640_0000005_39363_40388 340
426 3300046533 Ga0495640_0002721 Ga0495640_0002721_7989_9014 340
427 3300046535 Ga0495586_0035602 Ga0495586_0035602_1237_2274 340
428 3300046536 Ga0495587_0000007 Ga0495587_0000007_277854_278879 340
429 3300046543 Ga0495645_0000003 Ga0495645_0000003_385698_386723 340
430 3300046559 Ga0495667_0000002 Ga0495667_0000002_32251_33276 340
431 3300046616 Ga0495668_0005202 Ga0495668_0005202_1058_2089 340
432 3300046642 Ga0495634_0001824 Ga0495634_0001824_5664_6689 340
433 3300046642 Ga0495634_0019508 Ga0495634_0019508_1962_2987 340
434 3300046642 Ga0495634_0047464 Ga0495634_0047464_1537_2562 340
435 3300046660 Ga0495625_0004506 Ga0495625_0004506_6715_7746 340
436 3300046663 Ga0495635_0000289 Ga0495635_0000289_24254_25279 340
437 3300046663 Ga0495635_0000545 Ga0495635_0000545_16237_17262 340
438 3300046675 Ga0495657_0000781 Ga0495657_0000781_3775_4800 340
439 3300046675 Ga0495657_0073241 Ga0495657_0073241_816_1847 340
440 3300046678 Ga0495599_0000241 Ga0495599_0000241_5043_6068 340
441 3300046679 Ga0495623_0008537 Ga0495623_0008537_5032_6057 340
442 3300046680 Ga0495646_0000025 Ga0495646_0000025_101988_103013 340
443 3300046683 Ga0495658_0011495 Ga0495658_0011495_2637_3674 340
444 3300046690 Ga0495624_0021000 Ga0495624_0021000_858_1883 340
445 3300046690 Ga0495624_0051240 Ga0495624_0051240_1209_2234 340
446 3300046809 Ga0495600_0001041 Ga0495600_0001041_8295_9320 340
447 3300047315 Ga0495581_0005463 Ga0495581_0005463_711_1736 340
448 3300047317 Ga0495604_0001595 Ga0495604_0001595_12002_13027 340
449 3300047319 Ga0495674_0000003 Ga0495674_0000003_156654_157679 340
450 3300047319 Ga0495674_0000996 Ga0495674_0000996_16268_17293 340
451 3300047319 Ga0495674_0076929 Ga0495674_0076929_919_1950 340
452 3300047322 Ga0495680_0002558 Ga0495680_0002558_11919_12944 340
453 3300047444 Ga0495675_0001624 Ga0495675_0001624_6922_7947 340
454 3300047471 Ga0495684_0000405 Ga0495684_0000405_5615_6640 340
455 3300047471 Ga0495684_0017721 Ga0495684_0017721_1962_2987 340
456 3300047471 Ga0495684_0018466 Ga0495684_0018466_3020_4051 340
457 3300047673 Ga0495593_0003150 Ga0495593_0003150_1096_2121 340
458 3300048088 Ga0495602_0000027 Ga0495602_0000027_132007_133032 340
459 3300048912 Ga0496109_0307911 Ga0496109_0307911_418_1458 340
460 3300048913 Ga0496110_0019330 Ga0496110_0019330_20_1042 340
461 3300048913 Ga0496110_0377474 Ga0496110_0377474_110_1150 340
462 3300048914 Ga0496111_0144696 Ga0496111_0144696_501_1523 340
463 3300049569 Ga0501032_0016234 Ga0501032_0016234_2619_3677 340
464 3300049570 Ga0501033_0027706 Ga0501033_0027706_451_1479 340
465 3300049571 Ga0501034_0028499 Ga0501034_0028499_1538_2596 340
466 3300049571 Ga0501034_0041843 Ga0501034_0041843_1758_2786 340
467 3300049571 Ga0501034_0127525 Ga0501034_0127525_659_1717 340
468 3300049572 Ga0501036_0003666 Ga0501036_0003666_2998_4056 340
469 3300049572 Ga0501036_0102565 Ga0501036_0102565_692_1717 340
470 3300049573 Ga0501037_0012447 Ga0501037_0012447_2519_3577 340
471 3300049574 Ga0501038_0003531 Ga0501038_0003531_3567_4610 340
472 3300049575 Ga0501039_0007290 Ga0501039_0007290_368_1393 340
473 3300049577 Ga0501041_0055164 Ga0501041_0055164_1252_2277 340
474 3300049578 Ga0501042_0173542 Ga0501042_0173542_364_1389 340
475 3300049579 Ga0501043_0002821 Ga0501043_0002821_11728_12786 340
476 3300049580 Ga0501046_0034079 Ga0501046_0034079_1251_2309 340
477 3300049581 Ga0501047_0001508 Ga0501047_0001508_3023_4081 340
478 3300049581 Ga0501047_0008653 Ga0501047_0008653_705_1730 340
479 3300049581 Ga0501047_0293002 Ga0501047_0293002_239_1267 340
480 3300049581 Ga0501047_0331077 Ga0501047_0331077_210_1268 340
481 3300049582 Ga0501048_0000151 Ga0501048_0000151_17980_19038 340
482 3300049582 Ga0501048_0016788 Ga0501048_0016788_1541_2584 340
483 3300049582 Ga0501048_0124371 Ga0501048_0124371_727_1752 340
484 3300049583 Ga0501067_0001753 Ga0501067_0001753_10218_11243 340
485 3300049586 Ga0501070_0006477 Ga0501070_0006477_2900_3958 340
486 3300049586 Ga0501070_0147075 Ga0501070_0147075_708_1748 340
487 3300049587 Ga0501071_0031661 Ga0501071_0031661_1320_2345 340
488 3300049588 Ga0501072_0010510 Ga0501072_0010510_2645_3670 340
489 3300049588 Ga0501072_0035808 Ga0501072_0035808_1140_2165 340
490 3300049588 Ga0501072_0051585 Ga0501072_0051585_2090_3112 340
491 3300049589 Ga0501073_0005109 Ga0501073_0005109_8633_9658 340
492 3300049590 Ga0501074_0042415 Ga0501074_0042415_1587_2645 340
493 3300049590 Ga0501074_0051109 Ga0501074_0051109_618_1643 340
494 3300049590 Ga0501074_0083226 Ga0501074_0083226_886_1914 340
495 3300049591 Ga0501075_0103506 Ga0501075_0103506_951_1976 340
496 3300049592 Ga0501076_0025859 Ga0501076_0025859_1655_2680 340
497 3300049592 Ga0501076_0027671 Ga0501076_0027671_1267_2289 340
498 3300049592 Ga0501076_0129312 Ga0501076_0129312_368_1393 340
499 3300049593 Ga0501077_0122637 Ga0501077_0122637_474_1499 340
500 3300049741 Ga0501079_0011070 Ga0501079_0011070_114_1139 340
501 3300049741 Ga0501079_0188325 Ga0501079_0188325_13_1038 340
502 3300049742 Ga0501080_0000130 Ga0501080_0000130_44998_46056 340
503 3300049743 Ga0501081_0094116 Ga0501081_0094116_1049_2089 340
504 3300049743 Ga0501081_0109321 Ga0501081_0109321_515_1540 340
505 3300049766 Ga0501269_005849 Ga0501269_005849_349_1371 340
506 3300049822 Ga0501035_0210373 Ga0501035_0210373_559_1584 340
507 3300049823 Ga0501044_0000057 Ga0501044_0000057_98154_99182 340
508 3300049823 Ga0501044_0000636 Ga0501044_0000636_18008_19066 340
509 3300049824 Ga0501045_0011025 Ga0501045_0011025_3754_4779 340
510 3300049824 Ga0501045_0057631 Ga0501045_0057631_1141_2181 340
511 3300049824 Ga0501045_0222066 Ga0501045_0222066_71_1129 340
512 3300050511 nmdc:mga08y16_319496_c1 nmdc:mga08y16_319496_c1_476_1498 340
513 3300050512 nmdc:mga0n895_1662_c1 nmdc:mga0n895_1662_c1_8417_9439 340
514 3300050512 nmdc:mga0n895_212771_c1 nmdc:mga0n895_212771_c1_192_1214 340
515 3300050512 nmdc:mga0n895_25762_c1 nmdc:mga0n895_25762_c1_4424_5446 340
516 3300050513 nmdc:mga0rr50_359_c1 nmdc:mga0rr50_359_c1_5725_6747 340
517 3300050514 nmdc:mga08x19_1000_c1 nmdc:mga08x19_1000_c1_7435_8457 340
518 3300050515 nmdc:mga0a205_34768_c1 nmdc:mga0a205_34768_c1_2083_3105 340
519 3300053077 Ga0495601_0000010 Ga0495601_0000010_183365_184390 340
520 3300053077 Ga0495601_0007888 Ga0495601_0007888_5110_6141 340
521 3300053078 Ga0495612_0000348 Ga0495612_0000348_11999_13024 340
522 3300053078 Ga0495612_0002861 Ga0495612_0002861_2734_3759 340
523 3300053078 Ga0495612_0030080 Ga0495612_0030080_664_1737 340
524 3300053084 Ga0495595_0001784 Ga0495595_0001784_5832_6857 340
525 3300053085 Ga0495619_0000002 Ga0495619_0000002_404450_405475 340
526 3300053085 Ga0495619_0000639 Ga0495619_0000639_5198_6223 340
527 3300053085 Ga0495619_0010357 Ga0495619_0010357_4027_5058 340
528 3300053087 Ga0500643_001606 Ga0500643_001606_1872_2894 340
529 3300053087 Ga0500643_011611 Ga0500643_011611_1685_2716 340
530 3300053104 Ga0500556_0000522 Ga0500556_0000522_18119_19150 340
531 3300053122 Ga0500608_018897 Ga0500608_018897_1434_2459 340
532 3300053130 Ga0500642_0000007 Ga0500642_0000007_20854_21885 340
533 3300053139 Ga0500568_0000916 Ga0500568_0000916_16695_17717 340
534 3300053153 Ga0500616_0000123 Ga0500616_0000123_105629_106651 340
535 3300053153 Ga0500616_0008707 Ga0500616_0008707_3316_4344 340
536 3300053730 Ga0500645_000637 Ga0500645_000637_4803_5834 340
537 3300053739 Ga0500587_000693 Ga0500587_000693_1054_2076 340
538 3300054114 Ga0501084_0052444 Ga0501084_0052444_296_1321 340
539 3300060353 Ga0501082_0168027 Ga0501082_0168027_259_1284 340
540 3300060353 Ga0501082_0198589 Ga0501082_0198589_426_1484 340
541 3300061734 Ga0530510_0023795 Ga0530510_0023795_1674_2699 340
542 3300061734 Ga0530510_0063434 Ga0530510_0063434_1486_2514 340
543 3300061734 Ga0530510_0067569 Ga0530510_0067569_1018_2058 340
544 3300061734 Ga0530510_0141567 Ga0530510_0141567_695_1735 340
545 iso_pu_bacteria 2894772417 2894775823 340
546 3300000041 ARcpr5oldR_c000072 ARcpr5oldR_00007214 341
547 3300000042 ARSoilYngRDRAFT_c00041 ARSoilYngRDRAFT_000413 341
548 3300000043 ARcpr5yngRDRAFT_c000026 ARcpr5yngRDRAFT_00002621 341
549 3300000044 ARSoilOldRDRAFT_c000019 ARSoilOldRDRAFT_00001936 341
550 3300000652 ARCol0yngRDRAFT_1000004 ARCol0yngRDRAFT_10000048 341
551 3300001978 JGI24747J21853_1000329 JGI24747J21853_10003292 341
552 3300002076 JGI24749J21850_1000588 JGI24749J21850_10005883 341
553 3300005328 Ga0070676_10082059 Ga0070676_100820592 341
554 3300005329 Ga0070683_100001135 Ga0070683_1000011354 341
555 3300005329 Ga0070683_100189683 Ga0070683_1001896832 341
556 3300005329 Ga0070683_100326583 Ga0070683_1003265832 341
557 3300005334 Ga0068869_100047586 Ga0068869_1000475862 341
558 3300005334 Ga0068869_100283355 Ga0068869_1002833551 341
559 3300005336 Ga0070680_100001778 Ga0070680_1000017785 341
560 3300005336 Ga0070680_100005289 Ga0070680_10000528910 341
561 3300005336 Ga0070680_100029935 Ga0070680_1000299354 341
562 3300005337 Ga0070682_100004752 Ga0070682_1000047524 341
563 3300005337 Ga0070682_100005517 Ga0070682_1000055174 341
564 3300005337 Ga0070682_100154592 Ga0070682_1001545922 341
565 3300005338 Ga0068868_100058913 Ga0068868_1000589132 341
566 3300005338 Ga0068868_100091060 Ga0068868_1000910603 341
567 3300005339 Ga0070660_100113675 Ga0070660_1001136752 341
568 3300005340 Ga0070689_100157842 Ga0070689_1001578421 341
569 3300005341 Ga0070691_10010376 Ga0070691_100103762 341
570 3300005345 Ga0070692_10000361 Ga0070692_1000036111 341
571 3300005345 Ga0070692_10042153 Ga0070692_100421532 341
572 3300005345 Ga0070692_10107059 Ga0070692_101070591 341
573 3300005354 Ga0070675_100049909 Ga0070675_1000499092 341
574 3300005354 Ga0070675_100185464 Ga0070675_1001854642 341
575 3300005364 Ga0070673_100000366 Ga0070673_1000003662 341
576 3300005364 Ga0070673_100459994 Ga0070673_1004599941 341
577 3300005366 Ga0070659_100029831 Ga0070659_1000298312 341
578 3300005406 Ga0070703_10010831 Ga0070703_100108312 341
579 3300005435 Ga0070714_100449006 Ga0070714_1004490062 341
580 3300005438 Ga0070701_10004143 Ga0070701_100041433 341
581 3300005440 Ga0070705_100021783 Ga0070705_1000217831 341
582 3300005441 Ga0070700_100113361 Ga0070700_1001133612 341
583 3300005444 Ga0070694_100002075 Ga0070694_10000207510 341
584 3300005444 Ga0070694_100217378 Ga0070694_1002173782 341
585 3300005445 Ga0070708_100031172 Ga0070708_1000311724 341
586 3300005445 Ga0070708_100058764 Ga0070708_1000587642 341
587 3300005455 Ga0070663_100109644 Ga0070663_1001096441 341
588 3300005455 Ga0070663_100211019 Ga0070663_1002110191 341
589 3300005458 Ga0070681_10003628 Ga0070681_100036286 341
590 3300005458 Ga0070681_10025070 Ga0070681_100250704 341
591 3300005458 Ga0070681_10045260 Ga0070681_100452603 341
592 3300005458 Ga0070681_10215793 Ga0070681_102157932 341
593 3300005459 Ga0068867_100010360 Ga0068867_1000103603 341
594 3300005459 Ga0068867_100014164 Ga0068867_1000141644 341
595 3300005466 Ga0070685_10138051 Ga0070685_101380512 341
596 3300005467 Ga0070706_100064498 Ga0070706_1000644983 341
597 3300005518 Ga0070699_100115797 Ga0070699_1001157973 341
598 3300005530 Ga0070679_100004650 Ga0070679_10000465014 341
599 3300005530 Ga0070679_100101193 Ga0070679_1001011932 341
600 3300005535 Ga0070684_100013606 Ga0070684_1000136061 341
601 3300005535 Ga0070684_100100939 Ga0070684_1001009393 341
602 3300005535 Ga0070684_100230297 Ga0070684_1002302971 341
603 3300005536 Ga0070697_100025464 Ga0070697_1000254642 341
604 3300005539 Ga0068853_100062685 Ga0068853_1000626853 341
605 3300005543 Ga0070672_100000261 Ga0070672_1000002617 341
606 3300005543 Ga0070672_100002993 Ga0070672_1000029931 341
607 3300005544 Ga0070686_100057405 Ga0070686_1000574052 341
608 3300005545 Ga0070695_100029269 Ga0070695_1000292692 341
609 3300005545 Ga0070695_100121833 Ga0070695_1001218332 341
610 3300005546 Ga0070696_100025382 Ga0070696_1000253823 341
611 3300005546 Ga0070696_100044868 Ga0070696_1000448682 341
612 3300005547 Ga0070693_100081519 Ga0070693_1000815193 341
613 3300005548 Ga0070665_100048087 Ga0070665_1000480873 341
614 3300005549 Ga0070704_100001730 Ga0070704_1000017301 341
615 3300005563 Ga0068855_100000075 Ga0068855_10000007540 341
616 3300005563 Ga0068855_100002815 Ga0068855_10000281515 341
617 3300005577 Ga0068857_100012087 Ga0068857_1000120876 341
618 3300005577 Ga0068857_100057169 Ga0068857_1000571693 341
619 3300005578 Ga0068854_100021243 Ga0068854_1000212433 341
620 3300005614 Ga0068856_100189041 Ga0068856_1001890412 341
621 3300005616 Ga0068852_100022151 Ga0068852_1000221514 341
622 3300005616 Ga0068852_100034258 Ga0068852_1000342584 341
623 3300005617 Ga0068859_100040879 Ga0068859_1000408792 341
624 3300005617 Ga0068859_100355055 Ga0068859_1003550552 341
625 3300005618 Ga0068864_100008792 Ga0068864_1000087923 341
626 3300005618 Ga0068864_100080523 Ga0068864_1000805233 341
627 3300005618 Ga0068864_100089571 Ga0068864_1000895712 341
628 3300005719 Ga0068861_100113622 Ga0068861_1001136222 341
629 3300005719 Ga0068861_100185096 Ga0068861_1001850961 341
630 3300005840 Ga0068870_10012478 Ga0068870_100124783 341
631 3300005841 Ga0068863_100004833 Ga0068863_10000483312 341
632 3300005841 Ga0068863_100287673 Ga0068863_1002876731 341
633 3300005842 Ga0068858_100249103 Ga0068858_1002491032 341
634 3300005843 Ga0068860_100066460 Ga0068860_1000664603 341
635 3300005937 Ga0081455_10010735 Ga0081455_100107355 341
636 3300005937 Ga0081455_10014509 Ga0081455_100145094 341
637 3300005981 Ga0081538_10001357 Ga0081538_100013577 341
638 3300005981 Ga0081538_10019051 Ga0081538_100190513 341
639 3300005983 Ga0081540_1039393 Ga0081540_10393932 341
640 3300006038 Ga0075365_10002398 Ga0075365_100023989 341
641 3300006038 Ga0075365_10004549 Ga0075365_100045498 341
642 3300006038 Ga0075365_10020712 Ga0075365_100207125 341
643 3300006051 Ga0075364_10141587 Ga0075364_101415872 341
644 3300006175 Ga0070712_100376492 Ga0070712_1003764921 341
645 3300006178 Ga0075367_10167469 Ga0075367_101674691 341
646 3300006237 Ga0097621_100426102 Ga0097621_1004261021 341
647 3300006353 Ga0075370_10101318 Ga0075370_101013182 341
648 3300006353 Ga0075370_10169308 Ga0075370_101693081 341
649 3300006358 Ga0068871_100203481 Ga0068871_1002034813 341
650 3300006844 Ga0075428_100007369 Ga0075428_1000073694 341
651 3300006844 Ga0075428_100058911 Ga0075428_1000589115 341
652 3300006844 Ga0075428_100394294 Ga0075428_1003942941 341
653 3300006846 Ga0075430_100000163 Ga0075430_10000016335 341
654 3300006846 Ga0075430_100103514 Ga0075430_1001035141 341
655 3300006847 Ga0075431_100000512 Ga0075431_1000005123 341
656 3300006847 Ga0075431_100118026 Ga0075431_1001180263 341
657 3300006847 Ga0075431_100347094 Ga0075431_1003470942 341
658 3300006852 Ga0075433_10052432 Ga0075433_100524322 341
659 3300006871 Ga0075434_100022354 Ga0075434_1000223542 341
660 3300006871 Ga0075434_100044275 Ga0075434_1000442752 341
661 3300006880 Ga0075429_100077138 Ga0075429_1000771383 341
662 3300006880 Ga0075429_100199777 Ga0075429_1001997771 341
663 3300006881 Ga0068865_100003405 Ga0068865_1000034054 341
664 3300006881 Ga0068865_100246573 Ga0068865_1002465732 341
665 3300006931 Ga0097620_100040882 Ga0097620_1000408822 341
666 3300006931 Ga0097620_100355017 Ga0097620_1003550172 341
667 3300009093 Ga0105240_10020037 Ga0105240_100200378 341
668 3300009093 Ga0105240_10171309 Ga0105240_101713093 341
669 3300009094 Ga0111539_10014188 Ga0111539_100141886 341
670 3300009094 Ga0111539_10020284 Ga0111539_100202843 341
671 3300009094 Ga0111539_10153139 Ga0111539_101531392 341
672 3300009094 Ga0111539_10239024 Ga0111539_102390241 341
673 3300009098 Ga0105245_10003390 Ga0105245_100033906 341
674 3300009098 Ga0105245_10004500 Ga0105245_100045009 341
675 3300009147 Ga0114129_10085098 Ga0114129_100850984 341
676 3300009148 Ga0105243_10004927 Ga0105243_100049276 341
677 3300009148 Ga0105243_10014167 Ga0105243_100141672 341
678 3300009148 Ga0105243_10047513 Ga0105243_100475134 341
679 3300009148 Ga0105243_10127424 Ga0105243_101274243 341
680 3300009176 Ga0105242_10180980 Ga0105242_101809803 341
681 3300009177 Ga0105248_10031262 Ga0105248_100312626 341
682 3300009545 Ga0105237_10043106 Ga0105237_100431065 341
683 3300009545 Ga0105237_10334372 Ga0105237_103343721 341
684 3300009545 Ga0105237_10466684 Ga0105237_104666841 341
685 3300009553 Ga0105249_10012758 Ga0105249_100127582 341
686 3300009553 Ga0105249_10274100 Ga0105249_102741002 341
687 3300010375 Ga0105239_10272801 Ga0105239_102728013 341
688 3300010375 Ga0105239_10277639 Ga0105239_102776392 341
689 3300013104 Ga0157370_10007016 Ga0157370_1000701615 341
690 3300013105 Ga0157369_10081244 Ga0157369_100812444 341
691 3300013296 Ga0157374_10005719 Ga0157374_100057193 341
692 3300013297 Ga0157378_10154035 Ga0157378_101540351 341
693 3300013306 Ga0163162_10617573 Ga0163162_106175731 341
694 3300013307 Ga0157372_10024329 Ga0157372_100243295 341
695 3300013307 Ga0157372_10581451 Ga0157372_105814511 341
696 3300013308 Ga0157375_10086287 Ga0157375_100862872 341
697 3300014325 Ga0163163_10019181 Ga0163163_100191815 341
698 3300014325 Ga0163163_10043844 Ga0163163_100438445 341
699 3300014325 Ga0163163_10070587 Ga0163163_100705873 341
700 3300014325 Ga0163163_10401402 Ga0163163_104014022 341
701 3300014968 Ga0157379_10142997 Ga0157379_101429972 341
702 3300014969 Ga0157376_10002806 Ga0157376_100028064 341
703 3300020082 Ga0206353_10155976 Ga0206353_101559762 341
704 3300021361 Ga0213872_10043811 Ga0213872_100438111 341
705 3300025290 Ga0207673_1000675 Ga0207673_10006754 341
706 3300025297 Ga0209758_1020537 Ga0209758_10205372 341
707 3300025885 Ga0207653_10008179 Ga0207653_100081792 341
708 3300025885 Ga0207653_10013248 Ga0207653_100132481 341
709 3300025901 Ga0207688_10009840 Ga0207688_100098403 341
710 3300025908 Ga0207643_10001540 Ga0207643_100015403 341
711 3300025908 Ga0207643_10164685 Ga0207643_101646851 341
712 3300025910 Ga0207684_10071822 Ga0207684_100718221 341
713 3300025911 Ga0207654_10031282 Ga0207654_100312822 341
714 3300025912 Ga0207707_10000502 Ga0207707_1000050227 341
715 3300025912 Ga0207707_10123592 Ga0207707_101235922 341
716 3300025912 Ga0207707_10138327 Ga0207707_101383271 341
717 3300025912 Ga0207707_10208903 Ga0207707_102089032 341
718 3300025913 Ga0207695_10000018 Ga0207695_10000018294 341
719 3300025913 Ga0207695_10035913 Ga0207695_100359134 341
720 3300025913 Ga0207695_10145392 Ga0207695_101453922 341
721 3300025914 Ga0207671_10025181 Ga0207671_100251814 341
722 3300025915 Ga0207693_10194414 Ga0207693_101944141 341
723 3300025917 Ga0207660_10005522 Ga0207660_100055227 341
724 3300025917 Ga0207660_10116960 Ga0207660_101169602 341
725 3300025917 Ga0207660_10382345 Ga0207660_103823451 341
726 3300025919 Ga0207657_10027894 Ga0207657_100278944 341
727 3300025919 Ga0207657_10031225 Ga0207657_100312253 341
728 3300025920 Ga0207649_10000141 Ga0207649_1000014150 341
729 3300025921 Ga0207652_10003727 Ga0207652_100037271 341
730 3300025921 Ga0207652_10278081 Ga0207652_102780812 341
731 3300025923 Ga0207681_10000545 Ga0207681_100005457 341
732 3300025924 Ga0207694_10000018 Ga0207694_10000018247 341
733 3300025924 Ga0207694_10126328 Ga0207694_101263281 341
734 3300025926 Ga0207659_10264548 Ga0207659_102645481 341
735 3300025927 Ga0207687_10042804 Ga0207687_100428043 341
736 3300025927 Ga0207687_10130336 Ga0207687_101303362 341
737 3300025929 Ga0207664_10250299 Ga0207664_102502992 341
738 3300025932 Ga0207690_10038677 Ga0207690_100386772 341
739 3300025933 Ga0207706_10205604 Ga0207706_102056042 341
740 3300025934 Ga0207686_10029893 Ga0207686_100298933 341
741 3300025935 Ga0207709_10369114 Ga0207709_103691141 341
742 3300025936 Ga0207670_10127502 Ga0207670_101275022 341
743 3300025940 Ga0207691_10002404 Ga0207691_100024046 341
744 3300025940 Ga0207691_10004241 Ga0207691_1000424113 341
745 3300025942 Ga0207689_10298817 Ga0207689_102988171 341
746 3300025944 Ga0207661_10002308 Ga0207661_100023084 341
747 3300025944 Ga0207661_10016407 Ga0207661_100164077 341
748 3300025944 Ga0207661_10131308 Ga0207661_101313082 341
749 3300025944 Ga0207661_10243912 Ga0207661_102439122 341
750 3300025945 Ga0207679_10046971 Ga0207679_100469712 341
751 3300025945 Ga0207679_10068594 Ga0207679_100685942 341
752 3300025949 Ga0207667_10000052 Ga0207667_10000052108 341
753 3300025949 Ga0207667_10003248 Ga0207667_1000324815 341
754 3300025960 Ga0207651_10295712 Ga0207651_102957121 341
755 3300025961 Ga0207712_10017911 Ga0207712_100179112 341
756 3300025961 Ga0207712_10047642 Ga0207712_100476421 341
757 3300025961 Ga0207712_10072273 Ga0207712_100722732 341
758 3300025961 Ga0207712_10294061 Ga0207712_102940612 341
759 3300025972 Ga0207668_10280672 Ga0207668_102806722 341
760 3300026023 Ga0207677_10126770 Ga0207677_101267702 341
761 3300026041 Ga0207639_10001973 Ga0207639_100019732 341
762 3300026067 Ga0207678_10064970 Ga0207678_100649702 341
763 3300026067 Ga0207678_10108209 Ga0207678_101082092 341
764 3300026075 Ga0207708_10001091 Ga0207708_100010918 341
765 3300026075 Ga0207708_10043028 Ga0207708_100430281 341
766 3300026078 Ga0207702_10220899 Ga0207702_102208992 341
767 3300026089 Ga0207648_10004737 Ga0207648_100047372 341
768 3300026089 Ga0207648_10033858 Ga0207648_100338583 341
769 3300026089 Ga0207648_10102759 Ga0207648_101027593 341
770 3300026116 Ga0207674_10021996 Ga0207674_100219963 341
771 3300026116 Ga0207674_10036663 Ga0207674_100366633 341
772 3300026118 Ga0207675_100008197 Ga0207675_1000081976 341
773 3300026118 Ga0207675_100036540 Ga0207675_1000365403 341
774 3300026118 Ga0207675_100201253 Ga0207675_1002012532 341
775 3300026142 Ga0207698_10026794 Ga0207698_100267944 341
776 3300026142 Ga0207698_10054792 Ga0207698_100547921 341
777 3300026142 Ga0207698_10065880 Ga0207698_100658803 341
778 3300026142 Ga0207698_10273854 Ga0207698_102738542 341
779 3300026142 Ga0207698_10515445 Ga0207698_105154451 341
780 3300027617 Ga0210002_1001376 Ga0210002_10013762 341
781 3300027665 Ga0209983_1007861 Ga0209983_10078612 341
782 3300027682 Ga0209971_1003726 Ga0209971_10037262 341
783 3300027866 Ga0209813_10006291 Ga0209813_100062913 341
784 3300027876 Ga0209974_10011622 Ga0209974_100116223 341
785 3300027876 Ga0209974_10038060 Ga0209974_100380602 341
786 3300027907 Ga0207428_10000428 Ga0207428_100004287 341
787 3300028379 Ga0268266_10034337 Ga0268266_100343376 341
788 3300028380 Ga0268265_10189167 Ga0268265_101891671 341
789 3300028381 Ga0268264_10039631 Ga0268264_100396313 341
790 3300028381 Ga0268264_10542819 Ga0268264_105428191 341
791 3300028573 Ga0265334_10004064 Ga0265334_100040644 341
792 3300028800 Ga0265338_10000014 Ga0265338_10000014146 341
793 3300028800 Ga0265338_10010493 Ga0265338_100104937 341
794 3300028800 Ga0265338_10019750 Ga0265338_100197504 341
795 3300028800 Ga0265338_10025896 Ga0265338_100258964 341
796 3300028800 Ga0265338_10084537 Ga0265338_100845372 341
797 3300029957 Ga0265324_10042206 Ga0265324_100422062 341
798 3300031238 Ga0265332_10031843 Ga0265332_100318431 341
799 3300031241 Ga0265325_10000013 Ga0265325_1000001375 341
800 3300031242 Ga0265329_10016138 Ga0265329_100161382 341
801 3300031249 Ga0265339_10002954 Ga0265339_100029545 341
802 3300031250 Ga0265331_10004749 Ga0265331_100047495 341
803 3300031595 Ga0265313_10001257 Ga0265313_1000125713 341
804 3300031711 Ga0265314_10050087 Ga0265314_100500872 341
805 3300031730 Ga0307516_10151342 Ga0307516_101513422 341
806 3300031824 Ga0307413_10261391 Ga0307413_102613912 341
807 3300031824 Ga0307413_10345277 Ga0307413_103452771 341
808 3300031852 Ga0307410_10056114 Ga0307410_100561142 341
809 3300031852 Ga0307410_10341821 Ga0307410_103418212 341
810 3300031901 Ga0307406_10243332 Ga0307406_102433321 341
811 3300031903 Ga0307407_10083325 Ga0307407_100833251 341
812 3300031903 Ga0307407_10098478 Ga0307407_100984781 341
813 3300031995 Ga0307409_100077166 Ga0307409_1000771661 341
814 3300031995 Ga0307409_100231204 Ga0307409_1002312041 341
815 3300032004 Ga0307414_10239309 Ga0307414_102393091 341
816 3300032126 Ga0307415_100020123 Ga0307415_1000201234 341
817 3300034816 Ga0373930_0000010 Ga0373930_0000010_8573_9604 341
818 3300034818 Ga0373950_0002582 Ga0373950_0002582_371_1402 341
819 3300034819 Ga0373958_0000473 Ga0373958_0000473_769_1800 341
820 3300034820 Ga0373959_0013484 Ga0373959_0013484_356_1387 341
821 3300034957 Ga0373938_0000359 Ga0373938_0000359_1445_2476 341
822 3300034957 Ga0373938_0000382 Ga0373938_0000382_128_1159 341
823 3300035083 Ga0373926_0038599 Ga0373926_0038599_193_1227 341
824 3300035084 Ga0373928_0000051 Ga0373928_0000051_5135_6166 341
825 3300035084 Ga0373928_0011735 Ga0373928_0011735_343_1374 341
826 3300035085 Ga0373929_0001601 Ga0373929_0001601_72_1103 341
827 3300035088 Ga0373940_0000473 Ga0373940_0000473_2758_3789 341
828 3300035091 Ga0373951_0006787 Ga0373951_0006787_408_1439 341
829 3300035112 Ga0373932_0000029 Ga0373932_0000029_8978_10009 341
830 3300035114 Ga0373939_0001351 Ga0373939_0001351_2424_3455 341
831 3300035115 Ga0373941_0006937 Ga0373941_0006937_1047_2078 341
832 3300035115 Ga0373941_0008310 Ga0373941_0008310_359_1390 341
833 3300035121 Ga0373960_0000286 Ga0373960_0000286_7683_8714 341
834 3300035170 Ga0373943_0008340 Ga0373943_0008340_3441_4478 341
835 3300035170 Ga0373943_0022363 Ga0373943_0022363_1694_2728 341
836 3300035207 Ga0373942_0001638 Ga0373942_0001638_393_1424 341
837 3300035241 Ga0373961_0002909 Ga0373961_0002909_2969_4000 341
838 3300035410 Ga0373924_0010170 Ga0373924_0010170_951_1985 341
839 3300035725 Ga0373947_0006648 Ga0373947_0006648_2604_3641 341
840 3300036401 Ga0373937_0003491 Ga0373937_0003491_9288_10322 341
841 3300036401 Ga0373937_0088737 Ga0373937_0088737_148_1185 341
842 3300036401 Ga0373937_0144323 Ga0373937_0144323_840_1868 341
843 3300037068 Ga0373925_0030651 Ga0373925_0030651_881_1918 341
844 3300037068 Ga0373925_0220852 Ga0373925_0220852_454_1488 341
845 3300037853 Ga0436364_1488005 Ga0436364_1488005_298_1329 341
846 3300039438 Ga0436360_0949519 Ga0436360_0949519_407_1435 341
847 3300039447 Ga0436361_0587873 Ga0436361_0587873_654_1682 341
848 3300039453 Ga0436362_1038272 Ga0436362_1038272_206_1234 341
849 3300042012 Ga0439455_0030746 Ga0439455_0030746_83_1114 341
850 3300044656 Ga0466969_0005103 Ga0466969_0005103_4404_5429 341
851 3300044683 Ga0466965_0043234 Ga0466965_0043234_40_1074 341
852 3300044694 Ga0466963_0011909 Ga0466963_0011909_2660_3691 341
853 3300044694 Ga0466963_0013805 Ga0466963_0013805_2755_3819 341
854 3300044765 Ga0466970_0105336 Ga0466970_0105336_395_1420 341
855 3300044901 Ga0466960_0002189 Ga0466960_0002189_3330_4373 341
856 3300044901 Ga0466960_0011892 Ga0466960_0011892_1953_2987 341
857 3300045049 Ga0466959_0041124 Ga0466959_0041124_670_1695 341
858 3300045049 Ga0466959_0083864 Ga0466959_0083864_1189_2214 341
859 3300045051 Ga0451576_0033888 Ga0451576_0033888_2692_3723 341
860 3300045976 Ga0466967_0002394 Ga0466967_0002394_4477_5508 341
861 3300045976 Ga0466967_0029513 Ga0466967_0029513_275_1315 341
862 3300045976 Ga0466967_0086244 Ga0466967_0086244_316_1380 341
863 3300045976 Ga0466967_0157769 Ga0466967_0157769_241_1275 341
864 3300045976 Ga0466967_0341970 Ga0466967_0341970_151_1185 341
865 3300045976 Ga0466967_0415083 Ga0466967_0415083_219_1253 341
866 3300046454 Ga0495592_0019255 Ga0495592_0019255_1040_2065 341
867 3300046455 Ga0495603_0079516 Ga0495603_0079516_13_1044 341
868 3300046462 Ga0495651_0002648 Ga0495651_0002648_3767_4801 341
869 3300046472 Ga0495580_0133640 Ga0495580_0133640_345_1382 341
870 3300046473 Ga0495582_0095460 Ga0495582_0095460_25_1179 341
871 3300046476 Ga0495662_0045724 Ga0495662_0045724_778_1812 341
872 3300046477 Ga0495664_0114731 Ga0495664_0114731_60_1094 341
873 3300046491 Ga0495584_0061122 Ga0495584_0061122_577_1620 341
874 3300046499 Ga0495594_0062434 Ga0495594_0062434_40_1077 341
875 3300046507 Ga0495606_0000235 Ga0495606_0000235_40113_41147 341
876 3300046517 Ga0495630_0162095 Ga0495630_0162095_510_1547 341
877 3300046520 Ga0495637_0055657 Ga0495637_0055657_198_1229 341
878 3300046526 Ga0495666_0030836 Ga0495666_0030836_232_1266 341
879 3300046529 Ga0495652_0026042 Ga0495652_0026042_1406_2440 341
880 3300046529 Ga0495652_0035851 Ga0495652_0035851_2439_3470 341
881 3300046533 Ga0495640_0048972 Ga0495640_0048972_1467_2501 341
882 3300046536 Ga0495587_0030822 Ga0495587_0030822_1009_2043 341
883 3300046536 Ga0495587_0066006 Ga0495587_0066006_747_1781 341
884 3300046539 Ga0495621_0009048 Ga0495621_0009048_830_1861 341
885 3300046543 Ga0495645_0008661 Ga0495645_0008661_3194_4228 341
886 3300046663 Ga0495635_0090052 Ga0495635_0090052_220_1257 341
887 3300046675 Ga0495657_0003468 Ga0495657_0003468_4019_5053 341
888 3300046678 Ga0495599_0002704 Ga0495599_0002704_7615_8649 341
889 3300046681 Ga0495647_0001586 Ga0495647_0001586_1348_2502 341
890 3300046683 Ga0495658_0020633 Ga0495658_0020633_2197_3351 341
891 3300046683 Ga0495658_0058036 Ga0495658_0058036_137_1171 341
892 3300046683 Ga0495658_0138285 Ga0495658_0138285_16_1059 341
893 3300046684 Ga0495669_0063128 Ga0495669_0063128_622_1653 341
894 3300046690 Ga0495624_0070243 Ga0495624_0070243_573_1607 341
895 3300046809 Ga0495600_0003534 Ga0495600_0003534_7138_8172 341
896 3300047315 Ga0495581_0032717 Ga0495581_0032717_40_1194 341
897 3300047317 Ga0495604_0003208 Ga0495604_0003208_7892_8926 341
898 3300047319 Ga0495674_0025703 Ga0495674_0025703_3448_4482 341
899 3300047319 Ga0495674_0078508 Ga0495674_0078508_269_1297 341
900 3300047319 Ga0495674_0216934 Ga0495674_0216934_427_1461 341
901 3300047319 Ga0495674_0331247 Ga0495674_0331247_74_1117 341
902 3300047322 Ga0495680_0082397 Ga0495680_0082397_381_1415 341
903 3300047444 Ga0495675_0028598 Ga0495675_0028598_1545_2579 341
904 3300047471 Ga0495684_0147037 Ga0495684_0147037_266_1300 341
905 3300048903 Ga0496100_0010368 Ga0496100_0010368_544_1587 341
906 3300048903 Ga0496100_0124859 Ga0496100_0124859_172_1206 341
907 3300048904 Ga0496101_0083446 Ga0496101_0083446_242_1285 341
908 3300048904 Ga0496101_0227704 Ga0496101_0227704_33_1067 341
909 3300048905 Ga0496102_0044546 Ga0496102_0044546_1918_2961 341
910 3300048905 Ga0496102_0275635 Ga0496102_0275635_107_1138 341
911 3300048906 Ga0496103_0020228 Ga0496103_0020228_1141_2172 341
912 3300048907 Ga0496104_0000079 Ga0496104_0000079_23349_24404 341
913 3300048907 Ga0496104_0012241 Ga0496104_0012241_6494_7531 341
914 3300048908 Ga0496105_0000225 Ga0496105_0000225_18626_19681 341
915 3300048908 Ga0496105_0022493 Ga0496105_0022493_931_1965 341
916 3300048908 Ga0496105_0026740 Ga0496105_0026740_155_1198 341
917 3300048908 Ga0496105_0031651 Ga0496105_0031651_2598_3641 341
918 3300048908 Ga0496105_0058639 Ga0496105_0058639_1924_2961 341
919 3300048908 Ga0496105_0270530 Ga0496105_0270530_191_1234 341
920 3300048909 Ga0496106_0004035 Ga0496106_0004035_1981_3012 341
921 3300048909 Ga0496106_0013164 Ga0496106_0013164_1181_2215 341
922 3300048909 Ga0496106_0082901 Ga0496106_0082901_1405_2439 341
923 3300048910 Ga0496107_0065792 Ga0496107_0065792_915_1949 341
924 3300048911 Ga0496108_0002378 Ga0496108_0002378_3927_4961 341
925 3300048911 Ga0496108_0013499 Ga0496108_0013499_4182_5216 341
926 3300048911 Ga0496108_0047716 Ga0496108_0047716_1274_2317 341
927 3300048911 Ga0496108_0114586 Ga0496108_0114586_555_1598 341
928 3300048911 Ga0496108_0190531 Ga0496108_0190531_35_1078 341
929 3300048912 Ga0496109_0000431 Ga0496109_0000431_34215_35249 341
930 3300048912 Ga0496109_0006256 Ga0496109_0006256_7691_8734 341
931 3300048912 Ga0496109_0100135 Ga0496109_0100135_44_1078 341
932 3300048913 Ga0496110_0000404 Ga0496110_0000404_21815_22849 341
933 3300048913 Ga0496110_0005542 Ga0496110_0005542_5805_6848 341
934 3300048913 Ga0496110_0033215 Ga0496110_0033215_2884_3918 341
935 3300048913 Ga0496110_0175997 Ga0496110_0175997_23_1057 341
936 3300048913 Ga0496110_0200105 Ga0496110_0200105_525_1568 341
937 3300048914 Ga0496111_0001811 Ga0496111_0001811_3630_4664 341
938 3300048914 Ga0496111_0018492 Ga0496111_0018492_2240_3274 341
939 3300048914 Ga0496111_0028971 Ga0496111_0028971_131_1162 341
940 3300048914 Ga0496111_0086679 Ga0496111_0086679_824_1867 341
941 3300048915 Ga0496112_0037614 Ga0496112_0037614_1934_2968 341
942 3300048916 Ga0496113_0050969 Ga0496113_0050969_226_1269 341
943 3300048916 Ga0496113_0191055 Ga0496113_0191055_442_1476 341
944 3300048917 Ga0496114_0000984 Ga0496114_0000984_7221_8264 341
945 3300048917 Ga0496114_0041936 Ga0496114_0041936_680_1720 341
946 3300048917 Ga0496114_0237038 Ga0496114_0237038_124_1158 341
947 3300048918 Ga0496115_0008122 Ga0496115_0008122_6139_7170 341
948 3300048918 Ga0496115_0024668 Ga0496115_0024668_393_1436 341
949 3300048918 Ga0496115_0024867 Ga0496115_0024867_2250_3293 341
950 3300048918 Ga0496115_0144524 Ga0496115_0144524_898_1935 341
951 3300048924 Ga0496121_0223572 Ga0496121_0223572_266_1297 341
952 3300048929 Ga0496126_0166664 Ga0496126_0166664_647_1678 341
953 3300049568 Ga0501031_0085848 Ga0501031_0085848_633_1694 341
954 3300049569 Ga0501032_0038717 Ga0501032_0038717_1543_2604 341
955 3300049570 Ga0501033_0216233 Ga0501033_0216233_231_1292 341
956 3300049571 Ga0501034_0001160 Ga0501034_0001160_15912_16940 341
957 3300049571 Ga0501034_0005371 Ga0501034_0005371_1636_2697 341
958 3300049571 Ga0501034_0008354 Ga0501034_0008354_3509_4543 341
959 3300049571 Ga0501034_0044598 Ga0501034_0044598_1726_2787 341
960 3300049572 Ga0501036_0009460 Ga0501036_0009460_4206_5267 341
961 3300049572 Ga0501036_0101514 Ga0501036_0101514_444_1472 341
962 3300049573 Ga0501037_0015609 Ga0501037_0015609_3021_4082 341
963 3300049573 Ga0501037_0033088 Ga0501037_0033088_1737_2798 341
964 3300049574 Ga0501038_0014002 Ga0501038_0014002_2878_3939 341
965 3300049574 Ga0501038_0265642 Ga0501038_0265642_74_1135 341
966 3300049575 Ga0501039_0016919 Ga0501039_0016919_267_1295 341
967 3300049575 Ga0501039_0020033 Ga0501039_0020033_3462_4523 341
968 3300049575 Ga0501039_0035193 Ga0501039_0035193_1775_2836 341
969 3300049575 Ga0501039_0058789 Ga0501039_0058789_1446_2477 341
970 3300049575 Ga0501039_0341802 Ga0501039_0341802_43_1080 341
971 3300049576 Ga0501040_0032965 Ga0501040_0032965_1291_2319 341
972 3300049576 Ga0501040_0075300 Ga0501040_0075300_641_1684 341
973 3300049576 Ga0501040_0121335 Ga0501040_0121335_231_1262 341
974 3300049577 Ga0501041_0005970 Ga0501041_0005970_5730_6758 341
975 3300049577 Ga0501041_0018919 Ga0501041_0018919_2531_3577 341
976 3300049578 Ga0501042_0009911 Ga0501042_0009911_3685_4713 341
977 3300049579 Ga0501043_0004264 Ga0501043_0004264_1901_2962 341
978 3300049580 Ga0501046_0015650 Ga0501046_0015650_3020_4081 341
979 3300049581 Ga0501047_0003796 Ga0501047_0003796_9065_10126 341
980 3300049581 Ga0501047_0081802 Ga0501047_0081802_1900_2931 341
981 3300049582 Ga0501048_0004933 Ga0501048_0004933_8569_9597 341
982 3300049582 Ga0501048_0205115 Ga0501048_0205115_256_1293 341
983 3300049583 Ga0501067_0072465 Ga0501067_0072465_177_1238 341
984 3300049584 Ga0501068_0156172 Ga0501068_0156172_227_1255 341
985 3300049585 Ga0501069_0026965 Ga0501069_0026965_478_1509 341
986 3300049586 Ga0501070_0014067 Ga0501070_0014067_3423_4484 341
987 3300049586 Ga0501070_0086715 Ga0501070_0086715_1163_2197 341
988 3300049587 Ga0501071_0006146 Ga0501071_0006146_404_1432 341
989 3300049587 Ga0501071_0087628 Ga0501071_0087628_632_1660 341
990 3300049587 Ga0501071_0105785 Ga0501071_0105785_523_1554 341
991 3300049587 Ga0501071_0204364 Ga0501071_0204364_154_1200 341
992 3300049588 Ga0501072_0007105 Ga0501072_0007105_4069_5097 341
993 3300049588 Ga0501072_0055631 Ga0501072_0055631_484_1530 341
994 3300049588 Ga0501072_0161565 Ga0501072_0161565_39_1070 341
995 3300049588 Ga0501072_0219358 Ga0501072_0219358_307_1350 341
996 3300049589 Ga0501073_0039837 Ga0501073_0039837_1853_2914 341
997 3300049589 Ga0501073_0065821 Ga0501073_0065821_451_1482 341
998 3300049589 Ga0501073_0178092 Ga0501073_0178092_337_1398 341
999 3300049590 Ga0501074_0018041 Ga0501074_0018041_21_1052 341
1000 3300049590 Ga0501074_0156722 Ga0501074_0156722_159_1220 341
1001 3300049591 Ga0501075_0001865 Ga0501075_0001865_8155_9183 341
1002 3300049591 Ga0501075_0051007 Ga0501075_0051007_245_1291 341
1003 3300049592 Ga0501076_0011334 Ga0501076_0011334_1647_2684 341
1004 3300049592 Ga0501076_0024149 Ga0501076_0024149_1129_2175 341
1005 3300049592 Ga0501076_0036253 Ga0501076_0036253_2358_3386 341
1006 3300049592 Ga0501076_0050972 Ga0501076_0050972_1333_2361 341
1007 3300049592 Ga0501076_0113793 Ga0501076_0113793_1075_2118 341
1008 3300049592 Ga0501076_0192682 Ga0501076_0192682_258_1289 341
1009 3300049593 Ga0501077_0005310 Ga0501077_0005310_389_1417 341
1010 3300049593 Ga0501077_0032564 Ga0501077_0032564_202_1239 341
1011 3300049741 Ga0501079_0000619 Ga0501079_0000619_18451_19488 341
1012 3300049741 Ga0501079_0014520 Ga0501079_0014520_4339_5367 341
1013 3300049741 Ga0501079_0083003 Ga0501079_0083003_989_2020 341
1014 3300049742 Ga0501080_0004495 Ga0501080_0004495_9354_10415 341
1015 3300049742 Ga0501080_0075692 Ga0501080_0075692_777_1814 341
1016 3300049742 Ga0501080_0163581 Ga0501080_0163581_510_1538 341
1017 3300049743 Ga0501081_0012526 Ga0501081_0012526_2868_3896 341
1018 3300049743 Ga0501081_0033644 Ga0501081_0033644_601_1638 341
1019 3300049744 Ga0501083_0003052 Ga0501083_0003052_10053_11114 341
1020 3300049744 Ga0501083_0062365 Ga0501083_0062365_1026_2087 341
1021 3300049744 Ga0501083_0062602 Ga0501083_0062602_1405_2442 341
1022 3300049822 Ga0501035_0032177 Ga0501035_0032177_1107_2168 341
1023 3300049822 Ga0501035_0037832 Ga0501035_0037832_319_1350 341
1024 3300049822 Ga0501035_0234685 Ga0501035_0234685_84_1145 341
1025 3300049822 Ga0501035_0298136 Ga0501035_0298136_198_1226 341
1026 3300049823 Ga0501044_0006986 Ga0501044_0006986_153_1214 341
1027 3300049823 Ga0501044_0291707 Ga0501044_0291707_106_1167 341
1028 3300049824 Ga0501045_0025250 Ga0501045_0025250_389_1417 341
1029 3300050492 nmdc:mga0yw44_10989_c1 nmdc:mga0yw44_10989_c1_2237_3277 341
1030 3300050492 nmdc:mga0yw44_518_c1 nmdc:mga0yw44_518_c1_431_1468 341
1031 3300050495 nmdc:mga04h51_20217_c1 nmdc:mga04h51_20217_c1_671_1714 341
1032 3300050507 nmdc:mga05p37_113639_c1 nmdc:mga05p37_113639_c1_821_1852 341
1033 3300050508 nmdc:mga09592_189506_c1 nmdc:mga09592_189506_c1_691_1722 341
1034 3300050508 nmdc:mga09592_70931_c1 nmdc:mga09592_70931_c1_1259_2293 341
1035 3300050509 nmdc:mga0qj67_128_c1 nmdc:mga0qj67_128_c1_45869_46912 341
1036 3300050509 nmdc:mga0qj67_368758_c1 nmdc:mga0qj67_368758_c1_90_1121 341
1037 3300050510 nmdc:mga06r32_373217_c1 nmdc:mga06r32_373217_c1_340_1371 341
1038 3300050510 nmdc:mga06r32_8458_c1 nmdc:mga06r32_8458_c1_3256_4290 341
1039 3300050511 nmdc:mga08y16_25662_c1 nmdc:mga08y16_25662_c1_2473_3516 341
1040 3300050511 nmdc:mga08y16_2695_c1 nmdc:mga08y16_2695_c1_1040_2071 341
1041 3300050511 nmdc:mga08y16_3376_c1 nmdc:mga08y16_3376_c1_8549_9580 341
1042 3300050511 nmdc:mga08y16_69875_c1 nmdc:mga08y16_69875_c1_2422_3453 341
1043 3300050512 nmdc:mga0n895_152535_c1 nmdc:mga0n895_152535_c1_162_1190 341
1044 3300050512 nmdc:mga0n895_613259_c1 nmdc:mga0n895_613259_c1_25_1059 341
1045 3300050515 nmdc:mga0a205_15943_c1 nmdc:mga0a205_15943_c1_4606_5637 341
1046 3300053077 Ga0495601_0002422 Ga0495601_0002422_5801_6835 341
1047 3300053077 Ga0495601_0004361 Ga0495601_0004361_2121_3146 341
1048 3300053077 Ga0495601_0067998 Ga0495601_0067998_576_1610 341
1049 3300053078 Ga0495612_0034541 Ga0495612_0034541_672_1706 341
1050 3300053084 Ga0495595_0011344 Ga0495595_0011344_1505_2539 341
1051 3300053085 Ga0495619_0005083 Ga0495619_0005083_4837_5871 341
1052 3300053085 Ga0495619_0034643 Ga0495619_0034643_1493_2527 341
1053 3300053085 Ga0495619_0063009 Ga0495619_0063009_1228_2289 341
1054 3300053108 Ga0500562_005243 Ga0500562_005243_2124_3164 341
1055 3300053142 Ga0500577_0090498 Ga0500577_0090498_133_1167 341
1056 3300053153 Ga0500616_0003880 Ga0500616_0003880_2837_3871 341
1057 3300053153 Ga0500616_0055484 Ga0500616_0055484_337_1377 341
1058 3300053153 Ga0500616_0071653 Ga0500616_0071653_489_1523 341
1059 3300054114 Ga0501084_0045457 Ga0501084_0045457_817_1863 341
1060 3300054114 Ga0501084_0058284 Ga0501084_0058284_1397_2434 341
1061 3300054114 Ga0501084_0068538 Ga0501084_0068538_1053_2084 341
1062 3300054114 Ga0501084_0131836 Ga0501084_0131836_1017_2045 341
1063 3300054114 Ga0501084_0141473 Ga0501084_0141473_624_1667 341
1064 3300060353 Ga0501082_0007416 Ga0501082_0007416_3250_4287 341
1065 3300060353 Ga0501082_0009328 Ga0501082_0009328_4463_5509 341
1066 3300060353 Ga0501082_0021675 Ga0501082_0021675_3147_4175 341
1067 3300060353 Ga0501082_0082013 Ga0501082_0082013_1726_2769 341
1068 3300060353 Ga0501082_0330858 Ga0501082_0330858_57_1100 341
1069 3300061734 Ga0530510_0000189 Ga0530510_0000189_28139_29167 341
1070 iso_pu_bacteria 2836160341 2836163534 341
1071 3300005328 Ga0070676_10056879 Ga0070676_100568793 342
1072 3300005336 Ga0070680_100031720 Ga0070680_1000317202 342
1073 3300005339 Ga0070660_100057366 Ga0070660_1000573663 342
1074 3300005353 Ga0070669_100125771 Ga0070669_1001257711 342
1075 3300005355 Ga0070671_100068146 Ga0070671_1000681463 342
1076 3300005355 Ga0070671_100092034 Ga0070671_1000920342 342
1077 3300005365 Ga0070688_100007425 Ga0070688_1000074253 342
1078 3300005439 Ga0070711_100121467 Ga0070711_1001214671 342
1079 3300005458 Ga0070681_10228157 Ga0070681_102281571 342
1080 3300005458 Ga0070681_10303473 Ga0070681_103034732 342
1081 3300005530 Ga0070679_100025920 Ga0070679_1000259205 342
1082 3300006042 Ga0075368_10061938 Ga0075368_100619382 342
1083 3300006178 Ga0075367_10013590 Ga0075367_100135904 342
1084 3300006186 Ga0075369_10043313 Ga0075369_100433132 342
1085 3300006846 Ga0075430_100036460 Ga0075430_1000364602 342
1086 3300006847 Ga0075431_100055380 Ga0075431_1000553801 342
1087 3300009094 Ga0111539_10135670 Ga0111539_101356703 342
1088 3300009147 Ga0114129_10331077 Ga0114129_103310773 342
1089 3300013307 Ga0157372_10506431 Ga0157372_105064312 342
1090 3300021388 Ga0213875_10042248 Ga0213875_100422482 342
1091 3300025912 Ga0207707_10159603 Ga0207707_101596032 342
1092 3300025916 Ga0207663_10035215 Ga0207663_100352152 342
1093 3300025917 Ga0207660_10018534 Ga0207660_100185342 342
1094 3300025919 Ga0207657_10107046 Ga0207657_101070464 342
1095 3300025921 Ga0207652_10029498 Ga0207652_100294985 342
1096 3300025923 Ga0207681_10228407 Ga0207681_102284071 342
1097 3300025934 Ga0207686_10172311 Ga0207686_101723112 342
1098 3300025935 Ga0207709_10006983 Ga0207709_100069834 342
1099 3300025941 Ga0207711_10026504 Ga0207711_100265042 342
1100 3300025972 Ga0207668_10165692 Ga0207668_101656922 342
1101 3300027866 Ga0209813_10052768 Ga0209813_100527682 342
1102 3300027907 Ga0207428_10083926 Ga0207428_100839262 342
1103 3300031235 Ga0265330_10044615 Ga0265330_100446151 342
1104 3300031241 Ga0265325_10048275 Ga0265325_100482752 342
1105 3300031711 Ga0265314_10001589 Ga0265314_1000158914 342
1106 3300031712 Ga0265342_10012601 Ga0265342_100126012 342
1107 3300035118 Ga0373954_0027386 Ga0373954_0027386_169_1197 342
1108 3300035172 Ga0373955_0158784 Ga0373955_0158784_211_1239 342
1109 3300035242 Ga0373962_0002954 Ga0373962_0002954_1012_2043 342
1110 3300036401 Ga0373937_0231436 Ga0373937_0231436_124_1158 342
1111 3300037853 Ga0436364_0854666 Ga0436364_0854666_1660_2781 342
1112 3300037853 Ga0436364_1245108 Ga0436364_1245108_747_1805 342
1113 3300039450 Ga0436363_1341155 Ga0436363_1341155_466_1497 342
1114 3300046454 Ga0495592_0006154 Ga0495592_0006154_7058_8086 342
1115 3300046459 Ga0495629_0042647 Ga0495629_0042647_1273_2301 342
1116 3300046462 Ga0495651_0015269 Ga0495651_0015269_4475_5503 342
1117 3300046514 Ga0495618_0023173 Ga0495618_0023173_1862_2890 342
1118 3300046516 Ga0495628_0021637 Ga0495628_0021637_2251_3279 342
1119 3300046517 Ga0495630_0073754 Ga0495630_0073754_693_1724 342
1120 3300046529 Ga0495652_0028177 Ga0495652_0028177_3182_4210 342
1121 3300046531 Ga0495665_0011193 Ga0495665_0011193_1004_2035 342
1122 3300046536 Ga0495587_0003732 Ga0495587_0003732_1496_2524 342
1123 3300046543 Ga0495645_0058355 Ga0495645_0058355_123_1151 342
1124 3300046557 Ga0495622_0012565 Ga0495622_0012565_2634_3683 342
1125 3300046642 Ga0495634_0018741 Ga0495634_0018741_2767_3798 342
1126 3300046663 Ga0495635_0240248 Ga0495635_0240248_137_1165 342
1127 3300047317 Ga0495604_0007187 Ga0495604_0007187_1443_2471 342
1128 3300047322 Ga0495680_0012986 Ga0495680_0012986_60_1088 342
1129 3300047444 Ga0495675_0022611 Ga0495675_0022611_2710_3738 342
1130 3300048088 Ga0495602_0012633 Ga0495602_0012633_2129_3157 342
1131 3300048088 Ga0495602_0130000 Ga0495602_0130000_878_1933 342
1132 3300048903 Ga0496100_0031225 Ga0496100_0031225_749_1780 342
1133 3300048904 Ga0496101_0002910 Ga0496101_0002910_580_1611 342
1134 3300048905 Ga0496102_0013854 Ga0496102_0013854_2422_3453 342
1135 3300048908 Ga0496105_0002363 Ga0496105_0002363_9524_10555 342
1136 3300048909 Ga0496106_0087444 Ga0496106_0087444_1192_2223 342
1137 3300048912 Ga0496109_0034098 Ga0496109_0034098_1412_2443 342
1138 3300048913 Ga0496110_0003688 Ga0496110_0003688_10339_11370 342
1139 3300048916 Ga0496113_0238978 Ga0496113_0238978_284_1315 342
1140 3300048918 Ga0496115_0028299 Ga0496115_0028299_2374_3405 342
1141 3300049743 Ga0501081_0233682 Ga0501081_0233682_26_1105 342
1142 3300050509 nmdc:mga0qj67_159193_c1 nmdc:mga0qj67_159193_c1_279_1310 342
1143 3300050510 nmdc:mga06r32_211253_c1 nmdc:mga06r32_211253_c1_851_1879 342
1144 3300050511 nmdc:mga08y16_147581_c1 nmdc:mga08y16_147581_c1_285_1316 342
1145 3300053077 Ga0495601_0002289 Ga0495601_0002289_7478_8506 342
1146 3300053084 Ga0495595_0006272 Ga0495595_0006272_388_1443 342
1147 3300053085 Ga0495619_0009760 Ga0495619_0009760_3086_4114 342
1148 3300053085 Ga0495619_0015356 Ga0495619_0015356_3565_4593 342
1149 3300053096 Ga0500641_0005976 Ga0500641_0005976_1568_2599 342
1150 3300053117 Ga0500593_002098 Ga0500593_002098_5018_6097 342
1151 iso_pu_bacteria 8054472261 8054476227 342
1152 2209111006 2214781327 2213804219 343
1153 3300000041 ARcpr5oldR_c000072 ARcpr5oldR_00007215 343
1154 3300000042 ARSoilYngRDRAFT_c00041 ARSoilYngRDRAFT_000412 343
1155 3300000043 ARcpr5yngRDRAFT_c000026 ARcpr5yngRDRAFT_00002622 343
1156 3300000044 ARSoilOldRDRAFT_c000019 ARSoilOldRDRAFT_00001937 343
1157 3300000044 ARSoilOldRDRAFT_c000214 ARSoilOldRDRAFT_0002143 343
1158 3300000045 ARCol0oldRDRAFT_c00215 ARCol0oldRDRAFT_002152 343
1159 3300000652 ARCol0yngRDRAFT_1000004 ARCol0yngRDRAFT_10000047 343
1160 3300001976 JGI24752J21851_1006723 JGI24752J21851_10067232 343
1161 3300001977 JGI24746J21847_1000362 JGI24746J21847_10003622 343
1162 3300001989 JGI24739J22299_10001029 JGI24739J22299_100010296 343
1163 3300002070 JGI24750J21931_1001118 JGI24750J21931_10011182 343
1164 3300002075 JGI24738J21930_10000204 JGI24738J21930_100002046 343
1165 3300002076 JGI24749J21850_1000588 JGI24749J21850_10005882 343
1166 3300002126 JGI24035J26624_1004583 JGI24035J26624_10045832 343
1167 3300002155 JGI24033J26618_1001233 JGI24033J26618_10012332 343
1168 3300002239 JGI24034J26672_10002177 JGI24034J26672_100021772 343
1169 3300002244 JGI24742J22300_10000800 JGI24742J22300_100008002 343
1170 3300003215 JGI25153J46596_10008839 JGI25153J46596_100088393 343
1171 3300003215 JGI25153J46596_10038412 JGI25153J46596_100384122 343
1172 3300003792 Ga0055540_1003555 Ga0055540_10035556 343
1173 3300003794 Ga0055531_10009397 Ga0055531_100093975 343
1174 3300003911 JGI25405J52794_10017595 JGI25405J52794_100175951 343
1175 3300005277 Ga0065716_1001727 Ga0065716_10017272 343
1176 3300005293 Ga0065715_10013903 Ga0065715_100139032 343
1177 3300005293 Ga0065715_10021203 Ga0065715_100212032 343
1178 3300005295 Ga0065707_10090617 Ga0065707_100906172 343
1179 3300005327 Ga0070658_10067625 Ga0070658_100676252 343
1180 3300005329 Ga0070683_100005380 Ga0070683_1000053802 343
1181 3300005330 Ga0070690_100038393 Ga0070690_1000383932 343
1182 3300005330 Ga0070690_100210249 Ga0070690_1002102491 343
1183 3300005331 Ga0070670_100079320 Ga0070670_1000793202 343
1184 3300005333 Ga0070677_10000229 Ga0070677_1000022914 343
1185 3300005334 Ga0068869_100004650 Ga0068869_1000046505 343
1186 3300005334 Ga0068869_100103040 Ga0068869_1001030401 343
1187 3300005335 Ga0070666_10040728 Ga0070666_100407282 343
1188 3300005335 Ga0070666_10100616 Ga0070666_101006162 343
1189 3300005336 Ga0070680_100014162 Ga0070680_1000141623 343
1190 3300005336 Ga0070680_100043928 Ga0070680_1000439282 343
1191 3300005338 Ga0068868_100056127 Ga0068868_1000561273 343
1192 3300005339 Ga0070660_100161156 Ga0070660_1001611562 343
1193 3300005340 Ga0070689_100101275 Ga0070689_1001012752 343
1194 3300005340 Ga0070689_100130549 Ga0070689_1001305492 343
1195 3300005347 Ga0070668_100000683 Ga0070668_10000068314 343
1196 3300005353 Ga0070669_100000634 Ga0070669_10000063421 343
1197 3300005353 Ga0070669_100017336 Ga0070669_1000173363 343
1198 3300005354 Ga0070675_100000582 Ga0070675_1000005826 343
1199 3300005354 Ga0070675_100082781 Ga0070675_1000827812 343
1200 3300005355 Ga0070671_100006866 Ga0070671_1000068662 343
1201 3300005355 Ga0070671_100015677 Ga0070671_1000156774 343
1202 3300005355 Ga0070671_100102289 Ga0070671_1001022891 343
1203 3300005356 Ga0070674_100012128 Ga0070674_1000121282 343
1204 3300005356 Ga0070674_100015205 Ga0070674_1000152053 343
1205 3300005356 Ga0070674_100079147 Ga0070674_1000791472 343
1206 3300005364 Ga0070673_100121261 Ga0070673_1001212612 343
1207 3300005364 Ga0070673_100153362 Ga0070673_1001533622 343
1208 3300005366 Ga0070659_100329901 Ga0070659_1003299011 343
1209 3300005367 Ga0070667_100087240 Ga0070667_1000872403 343
1210 3300005406 Ga0070703_10007686 Ga0070703_100076862 343
1211 3300005434 Ga0070709_10030915 Ga0070709_100309151 343
1212 3300005434 Ga0070709_10102459 Ga0070709_101024592 343
1213 3300005434 Ga0070709_10112641 Ga0070709_101126412 343
1214 3300005437 Ga0070710_10104697 Ga0070710_101046972 343
1215 3300005439 Ga0070711_100058916 Ga0070711_1000589162 343
1216 3300005440 Ga0070705_100077004 Ga0070705_1000770041 343
1217 3300005441 Ga0070700_100001484 Ga0070700_1000014846 343
1218 3300005455 Ga0070663_100003347 Ga0070663_1000033472 343
1219 3300005455 Ga0070663_100132766 Ga0070663_1001327662 343
1220 3300005456 Ga0070678_100023437 Ga0070678_1000234372 343
1221 3300005457 Ga0070662_100115868 Ga0070662_1001158682 343
1222 3300005458 Ga0070681_10002535 Ga0070681_100025358 343
1223 3300005458 Ga0070681_10025070 Ga0070681_100250705 343
1224 3300005458 Ga0070681_10295152 Ga0070681_102951522 343
1225 3300005459 Ga0068867_100010360 Ga0068867_1000103602 343
1226 3300005530 Ga0070679_100006811 Ga0070679_1000068115 343
1227 3300005530 Ga0070679_100062671 Ga0070679_1000626714 343
1228 3300005530 Ga0070679_100144214 Ga0070679_1001442142 343
1229 3300005535 Ga0070684_100000334 Ga0070684_10000033423 343
1230 3300005536 Ga0070697_100112295 Ga0070697_1001122952 343
1231 3300005543 Ga0070672_100000261 Ga0070672_1000002616 343
1232 3300005545 Ga0070695_100051449 Ga0070695_1000514492 343
1233 3300005547 Ga0070693_100254898 Ga0070693_1002548981 343
1234 3300005548 Ga0070665_100025882 Ga0070665_1000258825 343
1235 3300005564 Ga0070664_100000892 Ga0070664_10000089216 343
1236 3300005578 Ga0068854_100002291 Ga0068854_1000022913 343
1237 3300005578 Ga0068854_100008595 Ga0068854_1000085952 343
1238 3300005615 Ga0070702_100000852 Ga0070702_1000008526 343
1239 3300005616 Ga0068852_100331252 Ga0068852_1003312522 343
1240 3300005617 Ga0068859_100131549 Ga0068859_1001315492 343
1241 3300005718 Ga0068866_10020987 Ga0068866_100209872 343
1242 3300005842 Ga0068858_100152923 Ga0068858_1001529232 343
1243 3300005842 Ga0068858_100210766 Ga0068858_1002107662 343
1244 3300005843 Ga0068860_100263200 Ga0068860_1002632002 343
1245 3300005937 Ga0081455_10000059 Ga0081455_100000599 343
1246 3300005937 Ga0081455_10010735 Ga0081455_100107354 343
1247 3300005937 Ga0081455_10024461 Ga0081455_100244612 343
1248 3300005937 Ga0081455_10136564 Ga0081455_101365642 343
1249 3300006038 Ga0075365_10230445 Ga0075365_102304452 343
1250 3300006048 Ga0075363_100124669 Ga0075363_1001246692 343
1251 3300006051 Ga0075364_10013411 Ga0075364_100134113 343
1252 3300006051 Ga0075364_10029662 Ga0075364_100296621 343
1253 3300006175 Ga0070712_100034748 Ga0070712_1000347483 343
1254 3300006237 Ga0097621_100002975 Ga0097621_1000029756 343
1255 3300006358 Ga0068871_100000753 Ga0068871_1000007536 343
1256 3300006358 Ga0068871_100042364 Ga0068871_1000423642 343
1257 3300006844 Ga0075428_100531556 Ga0075428_1005315561 343
1258 3300006846 Ga0075430_100027908 Ga0075430_1000279083 343
1259 3300006846 Ga0075430_100197628 Ga0075430_1001976282 343
1260 3300006847 Ga0075431_100084954 Ga0075431_1000849543 343
1261 3300006847 Ga0075431_100294918 Ga0075431_1002949182 343
1262 3300006852 Ga0075433_10052432 Ga0075433_100524323 343
1263 3300006852 Ga0075433_10170887 Ga0075433_101708873 343
1264 3300006871 Ga0075434_100002917 Ga0075434_1000029174 343
1265 3300006871 Ga0075434_100020644 Ga0075434_1000206449 343
1266 3300006871 Ga0075434_100051329 Ga0075434_1000513292 343
1267 3300006871 Ga0075434_100064663 Ga0075434_1000646633 343
1268 3300006871 Ga0075434_100108133 Ga0075434_1001081332 343
1269 3300006871 Ga0075434_100183092 Ga0075434_1001830922 343
1270 3300006880 Ga0075429_100107786 Ga0075429_1001077863 343
1271 3300006881 Ga0068865_100002150 Ga0068865_1000021506 343
1272 3300006914 Ga0075436_100024257 Ga0075436_1000242573 343
1273 3300006914 Ga0075436_100253720 Ga0075436_1002537201 343
1274 3300006931 Ga0097620_100131546 Ga0097620_1001315462 343
1275 3300007076 Ga0075435_100012013 Ga0075435_1000120132 343
1276 3300007076 Ga0075435_100059356 Ga0075435_1000593562 343
1277 3300007076 Ga0075435_100115361 Ga0075435_1001153612 343
1278 3300007076 Ga0075435_100142338 Ga0075435_1001423382 343
1279 3300007076 Ga0075435_100267527 Ga0075435_1002675271 343
1280 3300007788 Ga0099795_10011344 Ga0099795_100113441 343
1281 3300009092 Ga0105250_10047027 Ga0105250_100470272 343
1282 3300009093 Ga0105240_10188892 Ga0105240_101888922 343
1283 3300009093 Ga0105240_10366359 Ga0105240_103663592 343
1284 3300009094 Ga0111539_10002924 Ga0111539_100029246 343
1285 3300009094 Ga0111539_10014188 Ga0111539_100141885 343
1286 3300009094 Ga0111539_10514241 Ga0111539_105142411 343
1287 3300009098 Ga0105245_10001287 Ga0105245_100012879 343
1288 3300009098 Ga0105245_10006616 Ga0105245_100066163 343
1289 3300009098 Ga0105245_10133493 Ga0105245_101334933 343
1290 3300009101 Ga0105247_10014111 Ga0105247_100141112 343
1291 3300009101 Ga0105247_10026290 Ga0105247_100262903 343
1292 3300009101 Ga0105247_10095960 Ga0105247_100959602 343
1293 3300009147 Ga0114129_10208552 Ga0114129_102085523 343
1294 3300009147 Ga0114129_10742768 Ga0114129_107427681 343
1295 3300009148 Ga0105243_10014167 Ga0105243_100141673 343
1296 3300009148 Ga0105243_10075012 Ga0105243_100750122 343
1297 3300009174 Ga0105241_10168711 Ga0105241_101687112 343
1298 3300009174 Ga0105241_10215363 Ga0105241_102153632 343
1299 3300009176 Ga0105242_10001180 Ga0105242_100011806 343
1300 3300009176 Ga0105242_10010724 Ga0105242_100107243 343
1301 3300009176 Ga0105242_10093773 Ga0105242_100937733 343
1302 3300009177 Ga0105248_10007763 Ga0105248_100077634 343
1303 3300009177 Ga0105248_10231193 Ga0105248_102311932 343
1304 3300009551 Ga0105238_10114643 Ga0105238_101146432 343
1305 3300009553 Ga0105249_10027235 Ga0105249_100272353 343
1306 3300011119 Ga0105246_10012735 Ga0105246_100127353 343
1307 3300012503 Ga0157313_1001503 Ga0157313_10015032 343
1308 3300013102 Ga0157371_10023911 Ga0157371_100239112 343
1309 3300013104 Ga0157370_10090019 Ga0157370_100900193 343
1310 3300013296 Ga0157374_10005719 Ga0157374_100057192 343
1311 3300013297 Ga0157378_10307183 Ga0157378_103071831 343
1312 3300013306 Ga0163162_10031020 Ga0163162_100310202 343
1313 3300013308 Ga0157375_10029014 Ga0157375_100290145 343
1314 3300014325 Ga0163163_10019181 Ga0163163_100191816 343
1315 3300014325 Ga0163163_10052938 Ga0163163_100529382 343
1316 3300014325 Ga0163163_10317732 Ga0163163_103177321 343
1317 3300014326 Ga0157380_10004561 Ga0157380_100045615 343
1318 3300014497 Ga0182008_10105232 Ga0182008_101052322 343
1319 3300014745 Ga0157377_10000275 Ga0157377_1000027523 343
1320 3300014968 Ga0157379_10011946 Ga0157379_100119464 343
1321 3300014969 Ga0157376_10002806 Ga0157376_100028065 343
1322 3300014969 Ga0157376_10055282 Ga0157376_100552822 343
1323 3300017792 Ga0163161_10005587 Ga0163161_100055872 343
1324 3300025271 Ga0207666_1000035 Ga0207666_100003523 343
1325 3300025297 Ga0209758_1000170 Ga0209758_100017013 343
1326 3300025297 Ga0209758_1000244 Ga0209758_100024443 343
1327 3300025298 Ga0209050_1007449 Ga0209050_10074493 343
1328 3300025303 Ga0209051_1001025 Ga0209051_10010256 343
1329 3300025304 Ga0209257_1007708 Ga0209257_10077086 343
1330 3300025885 Ga0207653_10037753 Ga0207653_100377532 343
1331 3300025893 Ga0207682_10000048 Ga0207682_1000004843 343
1332 3300025893 Ga0207682_10007593 Ga0207682_100075933 343
1333 3300025898 Ga0207692_10018741 Ga0207692_100187412 343
1334 3300025898 Ga0207692_10151266 Ga0207692_101512662 343
1335 3300025900 Ga0207710_10001310 Ga0207710_100013107 343
1336 3300025900 Ga0207710_10012529 Ga0207710_100125293 343
1337 3300025900 Ga0207710_10019316 Ga0207710_100193162 343
1338 3300025901 Ga0207688_10005003 Ga0207688_100050034 343
1339 3300025905 Ga0207685_10096156 Ga0207685_100961561 343
1340 3300025907 Ga0207645_10000528 Ga0207645_1000052824 343
1341 3300025907 Ga0207645_10120302 Ga0207645_101203022 343
1342 3300025911 Ga0207654_10031282 Ga0207654_100312823 343
1343 3300025912 Ga0207707_10003748 Ga0207707_100037487 343
1344 3300025912 Ga0207707_10008850 Ga0207707_100088505 343
1345 3300025912 Ga0207707_10025352 Ga0207707_100253521 343
1346 3300025913 Ga0207695_10219068 Ga0207695_102190682 343
1347 3300025915 Ga0207693_10025156 Ga0207693_100251562 343
1348 3300025915 Ga0207693_10025657 Ga0207693_100256573 343
1349 3300025916 Ga0207663_10091527 Ga0207663_100915272 343
1350 3300025916 Ga0207663_10132433 Ga0207663_101324332 343
1351 3300025917 Ga0207660_10000104 Ga0207660_1000010430 343
1352 3300025917 Ga0207660_10028864 Ga0207660_100288642 343
1353 3300025917 Ga0207660_10137083 Ga0207660_101370832 343
1354 3300025918 Ga0207662_10043826 Ga0207662_100438262 343
1355 3300025919 Ga0207657_10127058 Ga0207657_101270582 343
1356 3300025920 Ga0207649_10000141 Ga0207649_1000014151 343
1357 3300025921 Ga0207652_10001464 Ga0207652_1000146414 343
1358 3300025921 Ga0207652_10017422 Ga0207652_100174224 343
1359 3300025921 Ga0207652_10100723 Ga0207652_101007232 343
1360 3300025923 Ga0207681_10000545 Ga0207681_100005456 343
1361 3300025923 Ga0207681_10045462 Ga0207681_100454623 343
1362 3300025923 Ga0207681_10064306 Ga0207681_100643062 343
1363 3300025924 Ga0207694_10119190 Ga0207694_101191902 343
1364 3300025924 Ga0207694_10189650 Ga0207694_101896502 343
1365 3300025925 Ga0207650_10134417 Ga0207650_101344172 343
1366 3300025926 Ga0207659_10000052 Ga0207659_1000005269 343
1367 3300025926 Ga0207659_10206667 Ga0207659_102066671 343
1368 3300025927 Ga0207687_10000097 Ga0207687_100000976 343
1369 3300025927 Ga0207687_10001401 Ga0207687_100014019 343
1370 3300025927 Ga0207687_10041696 Ga0207687_100416962 343
1371 3300025931 Ga0207644_10003247 Ga0207644_100032476 343
1372 3300025931 Ga0207644_10310944 Ga0207644_103109441 343
1373 3300025932 Ga0207690_10000631 Ga0207690_100006316 343
1374 3300025933 Ga0207706_10003987 Ga0207706_100039879 343
1375 3300025933 Ga0207706_10084323 Ga0207706_100843232 343
1376 3300025934 Ga0207686_10001329 Ga0207686_100013296 343
1377 3300025935 Ga0207709_10000349 Ga0207709_1000034939 343
1378 3300025935 Ga0207709_10049000 Ga0207709_100490002 343
1379 3300025936 Ga0207670_10004250 Ga0207670_100042503 343
1380 3300025936 Ga0207670_10031128 Ga0207670_100311283 343
1381 3300025936 Ga0207670_10096391 Ga0207670_100963912 343
1382 3300025937 Ga0207669_10000547 Ga0207669_100005476 343
1383 3300025937 Ga0207669_10083246 Ga0207669_100832462 343
1384 3300025938 Ga0207704_10000156 Ga0207704_100001566 343
1385 3300025939 Ga0207665_10148214 Ga0207665_101482142 343
1386 3300025939 Ga0207665_10152692 Ga0207665_101526922 343
1387 3300025941 Ga0207711_10012562 Ga0207711_100125626 343
1388 3300025941 Ga0207711_10071359 Ga0207711_100713592 343
1389 3300025942 Ga0207689_10004056 Ga0207689_100040565 343
1390 3300025942 Ga0207689_10024172 Ga0207689_100241724 343
1391 3300025944 Ga0207661_10002308 Ga0207661_100023085 343
1392 3300025945 Ga0207679_10000035 Ga0207679_1000003545 343
1393 3300025949 Ga0207667_10095203 Ga0207667_100952032 343
1394 3300025949 Ga0207667_10266814 Ga0207667_102668142 343
1395 3300025960 Ga0207651_10000180 Ga0207651_1000018024 343
1396 3300025960 Ga0207651_10024699 Ga0207651_100246993 343
1397 3300025961 Ga0207712_10000807 Ga0207712_1000080714 343
1398 3300025972 Ga0207668_10000354 Ga0207668_100003546 343
1399 3300025981 Ga0207640_10000543 Ga0207640_1000054313 343
1400 3300025986 Ga0207658_10219067 Ga0207658_102190672 343
1401 3300026023 Ga0207677_10005782 Ga0207677_100057825 343
1402 3300026035 Ga0207703_10282222 Ga0207703_102822222 343
1403 3300026035 Ga0207703_10326533 Ga0207703_103265332 343
1404 3300026067 Ga0207678_10022900 Ga0207678_100229002 343
1405 3300026075 Ga0207708_10164029 Ga0207708_101640291 343
1406 3300026088 Ga0207641_10020028 Ga0207641_100200283 343
1407 3300026088 Ga0207641_10246716 Ga0207641_102467162 343
1408 3300026088 Ga0207641_10259616 Ga0207641_102596162 343
1409 3300026089 Ga0207648_10074439 Ga0207648_100744393 343
1410 3300026095 Ga0207676_10000540 Ga0207676_1000054022 343
1411 3300026095 Ga0207676_10053391 Ga0207676_100533912 343
1412 3300026116 Ga0207674_10096393 Ga0207674_100963933 343
1413 3300026118 Ga0207675_100003150 Ga0207675_10000315014 343
1414 3300026118 Ga0207675_100142185 Ga0207675_1001421852 343
1415 3300026121 Ga0207683_10002434 Ga0207683_100024347 343
1416 3300026121 Ga0207683_10007253 Ga0207683_100072535 343
1417 3300026121 Ga0207683_10050165 Ga0207683_100501652 343
1418 3300026142 Ga0207698_10002914 Ga0207698_100029143 343
1419 3300027682 Ga0209971_1003726 Ga0209971_10037263 343
1420 3300027695 Ga0209966_1004125 Ga0209966_10041252 343
1421 3300027907 Ga0207428_10000428 Ga0207428_100004286 343
1422 3300027907 Ga0207428_10003864 Ga0207428_100038648 343
1423 3300027907 Ga0207428_10004005 Ga0207428_1000400511 343
1424 3300027907 Ga0207428_10057093 Ga0207428_100570932 343
1425 3300028379 Ga0268266_10352011 Ga0268266_103520111 343
1426 3300028380 Ga0268265_10002724 Ga0268265_100027245 343
1427 3300028381 Ga0268264_10531519 Ga0268264_105315192 343
1428 3300028800 Ga0265338_10152408 Ga0265338_101524082 343
1429 3300031090 Ga0265760_10039350 Ga0265760_100393501 343
1430 3300031235 Ga0265330_10028591 Ga0265330_100285912 343
1431 3300031241 Ga0265325_10001165 Ga0265325_100011651 343
1432 3300031241 Ga0265325_10029862 Ga0265325_100298623 343
1433 3300031247 Ga0265340_10052559 Ga0265340_100525592 343
1434 3300031247 Ga0265340_10058996 Ga0265340_100589962 343
1435 3300031249 Ga0265339_10002695 Ga0265339_100026958 343
1436 3300031250 Ga0265331_10014815 Ga0265331_100148153 343
1437 3300031344 Ga0265316_10026462 Ga0265316_100264625 343
1438 3300031344 Ga0265316_10137922 Ga0265316_101379222 343
1439 3300031595 Ga0265313_10005447 Ga0265313_100054478 343
1440 3300031595 Ga0265313_10013163 Ga0265313_100131634 343
1441 3300031595 Ga0265313_10036030 Ga0265313_100360302 343
1442 3300031711 Ga0265314_10052185 Ga0265314_100521852 343
1443 3300034816 Ga0373930_0000010 Ga0373930_0000010_7532_8563 343
1444 3300034818 Ga0373950_0002582 Ga0373950_0002582_1412_2443 343
1445 3300034820 Ga0373959_0001728 Ga0373959_0001728_2316_3347 343
1446 3300034957 Ga0373938_0000359 Ga0373938_0000359_403_1434 343
1447 3300034957 Ga0373938_0000560 Ga0373938_0000560_16_1047 343
1448 3300035084 Ga0373928_0000051 Ga0373928_0000051_4094_5125 343
1449 3300035085 Ga0373929_0001601 Ga0373929_0001601_1113_2144 343
1450 3300035088 Ga0373940_0000473 Ga0373940_0000473_1717_2748 343
1451 3300035090 Ga0373949_0000971 Ga0373949_0000971_786_1817 343
1452 3300035091 Ga0373951_0006787 Ga0373951_0006787_1449_2480 343
1453 3300035092 Ga0373952_0005036 Ga0373952_0005036_947_1978 343
1454 3300035112 Ga0373932_0000029 Ga0373932_0000029_7937_8968 343
1455 3300035112 Ga0373932_0004506 Ga0373932_0004506_1066_2097 343
1456 3300035113 Ga0373936_0002692 Ga0373936_0002692_1673_2707 343
1457 3300035113 Ga0373936_0044697 Ga0373936_0044697_343_1374 343
1458 3300035113 Ga0373936_0057170 Ga0373936_0057170_175_1212 343
1459 3300035114 Ga0373939_0001168 Ga0373939_0001168_548_1579 343
1460 3300035114 Ga0373939_0001351 Ga0373939_0001351_3465_4496 343
1461 3300035114 Ga0373939_0023213 Ga0373939_0023213_151_1191 343
1462 3300035115 Ga0373941_0008310 Ga0373941_0008310_1400_2431 343
1463 3300035116 Ga0373945_0011303 Ga0373945_0011303_1664_2698 343
1464 3300035116 Ga0373945_0039511 Ga0373945_0039511_226_1263 343
1465 3300035117 Ga0373953_0000827 Ga0373953_0000827_4642_5676 343
1466 3300035117 Ga0373953_0003061 Ga0373953_0003061_82_1113 343
1467 3300035117 Ga0373953_0070247 Ga0373953_0070247_379_1416 343
1468 3300035117 Ga0373953_0095190 Ga0373953_0095190_10_1047 343
1469 3300035118 Ga0373954_0014467 Ga0373954_0014467_1253_2287 343
1470 3300035120 Ga0373957_0003712 Ga0373957_0003712_827_1861 343
1471 3300035120 Ga0373957_0009241 Ga0373957_0009241_1569_2624 343
1472 3300035121 Ga0373960_0000286 Ga0373960_0000286_6642_7673 343
1473 3300035121 Ga0373960_0000460 Ga0373960_0000460_189_1220 343
1474 3300035170 Ga0373943_0004919 Ga0373943_0004919_4644_5678 343
1475 3300035170 Ga0373943_0007025 Ga0373943_0007025_2201_3238 343
1476 3300035170 Ga0373943_0036556 Ga0373943_0036556_489_1526 343
1477 3300035171 Ga0373946_0005065 Ga0373946_0005065_2144_3181 343
1478 3300035172 Ga0373955_0000302 Ga0373955_0000302_1701_2735 343
1479 3300035172 Ga0373955_0055427 Ga0373955_0055427_67_1104 343
1480 3300035207 Ga0373942_0001638 Ga0373942_0001638_1434_2465 343
1481 3300035207 Ga0373942_0018126 Ga0373942_0018126_368_1414 343
1482 3300035241 Ga0373961_0012170 Ga0373961_0012170_376_1410 343
1483 3300035241 Ga0373961_0018596 Ga0373961_0018596_468_1499 343
1484 3300035242 Ga0373962_0003826 Ga0373962_0003826_260_1291 343
1485 3300035410 Ga0373924_0022451 Ga0373924_0022451_377_1408 343
1486 3300035410 Ga0373924_0037358 Ga0373924_0037358_240_1295 343
1487 3300035691 Ga0373931_0002280 Ga0373931_0002280_1023_2069 343
1488 3300035691 Ga0373931_0065846 Ga0373931_0065846_806_1837 343
1489 3300035692 Ga0373935_0000053 Ga0373935_0000053_29486_30520 343
1490 3300035692 Ga0373935_0012816 Ga0373935_0012816_2380_3417 343
1491 3300035692 Ga0373935_0038215 Ga0373935_0038215_1835_2869 343
1492 3300035695 Ga0373927_0005225 Ga0373927_0005225_192_1229 343
1493 3300035695 Ga0373927_0019729 Ga0373927_0019729_1006_2037 343
1494 3300035695 Ga0373927_0066100 Ga0373927_0066100_960_1997 343
1495 3300035695 Ga0373927_0292782 Ga0373927_0292782_19_1053 343
1496 3300035724 Ga0373933_0022154 Ga0373933_0022154_1531_2562 343
1497 3300035724 Ga0373933_0119576 Ga0373933_0119576_538_1575 343
1498 3300035725 Ga0373947_0000828 Ga0373947_0000828_10011_11045 343
1499 3300035725 Ga0373947_0002037 Ga0373947_0002037_834_1871 343
1500 3300036401 Ga0373937_0000030 Ga0373937_0000030_9146_10180 343
1501 3300036401 Ga0373937_0127022 Ga0373937_0127022_416_1447 343
1502 3300036401 Ga0373937_0212309 Ga0373937_0212309_47_1084 343
1503 3300036401 Ga0373937_0299236 Ga0373937_0299236_199_1236 343
1504 3300036401 Ga0373937_0378549 Ga0373937_0378549_132_1169 343
1505 3300037068 Ga0373925_0000002 Ga0373925_0000002_56096_57130 343
1506 3300037068 Ga0373925_0040549 Ga0373925_0040549_33_1064 343
1507 3300037068 Ga0373925_0073492 Ga0373925_0073492_1085_2122 343
1508 3300037068 Ga0373925_0106928 Ga0373925_0106928_1059_2096 343
1509 3300037068 Ga0373925_0142515 Ga0373925_0142515_394_1431 343
1510 3300041408 Ga0439453_0009017 Ga0439453_0009017_258_1292 343
1511 3300042122 Ga0450920_019614 Ga0450920_019614_20_1102 343
1512 3300042436 Ga0439435_0001485 Ga0439435_0001485_142_1233 343
1513 3300042876 Ga0451577_0036724 Ga0451577_0036724_2637_3668 343
1514 3300044712 Ga0453684_0110281 Ga0453684_0110281_206_1237 343
1515 3300045051 Ga0451576_0033888 Ga0451576_0033888_1651_2682 343
1516 3300045051 Ga0451576_0210842 Ga0451576_0210842_617_1648 343
1517 3300046454 Ga0495592_0000046 Ga0495592_0000046_91739_92773 343
1518 3300046454 Ga0495592_0032536 Ga0495592_0032536_61_1098 343
1519 3300046454 Ga0495592_0082313 Ga0495592_0082313_1270_2301 343
1520 3300046454 Ga0495592_0257037 Ga0495592_0257037_17_1060 343
1521 3300046455 Ga0495603_0016187 Ga0495603_0016187_900_1931 343
1522 3300046459 Ga0495629_0005868 Ga0495629_0005868_1925_2959 343
1523 3300046459 Ga0495629_0038526 Ga0495629_0038526_286_1323 343
1524 3300046459 Ga0495629_0194206 Ga0495629_0194206_192_1229 343
1525 3300046461 Ga0495641_0025340 Ga0495641_0025340_133_1164 343
1526 3300046462 Ga0495651_0004884 Ga0495651_0004884_5718_6755 343
1527 3300046462 Ga0495651_0009517 Ga0495651_0009517_1674_2708 343
1528 3300046462 Ga0495651_0077320 Ga0495651_0077320_112_1143 343
1529 3300046462 Ga0495651_0114436 Ga0495651_0114436_127_1164 343
1530 3300046463 Ga0495653_0000006 Ga0495653_0000006_56142_57176 343
1531 3300046463 Ga0495653_0032923 Ga0495653_0032923_2217_3254 343
1532 3300046472 Ga0495580_0035505 Ga0495580_0035505_1565_2596 343
1533 3300046473 Ga0495582_0066941 Ga0495582_0066941_220_1257 343
1534 3300046475 Ga0495639_0005510 Ga0495639_0005510_74_1105 343
1535 3300046475 Ga0495639_0085464 Ga0495639_0085464_199_1236 343
1536 3300046476 Ga0495662_0000442 Ga0495662_0000442_6618_7655 343
1537 3300046476 Ga0495662_0002559 Ga0495662_0002559_5334_6368 343
1538 3300046476 Ga0495662_0037664 Ga0495662_0037664_865_2007 343
1539 3300046477 Ga0495664_0000002 Ga0495664_0000002_91776_92810 343
1540 3300046477 Ga0495664_0007103 Ga0495664_0007103_610_1647 343
1541 3300046477 Ga0495664_0093085 Ga0495664_0093085_764_1795 343
1542 3300046491 Ga0495584_0012274 Ga0495584_0012274_3280_4317 343
1543 3300046499 Ga0495594_0064841 Ga0495594_0064841_72_1103 343
1544 3300046499 Ga0495594_0078170 Ga0495594_0078170_258_1310 343
1545 3300046501 Ga0495607_0011493 Ga0495607_0011493_3438_4475 343
1546 3300046511 Ga0495608_0000006 Ga0495608_0000006_121736_122770 343
1547 3300046511 Ga0495608_0038217 Ga0495608_0038217_984_2015 343
1548 3300046511 Ga0495608_0048409 Ga0495608_0048409_1013_2068 343
1549 3300046511 Ga0495608_0179704 Ga0495608_0179704_42_1079 343
1550 3300046514 Ga0495618_0000282 Ga0495618_0000282_4646_5680 343
1551 3300046514 Ga0495618_0003926 Ga0495618_0003926_2165_3202 343
1552 3300046514 Ga0495618_0171452 Ga0495618_0171452_243_1298 343
1553 3300046516 Ga0495628_0000002 Ga0495628_0000002_56059_57093 343
1554 3300046516 Ga0495628_0070394 Ga0495628_0070394_1143_2180 343
1555 3300046517 Ga0495630_0002442 Ga0495630_0002442_6495_7532 343
1556 3300046517 Ga0495630_0004276 Ga0495630_0004276_4983_6017 343
1557 3300046517 Ga0495630_0055096 Ga0495630_0055096_858_1889 343
1558 3300046517 Ga0495630_0057839 Ga0495630_0057839_1160_2197 343
1559 3300046517 Ga0495630_0144950 Ga0495630_0144950_322_1359 343
1560 3300046517 Ga0495630_0205726 Ga0495630_0205726_82_1113 343
1561 3300046517 Ga0495630_0327618 Ga0495630_0327618_81_1118 343
1562 3300046523 Ga0495644_0003568 Ga0495644_0003568_83_1120 343
1563 3300046529 Ga0495652_0000004 Ga0495652_0000004_531688_532722 343
1564 3300046529 Ga0495652_0023812 Ga0495652_0023812_1133_2170 343
1565 3300046529 Ga0495652_0029237 Ga0495652_0029237_2430_3467 343
1566 3300046529 Ga0495652_0145726 Ga0495652_0145726_411_1448 343
1567 3300046531 Ga0495665_0008886 Ga0495665_0008886_3611_4648 343
1568 3300046531 Ga0495665_0024369 Ga0495665_0024369_506_1543 343
1569 3300046531 Ga0495665_0039097 Ga0495665_0039097_84_1118 343
1570 3300046533 Ga0495640_0000007 Ga0495640_0000007_69422_70456 343
1571 3300046533 Ga0495640_0011879 Ga0495640_0011879_5369_6406 343
1572 3300046533 Ga0495640_0048972 Ga0495640_0048972_418_1449 343
1573 3300046533 Ga0495640_0051947 Ga0495640_0051947_1493_2530 343
1574 3300046533 Ga0495640_0143295 Ga0495640_0143295_163_1200 343
1575 3300046535 Ga0495586_0018105 Ga0495586_0018105_1959_2996 343
1576 3300046535 Ga0495586_0066723 Ga0495586_0066723_55_1092 343
1577 3300046536 Ga0495587_0000031 Ga0495587_0000031_56161_57195 343
1578 3300046536 Ga0495587_0028606 Ga0495587_0028606_2085_3122 343
1579 3300046543 Ga0495645_0000003 Ga0495645_0000003_37412_38446 343
1580 3300046543 Ga0495645_0092021 Ga0495645_0092021_719_1756 343
1581 3300046557 Ga0495622_0001438 Ga0495622_0001438_6831_7868 343
1582 3300046558 Ga0495633_0002841 Ga0495633_0002841_7090_8127 343
1583 3300046559 Ga0495667_0000002 Ga0495667_0000002_380528_381562 343
1584 3300046559 Ga0495667_0003122 Ga0495667_0003122_6754_7809 343
1585 3300046559 Ga0495667_0005910 Ga0495667_0005910_3508_4545 343
1586 3300046559 Ga0495667_0062649 Ga0495667_0062649_808_1839 343
1587 3300046615 Ga0495656_0002668 Ga0495656_0002668_1572_2609 343
1588 3300046642 Ga0495634_0000110 Ga0495634_0000110_61404_62438 343
1589 3300046642 Ga0495634_0010842 Ga0495634_0010842_4212_5249 343
1590 3300046642 Ga0495634_0168093 Ga0495634_0168093_203_1240 343
1591 3300046663 Ga0495635_0000022 Ga0495635_0000022_26444_27478 343
1592 3300046663 Ga0495635_0008146 Ga0495635_0008146_6092_7129 343
1593 3300046663 Ga0495635_0018363 Ga0495635_0018363_3013_4050 343
1594 3300046664 Ga0495659_0008016 Ga0495659_0008016_257_1294 343
1595 3300046665 Ga0495661_0137361 Ga0495661_0137361_254_1291 343
1596 3300046674 Ga0495588_0027486 Ga0495588_0027486_1051_2088 343
1597 3300046674 Ga0495588_0080788 Ga0495588_0080788_156_1208 343
1598 3300046674 Ga0495588_0101591 Ga0495588_0101591_267_1298 343
1599 3300046675 Ga0495657_0000276 Ga0495657_0000276_29540_30574 343
1600 3300046675 Ga0495657_0004587 Ga0495657_0004587_1322_2377 343
1601 3300046675 Ga0495657_0013572 Ga0495657_0013572_1093_2124 343
1602 3300046675 Ga0495657_0116582 Ga0495657_0116582_602_1639 343
1603 3300046678 Ga0495599_0000001 Ga0495599_0000001_194839_195873 343
1604 3300046678 Ga0495599_0024646 Ga0495599_0024646_2122_3153 343
1605 3300046678 Ga0495599_0085890 Ga0495599_0085890_875_1912 343
1606 3300046679 Ga0495623_0000094 Ga0495623_0000094_37347_38381 343
1607 3300046679 Ga0495623_0010464 Ga0495623_0010464_524_1555 343
1608 3300046680 Ga0495646_0000007 Ga0495646_0000007_40932_41966 343
1609 3300046680 Ga0495646_0006972 Ga0495646_0006972_2381_3418 343
1610 3300046680 Ga0495646_0028980 Ga0495646_0028980_2122_3153 343
1611 3300046681 Ga0495647_0004252 Ga0495647_0004252_2562_3593 343
1612 3300046681 Ga0495647_0017104 Ga0495647_0017104_376_1413 343
1613 3300046689 Ga0495613_0013528 Ga0495613_0013528_2762_3796 343
1614 3300046689 Ga0495613_0076804 Ga0495613_0076804_814_1851 343
1615 3300046689 Ga0495613_0136543 Ga0495613_0136543_87_1124 343
1616 3300046690 Ga0495624_0002983 Ga0495624_0002983_2180_3217 343
1617 3300046690 Ga0495624_0053649 Ga0495624_0053649_49_1086 343
1618 3300046691 Ga0495670_0001519 Ga0495670_0001519_6321_7358 343
1619 3300046794 Ga0495589_0037919 Ga0495589_0037919_1151_2188 343
1620 3300046809 Ga0495600_0000033 Ga0495600_0000033_26492_27526 343
1621 3300046809 Ga0495600_0036195 Ga0495600_0036195_113_1150 343
1622 3300047315 Ga0495581_0014639 Ga0495581_0014639_234_1268 343
1623 3300047317 Ga0495604_0000005 Ga0495604_0000005_81805_82839 343
1624 3300047317 Ga0495604_0062814 Ga0495604_0062814_872_1903 343
1625 3300047317 Ga0495604_0112733 Ga0495604_0112733_210_1247 343
1626 3300047317 Ga0495604_0221676 Ga0495604_0221676_244_1281 343
1627 3300047319 Ga0495674_0000003 Ga0495674_0000003_504931_505965 343
1628 3300047319 Ga0495674_0006865 Ga0495674_0006865_3961_4998 343
1629 3300047319 Ga0495674_0035370 Ga0495674_0035370_776_1807 343
1630 3300047319 Ga0495674_0081250 Ga0495674_0081250_286_1323 343
1631 3300047321 Ga0495676_0095089 Ga0495676_0095089_915_1946 343
1632 3300047322 Ga0495680_0000091 Ga0495680_0000091_43273_44307 343
1633 3300047322 Ga0495680_0083274 Ga0495680_0083274_1369_2400 343
1634 3300047444 Ga0495675_0000064 Ga0495675_0000064_17040_18074 343
1635 3300047444 Ga0495675_0077361 Ga0495675_0077361_389_1444 343
1636 3300047444 Ga0495675_0123113 Ga0495675_0123113_412_1443 343
1637 3300047447 Ga0495685_022451 Ga0495685_022451_876_2114 343
1638 3300047471 Ga0495684_0000035 Ga0495684_0000035_37314_38348 343
1639 3300047471 Ga0495684_0026809 Ga0495684_0026809_1050_2087 343
1640 3300047673 Ga0495593_0000184 Ga0495593_0000184_8898_9932 343
1641 3300048088 Ga0495602_0000029 Ga0495602_0000029_37304_38338 343
1642 3300048088 Ga0495602_0025265 Ga0495602_0025265_4640_5671 343
1643 3300048088 Ga0495602_0165725 Ga0495602_0165725_581_1615 343
1644 3300048088 Ga0495602_0301828 Ga0495602_0301828_13_1050 343
1645 3300048089 Ga0495614_0014077 Ga0495614_0014077_2085_3122 343
1646 3300048904 Ga0496101_0000218 Ga0496101_0000218_28777_29808 343
1647 3300048905 Ga0496102_0282620 Ga0496102_0282620_249_1304 343
1648 3300048906 Ga0496103_0005048 Ga0496103_0005048_3260_4291 343
1649 3300048907 Ga0496104_0007271 Ga0496104_0007271_3928_4959 343
1650 3300048908 Ga0496105_0004861 Ga0496105_0004861_4679_5710 343
1651 3300048909 Ga0496106_0004371 Ga0496106_0004371_2425_3456 343
1652 3300048909 Ga0496106_0013164 Ga0496106_0013164_2233_3264 343
1653 3300048910 Ga0496107_0003226 Ga0496107_0003226_4244_5275 343
1654 3300048911 Ga0496108_0009724 Ga0496108_0009724_1304_2335 343
1655 3300048911 Ga0496108_0033422 Ga0496108_0033422_2889_3920 343
1656 3300048912 Ga0496109_0000979 Ga0496109_0000979_14064_15095 343
1657 3300048912 Ga0496109_0080820 Ga0496109_0080820_519_1550 343
1658 3300048913 Ga0496110_0063037 Ga0496110_0063037_1377_2408 343
1659 3300048913 Ga0496110_0150105 Ga0496110_0150105_879_1910 343
1660 3300048915 Ga0496112_0066533 Ga0496112_0066533_1301_2335 343
1661 3300048915 Ga0496112_0129803 Ga0496112_0129803_1051_2082 343
1662 3300048915 Ga0496112_0301700 Ga0496112_0301700_268_1299 343
1663 3300048916 Ga0496113_0036794 Ga0496113_0036794_2302_3333 343
1664 3300048917 Ga0496114_0005533 Ga0496114_0005533_826_1857 343
1665 3300048917 Ga0496114_0019273 Ga0496114_0019273_3024_4055 343
1666 3300048918 Ga0496115_0029345 Ga0496115_0029345_3085_4116 343
1667 3300048924 Ga0496121_0109319 Ga0496121_0109319_94_1194 343
1668 3300048927 Ga0496124_0000007 Ga0496124_0000007_72939_74039 343
1669 3300049568 Ga0501031_0020750 Ga0501031_0020750_1798_2832 343
1670 3300049569 Ga0501032_0015061 Ga0501032_0015061_1151_2185 343
1671 3300049569 Ga0501032_0072812 Ga0501032_0072812_937_1971 343
1672 3300049570 Ga0501033_0027706 Ga0501033_0027706_1503_2537 343
1673 3300049570 Ga0501033_0066643 Ga0501033_0066643_442_1476 343
1674 3300049571 Ga0501034_0008354 Ga0501034_0008354_2478_3512 343
1675 3300049571 Ga0501034_0143035 Ga0501034_0143035_251_1285 343
1676 3300049572 Ga0501036_0052138 Ga0501036_0052138_831_1865 343
1677 3300049572 Ga0501036_0074633 Ga0501036_0074633_796_1830 343
1678 3300049573 Ga0501037_0059131 Ga0501037_0059131_911_1945 343
1679 3300049574 Ga0501038_0003531 Ga0501038_0003531_2505_3539 343
1680 3300049574 Ga0501038_0109396 Ga0501038_0109396_712_1749 343
1681 3300049575 Ga0501039_0038161 Ga0501039_0038161_2404_3438 343
1682 3300049575 Ga0501039_0047643 Ga0501039_0047643_1859_2896 343
1683 3300049578 Ga0501042_0055099 Ga0501042_0055099_110_1144 343
1684 3300049578 Ga0501042_0057961 Ga0501042_0057961_559_1596 343
1685 3300049579 Ga0501043_0092288 Ga0501043_0092288_1225_2259 343
1686 3300049579 Ga0501043_0120354 Ga0501043_0120354_170_1204 343
1687 3300049579 Ga0501043_0186081 Ga0501043_0186081_157_1197 343
1688 3300049580 Ga0501046_0002832 Ga0501046_0002832_14961_15995 343
1689 3300049580 Ga0501046_0085141 Ga0501046_0085141_736_1770 343
1690 3300049581 Ga0501047_0048749 Ga0501047_0048749_239_1273 343
1691 3300049581 Ga0501047_0107822 Ga0501047_0107822_338_1375 343
1692 3300049582 Ga0501048_0016788 Ga0501048_0016788_479_1513 343
1693 3300049582 Ga0501048_0035256 Ga0501048_0035256_2344_3378 343
1694 3300049582 Ga0501048_0106815 Ga0501048_0106815_746_1783 343
1695 3300049583 Ga0501067_0026107 Ga0501067_0026107_403_1437 343
1696 3300049584 Ga0501068_0111094 Ga0501068_0111094_158_1195 343
1697 3300049584 Ga0501068_0155246 Ga0501068_0155246_201_1235 343
1698 3300049585 Ga0501069_0018766 Ga0501069_0018766_1531_2565 343
1699 3300049586 Ga0501070_0052874 Ga0501070_0052874_175_1209 343
1700 3300049586 Ga0501070_0079554 Ga0501070_0079554_1083_2117 343
1701 3300049586 Ga0501070_0113346 Ga0501070_0113346_674_1714 343
1702 3300049586 Ga0501070_0122600 Ga0501070_0122600_724_1761 343
1703 3300049587 Ga0501071_0010823 Ga0501071_0010823_3327_4364 343
1704 3300049587 Ga0501071_0139416 Ga0501071_0139416_536_1570 343
1705 3300049588 Ga0501072_0022482 Ga0501072_0022482_3119_4156 343
1706 3300049588 Ga0501072_0032318 Ga0501072_0032318_1003_2052 343
1707 3300049588 Ga0501072_0035535 Ga0501072_0035535_525_1559 343
1708 3300049589 Ga0501073_0001397 Ga0501073_0001397_1264_2298 343
1709 3300049589 Ga0501073_0005419 Ga0501073_0005419_6859_7896 343
1710 3300049590 Ga0501074_0001516 Ga0501074_0001516_13643_14677 343
1711 3300049590 Ga0501074_0026879 Ga0501074_0026879_1850_2884 343
1712 3300049590 Ga0501074_0106364 Ga0501074_0106364_937_1971 343
1713 3300049741 Ga0501079_0023851 Ga0501079_0023851_851_1885 343
1714 3300049741 Ga0501079_0093255 Ga0501079_0093255_250_1287 343
1715 3300049742 Ga0501080_0007639 Ga0501080_0007639_3784_4818 343
1716 3300049742 Ga0501080_0046995 Ga0501080_0046995_1491_2525 343
1717 3300049742 Ga0501080_0049611 Ga0501080_0049611_2835_3869 343
1718 3300049742 Ga0501080_0264378 Ga0501080_0264378_124_1158 343
1719 3300049744 Ga0501083_0047509 Ga0501083_0047509_850_1884 343
1720 3300049744 Ga0501083_0058203 Ga0501083_0058203_1246_2280 343
1721 3300049744 Ga0501083_0063315 Ga0501083_0063315_105_1145 343
1722 3300049744 Ga0501083_0088092 Ga0501083_0088092_393_1427 343
1723 3300049744 Ga0501083_0138920 Ga0501083_0138920_173_1207 343
1724 3300049744 Ga0501083_0153386 Ga0501083_0153386_327_1376 343
1725 3300049744 Ga0501083_0242849 Ga0501083_0242849_44_1075 343
1726 3300049822 Ga0501035_0042958 Ga0501035_0042958_2609_3643 343
1727 3300049822 Ga0501035_0130658 Ga0501035_0130658_577_1611 343
1728 3300049823 Ga0501044_0000057 Ga0501044_0000057_97096_98130 343
1729 3300049823 Ga0501044_0035670 Ga0501044_0035670_42_1076 343
1730 3300049823 Ga0501044_0131314 Ga0501044_0131314_220_1257 343
1731 3300049823 Ga0501044_0133734 Ga0501044_0133734_1094_2128 343
1732 3300049824 Ga0501045_0045589 Ga0501045_0045589_1743_2777 343
1733 3300050490 nmdc:mga03n38_47109_c1 nmdc:mga03n38_47109_c1_225_1256 343
1734 3300050491 nmdc:mga00v17_3113_c1 nmdc:mga00v17_3113_c1_2645_3679 343
1735 3300050491 nmdc:mga00v17_46850_c1 nmdc:mga00v17_46850_c1_384_1424 343
1736 3300050492 nmdc:mga0yw44_196203_c1 nmdc:mga0yw44_196203_c1_167_1201 343
1737 3300050492 nmdc:mga0yw44_205810_c1 nmdc:mga0yw44_205810_c1_153_1187 343
1738 3300050493 nmdc:mga0k408_31173_c1 nmdc:mga0k408_31173_c1_126_1160 343
1739 3300050507 nmdc:mga05p37_218872_c1 nmdc:mga05p37_218872_c1_911_1942 343
1740 3300050507 nmdc:mga05p37_517529_c1 nmdc:mga05p37_517529_c1_170_1231 343
1741 3300050509 nmdc:mga0qj67_96091_c1 nmdc:mga0qj67_96091_c1_1153_2214 343
1742 3300050511 nmdc:mga08y16_232187_c1 nmdc:mga08y16_232187_c1_53_1177 343
1743 3300050511 nmdc:mga08y16_2695_c1 nmdc:mga08y16_2695_c1_2082_3113 343
1744 3300050511 nmdc:mga08y16_3376_c1 nmdc:mga08y16_3376_c1_9590_10621 343
1745 3300050511 nmdc:mga08y16_43429_c1 nmdc:mga08y16_43429_c1_1588_2622 343
1746 3300050511 nmdc:mga08y16_87078_c1 nmdc:mga08y16_87078_c1_1084_2145 343
1747 3300050512 nmdc:mga0n895_12777_c1 nmdc:mga0n895_12777_c1_5027_6058 343
1748 3300050512 nmdc:mga0n895_144070_c1 nmdc:mga0n895_144070_c1_222_1253 343
1749 3300050512 nmdc:mga0n895_150972_c1 nmdc:mga0n895_150972_c1_749_1810 343
1750 3300050512 nmdc:mga0n895_212817_c1 nmdc:mga0n895_212817_c1_48_1091 343
1751 3300050512 nmdc:mga0n895_30713_c1 nmdc:mga0n895_30713_c1_1701_2747 343
1752 3300050512 nmdc:mga0n895_42015_c1 nmdc:mga0n895_42015_c1_515_1552 343
1753 3300050513 nmdc:mga0rr50_122982_c1 nmdc:mga0rr50_122982_c1_831_1892 343
1754 3300050513 nmdc:mga0rr50_127352_c1 nmdc:mga0rr50_127352_c1_986_2023 343
1755 3300050513 nmdc:mga0rr50_160579_c1 nmdc:mga0rr50_160579_c1_574_1605 343
1756 3300050513 nmdc:mga0rr50_280446_c1 nmdc:mga0rr50_280446_c1_290_1324 343
1757 3300050513 nmdc:mga0rr50_47798_c1 nmdc:mga0rr50_47798_c1_1435_2481 343
1758 3300050513 nmdc:mga0rr50_6403_c1 nmdc:mga0rr50_6403_c1_4503_5564 343
1759 3300050514 nmdc:mga08x19_314327_c1 nmdc:mga08x19_314327_c1_25_1059 343
1760 3300050514 nmdc:mga08x19_65951_c1 nmdc:mga08x19_65951_c1_1230_2291 343
1761 3300050514 nmdc:mga08x19_76345_c1 nmdc:mga08x19_76345_c1_67_1113 343
1762 3300050515 nmdc:mga0a205_152846_c1 nmdc:mga0a205_152846_c1_529_1590 343
1763 3300050515 nmdc:mga0a205_15943_c1 nmdc:mga0a205_15943_c1_5648_6679 343
1764 3300053077 Ga0495601_0000008 Ga0495601_0000008_265547_266581 343
1765 3300053077 Ga0495601_0002242 Ga0495601_0002242_6024_7061 343
1766 3300053077 Ga0495601_0040636 Ga0495601_0040636_1010_2041 343
1767 3300053077 Ga0495601_0048388 Ga0495601_0048388_75_1112 343
1768 3300053077 Ga0495601_0122218 Ga0495601_0122218_459_1496 343
1769 3300053078 Ga0495612_0000026 Ga0495612_0000026_79378_80412 343
1770 3300053078 Ga0495612_0000112 Ga0495612_0000112_16411_17448 343
1771 3300053078 Ga0495612_0008235 Ga0495612_0008235_889_1920 343
1772 3300053078 Ga0495612_0011660 Ga0495612_0011660_199_1236 343
1773 3300053078 Ga0495612_0039819 Ga0495612_0039819_118_1152 343
1774 3300053078 Ga0495612_0072008 Ga0495612_0072008_300_1331 343
1775 3300053084 Ga0495595_0000024 Ga0495595_0000024_37421_38455 343
1776 3300053084 Ga0495595_0015850 Ga0495595_0015850_584_1621 343
1777 3300053084 Ga0495595_0058099 Ga0495595_0058099_610_1641 343
1778 3300053085 Ga0495619_0000002 Ga0495619_0000002_56164_57198 343
1779 3300053085 Ga0495619_0003971 Ga0495619_0003971_4838_5875 343
1780 3300053085 Ga0495619_0014040 Ga0495619_0014040_1852_2889 343
1781 3300053085 Ga0495619_0057178 Ga0495619_0057178_337_1374 343
1782 3300053096 Ga0500641_0001457 Ga0500641_0001457_5552_6586 343
1783 3300053153 Ga0500616_0001606 Ga0500616_0001606_5224_6333 343
1784 3300053153 Ga0500616_0008707 Ga0500616_0008707_2278_3312 343
1785 3300053158 Ga0500627_0023201 Ga0500627_0023201_15_1052 343
1786 3300054114 Ga0501084_0051527 Ga0501084_0051527_2021_3055 343
1787 3300054114 Ga0501084_0118518 Ga0501084_0118518_721_1755 343
1788 3300060353 Ga0501082_0009032 Ga0501082_0009032_4332_5366 343
1789 3300060353 Ga0501082_0009184 Ga0501082_0009184_3383_4423 343
1790 3300060353 Ga0501082_0031208 Ga0501082_0031208_1737_2774 343
1791 3300060353 Ga0501082_0189049 Ga0501082_0189049_202_1236 343
1792 3300061734 Ga0530510_0028519 Ga0530510_0028519_270_1307 343
1793 iso_pu_bacteria 2791354901 2791914161 343

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01717

Meth_synt_2

Cobalamin-independent synthase, Catalytic domain

21

355

0.82

PF01208

URO-D

Uroporphyrinogen decarboxylase (URO-D)

161

354

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
3rpd-assembly2.cif.gz_B the structure of a b12-independent methionine synthase from shewanella sp. w3-18-1 in complex with selenomethionine. 0.8995 3 342
3rpd-assembly2.cif.gz_B the structure of a b12-independent methionine synthase from shewanella sp. w3-18-1 in complex with selenomethionine. 0.8918 3 342
3ppc-assembly2.cif.gz_B crystal structure of the candida albicans methionine synthase by surface entropy reduction, tyrosine variant with zinc 0.8616 4 340
4l61-assembly1.cif.gz_A crystal structure of the candida albicans methionine synthase in complex with methionine 0.8548 4 339
1t7l-assembly1.cif.gz_A crystal structure of cobalamin-independent methionine synthase from t. maritima 0.8519 4 341
ID Description Score Start End Superfamily
af_K7MME4_84_171_3.20.20.210 Alpha Beta;Alpha-Beta Barrel;TIM Barrel; 0.9259 276 339 3.20.20.210
3rpdA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel; 0.8978 4 342 3.20.20.210
af_K7KK03_1_110_3.20.20.210 Alpha Beta;Alpha-Beta Barrel;TIM Barrel; 0.8828 248 340 3.20.20.210
3rpdA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel; 0.8773 4 342 3.20.20.210
4l61A02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel; 0.8552 4 339 3.20.20.210
ID Description Score Start End GO Terms
AF-A0A484UXH8-F1-model_v4 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase (EC 2.1.1.14) 0.9963 1 342 GO:0003871
GO:0008270
GO:0009086
GO:0032259
AF-A0A534D697-F1-model_v4 deleted 0.9949 81 342
AF-A0A536VUS0-F1-model_v4 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase 0.9947 3 208 GO:0003871
GO:0008270
GO:0009086
GO:0032259
AF-A0A536VUU1-F1-model_v4 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase 0.9936 218 342 GO:0003871
GO:0008270
GO:0009086
GO:0032259
AF-A0A438M8X0-F1-model_v4 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase 0.9935 76 343 GO:0003871
GO:0008270
GO:0009086
GO:0032259

Feature Viewer

pLDDT pTM Quality
93.63 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map