F495706

General Info

Members Datasets Scaffolds Average Seq Length
1788 584 1708 252

Family's Representative Sequence

Representative Sequence 3300013306|Ga0163162_10250967|Ga0163162_102509672
Length 285
Sequence VRAGCPLRDLRDQDERKGTTRFVIFAITDERKNMRIDVVTLFPEFVENCARIGVVGRAQERGLLQVAAWNPRDYAHDNYRRVDDRPFGGGPGMVMLIDPLRETIAAARAAASEPASVIYLSPQGAQLTQEKVRELAQRPRLVLLCGRYEGVDERLIAKVVDEELSIGDYVLSGGELAAAVVIDAIGRLQEGALNDAQSAQQDSFSDGLLDCPHYTRPERHEWGEVPAVLTSGDHAAIGRWRRQQALGRTWLRRPELLGMMTLSKDDQKLLFEFQQLNDNSTDGPR

Samples

Sample ID Description Type Environment
1 2511231006 Pseudomonas sp. GM17 Isolate Nodule
2 2511231015 Pseudomonas sp. GM49 Isolate Nodule
3 2511231023 Pseudomonas sp. GM80 Isolate Nodule
4 2511231031 Pseudomonas sp. GM16 Isolate Nodule
5 2512047018 Pseudomonas chlororaphis chlororaphis GP72 Isolate Rhizosphere
6 2513237150 Cupriavidus taiwanensis STM6018 Isolate Nodule
7 2513237165 Cupriavidus neocaledonicus STM6070 Isolate Nodule
8 2524614729 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
9 2537561836 Rhodanobacter spathiphylli B39 Isolate Unclassified
10 2554235341 Pseudomonas protegens CHA0 Isolate Rhizosphere
11 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
12 2593339238 Luteibacter sp. UNCMF366Tsu5.1 Isolate Unclassified
13 2593339239 Luteibacter sp. UNCMF331Sha3.1 Isolate Unclassified
14 2597489887 Pseudomonas chlororaphis aureofaciens 30-84 Isolate Rhizosphere
15 2599185185 Pseudomonas sp. NFPP07 Isolate Rhizoplane
16 2599185257 Pseudomonas sp. NFACC41-3 Isolate Rhizoplane
17 2600254931 Pseudomonas sp. NFIX28 Isolate Rhizoplane
18 2600254954 Pseudomonas sp. NFACC19-2 Isolate Rhizoplane
19 2600255389 Pseudomonas sp. NFPP33 Isolate Rhizoplane
20 2627854209 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
21 2643221562 Rhodanobacter sp. Root561 Isolate Unclassified
22 2643221577 Rhodanobacter sp. Root627 Isolate Unclassified
23 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
24 2643221685 Rhodanobacter sp. Root480 Isolate Unclassified
25 2671180172 Pseudomonas sp. NFIX51 Isolate Rhizoplane
26 2687453129 Halotalea alkalilenta IHB B 13600 Isolate Unclassified
27 2687453130 Dyella thiooxydans ATSB10 Isolate Unclassified
28 2713897148 Pseudomonas fluorescens SF39a Isolate Rhizosphere
29 2718217725 Pseudomonas fluorescens CREA-C16 Isolate Rhizosphere
30 2718218334 Luteibacter rhizovicinus LJ96 Isolate Rhizosphere
31 2734482264 Dyella sp. AD052 Isolate Unclassified
32 2738543009 Luteibacter sp. OK325 Isolate Unclassified
33 2738543025 Pseudomonas sp. GV091 Isolate Unclassified
34 2739367700 Dyella sp. YR388 Isolate Unclassified
35 2740892503 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
36 2808606379 Pseudomonas sp. SJZ079 Isolate Rhizosphere
37 2818991440 Luteibacter yeojuensis 583 Isolate Unclassified
38 2823421272 Pseudomonas mendocina S5.2 Isolate Rhizoplane
39 2842832357 Pseudomonas sp. R-72164 Isolate Unclassified
40 2842843487 Pseudomonas sp. R-72074 Isolate Unclassified
41 2842914999 Luteibacter sp. R-72151 Isolate Unclassified
42 2842918807 Luteibacter sp. R-73110 Isolate Unclassified
43 2846033681 Chromobacterium sinusclupearum MWU13-2610 Isolate Rhizosphere
44 2858688981 Cupriavidus sp. UYMMa02A Isolate Unclassified
45 2884338543 Luteibacter pinisoli MAH-14 Isolate Rhizosphere
46 2884411467 Dyella sp. AD56 Isolate Rhizosphere
47 2894414249 Luteimonas sp. LNNU 24178 Isolate Rhizosphere
48 2894510363 Methylomonas sp. Kb3 Isolate Unclassified
49 2895395659 Rhodanobacter sp. T12-5 Isolate Unclassified
50 2901300506 Cupriavidus sp. UYMSc13B Isolate Unclassified
51 2904463128 Luteibacter yeojuensis 3191 Isolate Unclassified
52 2919085039 Luteibacter sp. 1214 Isolate Unclassified
53 2919385768 Pseudomonas sp. 2957 Isolate Unclassified
54 2919404418 Luteibacter sp. 3190 Isolate Unclassified
55 2919487758 Pseudomonas koreensis 3441 Isolate Unclassified
56 2919501602 Pseudomonas alcaliphila 3512 Isolate Unclassified
57 2923153595 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
58 2926063275 Pseudomonas sp. 3400 Isolate Unclassified
59 2928963466 Dyella japonica 1073 Isolate Unclassified
60 2939611941 Rhodanobacter soli 1757 Isolate Rhizosphere
61 2941471342 Luteibacter sp. 621 Isolate Unclassified
62 2953994433 Luteibacter sp. W1I16 Isolate Rhizosphere
63 2969304461 Pseudomonas sp. R84 Isolate Rhizosphere
64 2974289157 Pseudomonas fluorescens SORGH_AS 191 Isolate Unclassified
65 2984286254 Pseudomonas chlororaphis aurantiaca JD37 Isolate Rhizosphere
66 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
67 2998344455 Vogesella urethralis SLBN-145 Isolate Rhizosphere
68 3007252601 Pseudomonas punonensis D1-6 Isolate Unclassified
69 3007315729 Pseudomonas argentinensis SA190 Isolate Unclassified
70 3007395558 Pseudomonas chlororaphis PCL1601 Isolate Rhizosphere
71 3007419365 Pseudomonas vanderleydeniana RW8P3 Isolate Unclassified
72 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
73 3007855910 Pseudomonas khorasanensis SWRI153 Isolate Rhizosphere
74 3007861166 Pseudomonas hamedanensis SWRI65 Isolate Rhizosphere
75 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
76 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
77 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
78 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
79 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
80 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
81 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
82 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
83 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
84 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
85 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
86 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
87 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
88 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
89 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
90 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
91 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
92 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
93 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
94 3300003565 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_16_lowP_mix3_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
95 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
96 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
97 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
98 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
99 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
100 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
101 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
102 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
103 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
104 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
105 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
106 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
107 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
108 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
109 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
110 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
111 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
112 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
113 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
114 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
115 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
116 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
117 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
118 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
119 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
120 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
121 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
122 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
123 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
124 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
125 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
126 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
127 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
128 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
129 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
130 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
131 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
132 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
133 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
134 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
135 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
136 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
137 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
138 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
139 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
140 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
141 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
142 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
143 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
144 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
145 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
146 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
147 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
148 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
149 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
150 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
151 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
152 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
153 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
154 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
155 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
156 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
157 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
158 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
159 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
160 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
161 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
162 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
163 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
164 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
165 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
166 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
167 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
168 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
169 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
170 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
171 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
172 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
173 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
174 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
175 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
176 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
177 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
178 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
179 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
180 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
181 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
182 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
183 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
184 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
185 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
186 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
187 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
188 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
189 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
190 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
191 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
192 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
193 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
194 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
195 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
196 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
197 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
198 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
199 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
200 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
201 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
202 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
203 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
204 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
205 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
206 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
207 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
208 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
209 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
210 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
211 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
212 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
213 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
214 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
215 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
216 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
217 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
218 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
219 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
220 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
221 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
222 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
223 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
224 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
225 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
226 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
227 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
228 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
229 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
230 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
231 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
232 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
233 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
234 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
235 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
236 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
237 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
238 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
239 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
240 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
241 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
242 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
243 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
244 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
245 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
246 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
247 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
248 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
249 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
250 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
251 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
252 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
253 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
254 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
255 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
256 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
257 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
258 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
259 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
260 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
261 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
262 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
263 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
264 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
265 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
266 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
267 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
268 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
269 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
270 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
271 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
272 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
273 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
274 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
275 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
276 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
277 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
278 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
279 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
280 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
281 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
282 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
283 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
284 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
285 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
286 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
287 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
288 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
289 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
290 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
291 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
292 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
293 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
294 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
295 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
296 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
297 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
298 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
299 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
300 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
301 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
302 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
303 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
304 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
305 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
306 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
307 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
308 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
309 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
310 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
311 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
312 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
313 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
314 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
315 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
316 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
317 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
318 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
319 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
320 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
321 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
322 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
323 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
324 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
325 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
326 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
327 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
328 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
329 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
330 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
331 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
332 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
333 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
334 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
335 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
336 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
337 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
338 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
339 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
340 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
341 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
342 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
343 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
344 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
345 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
346 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
347 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
348 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
349 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
350 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
351 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
352 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
353 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
354 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
355 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
356 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
357 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
358 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
359 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
360 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
361 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
362 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
363 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
364 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
365 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
366 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
367 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
368 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
369 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
370 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
371 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
372 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
373 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
374 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
375 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
376 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
377 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
378 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
379 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
380 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
381 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
382 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
383 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
384 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
385 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
386 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
387 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
388 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
389 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
390 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
391 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
392 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
393 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
394 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
395 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
396 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
397 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
398 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
399 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
400 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
401 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
402 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
403 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
404 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
405 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
406 3300041464 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaT Metatranscriptome Rhizoplane
407 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
408 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
409 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
410 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
411 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
412 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
413 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
414 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
415 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
416 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
417 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
418 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
419 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
420 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
421 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
422 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
423 3300044663 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA2E_TR Metagenome Unclassified
424 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
425 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
426 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
427 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
428 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
429 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
430 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
431 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
432 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
433 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
434 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
435 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
436 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
437 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
438 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
439 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
440 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
441 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
442 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
443 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
444 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
445 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
446 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
447 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
448 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
449 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
450 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
451 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
452 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
453 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
454 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
455 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
456 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
457 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
458 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
459 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
460 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
461 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
462 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
463 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
464 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
465 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
466 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
467 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
468 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
469 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
470 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
471 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
472 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
473 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
474 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
475 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
476 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
477 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
478 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
479 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
480 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
481 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
482 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
483 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
484 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
485 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
486 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
487 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
488 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
489 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
490 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
491 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
492 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
493 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
494 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
495 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
496 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
497 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
498 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
499 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
500 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
501 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
502 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
503 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
504 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
505 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
506 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
507 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
508 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
509 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
510 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
511 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
512 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
513 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
514 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
515 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
516 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
517 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
518 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
519 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
520 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
521 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
522 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
523 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
524 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
525 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
526 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
527 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
528 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
529 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
530 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
531 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
532 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
533 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
534 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
535 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
536 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
537 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
538 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
539 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
540 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
541 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
542 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
543 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
544 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
545 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
546 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
547 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
548 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
549 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
550 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
551 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
552 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
553 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
554 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
555 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
556 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
557 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
558 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
559 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
560 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
561 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
562 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
563 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
564 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
565 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
566 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
567 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
568 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
569 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
570 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
571 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
572 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
573 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
574 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
575 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
576 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
577 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
578 644736347 Cupriavidus taiwanensis LMG 19424 Isolate Nodule
579 8002745576 Marinomonas spartinae USM8 Isolate Rhizosphere
580 8015687852 Pseudomonas chlororaphis aurantiaca RP4 Isolate Rhizosphere
581 8029995093 Pseudomonas atacamensis SM1 Isolate Rhizosphere
582 8034962539 Pseudomonas sediminis PI11 Isolate Rhizosphere
583 8055770955 Pseudomonas chlororaphis qlu-1 Isolate Rhizosphere
584 8056166840 Pseudomonas triticicola SWRI88 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.33
Metatranscriptomes 4.14
Isolates 4.53

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.72
Nodule 0.56
Rhizoplane 1.96
Rhizosphere 80.82
Stem 0
Stem Tuber 0
Unclassified 7.94

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1006935 3300001904 Bacteria 1908
2 JGI24736J21556_1010588 3300001904 Bacteria 1505
3 JGI24741J21665_1001528 3300001915 Bacteria 6562
4 JGI24741J21665_1004362 3300001915 Bacteria 3153
5 JGI24741J21665_1009278 3300001915 Bacteria 1815
6 JGI24740J21852_10001136 3300001979 Bacteria 12037
7 JGI24740J21852_10003252 3300001979 Bacteria 7177
8 JGI24740J21852_10003557 3300001979 Bacteria 6822
9 JGI24739J22299_10002603 3300001989 Bacteria 6946
10 JGI24739J22299_10007598 3300001989 Bacteria 4061
11 JGI24737J22298_10000899 3300001990 Bacteria 10568
12 JGI24735J21928_10011929 3300002067 Bacteria 2750
13 JGI24744J21845_10016356 3300002077 Bacteria 1477
14 JGI25156J39149_1004589 3300002705 Bacteria 4170
15 JGI25156J39149_1010939 3300002705 Bacteria 2092
16 JGI25162J39368_1000029 3300002737 Bacteria 220066
17 JGI25162J39368_1000257 3300002737 Bacteria 50817
18 JGI25162J39368_1000686 3300002737 Bacteria 23602
19 JGI25162J39368_1005350 3300002737 Bacteria 2556
20 JGI25162J39368_1006243 3300002737 Bacteria 2102
21 JGI25154J39366_1002591 3300002738 Bacteria 4526
22 JGI25157J39369_1000996 3300002741 Bacteria 13204
23 JGI25157J39369_1001342 3300002741 Bacteria 9721
24 JGI25157J39369_1001369 3300002741 Bacteria 9520
25 JGI25157J39369_1002698 3300002741 Bacteria 4121
26 JGI25163J39215_1000989 3300002771 Bacteria 6283
27 JGI25164J39214_1000045 3300002772 Bacteria 125909
28 JGI25164J39214_1000202 3300002772 Bacteria 50817
29 JGI25164J39214_1001231 3300002772 Bacteria 6840
30 JGI25151J46595_10002568 3300003187 Bacteria 10754
31 JGI25151J46595_10011802 3300003187 Bacteria 4003
32 JGI25151J46595_10024630 3300003187 Bacteria 2460
33 JGI25165J46597_1000072 3300003214 Bacteria 192184
34 JGI25165J46597_1000361 3300003214 Bacteria 50817
35 JGI25165J46597_1002202 3300003214 Bacteria 6896
36 JGI25153J46596_10043492 3300003215 Bacteria 1359
37 rootH1_10003782 3300003316 Bacteria 1149
38 rootH1_10003782 3300003323 Bacteria 43069
39 rootH1_10052609 3300003316 Bacteria 2418
40 rootH2_10001711 3300003320 Bacteria 8039
41 rootL2_10105381 3300003322 Bacteria 1321
42 Ga0006560J51390_1028717 3300003565 Bacteria 1532
43 Ga0006562J51391_1014503 3300003578 Bacteria 8470
44 Ga0006562J51391_1014504 3300003578 Bacteria 8150
45 Ga0055538_1001576 3300003751 Bacteria 4171
46 Ga0055533_1000617 3300003756 Bacteria 12010
47 Ga0055533_1001801 3300003756 Bacteria 5386
48 Ga0055525_1000027 3300003759 Bacteria 340506
49 Ga0055527_1000293 3300003760 Bacteria 28864
50 Ga0055527_1000294 3300003760 Bacteria 28742
51 Ga0055527_1000694 3300003760 Bacteria 9781
52 Ga0055535_1000623 3300003761 Bacteria 28693
53 Ga0055535_1001746 3300003761 Bacteria 9711
54 Ga0055535_1002327 3300003761 Bacteria 6896
55 Ga0055535_1009433 3300003761 Bacteria 1683
56 Ga0055535_1009450 3300003761 Bacteria 1680
57 Ga0055542_1000329 3300003762 Bacteria 50369
58 Ga0055542_1000649 3300003762 Bacteria 28693
59 Ga0055542_1006140 3300003762 Bacteria 2606
60 Ga0055542_1006760 3300003762 Bacteria 2412
61 Ga0055542_1010547 3300003762 Bacteria 1683
62 Ga0055542_1010580 3300003762 Bacteria 1680
63 Ga0055529_1001508 3300003763 Bacteria 6779
64 Ga0055529_1002348 3300003763 Bacteria 3743
65 Ga0055529_1005126 3300003763 Bacteria 1927
66 Ga0055529_1006206 3300003763 Bacteria 1683
67 Ga0055529_1006222 3300003763 Bacteria 1680
68 Ga0055526_1000580 3300003771 Bacteria 28731
69 Ga0055526_1018820 3300003771 Bacteria 2553
70 Ga0055526_1026663 3300003771 Bacteria 1813
71 Ga0055537_1000822 3300003773 Bacteria 15242
72 Ga0055524_1001415 3300003775 Bacteria 13811
73 Ga0055524_1003597 3300003775 Bacteria 7473
74 Ga0055524_1013467 3300003775 Bacteria 3082
75 Ga0055536_1000020 3300003781 Bacteria 199649
76 Ga0055534_1000601 3300003784 Bacteria 18680
77 Ga0055534_1001148 3300003784 Bacteria 11208
78 Ga0055534_1003594 3300003784 Bacteria 4820
79 Ga0055528_1000050 3300003790 Bacteria 93078
80 Ga0055540_1025844 3300003792 Bacteria 1430
81 Ga0065165_1000587 3300005262 Bacteria 53507
82 Ga0065165_1003615 3300005262 Bacteria 10615
83 Ga0070658_10004423 3300005327 Bacteria 11448
84 Ga0070658_10079714 3300005327 Bacteria 2689
85 Ga0070658_10131004 3300005327 Bacteria 2090
86 Ga0070658_10297438 3300005327 Bacteria 1376
87 Ga0070658_10325742 3300005327 Bacteria 1312
88 Ga0070658_10400607 3300005327 Bacteria 1179
89 Ga0070658_10518964 3300005327 Bacteria 1030
90 Ga0070658_10694702 3300005327 Bacteria 883
91 Ga0070676_10000078 3300005328 Bacteria 33251
92 Ga0070676_10059283 3300005328 Bacteria 2270
93 Ga0070683_100119371 3300005329 Bacteria 2490
94 Ga0070683_100128406 3300005329 Bacteria 2398
95 Ga0070683_100184171 3300005329 Bacteria 1982
96 Ga0070683_100187357 3300005329 Bacteria 1964
97 Ga0070683_100318777 3300005329 Bacteria 1479
98 Ga0070683_100343947 3300005329 Bacteria 1420
99 Ga0070690_100204832 3300005330 Bacteria 1374
100 Ga0070690_100205152 3300005330 Bacteria 1373
101 Ga0070670_100009753 3300005331 Bacteria 8201
102 Ga0070670_100150273 3300005331 Bacteria 2016
103 Ga0070670_100366514 3300005331 Bacteria 1267
104 Ga0068869_100000679 3300005334 Bacteria 19236
105 Ga0068869_100046919 3300005334 Bacteria 3117
106 Ga0068869_100223687 3300005334 Bacteria 1493
107 Ga0070666_10000005 3300005335 Bacteria 343092
108 Ga0070666_10000109 3300005335 Bacteria 56796
109 Ga0070666_10003252 3300005335 Bacteria 9869
110 Ga0070666_10216277 3300005335 Bacteria 1351
111 Ga0070680_100002566 3300005336 Bacteria 13435
112 Ga0070680_100035951 3300005336 Bacteria 4000
113 Ga0070680_100085679 3300005336 Bacteria 2603
114 Ga0070680_100100598 3300005336 Bacteria 2399
115 Ga0070680_100150299 3300005336 Bacteria 1955
116 Ga0070680_100227890 3300005336 Bacteria 1573
117 Ga0070680_100600616 3300005336 Bacteria 944
118 Ga0070682_100001048 3300005337 Bacteria 15991
119 Ga0070682_100005998 3300005337 Bacteria 6800
120 Ga0070682_100011654 3300005337 Bacteria 5029
121 Ga0070682_100014093 3300005337 Bacteria 4616
122 Ga0070682_100026910 3300005337 Bacteria 3446
123 Ga0070682_100103446 3300005337 Bacteria 1884
124 Ga0070682_100265407 3300005337 Bacteria 1244
125 Ga0068868_100005961 3300005338 Bacteria 8596
126 Ga0068868_100045091 3300005338 Bacteria 3449
127 Ga0068868_100145667 3300005338 Bacteria 1947
128 Ga0068868_100183755 3300005338 Bacteria 1736
129 Ga0070660_100000369 3300005339 Bacteria 30058
130 Ga0070660_100035972 3300005339 Bacteria 3749
131 Ga0070660_100166347 3300005339 Bacteria 1779
132 Ga0070660_100206953 3300005339 Bacteria 1592
133 Ga0070689_100000503 3300005340 Bacteria 23097
134 Ga0070689_100463040 3300005340 Bacteria 1081
135 Ga0070691_10003685 3300005341 Bacteria 6921
136 Ga0070691_10004460 3300005341 Bacteria 6359
137 Ga0070691_10103569 3300005341 Bacteria 1416
138 Ga0070691_10119729 3300005341 Bacteria 1324
139 Ga0070691_10122129 3300005341 Bacteria 1312
140 Ga0070661_100000449 3300005344 Bacteria 31415
141 Ga0070661_100011087 3300005344 Bacteria 6277
142 Ga0070661_100027110 3300005344 Bacteria 4124
143 Ga0070661_100031058 3300005344 Bacteria 3862
144 Ga0070661_100037672 3300005344 Bacteria 3518
145 Ga0070661_100043927 3300005344 Bacteria 3264
146 Ga0070661_100132250 3300005344 Bacteria 1875
147 Ga0070661_100165830 3300005344 Bacteria 1675
148 Ga0070661_100673044 3300005344 Bacteria 841
149 Ga0070692_10001584 3300005345 Bacteria 8354
150 Ga0070692_10015943 3300005345 Bacteria 3565
151 Ga0070692_10018107 3300005345 Bacteria 3381
152 Ga0070692_10088543 3300005345 Bacteria 1679
153 Ga0070668_100013598 3300005347 Bacteria 6077
154 Ga0070668_100030062 3300005347 Bacteria 4129
155 Ga0070668_100068441 3300005347 Bacteria 2759
156 Ga0070668_100112657 3300005347 Bacteria 2166
157 Ga0070668_100193652 3300005347 Bacteria 1666
158 Ga0070668_100421454 3300005347 Bacteria 1143
159 Ga0070669_100068181 3300005353 Bacteria 2625
160 Ga0070669_100071564 3300005353 Bacteria 2566
161 Ga0070669_100197913 3300005353 Bacteria 1580
162 Ga0070675_100067894 3300005354 Bacteria 2951
163 Ga0070675_100106792 3300005354 Bacteria 2363
164 Ga0070675_100293549 3300005354 Bacteria 1431
165 Ga0070671_100070009 3300005355 Bacteria 2926
166 Ga0070671_100141142 3300005355 Bacteria 2033
167 Ga0070671_100183076 3300005355 Bacteria 1774
168 Ga0070674_100231432 3300005356 Bacteria 1442
169 Ga0070674_100520571 3300005356 Bacteria 993
170 Ga0070673_100033543 3300005364 Bacteria 3878
171 Ga0070673_100073836 3300005364 Bacteria 2747
172 Ga0070673_100266670 3300005364 Bacteria 1498
173 Ga0070688_100109365 3300005365 Bacteria 1836
174 Ga0070688_100376323 3300005365 Bacteria 1046
175 Ga0070659_100003864 3300005366 Bacteria 10672
176 Ga0070659_100035435 3300005366 Bacteria 3886
177 Ga0070659_100109214 3300005366 Bacteria 2232
178 Ga0070659_100179434 3300005366 Bacteria 1737
179 Ga0070659_100196476 3300005366 Bacteria 1659
180 Ga0070659_100277474 3300005366 Bacteria 1394
181 Ga0070659_100283525 3300005366 Bacteria 1378
182 Ga0070667_100000005 3300005367 Bacteria 347268
183 Ga0070667_100011088 3300005367 Bacteria 7456
184 Ga0070667_100018821 3300005367 Bacteria 5728
185 Ga0070667_100036335 3300005367 Bacteria 4130
186 Ga0070667_100258782 3300005367 Bacteria 1558
187 Ga0070667_100307674 3300005367 Bacteria 1428
188 Ga0070667_100321454 3300005367 Bacteria 1396
189 Ga0070667_100334108 3300005367 Bacteria 1369
190 Ga0070703_10012638 3300005406 Bacteria 2393
191 Ga0070714_100035856 3300005435 Bacteria 4158
192 Ga0070714_100115600 3300005435 Bacteria 2381
193 Ga0070713_100002641 3300005436 Bacteria 11680
194 Ga0070711_100190947 3300005439 Bacteria 1574
195 Ga0070705_100000292 3300005440 Bacteria 29837
196 Ga0070694_100088104 3300005444 Bacteria 2173
197 Ga0070694_100115209 3300005444 Bacteria 1920
198 Ga0070708_100018903 3300005445 Bacteria 5774
199 Ga0070708_100323608 3300005445 Bacteria 1452
200 Ga0070708_100414067 3300005445 Bacteria 1271
201 Ga0070708_100644124 3300005445 Bacteria 999
202 Ga0070663_100001614 3300005455 Bacteria 12448
203 Ga0070663_100002590 3300005455 Bacteria 10218
204 Ga0070663_100003691 3300005455 Bacteria 8879
205 Ga0070663_100003836 3300005455 Bacteria 8749
206 Ga0070663_100023092 3300005455 Bacteria 4164
207 Ga0070663_100027969 3300005455 Bacteria 3834
208 Ga0070663_100094637 3300005455 Bacteria 2219
209 Ga0070663_100226957 3300005455 Bacteria 1469
210 Ga0070663_100287362 3300005455 Bacteria 1312
211 Ga0070663_100411181 3300005455 Bacteria 1108
212 Ga0070663_100795687 3300005455 Bacteria 810
213 Ga0070678_100032720 3300005456 Bacteria 3602
214 Ga0070678_100068406 3300005456 Bacteria 2647
215 Ga0070662_100001136 3300005457 Bacteria 16279
216 Ga0070662_100043134 3300005457 Bacteria 3226
217 Ga0070662_100050898 3300005457 Bacteria 2989
218 Ga0070662_100066979 3300005457 Bacteria 2636
219 Ga0070662_100143413 3300005457 Bacteria 1853
220 Ga0070662_100171880 3300005457 Bacteria 1702
221 Ga0070681_10000122 3300005458 Bacteria 58332
222 Ga0070681_10003994 3300005458 Bacteria 13915
223 Ga0070681_10004905 3300005458 Bacteria 12843
224 Ga0070681_10044503 3300005458 Bacteria 4443
225 Ga0070681_10114722 3300005458 Bacteria 2632
226 Ga0070681_10121667 3300005458 Bacteria 2544
227 Ga0070681_10187020 3300005458 Bacteria 1991
228 Ga0070681_10348376 3300005458 Bacteria 1391
229 Ga0070681_10415251 3300005458 Bacteria 1257
230 Ga0070681_10453641 3300005458 Bacteria 1194
231 Ga0068867_100002791 3300005459 Bacteria 12281
232 Ga0068867_100014624 3300005459 Bacteria 5561
233 Ga0068867_100117777 3300005459 Bacteria 2048
234 Ga0068867_100273716 3300005459 Bacteria 1382
235 Ga0068867_100285344 3300005459 Bacteria 1355
236 Ga0070685_10007066 3300005466 Bacteria 5733
237 Ga0070685_10052180 3300005466 Bacteria 2366
238 Ga0070706_100015314 3300005467 Bacteria 7080
239 Ga0070706_100054339 3300005467 Bacteria 3696
240 Ga0070706_100067931 3300005467 Bacteria 3296
241 Ga0070707_100080966 3300005468 Bacteria 3135
242 Ga0070698_100012924 3300005471 Bacteria 8839
243 Ga0070698_100041165 3300005471 Bacteria 4744
244 Ga0070699_100024294 3300005518 Bacteria 5221
245 Ga0070699_100032858 3300005518 Bacteria 4482
246 Ga0070699_100102912 3300005518 Bacteria 2504
247 Ga0070679_100001153 3300005530 Bacteria 23132
248 Ga0070679_100001205 3300005530 Bacteria 22763
249 Ga0070679_100006031 3300005530 Bacteria 11275
250 Ga0070679_100029564 3300005530 Bacteria 5406
251 Ga0070679_100082714 3300005530 Bacteria 3200
252 Ga0070679_100157157 3300005530 Bacteria 2248
253 Ga0070679_100434738 3300005530 Bacteria 1257
254 Ga0070684_100004922 3300005535 Bacteria 10196
255 Ga0070684_100131879 3300005535 Bacteria 2254
256 Ga0070684_100256986 3300005535 Bacteria 1597
257 Ga0070697_100000561 3300005536 Bacteria 27986
258 Ga0070697_100017353 3300005536 Bacteria 5662
259 Ga0070697_100031854 3300005536 Bacteria 4243
260 Ga0070697_100228890 3300005536 Bacteria 1585
261 Ga0068853_100003605 3300005539 Bacteria 11857
262 Ga0068853_100015685 3300005539 Bacteria 6223
263 Ga0068853_100030340 3300005539 Bacteria 4566
264 Ga0068853_100030487 3300005539 Bacteria 4555
265 Ga0068853_100060929 3300005539 Bacteria 3262
266 Ga0068853_100062449 3300005539 Bacteria 3224
267 Ga0068853_100097425 3300005539 Bacteria 2596
268 Ga0068853_100098452 3300005539 Bacteria 2582
269 Ga0068853_100136503 3300005539 Bacteria 2199
270 Ga0068853_100139695 3300005539 Bacteria 2174
271 Ga0068853_100307837 3300005539 Bacteria 1466
272 Ga0068853_100487258 3300005539 Bacteria 1163
273 Ga0070672_100015511 3300005543 Bacteria 5428
274 Ga0070672_100022870 3300005543 Bacteria 4599
275 Ga0070672_100071348 3300005543 Bacteria 2763
276 Ga0070672_100107701 3300005543 Bacteria 2268
277 Ga0070672_100161959 3300005543 Bacteria 1857
278 Ga0070672_100288116 3300005543 Bacteria 1390
279 Ga0070695_100018060 3300005545 Bacteria 4282
280 Ga0070695_100092135 3300005545 Bacteria 2025
281 Ga0070695_100120739 3300005545 Bacteria 1792
282 Ga0070696_100000277 3300005546 Bacteria 30739
283 Ga0070696_100002542 3300005546 Bacteria 12087
284 Ga0070696_100014375 3300005546 Bacteria 5311
285 Ga0070696_100031811 3300005546 Bacteria 3618
286 Ga0070696_100043559 3300005546 Bacteria 3105
287 Ga0070696_100044652 3300005546 Bacteria 3068
288 Ga0070696_100069181 3300005546 Bacteria 2480
289 Ga0070696_100210264 3300005546 Bacteria 1456
290 Ga0070693_100000692 3300005547 Bacteria 14930
291 Ga0070693_100012046 3300005547 Bacteria 4367
292 Ga0070693_100020805 3300005547 Bacteria 3468
293 Ga0070693_100029136 3300005547 Bacteria 3008
294 Ga0070693_100081272 3300005547 Bacteria 1932
295 Ga0070693_100204112 3300005547 Bacteria 1285
296 Ga0070665_100000057 3300005548 Bacteria 237271
297 Ga0070665_100000838 3300005548 Bacteria 40099
298 Ga0070665_100041503 3300005548 Bacteria 4625
299 Ga0070665_100146563 3300005548 Bacteria 2363
300 Ga0070665_100217554 3300005548 Bacteria 1911
301 Ga0070665_100250182 3300005548 Bacteria 1773
302 Ga0070665_100317672 3300005548 Bacteria 1562
303 Ga0070665_100499306 3300005548 Bacteria 1228
304 Ga0070704_100000361 3300005549 Bacteria 20630
305 Ga0068855_100000559 3300005563 Bacteria 45612
306 Ga0068855_100002399 3300005563 Bacteria 23114
307 Ga0068855_100024413 3300005563 Bacteria 7232
308 Ga0068855_100034536 3300005563 Bacteria 6029
309 Ga0068855_100100139 3300005563 Bacteria 3337
310 Ga0068855_100155534 3300005563 Bacteria 2598
311 Ga0068855_100159346 3300005563 Bacteria 2563
312 Ga0068855_100293923 3300005563 Bacteria 1800
313 Ga0068855_100360132 3300005563 Bacteria 1601
314 Ga0070664_100002942 3300005564 Bacteria 13771
315 Ga0070664_100060997 3300005564 Bacteria 3213
316 Ga0070664_100074821 3300005564 Bacteria 2907
317 Ga0068857_100000591 3300005577 Bacteria 26568
318 Ga0068857_100005102 3300005577 Bacteria 11164
319 Ga0068857_100026022 3300005577 Bacteria 5153
320 Ga0068857_100040303 3300005577 Bacteria 4141
321 Ga0068857_100244529 3300005577 Bacteria 1643
322 Ga0068857_100284186 3300005577 Bacteria 1522
323 Ga0068857_100454352 3300005577 Bacteria 1198
324 Ga0068854_100000497 3300005578 Bacteria 23919
325 Ga0068854_100010672 3300005578 Bacteria 5962
326 Ga0068854_100047075 3300005578 Bacteria 3073
327 Ga0068854_100204707 3300005578 Bacteria 1553
328 Ga0068854_100226578 3300005578 Bacteria 1481
329 Ga0068856_100000940 3300005614 Bacteria 31221
330 Ga0068856_100001887 3300005614 Bacteria 21829
331 Ga0068856_100008425 3300005614 Bacteria 10039
332 Ga0068856_100049386 3300005614 Bacteria 4147
333 Ga0068856_100055647 3300005614 Bacteria 3904
334 Ga0068856_100126308 3300005614 Bacteria 2561
335 Ga0068856_100144506 3300005614 Bacteria 2386
336 Ga0068856_100219979 3300005614 Bacteria 1914
337 Ga0068856_100221061 3300005614 Bacteria 1909
338 Ga0068856_100310128 3300005614 Bacteria 1595
339 Ga0068856_100323501 3300005614 Bacteria 1559
340 Ga0068856_100547304 3300005614 Bacteria 1178
341 Ga0070702_100279397 3300005615 Bacteria 1146
342 Ga0068852_100020193 3300005616 Bacteria 5293
343 Ga0068852_100038168 3300005616 Bacteria 4035
344 Ga0068852_100056139 3300005616 Bacteria 3402
345 Ga0068852_100167375 3300005616 Bacteria 2058
346 Ga0068852_100189399 3300005616 Bacteria 1940
347 Ga0068852_100298511 3300005616 Bacteria 1558
348 Ga0068852_100345723 3300005616 Bacteria 1451
349 Ga0068852_100354288 3300005616 Bacteria 1434
350 Ga0068852_100424242 3300005616 Bacteria 1312
351 Ga0068852_100435473 3300005616 Bacteria 1295
352 Ga0068859_100001188 3300005617 Bacteria 26597
353 Ga0068859_100003247 3300005617 Bacteria 16553
354 Ga0068859_100038947 3300005617 Bacteria 4768
355 Ga0068859_100183596 3300005617 Bacteria 2175
356 Ga0068859_100583789 3300005617 Bacteria 1211
357 Ga0068864_100015261 3300005618 Bacteria 6388
358 Ga0068864_100137235 3300005618 Bacteria 2203
359 Ga0068864_100171677 3300005618 Bacteria 1977
360 Ga0068864_100208859 3300005618 Bacteria 1797
361 Ga0068861_100006592 3300005719 Bacteria 7925
362 Ga0068861_100054679 3300005719 Bacteria 3042
363 Ga0068861_100271260 3300005719 Bacteria 1457
364 Ga0068851_10001445 3300005834 Bacteria 10399
365 Ga0068851_10016464 3300005834 Bacteria 3537
366 Ga0068851_10139662 3300005834 Bacteria 1317
367 Ga0068851_10248850 3300005834 Bacteria 1007
368 Ga0068870_10000438 3300005840 Bacteria 15777
369 Ga0068863_100010303 3300005841 Bacteria 9082
370 Ga0068863_100090958 3300005841 Bacteria 2894
371 Ga0068863_100235473 3300005841 Bacteria 1767
372 Ga0068863_100518929 3300005841 Bacteria 1175
373 Ga0068863_100660228 3300005841 Bacteria 1037
374 Ga0068858_100001163 3300005842 Bacteria 27276
375 Ga0068858_100023895 3300005842 Bacteria 5695
376 Ga0068858_100024853 3300005842 Bacteria 5578
377 Ga0068858_100038899 3300005842 Bacteria 4412
378 Ga0068858_100220414 3300005842 Bacteria 1796
379 Ga0068858_100361783 3300005842 Bacteria 1391
380 Ga0068858_100448019 3300005842 Bacteria 1244
381 Ga0068860_100009879 3300005843 Bacteria 9461
382 Ga0068860_100011610 3300005843 Bacteria 8688
383 Ga0068860_100012175 3300005843 Bacteria 8474
384 Ga0068860_100052752 3300005843 Bacteria 3867
385 Ga0068860_100471054 3300005843 Bacteria 1251
386 Ga0068860_100499246 3300005843 Bacteria 1214
387 Ga0068860_100653003 3300005843 Bacteria 1060
388 Ga0068862_100003503 3300005844 Bacteria 13478
389 Ga0068862_100023439 3300005844 Bacteria 5171
390 Ga0068862_100046061 3300005844 Bacteria 3722
391 Ga0068862_100048171 3300005844 Bacteria 3638
392 Ga0068862_100248880 3300005844 Bacteria 1619
393 Ga0081455_10029994 3300005937 Bacteria 4949
394 Ga0081455_10048313 3300005937 Bacteria 3678
395 Ga0081540_1000778 3300005983 Bacteria 29291
396 Ga0081540_1002617 3300005983 Bacteria 14627
397 Ga0081539_10004036 3300005985 Bacteria 16839
398 Ga0070717_10356078 3300006028 Bacteria 1309
399 Ga0075363_100042233 3300006048 Bacteria 2408
400 Ga0075369_10005288 3300006186 Bacteria 4813
401 Ga0075366_10203433 3300006195 Bacteria 1204
402 Ga0097621_100061006 3300006237 Bacteria 3092
403 Ga0097621_100065210 3300006237 Bacteria 2996
404 Ga0097621_100087245 3300006237 Bacteria 2605
405 Ga0097621_100121627 3300006237 Bacteria 2214
406 Ga0097621_100166539 3300006237 Bacteria 1897
407 Ga0097621_100180020 3300006237 Bacteria 1826
408 Ga0068871_100029228 3300006358 Bacteria 4327
409 Ga0068871_100043867 3300006358 Bacteria 3593
410 Ga0068871_100099326 3300006358 Bacteria 2436
411 Ga0075428_100259142 3300006844 Bacteria 1873
412 Ga0075433_10005758 3300006852 Bacteria 9751
413 Ga0075433_10072430 3300006852 Bacteria 3030
414 Ga0075434_100080191 3300006871 Bacteria 3260
415 Ga0075434_100102288 3300006871 Bacteria 2873
416 Ga0068865_100115381 3300006881 Bacteria 1987
417 Ga0068865_100171583 3300006881 Bacteria 1663
418 Ga0068865_100237310 3300006881 Bacteria 1433
419 Ga0075436_100170331 3300006914 Bacteria 1537
420 Ga0097620_100001188 3300006931 Bacteria 26597
421 Ga0097620_100003247 3300006931 Bacteria 16553
422 Ga0097620_100038946 3300006931 Bacteria 4768
423 Ga0097620_100183608 3300006931 Bacteria 2175
424 Ga0097620_100583927 3300006931 Bacteria 1211
425 Ga0099826_10000004 3300006948 Bacteria 802669
426 Ga0099794_10018520 3300007265 Bacteria 3124
427 Ga0099794_10023823 3300007265 Bacteria 2804
428 Ga0105244_10085977 3300009036 Bacteria 1551
429 Ga0105240_10000931 3300009093 Bacteria 52113
430 Ga0105240_10014485 3300009093 Bacteria 10766
431 Ga0105240_10018571 3300009093 Bacteria 9332
432 Ga0105240_10038619 3300009093 Bacteria 6122
433 Ga0105240_10077509 3300009093 Bacteria 4094
434 Ga0105240_10130805 3300009093 Bacteria 3011
435 Ga0105240_10171297 3300009093 Bacteria 2571
436 Ga0105240_10301359 3300009093 Bacteria 1833
437 Ga0105240_10384666 3300009093 Bacteria 1584
438 Ga0105240_10525973 3300009093 Bacteria 1312
439 Ga0105240_10611385 3300009093 Bacteria 1199
440 Ga0105245_10058222 3300009098 Bacteria 3477
441 Ga0105245_10176080 3300009098 Bacteria 2040
442 Ga0105245_10368152 3300009098 Bacteria 1428
443 Ga0105245_10579081 3300009098 Bacteria 1147
444 Ga0105245_10754806 3300009098 Bacteria 1009
445 Ga0114129_10079228 3300009147 Bacteria 4568
446 Ga0114129_10118723 3300009147 Bacteria 3643
447 Ga0114129_10176245 3300009147 Bacteria 2912
448 Ga0105243_10247287 3300009148 Bacteria 1590
449 Ga0105243_10871699 3300009148 Bacteria 893
450 Ga0105241_10000966 3300009174 Bacteria 21742
451 Ga0105241_10034302 3300009174 Bacteria 3812
452 Ga0105241_10107632 3300009174 Bacteria 2227
453 Ga0105241_10141839 3300009174 Bacteria 1957
454 Ga0105241_10183109 3300009174 Bacteria 1739
455 Ga0105242_10000940 3300009176 Bacteria 22701
456 Ga0105248_10001462 3300009177 Bacteria 26311
457 Ga0105248_10184190 3300009177 Bacteria 2353
458 Ga0105248_10251892 3300009177 Bacteria 1988
459 Ga0105248_10395924 3300009177 Bacteria 1555
460 Ga0105248_10976783 3300009177 Bacteria 956
461 Ga0105237_10000007 3300009545 Bacteria 367690
462 Ga0105237_10000064 3300009545 Bacteria 139463
463 Ga0105237_10004545 3300009545 Bacteria 16029
464 Ga0105237_10008004 3300009545 Bacteria 11503
465 Ga0105237_10049193 3300009545 Bacteria 4238
466 Ga0105237_10096955 3300009545 Bacteria 2939
467 Ga0105237_10173710 3300009545 Bacteria 2155
468 Ga0105237_10640253 3300009545 Bacteria 1070
469 Ga0105238_10000924 3300009551 Bacteria 30076
470 Ga0105238_10001307 3300009551 Bacteria 25025
471 Ga0105238_10010394 3300009551 Bacteria 9341
472 Ga0105238_10021154 3300009551 Bacteria 6631
473 Ga0105238_10027655 3300009551 Bacteria 5780
474 Ga0105238_10035391 3300009551 Bacteria 5077
475 Ga0105238_10042220 3300009551 Bacteria 4619
476 Ga0105238_10107765 3300009551 Bacteria 2767
477 Ga0105238_10122721 3300009551 Bacteria 2577
478 Ga0105238_10128356 3300009551 Bacteria 2514
479 Ga0105238_10439323 3300009551 Bacteria 1301
480 Ga0105238_10587977 3300009551 Bacteria 1120
481 Ga0105249_10000763 3300009553 Bacteria 28922
482 Ga0105249_10271332 3300009553 Bacteria 1690
483 Ga0105249_10462895 3300009553 Bacteria 1308
484 Ga0105239_10008425 3300010375 Bacteria 11739
485 Ga0105239_10010561 3300010375 Bacteria 10324
486 Ga0105239_10015419 3300010375 Bacteria 8466
487 Ga0105239_10018248 3300010375 Bacteria 7757
488 Ga0105239_10090670 3300010375 Bacteria 3372
489 Ga0105239_10094117 3300010375 Bacteria 3309
490 Ga0105239_10101282 3300010375 Bacteria 3186
491 Ga0105239_10110828 3300010375 Bacteria 3042
492 Ga0105239_10127734 3300010375 Bacteria 2826
493 Ga0105239_10159178 3300010375 Bacteria 2522
494 Ga0105239_10174525 3300010375 Bacteria 2404
495 Ga0105239_10184573 3300010375 Bacteria 2334
496 Ga0105239_10197223 3300010375 Bacteria 2254
497 Ga0105239_10239301 3300010375 Bacteria 2037
498 Ga0105239_10241998 3300010375 Bacteria 2025
499 Ga0105239_10450554 3300010375 Bacteria 1460
500 Ga0157347_1000121 3300012502 Bacteria 3912
501 Ga0157373_10000304 3300013100 Bacteria 39700
502 Ga0157373_10071342 3300013100 Bacteria 2454
503 Ga0157373_10081763 3300013100 Bacteria 2277
504 Ga0157373_10238248 3300013100 Bacteria 1286
505 Ga0157373_10256059 3300013100 Bacteria 1238
506 Ga0157373_10361367 3300013100 Bacteria 1036
507 Ga0157373_10398631 3300013100 Bacteria 986
508 Ga0157371_10014172 3300013102 Bacteria 6027
509 Ga0157371_10046460 3300013102 Bacteria 3088
510 Ga0157371_10148481 3300013102 Bacteria 1671
511 Ga0157371_10192929 3300013102 Bacteria 1459
512 Ga0157371_10316741 3300013102 Bacteria 1131
513 Ga0157370_10003005 3300013104 Bacteria 20023
514 Ga0157370_10009864 3300013104 Bacteria 10122
515 Ga0157370_10019411 3300013104 Bacteria 6818
516 Ga0157370_10029943 3300013104 Bacteria 5336
517 Ga0157370_10047259 3300013104 Bacteria 4126
518 Ga0157370_10061424 3300013104 Bacteria 3567
519 Ga0157370_10087421 3300013104 Bacteria 2928
520 Ga0157370_10210385 3300013104 Bacteria 1802
521 Ga0157370_10415832 3300013104 Bacteria 1237
522 Ga0157369_10000195 3300013105 Bacteria 84688
523 Ga0157369_10000509 3300013105 Bacteria 51146
524 Ga0157369_10004837 3300013105 Bacteria 15811
525 Ga0157369_10034421 3300013105 Bacteria 5559
526 Ga0157369_10063749 3300013105 Bacteria 3970
527 Ga0157369_10095444 3300013105 Bacteria 3173
528 Ga0157369_10370628 3300013105 Bacteria 1486
529 Ga0157369_10390047 3300013105 Bacteria 1445
530 Ga0157369_10406107 3300013105 Bacteria 1413
531 Ga0157369_10523965 3300013105 Bacteria 1226
532 Ga0157369_10706311 3300013105 Bacteria 1038
533 Ga0157369_10877909 3300013105 Bacteria 920
534 Ga0157369_10975698 3300013105 Bacteria 868
535 Ga0157369_10975699 3300013105 Bacteria 868
536 Ga0157374_10022868 3300013296 Bacteria 5582
537 Ga0157374_10061587 3300013296 Bacteria 3515
538 Ga0157374_10125394 3300013296 Bacteria 2482
539 Ga0157374_10328522 3300013296 Bacteria 1517
540 Ga0157374_10356538 3300013296 Bacteria 1454
541 Ga0157378_10000043 3300013297 Bacteria 107750
542 Ga0157378_10039097 3300013297 Bacteria 4207
543 Ga0157378_10180632 3300013297 Bacteria 1985
544 Ga0157378_10367082 3300013297 Bacteria 1410
545 Ga0157378_10384416 3300013297 Bacteria 1379
546 Ga0163162_10000003 3300013306 Bacteria 698280
547 Ga0163162_10000489 3300013306 Bacteria 36741
548 Ga0163162_10009175 3300013306 Bacteria 9626
549 Ga0163162_10078541 3300013306 Bacteria 3366
550 Ga0163162_10250967 3300013306 Bacteria 1901
551 Ga0163162_10306137 3300013306 Bacteria 1721
552 Ga0163162_10490145 3300013306 Bacteria 1360
553 Ga0157372_10001376 3300013307 Bacteria 26252
554 Ga0157372_10005525 3300013307 Bacteria 13442
555 Ga0157372_10005613 3300013307 Bacteria 13341
556 Ga0157372_10005944 3300013307 Bacteria 12975
557 Ga0157372_10019732 3300013307 Bacteria 7266
558 Ga0157372_10038893 3300013307 Bacteria 5250
559 Ga0157372_10065619 3300013307 Bacteria 4076
560 Ga0157372_10072607 3300013307 Bacteria 3878
561 Ga0157372_10110493 3300013307 Bacteria 3149
562 Ga0157372_10397239 3300013307 Bacteria 1607
563 Ga0157372_10498585 3300013307 Bacteria 1420
564 Ga0157372_10499535 3300013307 Bacteria 1418
565 Ga0157372_10879031 3300013307 Bacteria 1040
566 Ga0157375_10000940 3300013308 Bacteria 25256
567 Ga0157375_10001135 3300013308 Bacteria 23067
568 Ga0157375_10120424 3300013308 Bacteria 2733
569 Ga0157375_10127593 3300013308 Bacteria 2660
570 Ga0157375_10188760 3300013308 Bacteria 2215
571 Ga0157375_10406402 3300013308 Bacteria 1528
572 Ga0157375_10492557 3300013308 Bacteria 1390
573 Ga0157375_10871657 3300013308 Bacteria 1046
574 Ga0163163_10002153 3300014325 Bacteria 16654
575 Ga0163163_10103999 3300014325 Bacteria 2864
576 Ga0182008_10002353 3300014497 Bacteria 11897
577 Ga0182008_10009625 3300014497 Bacteria 5205
578 Ga0182008_10033435 3300014497 Bacteria 2580
579 Ga0182008_10051007 3300014497 Bacteria 2053
580 Ga0157379_10001006 3300014968 Bacteria 22858
581 Ga0157379_10207665 3300014968 Bacteria 1772
582 Ga0157379_10672303 3300014968 Bacteria 971
583 Ga0157376_10039337 3300014969 Bacteria 3856
584 Ga0157376_10054895 3300014969 Bacteria 3323
585 Ga0157376_10088038 3300014969 Bacteria 2681
586 Ga0157376_10207223 3300014969 Bacteria 1808
587 Ga0157376_10303334 3300014969 Bacteria 1512
588 Ga0157376_10324512 3300014969 Bacteria 1465
589 Ga0157376_10396833 3300014969 Bacteria 1333
590 Ga0157376_10420760 3300014969 Bacteria 1296
591 Ga0182006_1000085 3300015261 Bacteria 117595
592 Ga0182006_1001966 3300015261 Bacteria 11638
593 Ga0182006_1006387 3300015261 Bacteria 5487
594 Ga0182006_1046769 3300015261 Bacteria 1680
595 Ga0182007_10003021 3300015262 Bacteria 8128
596 Ga0182007_10035389 3300015262 Bacteria 1683
597 Ga0182005_1000028 3300015265 Bacteria 221889
598 Ga0182005_1004956 3300015265 Bacteria 4218
599 Ga0183369_1007 3300015685 Bacteria 414878
600 Ga0183368_1003 3300015687 Bacteria 1276390
601 Ga0163161_10001533 3300017792 Bacteria 17070
602 Ga0163161_10103332 3300017792 Bacteria 2123
603 Ga0163161_10406621 3300017792 Bacteria 1092
604 Ga0197907_10112819 3300020069 Bacteria 1819
605 Ga0206356_10073673 3300020070 Bacteria 4442
606 Ga0206356_11092931 3300020070 Bacteria 2599
607 Ga0206356_11137881 3300020070 Bacteria 5985
608 Ga0206356_11619311 3300020070 Bacteria 1829
609 Ga0206351_10351414 3300020077 Bacteria 2935
610 Ga0206352_10906711 3300020078 Bacteria 1999
611 Ga0206354_10103479 3300020081 Bacteria 3460
612 Ga0206354_11015677 3300020081 Bacteria 1317
613 Ga0206353_10470642 3300020082 Bacteria 3181
614 Ga0206353_10873698 3300020082 Bacteria 2962
615 Ga0206353_11102501 3300020082 Bacteria 1263
616 Ga0206353_11830696 3300020082 Bacteria 2098
617 Ga0213876_10044835 3300021384 Bacteria 2338
618 Ga0209435_110491 3300025206 Bacteria 1002
619 Ga0209760_100055 3300025207 Bacteria 100237
620 Ga0209760_100585 3300025207 Bacteria 6376
621 Ga0209784_100709 3300025224 Bacteria 8923
622 Ga0209566_106060 3300025225 Bacteria 1456
623 Ga0209674_100012 3300025226 Bacteria 950162
624 Ga0209674_100119 3300025226 Bacteria 135468
625 Ga0209674_100973 3300025226 Bacteria 8987
626 Ga0209672_100005 3300025228 Bacteria 1069303
627 Ga0209672_100016 3300025228 Bacteria 522604
628 Ga0209672_100312 3300025228 Bacteria 32535
629 Ga0209672_100887 3300025228 Bacteria 13631
630 Ga0209672_104091 3300025228 Bacteria 2800
631 Ga0209563_100023 3300025230 Bacteria 636844
632 Ga0207427_100004 3300025231 Bacteria 939600
633 Ga0207427_100055 3300025231 Bacteria 209093
634 Ga0207427_100156 3300025231 Bacteria 77311
635 Ga0207427_105404 3300025231 Bacteria 1810
636 Ga0209437_100020 3300025233 Bacteria 656374
637 Ga0209437_100028 3300025233 Bacteria 540136
638 Ga0209437_100147 3300025233 Bacteria 161997
639 Ga0209437_100161 3300025233 Bacteria 148264
640 Ga0209437_100224 3300025233 Bacteria 101515
641 Ga0209437_100476 3300025233 Bacteria 30448
642 Ga0209258_100006 3300025242 Bacteria 1069303
643 Ga0209258_100012 3300025242 Bacteria 825544
644 Ga0209258_100049 3300025242 Bacteria 358328
645 Ga0209258_100064 3300025242 Bacteria 293837
646 Ga0209258_100186 3300025242 Bacteria 132381
647 Ga0209258_101282 3300025242 Bacteria 9408
648 Ga0207425_1017100 3300025245 Bacteria 1600
649 Ga0209646_1002608 3300025246 Bacteria 3887
650 Ga0209646_1004739 3300025246 Bacteria 2452
651 Ga0209646_1010458 3300025246 Bacteria 1453
652 Ga0209026_1000037 3300025250 Bacteria 282562
653 Ga0209026_1000099 3300025250 Bacteria 161750
654 Ga0209026_1000375 3300025250 Bacteria 41000
655 Ga0209026_1000391 3300025250 Bacteria 39130
656 Ga0209026_1000541 3300025250 Bacteria 26051
657 Ga0209148_1000005 3300025254 Bacteria 1806504
658 Ga0209148_1000010 3300025254 Bacteria 1265567
659 Ga0209148_1000012 3300025254 Bacteria 1069303
660 Ga0209148_1000014 3300025254 Bacteria 925277
661 Ga0209148_1000073 3300025254 Bacteria 320851
662 Ga0209148_1000142 3300025254 Bacteria 163404
663 Ga0209148_1002604 3300025254 Bacteria 5903
664 Ga0209759_1000103 3300025256 Bacteria 153195
665 Ga0209759_1000792 3300025256 Bacteria 25985
666 Ga0209759_1001568 3300025256 Bacteria 12465
667 Ga0209759_1002641 3300025256 Bacteria 7707
668 Ga0209759_1010031 3300025256 Bacteria 2811
669 Ga0209759_1016594 3300025256 Bacteria 1851
670 Ga0209129_1004913 3300025258 Bacteria 4986
671 Ga0209129_1005589 3300025258 Bacteria 4381
672 Ga0209233_1000008 3300025261 Bacteria 1356712
673 Ga0209233_1000009 3300025261 Bacteria 1265567
674 Ga0209233_1000020 3300025261 Bacteria 798224
675 Ga0209233_1000063 3300025261 Bacteria 395810
676 Ga0209233_1000147 3300025261 Bacteria 186517
677 Ga0209233_1004515 3300025261 Bacteria 4719
678 Ga0209565_1000018 3300025263 Bacteria 460940
679 Ga0209565_1000136 3300025263 Bacteria 103019
680 Ga0209565_1002813 3300025263 Bacteria 6014
681 Ga0209455_1000008 3300025272 Bacteria 1069303
682 Ga0209455_1000014 3300025272 Bacteria 806601
683 Ga0209455_1000086 3300025272 Bacteria 244650
684 Ga0209455_1000177 3300025272 Bacteria 106026
685 Ga0209455_1000344 3300025272 Bacteria 43864
686 Ga0209673_1000090 3300025273 Bacteria 202223
687 Ga0209130_1012206 3300025284 Bacteria 2261
688 Ga0209675_1000005 3300025291 Bacteria 849192
689 Ga0209675_1000587 3300025291 Bacteria 26247
690 Ga0209675_1006760 3300025291 Bacteria 4536
691 Ga0209675_1009558 3300025291 Bacteria 3411
692 Ga0209676_1000056 3300025292 Bacteria 361329
693 Ga0209676_1000066 3300025292 Bacteria 317897
694 Ga0209676_1000101 3300025292 Bacteria 227976
695 Ga0209025_1000471 3300025294 Bacteria 78395
696 Ga0209025_1000711 3300025294 Bacteria 56608
697 Ga0209025_1001264 3300025294 Bacteria 34892
698 Ga0209025_1001519 3300025294 Bacteria 29705
699 Ga0209025_1068236 3300025294 Bacteria 1279
700 Ga0209564_1000078 3300025295 Bacteria 275766
701 Ga0209564_1003271 3300025295 Bacteria 11297
702 Ga0209564_1003275 3300025295 Bacteria 11288
703 Ga0209564_1003554 3300025295 Bacteria 10463
704 Ga0209758_1001371 3300025297 Bacteria 29065
705 Ga0209758_1004728 3300025297 Bacteria 11097
706 Ga0209758_1018326 3300025297 Bacteria 3436
707 Ga0209758_1079160 3300025297 Bacteria 1001
708 Ga0209256_1000070 3300025299 Bacteria 245034
709 Ga0209256_1001248 3300025299 Bacteria 28107
710 Ga0209256_1003130 3300025299 Bacteria 12059
711 Ga0209256_1012253 3300025299 Bacteria 3311
712 Ga0209051_1003162 3300025303 Bacteria 11043
713 Ga0209051_1039422 3300025303 Bacteria 1706
714 Ga0209051_1064040 3300025303 Bacteria 1141
715 Ga0209257_1025065 3300025304 Bacteria 2047
716 Ga0207656_10004478 3300025321 Bacteria 4885
717 Ga0207656_10044372 3300025321 Bacteria 1898
718 Ga0207655_1000005 3300025728 Bacteria 917277
719 Ga0207655_1000015 3300025728 Bacteria 600662
720 Ga0207655_1000166 3300025728 Bacteria 119771
721 Ga0207653_10001491 3300025885 Bacteria 7581
722 Ga0207688_10028620 3300025901 Bacteria 3065
723 Ga0207680_10000005 3300025903 Bacteria 660983
724 Ga0207680_10000255 3300025903 Bacteria 25597
725 Ga0207680_10147436 3300025903 Bacteria 1566
726 Ga0207680_10157513 3300025903 Bacteria 1520
727 Ga0207647_10000512 3300025904 Bacteria 30880
728 Ga0207647_10000610 3300025904 Bacteria 27881
729 Ga0207647_10001940 3300025904 Bacteria 15811
730 Ga0207647_10007302 3300025904 Bacteria 7998
731 Ga0207647_10013553 3300025904 Bacteria 5646
732 Ga0207647_10018521 3300025904 Bacteria 4705
733 Ga0207647_10042751 3300025904 Bacteria 2840
734 Ga0207699_10199183 3300025906 Bacteria 1356
735 Ga0207645_10000076 3300025907 Bacteria 70294
736 Ga0207645_10016221 3300025907 Bacteria 4934
737 Ga0207645_10107216 3300025907 Bacteria 1806
738 Ga0207645_10122962 3300025907 Bacteria 1685
739 Ga0207645_10299855 3300025907 Bacteria 1070
740 Ga0207643_10000227 3300025908 Bacteria 39423
741 Ga0207705_10003418 3300025909 Bacteria 12075
742 Ga0207705_10005224 3300025909 Bacteria 9733
743 Ga0207705_10013859 3300025909 Bacteria 5812
744 Ga0207705_10014275 3300025909 Bacteria 5719
745 Ga0207705_10067187 3300025909 Bacteria 2594
746 Ga0207705_10175935 3300025909 Bacteria 1613
747 Ga0207705_10179726 3300025909 Bacteria 1596
748 Ga0207705_10265431 3300025909 Bacteria 1312
749 Ga0207705_10305881 3300025909 Bacteria 1220
750 Ga0207684_10000874 3300025910 Bacteria 34386
751 Ga0207684_10015879 3300025910 Bacteria 6473
752 Ga0207654_10001950 3300025911 Bacteria 10699
753 Ga0207654_10006920 3300025911 Bacteria 5712
754 Ga0207654_10007889 3300025911 Bacteria 5367
755 Ga0207654_10089144 3300025911 Bacteria 1876
756 Ga0207654_10091337 3300025911 Bacteria 1857
757 Ga0207707_10000069 3300025912 Bacteria 103460
758 Ga0207707_10000310 3300025912 Bacteria 51190
759 Ga0207707_10000357 3300025912 Bacteria 48036
760 Ga0207707_10001014 3300025912 Bacteria 26932
761 Ga0207707_10004786 3300025912 Bacteria 11872
762 Ga0207707_10009538 3300025912 Bacteria 8420
763 Ga0207707_10013618 3300025912 Bacteria 7092
764 Ga0207707_10042934 3300025912 Bacteria 3945
765 Ga0207707_10174379 3300025912 Bacteria 1879
766 Ga0207707_10185756 3300025912 Bacteria 1814
767 Ga0207707_10188585 3300025912 Bacteria 1799
768 Ga0207707_10214905 3300025912 Bacteria 1674
769 Ga0207707_10414408 3300025912 Bacteria 1156
770 Ga0207695_10000007 3300025913 Bacteria 1092551
771 Ga0207695_10000780 3300025913 Bacteria 60243
772 Ga0207695_10001750 3300025913 Bacteria 34466
773 Ga0207695_10003105 3300025913 Bacteria 23782
774 Ga0207695_10005621 3300025913 Bacteria 16567
775 Ga0207695_10042664 3300025913 Bacteria 4841
776 Ga0207695_10059150 3300025913 Bacteria 3976
777 Ga0207695_10069722 3300025913 Bacteria 3597
778 Ga0207695_10070350 3300025913 Bacteria 3578
779 Ga0207695_10154475 3300025913 Bacteria 2230
780 Ga0207695_10379157 3300025913 Bacteria 1300
781 Ga0207695_10451902 3300025913 Bacteria 1168
782 Ga0207671_10000061 3300025914 Bacteria 175061
783 Ga0207671_10000074 3300025914 Bacteria 156482
784 Ga0207671_10001147 3300025914 Bacteria 31646
785 Ga0207671_10003503 3300025914 Bacteria 15596
786 Ga0207671_10003678 3300025914 Bacteria 15116
787 Ga0207671_10065748 3300025914 Bacteria 2698
788 Ga0207671_10080968 3300025914 Bacteria 2435
789 Ga0207671_10123741 3300025914 Bacteria 1979
790 Ga0207693_10249914 3300025915 Bacteria 1392
791 Ga0207663_10352093 3300025916 Bacteria 1115
792 Ga0207660_10003495 3300025917 Bacteria 10237
793 Ga0207660_10019459 3300025917 Bacteria 4539
794 Ga0207660_10027109 3300025917 Bacteria 3906
795 Ga0207660_10040839 3300025917 Bacteria 3249
796 Ga0207660_10110909 3300025917 Bacteria 2064
797 Ga0207660_10149308 3300025917 Bacteria 1794
798 Ga0207660_10240301 3300025917 Bacteria 1427
799 Ga0207657_10000417 3300025919 Bacteria 45146
800 Ga0207657_10014538 3300025919 Bacteria 7675
801 Ga0207657_10045337 3300025919 Bacteria 3860
802 Ga0207657_10206205 3300025919 Bacteria 1579
803 Ga0207657_10206256 3300025919 Bacteria 1579
804 Ga0207649_10000847 3300025920 Bacteria 19667
805 Ga0207649_10001653 3300025920 Bacteria 12915
806 Ga0207649_10005305 3300025920 Bacteria 6976
807 Ga0207649_10017567 3300025920 Bacteria 4054
808 Ga0207649_10035699 3300025920 Bacteria 2989
809 Ga0207649_10049981 3300025920 Bacteria 2585
810 Ga0207649_10149653 3300025920 Bacteria 1606
811 Ga0207649_10159121 3300025920 Bacteria 1563
812 Ga0207649_10184626 3300025920 Bacteria 1462
813 Ga0207649_10197151 3300025920 Bacteria 1420
814 Ga0207652_10000394 3300025921 Bacteria 45530
815 Ga0207652_10003410 3300025921 Bacteria 13119
816 Ga0207652_10010725 3300025921 Bacteria 7378
817 Ga0207652_10026547 3300025921 Bacteria 4825
818 Ga0207652_10055480 3300025921 Bacteria 3408
819 Ga0207652_10074563 3300025921 Bacteria 2955
820 Ga0207652_10199817 3300025921 Bacteria 1799
821 Ga0207652_10228318 3300025921 Bacteria 1678
822 Ga0207646_10001150 3300025922 Bacteria 33745
823 Ga0207646_10035755 3300025922 Bacteria 4485
824 Ga0207646_10111999 3300025922 Bacteria 2449
825 Ga0207681_10060077 3300025923 Bacteria 2608
826 Ga0207681_10086448 3300025923 Bacteria 2228
827 Ga0207681_10158962 3300025923 Bacteria 1701
828 Ga0207694_10000162 3300025924 Bacteria 68375
829 Ga0207694_10001362 3300025924 Bacteria 21050
830 Ga0207694_10009064 3300025924 Bacteria 7509
831 Ga0207694_10022629 3300025924 Bacteria 4769
832 Ga0207694_10023759 3300025924 Bacteria 4655
833 Ga0207694_10063972 3300025924 Bacteria 2866
834 Ga0207694_10096636 3300025924 Bacteria 2336
835 Ga0207694_10136232 3300025924 Bacteria 1972
836 Ga0207694_10340457 3300025924 Bacteria 1240
837 Ga0207694_10370239 3300025924 Bacteria 1188
838 Ga0207650_10006670 3300025925 Bacteria 7878
839 Ga0207650_10169670 3300025925 Bacteria 1734
840 Ga0207659_10202713 3300025926 Bacteria 1585
841 Ga0207687_10090627 3300025927 Bacteria 2229
842 Ga0207687_10105282 3300025927 Bacteria 2084
843 Ga0207700_10007782 3300025928 Bacteria 6585
844 Ga0207700_10420206 3300025928 Bacteria 1174
845 Ga0207664_10000026 3300025929 Bacteria 194571
846 Ga0207664_10168743 3300025929 Bacteria 1871
847 Ga0207644_10245162 3300025931 Bacteria 1428
848 Ga0207644_10293900 3300025931 Bacteria 1307
849 Ga0207690_10001242 3300025932 Bacteria 16111
850 Ga0207690_10001494 3300025932 Bacteria 14609
851 Ga0207690_10002715 3300025932 Bacteria 10679
852 Ga0207690_10004311 3300025932 Bacteria 8397
853 Ga0207690_10019003 3300025932 Bacteria 4220
854 Ga0207690_10030674 3300025932 Bacteria 3432
855 Ga0207690_10050680 3300025932 Bacteria 2772
856 Ga0207690_10505429 3300025932 Bacteria 978
857 Ga0207706_10010437 3300025933 Bacteria 8485
858 Ga0207706_10026077 3300025933 Bacteria 5232
859 Ga0207706_10045071 3300025933 Bacteria 3908
860 Ga0207706_10095324 3300025933 Bacteria 2617
861 Ga0207706_10127035 3300025933 Bacteria 2242
862 Ga0207706_10252353 3300025933 Bacteria 1541
863 Ga0207686_10073323 3300025934 Bacteria 2208
864 Ga0207686_10271747 3300025934 Bacteria 1247
865 Ga0207709_10000134 3300025935 Bacteria 108529
866 Ga0207670_10340721 3300025936 Bacteria 1185
867 Ga0207670_10355762 3300025936 Bacteria 1161
868 Ga0207669_10515692 3300025937 Bacteria 959
869 Ga0207704_10210700 3300025938 Bacteria 1430
870 Ga0207704_10339637 3300025938 Bacteria 1165
871 Ga0207665_10013326 3300025939 Bacteria 5404
872 Ga0207691_10020705 3300025940 Bacteria 6220
873 Ga0207691_10024916 3300025940 Bacteria 5622
874 Ga0207691_10033298 3300025940 Bacteria 4797
875 Ga0207691_10075826 3300025940 Bacteria 3031
876 Ga0207711_10001229 3300025941 Bacteria 24284
877 Ga0207711_10225466 3300025941 Bacteria 1715
878 Ga0207689_10000281 3300025942 Bacteria 46204
879 Ga0207689_10086754 3300025942 Bacteria 2572
880 Ga0207689_10166996 3300025942 Bacteria 1813
881 Ga0207689_10263540 3300025942 Bacteria 1426
882 Ga0207689_10264633 3300025942 Bacteria 1423
883 Ga0207661_10084908 3300025944 Bacteria 2623
884 Ga0207661_10097137 3300025944 Bacteria 2466
885 Ga0207661_10246511 3300025944 Bacteria 1586
886 Ga0207679_10000280 3300025945 Bacteria 38589
887 Ga0207679_10234820 3300025945 Bacteria 1550
888 Ga0207679_10312468 3300025945 Bacteria 1358
889 Ga0207679_10389602 3300025945 Bacteria 1223
890 Ga0207667_10000381 3300025949 Bacteria 59990
891 Ga0207667_10018815 3300025949 Bacteria 7733
892 Ga0207667_10023112 3300025949 Bacteria 6849
893 Ga0207667_10038148 3300025949 Bacteria 5132
894 Ga0207667_10038559 3300025949 Bacteria 5101
895 Ga0207667_10054076 3300025949 Bacteria 4223
896 Ga0207667_10054635 3300025949 Bacteria 4200
897 Ga0207667_10092652 3300025949 Bacteria 3120
898 Ga0207667_10126234 3300025949 Bacteria 2635
899 Ga0207667_10126270 3300025949 Bacteria 2635
900 Ga0207667_10249823 3300025949 Bacteria 1814
901 Ga0207667_10249844 3300025949 Bacteria 1814
902 Ga0207651_10105004 3300025960 Bacteria 2106
903 Ga0207651_10276350 3300025960 Bacteria 1386
904 Ga0207651_10411670 3300025960 Bacteria 1152
905 Ga0207712_10001183 3300025961 Bacteria 18055
906 Ga0207712_10033417 3300025961 Bacteria 3478
907 Ga0207668_10111329 3300025972 Bacteria 2055
908 Ga0207668_10306195 3300025972 Bacteria 1313
909 Ga0207640_10000797 3300025981 Bacteria 17930
910 Ga0207640_10001740 3300025981 Bacteria 11681
911 Ga0207640_10006198 3300025981 Bacteria 6548
912 Ga0207640_10008720 3300025981 Bacteria 5642
913 Ga0207640_10011204 3300025981 Bacteria 5070
914 Ga0207640_10020709 3300025981 Bacteria 3908
915 Ga0207640_10038505 3300025981 Bacteria 3018
916 Ga0207640_10050569 3300025981 Bacteria 2698
917 Ga0207640_10076264 3300025981 Bacteria 2275
918 Ga0207640_10267166 3300025981 Bacteria 1336
919 Ga0207658_10000006 3300025986 Bacteria 392309
920 Ga0207658_10018272 3300025986 Bacteria 4839
921 Ga0207658_10020586 3300025986 Bacteria 4567
922 Ga0207658_10156818 3300025986 Bacteria 1861
923 Ga0207658_10228535 3300025986 Bacteria 1569
924 Ga0207677_10137076 3300026023 Bacteria 1868
925 Ga0207677_10192173 3300026023 Bacteria 1615
926 Ga0207677_10247984 3300026023 Bacteria 1444
927 Ga0207703_10003470 3300026035 Bacteria 13203
928 Ga0207703_10011783 3300026035 Bacteria 6805
929 Ga0207703_10030081 3300026035 Bacteria 4290
930 Ga0207703_10129839 3300026035 Bacteria 2175
931 Ga0207639_10002695 3300026041 Bacteria 11917
932 Ga0207639_10003901 3300026041 Bacteria 10058
933 Ga0207639_10003979 3300026041 Bacteria 9972
934 Ga0207639_10004097 3300026041 Bacteria 9830
935 Ga0207639_10004960 3300026041 Bacteria 8966
936 Ga0207639_10006175 3300026041 Bacteria 8135
937 Ga0207639_10008407 3300026041 Bacteria 7072
938 Ga0207639_10011963 3300026041 Bacteria 6038
939 Ga0207639_10034646 3300026041 Bacteria 3732
940 Ga0207639_10103696 3300026041 Bacteria 2305
941 Ga0207639_10109558 3300026041 Bacteria 2247
942 Ga0207639_10229565 3300026041 Bacteria 1608
943 Ga0207639_10238882 3300026041 Bacteria 1579
944 Ga0207639_10580621 3300026041 Bacteria 1032
945 Ga0207678_10004583 3300026067 Bacteria 12431
946 Ga0207678_10007556 3300026067 Bacteria 9605
947 Ga0207678_10007809 3300026067 Bacteria 9445
948 Ga0207678_10010017 3300026067 Bacteria 8317
949 Ga0207678_10016606 3300026067 Bacteria 6467
950 Ga0207678_10032508 3300026067 Bacteria 4547
951 Ga0207678_10036895 3300026067 Bacteria 4255
952 Ga0207678_10038897 3300026067 Bacteria 4130
953 Ga0207678_10043296 3300026067 Bacteria 3895
954 Ga0207678_10122985 3300026067 Bacteria 2214
955 Ga0207678_10123140 3300026067 Bacteria 2213
956 Ga0207678_10177580 3300026067 Bacteria 1818
957 Ga0207678_10303673 3300026067 Bacteria 1372
958 Ga0207678_10425557 3300026067 Bacteria 1152
959 Ga0207702_10000185 3300026078 Bacteria 74602
960 Ga0207702_10002243 3300026078 Bacteria 18541
961 Ga0207702_10002724 3300026078 Bacteria 16557
962 Ga0207702_10004362 3300026078 Bacteria 12611
963 Ga0207702_10005659 3300026078 Bacteria 10899
964 Ga0207702_10013254 3300026078 Bacteria 6856
965 Ga0207702_10032427 3300026078 Bacteria 4359
966 Ga0207702_10060932 3300026078 Bacteria 3217
967 Ga0207702_10112765 3300026078 Bacteria 2420
968 Ga0207702_10238212 3300026078 Bacteria 1704
969 Ga0207641_10020593 3300026088 Bacteria 5419
970 Ga0207641_10030714 3300026088 Bacteria 4451
971 Ga0207641_10087126 3300026088 Bacteria 2724
972 Ga0207641_10099047 3300026088 Bacteria 2564
973 Ga0207641_10115438 3300026088 Bacteria 2387
974 Ga0207641_10126684 3300026088 Bacteria 2287
975 Ga0207641_10150579 3300026088 Bacteria 2107
976 Ga0207641_10152166 3300026088 Bacteria 2096
977 Ga0207641_10471639 3300026088 Bacteria 1215
978 Ga0207648_10002334 3300026089 Bacteria 20483
979 Ga0207648_10031857 3300026089 Bacteria 4659
980 Ga0207648_10033541 3300026089 Bacteria 4528
981 Ga0207648_10056639 3300026089 Bacteria 3420
982 Ga0207648_10110473 3300026089 Bacteria 2413
983 Ga0207648_10594987 3300026089 Bacteria 1019
984 Ga0207676_10041958 3300026095 Bacteria 3516
985 Ga0207674_10000226 3300026116 Bacteria 70605
986 Ga0207674_10001350 3300026116 Bacteria 31756
987 Ga0207674_10064922 3300026116 Bacteria 3681
988 Ga0207674_10067399 3300026116 Bacteria 3603
989 Ga0207674_10171398 3300026116 Bacteria 2123
990 Ga0207674_10213726 3300026116 Bacteria 1877
991 Ga0207674_10311061 3300026116 Bacteria 1524
992 Ga0207674_10378295 3300026116 Bacteria 1369
993 Ga0207675_100012481 3300026118 Bacteria 7937
994 Ga0207675_100020033 3300026118 Bacteria 6241
995 Ga0207675_100275153 3300026118 Bacteria 1635
996 Ga0207675_100808280 3300026118 Bacteria 951
997 Ga0207683_10018309 3300026121 Bacteria 5975
998 Ga0207698_10000529 3300026142 Bacteria 22200
999 Ga0207698_10010039 3300026142 Bacteria 6063
1000 Ga0207698_10065485 3300026142 Bacteria 2854
1001 Ga0207698_10099827 3300026142 Bacteria 2402
1002 Ga0207698_10112145 3300026142 Bacteria 2288
1003 Ga0207698_10125951 3300026142 Bacteria 2178
1004 Ga0207698_10170773 3300026142 Bacteria 1914
1005 Ga0207698_10362427 3300026142 Bacteria 1373
1006 Ga0207698_10438240 3300026142 Bacteria 1258
1007 Ga0207698_11030904 3300026142 Bacteria 834
1008 Ga0209281_1004884 3300027111 Bacteria 3878
1009 Ga0209371_1000197 3300027312 Bacteria 88691
1010 Ga0209969_1002912 3300027360 Bacteria 2369
1011 Ga0209984_1000926 3300027424 Bacteria 3136
1012 Ga0209995_1000280 3300027471 Bacteria 8040
1013 Ga0209968_1004656 3300027526 Bacteria 2058
1014 Ga0209968_1013426 3300027526 Bacteria 1285
1015 Ga0209999_1000590 3300027543 Bacteria 5733
1016 Ga0209982_1001566 3300027552 Bacteria 3144
1017 Ga0209970_1001836 3300027614 Bacteria 3677
1018 Ga0209970_1006001 3300027614 Bacteria 1992
1019 Ga0210002_1011695 3300027617 Bacteria 1359
1020 Ga0209983_1000494 3300027665 Bacteria 8492
1021 Ga0209282_1000051 3300027666 Bacteria 107809
1022 Ga0209971_1000054 3300027682 Bacteria 37135
1023 Ga0209971_1000099 3300027682 Bacteria 25501
1024 Ga0209966_1000059 3300027695 Bacteria 48677
1025 Ga0209998_10000066 3300027717 Bacteria 41640
1026 Ga0209974_10002860 3300027876 Bacteria 6259
1027 Ga0209974_10050802 3300027876 Bacteria 1393
1028 Ga0268266_10000001 3300028379 Bacteria 4040580
1029 Ga0268266_10000004 3300028379 Bacteria 1495817
1030 Ga0268266_10000006 3300028379 Bacteria 1410021
1031 Ga0268266_10082833 3300028379 Bacteria 2799
1032 Ga0268266_10343959 3300028379 Bacteria 1400
1033 Ga0268265_10002756 3300028380 Bacteria 12975
1034 Ga0268265_10004000 3300028380 Bacteria 10377
1035 Ga0268265_10028139 3300028380 Bacteria 4021
1036 Ga0268265_10420735 3300028380 Bacteria 1240
1037 Ga0268265_10506695 3300028380 Bacteria 1138
1038 Ga0268265_10612088 3300028380 Bacteria 1042
1039 Ga0268264_10019805 3300028381 Bacteria 5497
1040 Ga0268264_10020911 3300028381 Bacteria 5346
1041 Ga0268264_10024072 3300028381 Bacteria 4969
1042 Ga0268264_10051695 3300028381 Bacteria 3425
1043 Ga0268264_10156716 3300028381 Bacteria 2047
1044 Ga0268264_10816942 3300028381 Bacteria 932
1045 Ga0265318_10092476 3300028577 Bacteria 1114
1046 Ga0268256_1000147 3300030500 Bacteria 94888
1047 Ga0316179_1058374 3300030734 Bacteria 3030
1048 Ga0316178_1149128 3300030735 Bacteria 5805
1049 Ga0265331_10059719 3300031250 Bacteria 1803
1050 Ga0265327_10037033 3300031251 Bacteria 2675
1051 Ga0265316_10197819 3300031344 Bacteria 1491
1052 Ga0307408_100000045 3300031548 Bacteria 169484
1053 Ga0307408_100002332 3300031548 Bacteria 13441
1054 Ga0307408_100601933 3300031548 Bacteria 977
1055 Ga0307508_10251269 3300031616 Bacteria 1364
1056 Ga0316575_10001754 3300031665 Bacteria 7100
1057 Ga0316575_10008938 3300031665 Bacteria 3659
1058 Ga0316575_10035622 3300031665 Bacteria 1957
1059 Ga0316579_10000043 3300031691 Bacteria 29246
1060 Ga0316579_10000317 3300031691 Bacteria 14936
1061 Ga0316579_10020194 3300031691 Bacteria 2951
1062 Ga0316579_10021774 3300031691 Bacteria 2860
1063 Ga0316576_10001368 3300031727 Bacteria 13015
1064 Ga0316576_10069720 3300031727 Bacteria 2592
1065 Ga0316576_10100835 3300031727 Bacteria 2158
1066 Ga0316576_10114325 3300031727 Bacteria 2024
1067 Ga0316576_10130349 3300031727 Bacteria 1892
1068 Ga0316576_10154118 3300031727 Bacteria 1732
1069 Ga0316576_10210742 3300031727 Bacteria 1462
1070 Ga0316576_10342639 3300031727 Bacteria 1113
1071 Ga0316578_10003074 3300031728 Bacteria 7533
1072 Ga0316578_10008573 3300031728 Bacteria 5212
1073 Ga0316578_10049852 3300031728 Bacteria 2448
1074 Ga0316578_10065209 3300031728 Bacteria 2150
1075 Ga0307516_10000386 3300031730 Bacteria 57562
1076 Ga0307516_10027880 3300031730 Bacteria 5722
1077 Ga0307516_10054707 3300031730 Bacteria 3899
1078 Ga0307516_10088520 3300031730 Bacteria 2929
1079 Ga0307405_10066722 3300031731 Bacteria 2295
1080 Ga0316577_10001045 3300031733 Bacteria 12508
1081 Ga0316577_10282142 3300031733 Bacteria 940
1082 Ga0307413_10111219 3300031824 Bacteria 1834
1083 Ga0307406_10061681 3300031901 Bacteria 2422
1084 Ga0307412_10017964 3300031911 Bacteria 4243
1085 Ga0307416_100045064 3300032002 Bacteria 3470
1086 Ga0307414_10005715 3300032004 Bacteria 6872
1087 Ga0307414_10031363 3300032004 Bacteria 3485
1088 Ga0307414_10238244 3300032004 Bacteria 1504
1089 Ga0307414_10351179 3300032004 Bacteria 1266
1090 Ga0307411_10206503 3300032005 Bacteria 1513
1091 Ga0307411_10373142 3300032005 Bacteria 1171
1092 Ga0307411_10385626 3300032005 Bacteria 1154
1093 Ga0316583_10003786 3300032133 Bacteria 5362
1094 Ga0316585_10000368 3300032137 Bacteria 10376
1095 Ga0316585_10032912 3300032137 Bacteria 1634
1096 Ga0316580_10007606 3300032139 Bacteria 3230
1097 Ga0316580_10009440 3300032139 Bacteria 2932
1098 Ga0316580_10011538 3300032139 Bacteria 2683
1099 Ga0316593_10000550 3300032168 Bacteria 7006
1100 Ga0316593_10000980 3300032168 Bacteria 5914
1101 Ga0316593_10001425 3300032168 Bacteria 5266
1102 Ga0316593_10003419 3300032168 Bacteria 3937
1103 Ga0316593_10004705 3300032168 Bacteria 3530
1104 Ga0316593_10006108 3300032168 Bacteria 3232
1105 Ga0316593_10009511 3300032168 Bacteria 2748
1106 Ga0316593_10015674 3300032168 Bacteria 2285
1107 Ga0316593_10018656 3300032168 Bacteria 2135
1108 Ga0316593_10019079 3300032168 Bacteria 2116
1109 Ga0316593_10021052 3300032168 Bacteria 2035
1110 Ga0316593_10025794 3300032168 Bacteria 1874
1111 Ga0316593_10026747 3300032168 Bacteria 1847
1112 Ga0316593_10026969 3300032168 Bacteria 1840
1113 Ga0316593_10027882 3300032168 Bacteria 1816
1114 Ga0316593_10028085 3300032168 Bacteria 1811
1115 Ga0316593_10040703 3300032168 Bacteria 1545
1116 Ga0316593_10053218 3300032168 Bacteria 1371
1117 Ga0307507_10161388 3300033179 Bacteria 1655
1118 Ga0307510_10002044 3300033180 Bacteria 22812
1119 Ga0316592_1000863 3300033524 Bacteria 4583
1120 Ga0316592_1002557 3300033524 Bacteria 3160
1121 Ga0316592_1004759 3300033524 Bacteria 2544
1122 Ga0316592_1008886 3300033524 Bacteria 1999
1123 Ga0316592_1013362 3300033524 Bacteria 1692
1124 Ga0316592_1026549 3300033524 Bacteria 1250
1125 Ga0316586_1001418 3300033527 Bacteria 2747
1126 Ga0316586_1002226 3300033527 Bacteria 2390
1127 Ga0316586_1002983 3300033527 Bacteria 2175
1128 Ga0316586_1003553 3300033527 Bacteria 2057
1129 Ga0316586_1007210 3300033527 Bacteria 1616
1130 Ga0316588_1000832 3300033528 Bacteria 4655
1131 Ga0316588_1003893 3300033528 Bacteria 2775
1132 Ga0316588_1004524 3300033528 Bacteria 2642
1133 Ga0316588_1006413 3300033528 Bacteria 2350
1134 Ga0316588_1013330 3300033528 Bacteria 1782
1135 Ga0316588_1030522 3300033528 Bacteria 1263
1136 Ga0316587_1001625 3300033529 Bacteria 2827
1137 Ga0316587_1001728 3300033529 Bacteria 2772
1138 Ga0316587_1002587 3300033529 Bacteria 2434
1139 Ga0316587_1002672 3300033529 Bacteria 2411
1140 Ga0316587_1006257 3300033529 Bacteria 1814
1141 Ga0316587_1006816 3300033529 Bacteria 1758
1142 Ga0316596_1000224 3300033541 Bacteria 8525
1143 Ga0316596_1001143 3300033541 Bacteria 5190
1144 Ga0316596_1001775 3300033541 Bacteria 4479
1145 Ga0316596_1003514 3300033541 Bacteria 3443
1146 Ga0316596_1005947 3300033541 Bacteria 2813
1147 Ga0316596_1009326 3300033541 Bacteria 2354
1148 Ga0316596_1010266 3300033541 Bacteria 2263
1149 Ga0316596_1015403 3300033541 Bacteria 1905
1150 Ga0373958_0033968 3300034819 Bacteria 1014
1151 Ga0373940_0003447 3300035088 Bacteria 3232
1152 Ga0373940_0111018 3300035088 Bacteria 842
1153 Ga0373951_0005229 3300035091 Bacteria 3027
1154 Ga0373952_0005206 3300035092 Bacteria 2372
1155 Ga0373941_0043016 3300035115 Bacteria 1404
1156 Ga0373960_0003203 3300035121 Bacteria 3701
1157 Ga0373943_0051525 3300035170 Bacteria 2027
1158 Ga0373942_0045152 3300035207 Bacteria 1216
1159 Ga0316574_0000519 3300035398 Bacteria 15743
1160 Ga0316574_0000879 3300035398 Bacteria 13274
1161 Ga0316574_0001141 3300035398 Bacteria 12209
1162 Ga0316574_0001723 3300035398 Bacteria 10593
1163 Ga0316574_0217935 3300035398 Bacteria 1223
1164 Ga0316574_0237261 3300035398 Bacteria 1166
1165 Ga0316574_0341579 3300035398 Bacteria 948
1166 Ga0373931_0362461 3300035691 Bacteria 910
1167 Ga0373935_0111045 3300035692 Bacteria 1820
1168 Ga0316582_0001446 3300036647 Bacteria 10420
1169 Ga0316582_0002348 3300036647 Bacteria 8857
1170 Ga0316582_0002490 3300036647 Bacteria 8674
1171 Ga0316582_0022499 3300036647 Bacteria 3743
1172 Ga0316582_0032390 3300036647 Bacteria 3202
1173 Ga0316582_0207547 3300036647 Bacteria 1338
1174 Ga0316582_0236814 3300036647 Bacteria 1250
1175 Ga0316584_0001564 3300036712 Bacteria 13866
1176 Ga0316584_0007606 3300036712 Bacteria 7432
1177 Ga0316584_0012345 3300036712 Bacteria 6023
1178 Ga0316584_0058976 3300036712 Bacteria 2874
1179 Ga0316584_0306418 3300036712 Bacteria 1149
1180 Ga0373925_0188164 3300037068 Bacteria 1637
1181 Ga0373925_0275217 3300037068 Bacteria 1355
1182 Ga0395899_0000108 3300037312 Bacteria 142347
1183 Ga0395899_0064157 3300037312 Bacteria 2701
1184 Ga0395899_0293868 3300037312 Bacteria 1101
1185 Ga0395899_0329021 3300037312 Bacteria 1027
1186 Ga0395900_0000051 3300037418 Bacteria 224228
1187 Ga0395900_0000144 3300037418 Bacteria 119971
1188 Ga0395900_0002611 3300037418 Bacteria 19685
1189 Ga0395900_0085695 3300037418 Bacteria 3237
1190 Ga0395900_0138444 3300037418 Bacteria 2494
1191 Ga0395900_0419903 3300037418 Bacteria 1298
1192 Ga0395898_0000018 3300037466 Bacteria 418600
1193 Ga0395898_0000049 3300037466 Bacteria 284792
1194 Ga0395898_0050876 3300037466 Bacteria 4053
1195 Ga0395898_0062023 3300037466 Bacteria 3631
1196 Ga0395898_0159975 3300037466 Bacteria 2154
1197 Ga0395898_0257020 3300037466 Bacteria 1666
1198 Ga0395898_0614016 3300037466 Bacteria 1030
1199 Ga0395905_0002802 3300037471 Bacteria 19102
1200 Ga0395905_0014636 3300037471 Bacteria 7483
1201 Ga0395905_0159906 3300037471 Bacteria 2117
1202 Ga0395905_0240238 3300037471 Bacteria 1693
1203 Ga0395905_0289328 3300037471 Bacteria 1525
1204 Ga0395901_0000356 3300038443 Bacteria 55523
1205 Ga0395901_0007439 3300038443 Bacteria 11052
1206 Ga0395901_0065745 3300038443 Bacteria 3776
1207 Ga0395901_0263752 3300038443 Bacteria 1792
1208 Ga0395901_0399852 3300038443 Bacteria 1411
1209 Ga0395901_0443936 3300038443 Bacteria 1328
1210 Ga0395901_0449792 3300038443 Bacteria 1317
1211 Ga0237819_01204 3300038705 Bacteria 7225
1212 Ga0400488_28249 3300038741 Bacteria 3983
1213 Ga0400483_043964 3300039062 Bacteria 4816
1214 Ga0400483_173977 3300039062 Bacteria 8288
1215 Ga0400487_66353 3300039110 Bacteria 11859
1216 Ga0436365_0191135 3300039437 Bacteria 1980
1217 Ga0439436_0000030 3300041404 Bacteria 48429
1218 Ga0439465_0000405 3300041413 Bacteria 12512
1219 Ga0439465_0002224 3300041413 Bacteria 6363
1220 Ga0451793_0077380 3300041452 Bacteria 1568
1221 Ga0451793_0740756 3300041452 Bacteria 3252
1222 Ga0451793_1663964 3300041452 Bacteria 1384
1223 Ga0451797_1461544 3300041453 Bacteria 1713
1224 Ga0451795_0260148 3300041456 Bacteria 1367
1225 Ga0451802_0477990 3300041460 Bacteria 7183
1226 Ga0451808_17140 3300041464 Bacteria 1458
1227 Ga0451807_0735864 3300041486 Bacteria 3233
1228 Ga0451843_0137728 3300041509 Bacteria 1325
1229 Ga0439441_014725 3300042001 Bacteria 1375
1230 Ga0439445_0003009 3300042004 Bacteria 3774
1231 Ga0439448_0001117 3300042005 Bacteria 6768
1232 Ga0439448_0067247 3300042005 Bacteria 1190
1233 Ga0439449_0000048 3300042007 Bacteria 36681
1234 Ga0439450_009785 3300042008 Bacteria 1832
1235 Ga0439455_0001844 3300042012 Bacteria 3697
1236 Ga0439455_0004575 3300042012 Bacteria 2751
1237 Ga0439455_0008969 3300042012 Bacteria 2159
1238 Ga0450891_002252 3300042129 Unclassified 1951
1239 Ga0450908_001816 3300042184 Bacteria 4176
1240 Ga0439459_0000122 3300042438 Bacteria 7534
1241 Ga0439459_0001238 3300042438 Bacteria 3730
1242 Ga0439464_0002592 3300042439 Bacteria 4467
1243 Ga0439464_0004445 3300042439 Bacteria 3589
1244 Ga0439464_0021652 3300042439 Bacteria 1765
1245 Ga0439460_0001989 3300042461 Bacteria 4888
1246 Ga0451577_0000852 3300042876 Bacteria 45450
1247 Ga0451577_0001148 3300042876 Bacteria 37395
1248 Ga0451577_0005484 3300042876 Bacteria 12988
1249 Ga0451577_0013868 3300042876 Bacteria 7525
1250 Ga0466969_0007454 3300044656 Bacteria 5813
1251 Ga0466972_0032221 3300044658 Bacteria 2574
1252 Ga0466972_0073090 3300044658 Bacteria 1634
1253 Ga0466989_0188469 3300044663 Bacteria 1222
1254 Ga0466982_0000003 3300044672 Bacteria 417243
1255 Ga0453683_0076427 3300044673 Bacteria 2097
1256 Ga0466965_0006406 3300044683 Bacteria 5344
1257 Ga0466965_0025791 3300044683 Bacteria 2847
1258 Ga0466965_0187235 3300044683 Bacteria 1094
1259 Ga0466966_0002423 3300044684 Bacteria 12184
1260 Ga0466966_0015597 3300044684 Bacteria 5021
1261 Ga0466966_0019653 3300044684 Bacteria 4443
1262 Ga0466966_0034789 3300044684 Bacteria 3257
1263 Ga0466966_0288483 3300044684 Bacteria 986
1264 Ga0466961_0001662 3300044693 Bacteria 13835
1265 Ga0466961_0028191 3300044693 Bacteria 3610
1266 Ga0466961_0035526 3300044693 Bacteria 3200
1267 Ga0466961_0091880 3300044693 Bacteria 1916
1268 Ga0466961_0145599 3300044693 Bacteria 1481
1269 Ga0466963_0133386 3300044694 Bacteria 1717
1270 Ga0466963_0302871 3300044694 Bacteria 1124
1271 Ga0466964_0001374 3300044706 Bacteria 8309
1272 Ga0453684_0000298 3300044712 Bacteria 209777
1273 Ga0453684_0000348 3300044712 Bacteria 192530
1274 Ga0453684_0000419 3300044712 Bacteria 173463
1275 Ga0453684_0002092 3300044712 Bacteria 50519
1276 Ga0453684_0003824 3300044712 Bacteria 33195
1277 Ga0453684_0042299 3300044712 Bacteria 6144
1278 Ga0453684_0319178 3300044712 Unclassified 1760
1279 Ga0466971_0001052 3300044719 Bacteria 11434
1280 Ga0466971_0015307 3300044719 Bacteria 3375
1281 Ga0466971_0052473 3300044719 Bacteria 1836
1282 Ga0466968_0018034 3300044735 Bacteria 2828
1283 Ga0466968_0057632 3300044735 Bacteria 1670
1284 Ga0466968_0085106 3300044735 Bacteria 1395
1285 Ga0466970_0000202 3300044765 Bacteria 28937
1286 Ga0466970_0021855 3300044765 Bacteria 3337
1287 Ga0466970_0040664 3300044765 Bacteria 2469
1288 Ga0466970_0063568 3300044765 Bacteria 1979
1289 Ga0466970_0232500 3300044765 Bacteria 1030
1290 Ga0466970_0234734 3300044765 Bacteria 1025
1291 Ga0466957_0006156 3300044842 Bacteria 6773
1292 Ga0466957_0108334 3300044842 Bacteria 1759
1293 Ga0466957_0308180 3300044842 Bacteria 1065
1294 Ga0466959_0000194 3300045049 Bacteria 39999
1295 Ga0466959_0003791 3300045049 Bacteria 10025
1296 Ga0466959_0005674 3300045049 Bacteria 8585
1297 Ga0466959_0031749 3300045049 Bacteria 3908
1298 Ga0451576_0000033 3300045051 Bacteria 393131
1299 Ga0451576_0005108 3300045051 Bacteria 16632
1300 Ga0451576_0007972 3300045051 Bacteria 12526
1301 Ga0451576_0132144 3300045051 Bacteria 2602
1302 Ga0451576_0164052 3300045051 Bacteria 2318
1303 Ga0451576_0279211 3300045051 Bacteria 1746
1304 Ga0451576_0740926 3300045051 Bacteria 1032
1305 Ga0466958_0010562 3300045836 Bacteria 5175
1306 Ga0466958_0106742 3300045836 Bacteria 1746
1307 Ga0466958_0283288 3300045836 Bacteria 1062
1308 Ga0466967_0134565 3300045976 Bacteria 2298
1309 Ga0495617_000586 3300046452 Bacteria 18560
1310 Ga0495617_000939 3300046452 Bacteria 13544
1311 Ga0495627_000074 3300046453 Bacteria 123139
1312 Ga0495590_0002633 3300046457 Bacteria 7420
1313 Ga0495590_0024655 3300046457 Bacteria 2119
1314 Ga0495591_000142 3300046458 Bacteria 76727
1315 Ga0495629_0120610 3300046459 Bacteria 1827
1316 Ga0495638_0000038 3300046460 Bacteria 249534
1317 Ga0495638_0000153 3300046460 Bacteria 109155
1318 Ga0495641_0038501 3300046461 Bacteria 2234
1319 Ga0495651_0307790 3300046462 Bacteria 1061
1320 Ga0495650_0000337 3300046471 Bacteria 83530
1321 Ga0495650_0001325 3300046471 Bacteria 24874
1322 Ga0495650_0001596 3300046471 Bacteria 21215
1323 Ga0495580_0189443 3300046472 Bacteria 1419
1324 Ga0495580_0379156 3300046472 Bacteria 955
1325 Ga0495582_0098622 3300046473 Bacteria 1635
1326 Ga0495605_0003518 3300046474 Bacteria 9308
1327 Ga0495584_0002465 3300046491 Bacteria 10482
1328 Ga0495585_0000104 3300046492 Bacteria 90097
1329 Ga0495585_0082489 3300046492 Bacteria 1740
1330 Ga0495594_0358867 3300046499 Bacteria 830
1331 Ga0495596_0002137 3300046500 Bacteria 10800
1332 Ga0495607_0000211 3300046501 Bacteria 62291
1333 Ga0495607_0002313 3300046501 Bacteria 15633
1334 Ga0495607_0021677 3300046501 Bacteria 4040
1335 Ga0495583_0018274 3300046506 Bacteria 3694
1336 Ga0495606_0000338 3300046507 Bacteria 80898
1337 Ga0495606_0000401 3300046507 Bacteria 73149
1338 Ga0495606_0009207 3300046507 Bacteria 8393
1339 Ga0495606_0024882 3300046507 Bacteria 4301
1340 Ga0495606_0078131 3300046507 Bacteria 2065
1341 Ga0495610_0000482 3300046512 Bacteria 41191
1342 Ga0495610_0004004 3300046512 Bacteria 11120
1343 Ga0495610_0015960 3300046512 Bacteria 4343
1344 Ga0495616_0000086 3300046513 Bacteria 78187
1345 Ga0495616_0008261 3300046513 Bacteria 6178
1346 Ga0495620_0001045 3300046515 Bacteria 16982
1347 Ga0495620_0001112 3300046515 Bacteria 16400
1348 Ga0495631_0064213 3300046518 Bacteria 1589
1349 Ga0495632_0000004 3300046519 Bacteria 381372
1350 Ga0495632_0053890 3300046519 Bacteria 1973
1351 Ga0495632_0098893 3300046519 Bacteria 1376
1352 Ga0495632_0147550 3300046519 Bacteria 1088
1353 Ga0495643_0058644 3300046522 Bacteria 2048
1354 Ga0495648_0009285 3300046524 Bacteria 7644
1355 Ga0495648_0030047 3300046524 Bacteria 3599
1356 Ga0495642_0011374 3300046528 Bacteria 3418
1357 Ga0495609_0002596 3300046538 Bacteria 10988
1358 Ga0495609_0025461 3300046538 Bacteria 2712
1359 Ga0495621_0023410 3300046539 Bacteria 2054
1360 Ga0495597_0000040 3300046542 Bacteria 112292
1361 Ga0495597_0151779 3300046542 Bacteria 950
1362 Ga0495645_0072485 3300046543 Bacteria 2482
1363 Ga0495622_0157027 3300046557 Bacteria 1027
1364 Ga0495656_0049079 3300046615 Bacteria 1796
1365 Ga0495668_0003978 3300046616 Bacteria 10764
1366 Ga0495611_0000001 3300046648 Bacteria 2628469
1367 Ga0495611_0000105 3300046648 Bacteria 58236
1368 Ga0495625_0000022 3300046660 Bacteria 278823
1369 Ga0495625_0080749 3300046660 Bacteria 2264
1370 Ga0495625_0135776 3300046660 Bacteria 1663
1371 Ga0495661_0000199 3300046665 Bacteria 69536
1372 Ga0495661_0005804 3300046665 Bacteria 8726
1373 Ga0495647_0056706 3300046681 Bacteria 1536
1374 Ga0495658_0013679 3300046683 Bacteria 4134
1375 Ga0495658_0019973 3300046683 Bacteria 3506
1376 Ga0495671_0000372 3300046692 Bacteria 36874
1377 Ga0495671_0002703 3300046692 Bacteria 11106
1378 Ga0495649_0001571 3300046694 Bacteria 17089
1379 Ga0495649_0013612 3300046694 Bacteria 4689
1380 Ga0495649_0040058 3300046694 Bacteria 2567
1381 Ga0495589_0000059 3300046794 Bacteria 107171
1382 Ga0495660_0057098 3300046810 Bacteria 2106
1383 Ga0495636_0090633 3300047318 Bacteria 1327
1384 Ga0495674_0160703 3300047319 Bacteria 1880
1385 Ga0495672_0059695 3300047320 Bacteria 2206
1386 Ga0495687_005446 3300047443 Bacteria 8111
1387 Ga0495679_000004 3300047446 Bacteria 748056
1388 Ga0495685_007721 3300047447 Bacteria 3558
1389 Ga0495673_0000004 3300047469 Bacteria 1354526
1390 Ga0495673_0000048 3300047469 Bacteria 265950
1391 Ga0495686_0000017 3300047472 Bacteria 435554
1392 Ga0495686_0001206 3300047472 Bacteria 29747
1393 Ga0495686_0013830 3300047472 Bacteria 5587
1394 Ga0495686_0013909 3300047472 Bacteria 5567
1395 Ga0495686_0030419 3300047472 Bacteria 3507
1396 Ga0495686_0089278 3300047472 Bacteria 1873
1397 Ga0496100_0009393 3300048903 Bacteria 5498
1398 Ga0496101_0000776 3300048904 Bacteria 18897
1399 Ga0496101_0283596 3300048904 Bacteria 1295
1400 Ga0496102_0066165 3300048905 Bacteria 3313
1401 Ga0496102_0216773 3300048905 Bacteria 1804
1402 Ga0496103_0021319 3300048906 Bacteria 3898
1403 Ga0496103_0418985 3300048906 Bacteria 859
1404 Ga0496104_0000011 3300048907 Bacteria 459358
1405 Ga0496104_0072803 3300048907 Bacteria 3268
1406 Ga0496104_0197782 3300048907 Bacteria 1922
1407 Ga0496105_0000071 3300048908 Bacteria 79908
1408 Ga0496105_0001886 3300048908 Bacteria 15030
1409 Ga0496106_0001299 3300048909 Bacteria 18754
1410 Ga0496106_0076000 3300048909 Bacteria 2574
1411 Ga0496113_0002731 3300048916 Bacteria 10367
1412 Ga0496113_0312504 3300048916 Bacteria 1259
1413 Ga0496115_0000062 3300048918 Bacteria 100189
1414 Ga0496115_0000503 3300048918 Bacteria 30610
1415 Ga0496115_0010955 3300048918 Bacteria 6789
1416 Ga0496115_0143611 3300048918 Bacteria 1969
1417 Ga0496116_0005928 3300048919 Bacteria 11207
1418 Ga0496116_0032919 3300048919 Bacteria 3687
1419 Ga0496116_0034533 3300048919 Bacteria 3567
1420 Ga0496116_0040912 3300048919 Bacteria 3186
1421 Ga0496116_0065855 3300048919 Bacteria 2322
1422 Ga0496117_0002308 3300048920 Bacteria 24516
1423 Ga0496117_0008888 3300048920 Bacteria 9471
1424 Ga0496117_0011079 3300048920 Bacteria 8114
1425 Ga0496117_0015531 3300048920 Bacteria 6484
1426 Ga0496117_0187842 3300048920 Bacteria 1181
1427 Ga0496118_0001694 3300048921 Bacteria 32220
1428 Ga0496118_0002288 3300048921 Bacteria 26119
1429 Ga0496118_0004070 3300048921 Bacteria 17730
1430 Ga0496118_0005974 3300048921 Bacteria 13580
1431 Ga0496118_0008410 3300048921 Bacteria 10671
1432 Ga0496118_0016919 3300048921 Bacteria 6660
1433 Ga0496118_0044429 3300048921 Bacteria 3479
1434 Ga0496119_0000430 3300048922 Bacteria 57802
1435 Ga0496120_0001482 3300048923 Bacteria 27908
1436 Ga0496120_0026146 3300048923 Bacteria 3609
1437 Ga0496121_0000743 3300048924 Bacteria 59998
1438 Ga0496121_0000878 3300048924 Bacteria 54427
1439 Ga0496121_0005536 3300048924 Bacteria 16138
1440 Ga0496121_0011904 3300048924 Bacteria 9576
1441 Ga0496121_0019136 3300048924 Bacteria 6864
1442 Ga0496121_0025245 3300048924 Bacteria 5646
1443 Ga0496121_0029686 3300048924 Bacteria 5045
1444 Ga0496121_0068654 3300048924 Bacteria 2866
1445 Ga0496121_0099925 3300048924 Bacteria 2241
1446 Ga0496121_0166342 3300048924 Bacteria 1607
1447 Ga0496122_0001419 3300048925 Bacteria 38784
1448 Ga0496122_0006843 3300048925 Bacteria 12928
1449 Ga0496122_0008492 3300048925 Bacteria 11061
1450 Ga0496122_0034716 3300048925 Bacteria 4120
1451 Ga0496122_0260417 3300048925 Bacteria 963
1452 Ga0496123_0001598 3300048926 Bacteria 30746
1453 Ga0496123_0006599 3300048926 Bacteria 11206
1454 Ga0496123_0007233 3300048926 Bacteria 10537
1455 Ga0496123_0044685 3300048926 Bacteria 3026
1456 Ga0496123_0053734 3300048926 Bacteria 2659
1457 Ga0496123_0108715 3300048926 Bacteria 1591
1458 Ga0496123_0208601 3300048926 Bacteria 995
1459 Ga0496124_0001044 3300048927 Bacteria 43754
1460 Ga0496124_0022236 3300048927 Bacteria 5819
1461 Ga0496124_0084629 3300048927 Bacteria 2600
1462 Ga0496125_0000330 3300048928 Bacteria 91043
1463 Ga0496125_0007864 3300048928 Bacteria 11266
1464 Ga0496125_0141264 3300048928 Bacteria 1674
1465 Ga0496125_0234616 3300048928 Bacteria 1170
1466 Ga0496126_0000057 3300048929 Bacteria 276781
1467 Ga0496126_0003181 3300048929 Bacteria 21118
1468 Ga0496126_0011781 3300048929 Bacteria 9002
1469 Ga0496126_0037880 3300048929 Bacteria 4492
1470 Ga0496126_0085543 3300048929 Bacteria 2779
1471 Ga0496126_0107731 3300048929 Bacteria 2430
1472 Ga0496126_0122123 3300048929 Bacteria 2258
1473 Ga0496126_0528490 3300048929 Bacteria 939
1474 Ga0501308_005631 3300049128 Bacteria 1255
1475 Ga0501305_002547 3300049161 Bacteria 1980
1476 Ga0495678_000237 3300049459 Bacteria 62286
1477 Ga0495678_046180 3300049459 Bacteria 1713
1478 Ga0495682_0010154 3300049460 Bacteria 3656
1479 Ga0501031_0005253 3300049568 Bacteria 8442
1480 Ga0501031_0081639 3300049568 Bacteria 2107
1481 Ga0501031_0149859 3300049568 Bacteria 1524
1482 Ga0501031_0523149 3300049568 Bacteria 765
1483 Ga0501032_0005060 3300049569 Bacteria 9851
1484 Ga0501032_0005454 3300049569 Bacteria 9442
1485 Ga0501032_0123687 3300049569 Bacteria 1709
1486 Ga0501032_0153567 3300049569 Bacteria 1513
1487 Ga0501033_0000329 3300049570 Bacteria 45324
1488 Ga0501033_0003729 3300049570 Bacteria 12395
1489 Ga0501033_0019213 3300049570 Bacteria 5166
1490 Ga0501033_0186760 3300049570 Bacteria 1484
1491 Ga0501034_0000411 3300049571 Bacteria 72008
1492 Ga0501034_0001357 3300049571 Bacteria 33066
1493 Ga0501034_0001661 3300049571 Bacteria 28667
1494 Ga0501034_0003703 3300049571 Bacteria 17262
1495 Ga0501034_0037041 3300049571 Bacteria 4939
1496 Ga0501034_0062696 3300049571 Bacteria 3733
1497 Ga0501034_0123873 3300049571 Bacteria 2570
1498 Ga0501034_0149559 3300049571 Bacteria 2311
1499 Ga0501034_0183306 3300049571 Bacteria 2058
1500 Ga0501034_0295390 3300049571 Bacteria 1557
1501 Ga0501034_0331371 3300049571 Bacteria 1454
1502 Ga0501034_0397917 3300049571 Bacteria 1300
1503 Ga0501034_0727426 3300049571 Bacteria 889
1504 Ga0501036_0005648 3300049572 Bacteria 10147
1505 Ga0501036_0027370 3300049572 Bacteria 4818
1506 Ga0501036_0045145 3300049572 Bacteria 3734
1507 Ga0501036_0064157 3300049572 Bacteria 3109
1508 Ga0501036_0328518 3300049572 Bacteria 1278
1509 Ga0501036_0482795 3300049572 Bacteria 1031
1510 Ga0501037_0007118 3300049573 Bacteria 8175
1511 Ga0501037_0009391 3300049573 Bacteria 7176
1512 Ga0501037_0044301 3300049573 Bacteria 3267
1513 Ga0501037_0186342 3300049573 Bacteria 1470
1514 Ga0501038_0002332 3300049574 Bacteria 17683
1515 Ga0501038_0007237 3300049574 Bacteria 10252
1516 Ga0501038_0020463 3300049574 Bacteria 5947
1517 Ga0501038_0224483 3300049574 Bacteria 1497
1518 Ga0501038_0330702 3300049574 Bacteria 1190
1519 Ga0501038_0610420 3300049574 Bacteria 824
1520 Ga0501039_0003401 3300049575 Bacteria 11893
1521 Ga0501039_0013074 3300049575 Bacteria 6347
1522 Ga0501039_0137852 3300049575 Bacteria 1916
1523 Ga0501040_0002748 3300049576 Bacteria 11335
1524 Ga0501040_0009977 3300049576 Bacteria 6202
1525 Ga0501040_0029928 3300049576 Bacteria 3675
1526 Ga0501041_0005212 3300049577 Bacteria 7592
1527 Ga0501041_0105148 3300049577 Bacteria 1749
1528 Ga0501042_0019042 3300049578 Bacteria 4763
1529 Ga0501042_0037272 3300049578 Bacteria 3451
1530 Ga0501042_0104451 3300049578 Bacteria 2038
1531 Ga0501042_0325065 3300049578 Bacteria 1111
1532 Ga0501043_0004587 3300049579 Bacteria 11206
1533 Ga0501043_0005521 3300049579 Bacteria 10209
1534 Ga0501043_0038883 3300049579 Bacteria 3741
1535 Ga0501043_0079013 3300049579 Bacteria 2585
1536 Ga0501043_0081864 3300049579 Bacteria 2537
1537 Ga0501043_0123909 3300049579 Bacteria 2026
1538 Ga0501043_0233102 3300049579 Bacteria 1421
1539 Ga0501043_0447378 3300049579 Bacteria 971
1540 Ga0501046_0000202 3300049580 Bacteria 61588
1541 Ga0501046_0002951 3300049580 Bacteria 15738
1542 Ga0501046_0008359 3300049580 Bacteria 9027
1543 Ga0501046_0012744 3300049580 Bacteria 7153
1544 Ga0501046_0020233 3300049580 Bacteria 5508
1545 Ga0501046_0024836 3300049580 Bacteria 4910
1546 Ga0501046_0045092 3300049580 Bacteria 3505
1547 Ga0501046_0086828 3300049580 Bacteria 2411
1548 Ga0501047_0000748 3300049581 Bacteria 33896
1549 Ga0501047_0007229 3300049581 Bacteria 10437
1550 Ga0501047_0034066 3300049581 Bacteria 4917
1551 Ga0501047_0057135 3300049581 Bacteria 3774
1552 Ga0501047_0080934 3300049581 Bacteria 3122
1553 Ga0501047_0085772 3300049581 Bacteria 3025
1554 Ga0501047_0099975 3300049581 Bacteria 2779
1555 Ga0501047_0119717 3300049581 Bacteria 2515
1556 Ga0501047_0202088 3300049581 Unclassified 1848
1557 Ga0501047_0238805 3300049581 Bacteria 1668
1558 Ga0501047_0286709 3300049581 Bacteria 1490
1559 Ga0501048_0024201 3300049582 Bacteria 4432
1560 Ga0501048_0026524 3300049582 Bacteria 4219
1561 Ga0501048_0049453 3300049582 Bacteria 2996
1562 Ga0501048_0110752 3300049582 Bacteria 1938
1563 Ga0501067_0000969 3300049583 Bacteria 15401
1564 Ga0501067_0004300 3300049583 Bacteria 7847
1565 Ga0501067_0211324 3300049583 Bacteria 1081
1566 Ga0501068_0108801 3300049584 Bacteria 1722
1567 Ga0501068_0134694 3300049584 Bacteria 1546
1568 Ga0501068_0165665 3300049584 Bacteria 1394
1569 Ga0501068_0310731 3300049584 Bacteria 1010
1570 Ga0501069_0008226 3300049585 Bacteria 5477
1571 Ga0501069_0008287 3300049585 Bacteria 5458
1572 Ga0501069_0009860 3300049585 Bacteria 5051
1573 Ga0501069_0026830 3300049585 Bacteria 3155
1574 Ga0501069_0037712 3300049585 Bacteria 2667
1575 Ga0501069_0137842 3300049585 Bacteria 1399
1576 Ga0501069_0220764 3300049585 Bacteria 1101
1577 Ga0501069_0359915 3300049585 Bacteria 858
1578 Ga0501070_0000511 3300049586 Bacteria 35493
1579 Ga0501070_0000588 3300049586 Bacteria 33139
1580 Ga0501070_0003969 3300049586 Bacteria 12730
1581 Ga0501070_0007466 3300049586 Bacteria 9287
1582 Ga0501070_0020658 3300049586 Bacteria 5523
1583 Ga0501070_0038354 3300049586 Bacteria 3997
1584 Ga0501070_0052819 3300049586 Bacteria 3372
1585 Ga0501070_0063480 3300049586 Bacteria 3059
1586 Ga0501070_0111768 3300049586 Bacteria 2258
1587 Ga0501070_0156042 3300049586 Bacteria 1882
1588 Ga0501070_0169190 3300049586 Bacteria 1800
1589 Ga0501070_0261498 3300049586 Bacteria 1414
1590 Ga0501070_0332190 3300049586 Bacteria 1235
1591 Ga0501070_0341362 3300049586 Bacteria 1216
1592 Ga0501071_0016581 3300049587 Bacteria 5068
1593 Ga0501071_0068531 3300049587 Bacteria 2582
1594 Ga0501071_0205135 3300049587 Bacteria 1481
1595 Ga0501071_0268087 3300049587 Bacteria 1290
1596 Ga0501072_0009507 3300049588 Bacteria 7394
1597 Ga0501072_0031970 3300049588 Bacteria 4120
1598 Ga0501072_0075815 3300049588 Bacteria 2660
1599 Ga0501072_0094580 3300049588 Bacteria 2374
1600 Ga0501073_0013953 3300049589 Bacteria 5840
1601 Ga0501073_0016433 3300049589 Bacteria 5362
1602 Ga0501073_0020861 3300049589 Bacteria 4725
1603 Ga0501073_0037122 3300049589 Bacteria 3461
1604 Ga0501073_0046668 3300049589 Bacteria 3045
1605 Ga0501073_0051652 3300049589 Bacteria 2879
1606 Ga0501073_0073633 3300049589 Bacteria 2378
1607 Ga0501073_0085565 3300049589 Bacteria 2193
1608 Ga0501073_0204491 3300049589 Bacteria 1365
1609 Ga0501073_0279371 3300049589 Bacteria 1152
1610 Ga0501074_0004544 3300049590 Bacteria 9933
1611 Ga0501074_0006004 3300049590 Bacteria 8762
1612 Ga0501074_0007085 3300049590 Bacteria 8101
1613 Ga0501074_0009292 3300049590 Bacteria 7140
1614 Ga0501074_0013181 3300049590 Bacteria 6011
1615 Ga0501074_0053421 3300049590 Bacteria 2914
1616 Ga0501074_0086594 3300049590 Bacteria 2244
1617 Ga0501074_0175423 3300049590 Bacteria 1529
1618 Ga0501075_0022125 3300049591 Bacteria 4642
1619 Ga0501075_0143193 3300049591 Bacteria 1822
1620 Ga0501076_0018272 3300049592 Bacteria 5343
1621 Ga0501076_0251135 3300049592 Bacteria 1447
1622 Ga0501079_0000982 3300049741 Bacteria 19647
1623 Ga0501079_0079959 3300049741 Bacteria 2527
1624 Ga0501079_0086907 3300049741 Bacteria 2420
1625 Ga0501079_0224337 3300049741 Bacteria 1468
1626 Ga0501079_0310252 3300049741 Bacteria 1234
1627 Ga0501080_0001987 3300049742 Bacteria 17631
1628 Ga0501080_0005078 3300049742 Bacteria 11725
1629 Ga0501080_0009813 3300049742 Bacteria 8750
1630 Ga0501080_0024565 3300049742 Bacteria 5587
1631 Ga0501080_0026489 3300049742 Bacteria 5387
1632 Ga0501080_0029269 3300049742 Bacteria 5127
1633 Ga0501080_0037132 3300049742 Bacteria 4548
1634 Ga0501080_0058835 3300049742 Bacteria 3576
1635 Ga0501080_0119095 3300049742 Bacteria 2447
1636 Ga0501080_0183587 3300049742 Unclassified 1924
1637 Ga0501081_0002701 3300049743 Bacteria 11222
1638 Ga0501083_0003824 3300049744 Bacteria 10573
1639 Ga0501083_0012064 3300049744 Bacteria 6051
1640 Ga0501083_0093189 3300049744 Bacteria 1988
1641 Ga0501035_0003159 3300049822 Bacteria 15825
1642 Ga0501035_0004686 3300049822 Bacteria 12978
1643 Ga0501035_0011530 3300049822 Bacteria 8189
1644 Ga0501035_0059213 3300049822 Bacteria 3411
1645 Ga0501035_0065799 3300049822 Bacteria 3217
1646 Ga0501035_0225887 3300049822 Bacteria 1597
1647 Ga0501035_0288812 3300049822 Bacteria 1384
1648 Ga0501035_0310314 3300049822 Bacteria 1327
1649 Ga0501035_0466818 3300049822 Bacteria 1042
1650 Ga0501044_0006675 3300049823 Bacteria 12721
1651 Ga0501044_0009007 3300049823 Bacteria 10916
1652 Ga0501044_0010264 3300049823 Bacteria 10172
1653 Ga0501044_0030778 3300049823 Bacteria 5654
1654 Ga0501044_0035211 3300049823 Bacteria 5244
1655 Ga0501044_0051231 3300049823 Bacteria 4256
1656 Ga0501044_0071532 3300049823 Bacteria 3526
1657 Ga0501044_0088501 3300049823 Bacteria 3126
1658 Ga0501044_0122205 3300049823 Bacteria 2603
1659 Ga0501044_0128713 3300049823 Bacteria 2527
1660 Ga0501044_0189331 3300049823 Bacteria 2021
1661 Ga0501044_0476047 3300049823 Bacteria 1152
1662 Ga0501044_0545866 3300049823 Bacteria 1056
1663 Ga0501045_0001661 3300049824 Bacteria 14965
1664 Ga0501045_0165938 3300049824 Bacteria 1644
1665 Ga0501045_0196647 3300049824 Bacteria 1503
1666 nmdc:mga05p37_253260_c1 3300050507 Bacteria 2111
1667 nmdc:mga05p37_43420_c1 3300050507 Bacteria 5531
1668 nmdc:mga08y16_288964_c1 3300050511 Bacteria 1690
1669 nmdc:mga0n895_121117_c1 3300050512 Bacteria 2638
1670 nmdc:mga0rr50_798_c1 3300050513 Bacteria 17004
1671 nmdc:mga08x19_107361_c1 3300050514 Bacteria 1859
1672 nmdc:mga08x19_193477_c1 3300050514 Bacteria 1392
1673 nmdc:mga08x19_40745_c1 3300050514 Bacteria 2957
1674 nmdc:mga0a205_67618_c1 3300050515 Bacteria 3452
1675 nmdc:mga0sz30_9663_c1 3300050516 Bacteria 3676
1676 Ga0500610_0013261 3300053079 Bacteria 3829
1677 Ga0500643_000020 3300053087 Bacteria 290328
1678 Ga0500643_036015 3300053087 Bacteria 1479
1679 Ga0500651_0000592 3300053093 Bacteria 18193
1680 Ga0500555_000336 3300053103 Bacteria 20134
1681 Ga0500597_027420 3300053120 Bacteria 2314
1682 Ga0500652_085216 3300053131 Bacteria 1317
1683 Ga0500559_0144884 3300053136 Bacteria 1113
1684 Ga0500561_0014856 3300053137 Bacteria 1717
1685 Ga0500568_0000145 3300053139 Bacteria 62300
1686 Ga0500627_0119526 3300053158 Bacteria 1188
1687 Ga0500633_0000702 3300053160 Bacteria 5658
1688 Ga0500636_0214431 3300053177 Bacteria 1008
1689 Ga0500645_001746 3300053730 Bacteria 10543
1690 Ga0501084_0002444 3300054114 Bacteria 14939
1691 Ga0501084_0077485 3300054114 Bacteria 2787
1692 Ga0501084_0315743 3300054114 Bacteria 1320
1693 Ga0500661_007161 3300055283 Bacteria 2070
1694 Ga0587073_0002117 3300059492 Bacteria 2486
1695 Ga0587082_000953 3300059504 Bacteria 2763
1696 Ga0587083_0017763 3300059505 Bacteria 1277
1697 Ga0587088_021761 3300059508 Bacteria 1075
1698 Ga0587106_011083 3300059605 Bacteria 1181
1699 Ga0587076_002674 3300059645 Bacteria 2030
1700 Ga0501082_0000082 3300060353 Bacteria 71065
1701 Ga0501082_0001816 3300060353 Bacteria 18794
1702 Ga0501082_0160299 3300060353 Bacteria 1955
1703 Ga0501082_0197205 3300060353 Bacteria 1751
1704 Ga0501082_0330353 3300060353 Bacteria 1328
1705 Ga0466962_0002443 3300061719 Bacteria 8811
1706 Ga0466962_0061287 3300061719 Bacteria 1796
1707 Ga0530510_0013467 3300061734 Bacteria 5750
1708 Ga0530510_0101826 3300061734 Bacteria 2100

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046542 Ga0495597_0151779 Ga0495597_0151779_182_937 212
2 iso_pu_bacteria 2858688981 2858697910 213
3 iso_pu_bacteria 2901300506 2901308509 213
4 3300046665 Ga0495661_0005804 Ga0495661_0005804_4455_5120 216
5 3300047447 Ga0495685_007721 Ga0495685_007721_778_1482 218
6 3300042005 Ga0439448_0067247 Ga0439448_0067247_372_1124 220
7 3300042008 Ga0439450_009785 Ga0439450_009785_109_861 220
8 3300042439 Ga0439464_0021652 Ga0439464_0021652_839_1591 220
9 3300042461 Ga0439460_0001989 Ga0439460_0001989_1743_2495 220
10 3300049589 Ga0501073_0279371 Ga0501073_0279371_25_777 220
11 3300049574 Ga0501038_0020463 Ga0501038_0020463_553_1305 221
12 3300049576 Ga0501040_0002748 Ga0501040_0002748_7897_8649 221
13 3300049577 Ga0501041_0005212 Ga0501041_0005212_119_871 221
14 3300049578 Ga0501042_0019042 Ga0501042_0019042_161_913 221
15 3300049580 Ga0501046_0000202 Ga0501046_0000202_6544_7296 221
16 3300049581 Ga0501047_0202088 Ga0501047_0202088_801_1553 221
17 3300049582 Ga0501048_0024201 Ga0501048_0024201_1516_2268 221
18 3300049584 Ga0501068_0310731 Ga0501068_0310731_59_811 221
19 3300049587 Ga0501071_0016581 Ga0501071_0016581_663_1415 221
20 3300049588 Ga0501072_0031970 Ga0501072_0031970_1316_2068 221
21 3300049590 Ga0501074_0006004 Ga0501074_0006004_3017_3769 221
22 3300049592 Ga0501076_0018272 Ga0501076_0018272_290_1042 221
23 3300049741 Ga0501079_0000982 Ga0501079_0000982_1045_1797 221
24 3300049742 Ga0501080_0183587 Ga0501080_0183587_29_781 221
25 3300049743 Ga0501081_0002701 Ga0501081_0002701_10367_11119 221
26 3300049744 Ga0501083_0003824 Ga0501083_0003824_912_1664 221
27 3300049824 Ga0501045_0001661 Ga0501045_0001661_9432_10184 221
28 3300054114 Ga0501084_0002444 Ga0501084_0002444_8283_9035 221
29 3300060353 Ga0501082_0001816 Ga0501082_0001816_10373_11125 221
30 3300061734 Ga0530510_0101826 Ga0530510_0101826_1338_2090 221
31 3300005341 Ga0070691_10103569 Ga0070691_101035691 223
32 3300005457 Ga0070662_100050898 Ga0070662_1000508982 223
33 3300005545 Ga0070695_100018060 Ga0070695_1000180606 223
34 3300013307 Ga0157372_10110493 Ga0157372_101104935 223
35 3300025933 Ga0207706_10127035 Ga0207706_101270354 223
36 3300027526 Ga0209968_1013426 Ga0209968_10134262 223
37 3300027543 Ga0209999_1000590 Ga0209999_10005906 223
38 3300027614 Ga0209970_1006001 Ga0209970_10060013 223
39 3300027617 Ga0210002_1011695 Ga0210002_10116952 223
40 3300027682 Ga0209971_1000054 Ga0209971_100005437 223
41 3300027695 Ga0209966_1000059 Ga0209966_100005936 223
42 3300027717 Ga0209998_10000066 Ga0209998_1000006634 223
43 3300045051 Ga0451576_0132144 Ga0451576_0132144_22_774 223
44 3300046528 Ga0495642_0011374 Ga0495642_0011374_452_1240 223
45 3300047443 Ga0495687_005446 Ga0495687_005446_817_1605 223
46 3300049591 Ga0501075_0022125 Ga0501075_0022125_99_851 223
47 3300044658 Ga0466972_0032221 Ga0466972_0032221_1243_2034 225
48 3300044765 Ga0466970_0000202 Ga0466970_0000202_15555_16346 225
49 3300046519 Ga0495632_0098893 Ga0495632_0098893_641_1363 227
50 iso_pu_bacteria 2554235341 2555668058 227
51 3300005338 Ga0068868_100045091 Ga0068868_1000450914 229
52 3300005618 Ga0068864_100208859 Ga0068864_1002088593 229
53 3300006852 Ga0075433_10005758 Ga0075433_100057584 229
54 3300026023 Ga0207677_10247984 Ga0207677_102479841 229
55 3300035691 Ga0373931_0362461 Ga0373931_0362461_175_885 229
56 3300033179 Ga0307507_10161388 Ga0307507_101613882 230
57 3300046461 Ga0495641_0038501 Ga0495641_0038501_542_1252 230
58 3300053136 Ga0500559_0144884 Ga0500559_0144884_144_854 230
59 3300053177 Ga0500636_0214431 Ga0500636_0214431_134_844 230
60 3300005445 Ga0070708_100644124 Ga0070708_1006441242 231
61 3300005467 Ga0070706_100054339 Ga0070706_1000543394 231
62 3300005471 Ga0070698_100012924 Ga0070698_1000129248 231
63 3300005518 Ga0070699_100024294 Ga0070699_1000242944 231
64 3300005536 Ga0070697_100017353 Ga0070697_1000173537 231
65 3300025915 Ga0207693_10249914 Ga0207693_102499142 231
66 3300025922 Ga0207646_10035755 Ga0207646_100357553 231
67 3300025939 Ga0207665_10013326 Ga0207665_100133266 231
68 3300049568 Ga0501031_0523149 Ga0501031_0523149_17_739 231
69 3300049583 Ga0501067_0211324 Ga0501067_0211324_245_997 231
70 3300006881 Ga0068865_100115381 Ga0068865_1001153812 232
71 3300014968 Ga0157379_10672303 Ga0157379_106723031 232
72 3300049574 Ga0501038_0610420 Ga0501038_0610420_109_810 233
73 3300005367 Ga0070667_100000005 Ga0070667_10000000526 234
74 3300005455 Ga0070663_100001614 Ga0070663_10000161411 234
75 3300005539 Ga0068853_100030487 Ga0068853_1000304874 234
76 3300005616 Ga0068852_100056139 Ga0068852_1000561393 234
77 3300009093 Ga0105240_10038619 Ga0105240_100386194 234
78 3300009177 Ga0105248_10001462 Ga0105248_1000146224 234
79 3300009545 Ga0105237_10004545 Ga0105237_1000454511 234
80 3300009553 Ga0105249_10000763 Ga0105249_1000076316 234
81 3300010375 Ga0105239_10110828 Ga0105239_101108283 234
82 3300014969 Ga0157376_10420760 Ga0157376_104207602 234
83 3300025914 Ga0207671_10003678 Ga0207671_100036787 234
84 3300025938 Ga0207704_10339637 Ga0207704_103396372 234
85 3300025941 Ga0207711_10001229 Ga0207711_1000122915 234
86 3300025941 Ga0207711_10225466 Ga0207711_102254663 234
87 3300025961 Ga0207712_10001183 Ga0207712_1000118314 234
88 3300025986 Ga0207658_10000006 Ga0207658_10000006345 234
89 3300026041 Ga0207639_10004960 Ga0207639_100049605 234
90 3300026067 Ga0207678_10004583 Ga0207678_100045833 234
91 3300047472 Ga0495686_0030419 Ga0495686_0030419_1858_2661 234
92 3300048916 Ga0496113_0312504 Ga0496113_0312504_72_857 234
93 3300048924 Ga0496121_0166342 Ga0496121_0166342_162_947 234
94 3300048925 Ga0496122_0001419 Ga0496122_0001419_298_1083 234
95 3300048926 Ga0496123_0001598 Ga0496123_0001598_25410_26195 234
96 3300048929 Ga0496126_0107731 Ga0496126_0107731_1197_1982 234
97 3300050507 nmdc:mga05p37_43420_c1 nmdc:mga05p37_43420_c1_4622_5374 234
98 3300050513 nmdc:mga0rr50_798_c1 nmdc:mga0rr50_798_c1_2964_3716 234
99 3300050514 nmdc:mga08x19_107361_c1 nmdc:mga08x19_107361_c1_254_1006 234
100 3300053087 Ga0500643_036015 Ga0500643_036015_160_945 234
101 3300053120 Ga0500597_027420 Ga0500597_027420_1349_2134 234
102 3300005356 Ga0070674_100520571 Ga0070674_1005205711 235
103 3300005456 Ga0070678_100032720 Ga0070678_1000327204 235
104 3300005467 Ga0070706_100015314 Ga0070706_1000153147 235
105 3300005468 Ga0070707_100080966 Ga0070707_1000809662 235
106 3300025922 Ga0207646_10111999 Ga0207646_101119994 235
107 3300026142 Ga0207698_10438240 Ga0207698_104382402 235
108 3300045051 Ga0451576_0164052 Ga0451576_0164052_1396_2148 235
109 3300061734 Ga0530510_0013467 Ga0530510_0013467_656_1408 235
110 iso_pu_bacteria 2643221603 2644030482 235
111 iso_pu_bacteria 2894510363 2894510786 235
112 3300005328 Ga0070676_10000078 Ga0070676_100000787 236
113 3300005329 Ga0070683_100128406 Ga0070683_1001284063 236
114 3300005330 Ga0070690_100204832 Ga0070690_1002048322 236
115 3300005334 Ga0068869_100000679 Ga0068869_10000067911 236
116 3300005336 Ga0070680_100002566 Ga0070680_1000025669 236
117 3300005337 Ga0070682_100001048 Ga0070682_10000104812 236
118 3300005338 Ga0068868_100005961 Ga0068868_1000059616 236
119 3300005339 Ga0070660_100000369 Ga0070660_10000036921 236
120 3300005341 Ga0070691_10004460 Ga0070691_100044604 236
121 3300005344 Ga0070661_100000449 Ga0070661_10000044923 236
122 3300005345 Ga0070692_10001584 Ga0070692_100015843 236
123 3300005353 Ga0070669_100071564 Ga0070669_1000715643 236
124 3300005364 Ga0070673_100033543 Ga0070673_1000335435 236
125 3300005366 Ga0070659_100196476 Ga0070659_1001964763 236
126 3300005406 Ga0070703_10012638 Ga0070703_100126381 236
127 3300005440 Ga0070705_100000292 Ga0070705_10000029222 236
128 3300005444 Ga0070694_100115209 Ga0070694_1001152093 236
129 3300005455 Ga0070663_100003836 Ga0070663_1000038362 236
130 3300005457 Ga0070662_100001136 Ga0070662_10000113615 236
131 3300005458 Ga0070681_10004905 Ga0070681_1000490511 236
132 3300005459 Ga0068867_100002791 Ga0068867_1000027919 236
133 3300005530 Ga0070679_100001205 Ga0070679_1000012058 236
134 3300005535 Ga0070684_100004922 Ga0070684_1000049224 236
135 3300005539 Ga0068853_100015685 Ga0068853_1000156857 236
136 3300005545 Ga0070695_100120739 Ga0070695_1001207393 236
137 3300005546 Ga0070696_100000277 Ga0070696_1000002778 236
138 3300005547 Ga0070693_100000692 Ga0070693_1000006923 236
139 3300005549 Ga0070704_100000361 Ga0070704_1000003612 236
140 3300005563 Ga0068855_100000559 Ga0068855_1000005598 236
141 3300005564 Ga0070664_100002942 Ga0070664_1000029429 236
142 3300005577 Ga0068857_100005102 Ga0068857_1000051027 236
143 3300005578 Ga0068854_100000497 Ga0068854_10000049722 236
144 3300005614 Ga0068856_100000940 Ga0068856_1000009405 236
145 3300005615 Ga0070702_100279397 Ga0070702_1002793972 236
146 3300005616 Ga0068852_100189399 Ga0068852_1001893993 236
147 3300005616 Ga0068852_100345723 Ga0068852_1003457232 236
148 3300005617 Ga0068859_100003247 Ga0068859_10000324719 236
149 3300005617 Ga0068859_100183596 Ga0068859_1001835962 236
150 3300005719 Ga0068861_100006592 Ga0068861_1000065924 236
151 3300005840 Ga0068870_10000438 Ga0068870_1000043814 236
152 3300005841 Ga0068863_100010303 Ga0068863_1000103038 236
153 3300005841 Ga0068863_100235473 Ga0068863_1002354732 236
154 3300005842 Ga0068858_100038899 Ga0068858_1000388995 236
155 3300005843 Ga0068860_100011610 Ga0068860_1000116108 236
156 3300005844 Ga0068862_100003503 Ga0068862_1000035039 236
157 3300006237 Ga0097621_100166539 Ga0097621_1001665392 236
158 3300006358 Ga0068871_100029228 Ga0068871_1000292285 236
159 3300006852 Ga0075433_10072430 Ga0075433_100724304 236
160 3300006871 Ga0075434_100080191 Ga0075434_1000801915 236
161 3300006914 Ga0075436_100170331 Ga0075436_1001703311 236
162 3300006931 Ga0097620_100003247 Ga0097620_10000324719 236
163 3300006931 Ga0097620_100183608 Ga0097620_1001836082 236
164 3300009098 Ga0105245_10176080 Ga0105245_101760802 236
165 3300009147 Ga0114129_10118723 Ga0114129_101187233 236
166 3300009147 Ga0114129_10176245 Ga0114129_101762454 236
167 3300009174 Ga0105241_10000966 Ga0105241_1000096614 236
168 3300013100 Ga0157373_10000304 Ga0157373_1000030422 236
169 3300013105 Ga0157369_10095444 Ga0157369_100954444 236
170 3300013297 Ga0157378_10039097 Ga0157378_100390976 236
171 3300013297 Ga0157378_10180632 Ga0157378_101806323 236
172 3300013307 Ga0157372_10005525 Ga0157372_100055258 236
173 3300013308 Ga0157375_10120424 Ga0157375_101204242 236
174 3300013308 Ga0157375_10406402 Ga0157375_104064023 236
175 3300014325 Ga0163163_10103999 Ga0163163_101039994 236
176 3300014969 Ga0157376_10054895 Ga0157376_100548953 236
177 3300025885 Ga0207653_10001491 Ga0207653_100014912 236
178 3300025901 Ga0207688_10028620 Ga0207688_100286203 236
179 3300025907 Ga0207645_10000076 Ga0207645_1000007656 236
180 3300025907 Ga0207645_10299855 Ga0207645_102998552 236
181 3300025908 Ga0207643_10000227 Ga0207643_1000022711 236
182 3300025911 Ga0207654_10006920 Ga0207654_100069202 236
183 3300025912 Ga0207707_10000357 Ga0207707_1000035715 236
184 3300025917 Ga0207660_10003495 Ga0207660_100034958 236
185 3300025919 Ga0207657_10000417 Ga0207657_1000041717 236
186 3300025920 Ga0207649_10001653 Ga0207649_100016539 236
187 3300025921 Ga0207652_10003410 Ga0207652_1000341017 236
188 3300025923 Ga0207681_10060077 Ga0207681_100600773 236
189 3300025931 Ga0207644_10293900 Ga0207644_102939002 236
190 3300025932 Ga0207690_10001242 Ga0207690_1000124217 236
191 3300025933 Ga0207706_10026077 Ga0207706_100260772 236
192 3300025937 Ga0207669_10515692 Ga0207669_105156921 236
193 3300025942 Ga0207689_10000281 Ga0207689_1000028128 236
194 3300025944 Ga0207661_10097137 Ga0207661_100971372 236
195 3300025945 Ga0207679_10000280 Ga0207679_1000028035 236
196 3300025949 Ga0207667_10000381 Ga0207667_1000038135 236
197 3300025960 Ga0207651_10105004 Ga0207651_101050043 236
198 3300025981 Ga0207640_10001740 Ga0207640_100017402 236
199 3300026041 Ga0207639_10002695 Ga0207639_100026952 236
200 3300026067 Ga0207678_10007809 Ga0207678_100078092 236
201 3300026078 Ga0207702_10002724 Ga0207702_100027248 236
202 3300026088 Ga0207641_10030714 Ga0207641_100307144 236
203 3300026088 Ga0207641_10152166 Ga0207641_101521662 236
204 3300026089 Ga0207648_10002334 Ga0207648_100023349 236
205 3300026089 Ga0207648_10594987 Ga0207648_105949871 236
206 3300026095 Ga0207676_10041958 Ga0207676_100419586 236
207 3300026116 Ga0207674_10001350 Ga0207674_100013506 236
208 3300028380 Ga0268265_10004000 Ga0268265_1000400013 236
209 3300028381 Ga0268264_10019805 Ga0268264_100198056 236
210 3300035088 Ga0373940_0003447 Ga0373940_0003447_1815_2567 236
211 3300035091 Ga0373951_0005229 Ga0373951_0005229_662_1414 236
212 3300035092 Ga0373952_0005206 Ga0373952_0005206_391_1143 236
213 3300035115 Ga0373941_0043016 Ga0373941_0043016_40_792 236
214 3300035121 Ga0373960_0003203 Ga0373960_0003203_1415_2167 236
215 3300035207 Ga0373942_0045152 Ga0373942_0045152_219_971 236
216 3300042005 Ga0439448_0001117 Ga0439448_0001117_5496_6248 236
217 3300042012 Ga0439455_0008969 Ga0439455_0008969_83_835 236
218 3300042438 Ga0439459_0001238 Ga0439459_0001238_295_1047 236
219 3300042876 Ga0451577_0005484 Ga0451577_0005484_10576_11328 236
220 3300044712 Ga0453684_0042299 Ga0453684_0042299_540_1292 236
221 3300045051 Ga0451576_0005108 Ga0451576_0005108_4769_5521 236
222 3300048905 Ga0496102_0066165 Ga0496102_0066165_1103_1855 236
223 3300048907 Ga0496104_0197782 Ga0496104_0197782_933_1685 236
224 3300048920 Ga0496117_0008888 Ga0496117_0008888_8470_9249 236
225 3300048921 Ga0496118_0002288 Ga0496118_0002288_11563_12342 236
226 3300048924 Ga0496121_0068654 Ga0496121_0068654_1221_2000 236
227 3300050507 nmdc:mga05p37_253260_c1 nmdc:mga05p37_253260_c1_709_1461 236
228 3300050512 nmdc:mga0n895_121117_c1 nmdc:mga0n895_121117_c1_1450_2202 236
229 3300050514 nmdc:mga08x19_40745_c1 nmdc:mga08x19_40745_c1_1509_2261 236
230 3300050515 nmdc:mga0a205_67618_c1 nmdc:mga0a205_67618_c1_977_1729 236
231 3300005327 Ga0070658_10694702 Ga0070658_106947021 237
232 3300006195 Ga0075366_10203433 Ga0075366_102034332 237
233 3300009147 Ga0114129_10079228 Ga0114129_100792287 237
234 3300026118 Ga0207675_100808280 Ga0207675_1008082802 237
235 3300047320 Ga0495672_0059695 Ga0495672_0059695_1401_2180 237
236 3300049579 Ga0501043_0038883 Ga0501043_0038883_906_1652 237
237 3300003771 Ga0055526_1000580 Ga0055526_10005807 238
238 3300003773 Ga0055537_1000822 Ga0055537_100082216 238
239 3300003775 Ga0055524_1003597 Ga0055524_10035977 238
240 3300003784 Ga0055534_1000601 Ga0055534_100060116 238
241 3300003790 Ga0055528_1000050 Ga0055528_100005074 238
242 3300005337 Ga0070682_100011654 Ga0070682_1000116546 238
243 3300005518 Ga0070699_100102912 Ga0070699_1001029123 238
244 3300006237 Ga0097621_100065210 Ga0097621_1000652104 238
245 3300006358 Ga0068871_100043867 Ga0068871_1000438674 238
246 3300007265 Ga0099794_10018520 Ga0099794_100185206 238
247 3300010375 Ga0105239_10197223 Ga0105239_101972234 238
248 3300025263 Ga0209565_1000018 Ga0209565_1000018161 238
249 3300025273 Ga0209673_1000090 Ga0209673_100009016 238
250 3300025291 Ga0209675_1000005 Ga0209675_1000005161 238
251 3300025295 Ga0209564_1000078 Ga0209564_1000078103 238
252 3300025299 Ga0209256_1000070 Ga0209256_1000070124 238
253 3300025910 Ga0207684_10015879 Ga0207684_100158793 238
254 3300031251 Ga0265327_10037033 Ga0265327_100370334 238
255 3300037471 Ga0395905_0002802 Ga0395905_0002802_306_1052 238
256 3300038741 Ga0400488_28249 Ga0400488_28249_2393_3127 238
257 3300039110 Ga0400487_66353 Ga0400487_66353_9628_10362 238
258 3300044765 Ga0466970_0040664 Ga0466970_0040664_940_1686 238
259 3300045049 Ga0466959_0003791 Ga0466959_0003791_3490_4236 238
260 3300048918 Ga0496115_0143611 Ga0496115_0143611_691_1437 238
261 3300048919 Ga0496116_0032919 Ga0496116_0032919_486_1232 238
262 3300049568 Ga0501031_0005253 Ga0501031_0005253_4314_5126 238
263 3300049569 Ga0501032_0005060 Ga0501032_0005060_3189_4001 238
264 3300049570 Ga0501033_0019213 Ga0501033_0019213_3033_3845 238
265 3300049571 Ga0501034_0001661 Ga0501034_0001661_16407_17219 238
266 3300049572 Ga0501036_0064157 Ga0501036_0064157_2149_2961 238
267 3300049573 Ga0501037_0009391 Ga0501037_0009391_3332_4144 238
268 3300049574 Ga0501038_0007237 Ga0501038_0007237_3533_4345 238
269 3300049575 Ga0501039_0013074 Ga0501039_0013074_2529_3341 238
270 3300049579 Ga0501043_0005521 Ga0501043_0005521_6365_7177 238
271 3300049580 Ga0501046_0002951 Ga0501046_0002951_13720_14532 238
272 3300049581 Ga0501047_0099975 Ga0501047_0099975_1467_2279 238
273 3300049582 Ga0501048_0026524 Ga0501048_0026524_3361_4173 238
274 3300049589 Ga0501073_0016433 Ga0501073_0016433_2961_3773 238
275 3300049742 Ga0501080_0029269 Ga0501080_0029269_2963_3775 238
276 3300049822 Ga0501035_0288812 Ga0501035_0288812_200_1012 238
277 3300049823 Ga0501044_0051231 Ga0501044_0051231_373_1185 238
278 3300059505 Ga0587083_0017763 Ga0587083_0017763_347_1093 238
279 iso_pu_bacteria 2600254954 2600442452 238
280 iso_pu_bacteria 2600255389 2602012386 238
281 iso_pu_bacteria 2823421272 2823422551 238
282 iso_pu_bacteria 2919501602 2919505010 238
283 iso_pu_bacteria 2926063275 2926066687 238
284 iso_pu_bacteria 8034962539 8034964162 238
285 3300005445 Ga0070708_100323608 Ga0070708_1003236082 239
286 3300005536 Ga0070697_100228890 Ga0070697_1002288903 239
287 3300005545 Ga0070695_100092135 Ga0070695_1000921353 239
288 3300005937 Ga0081455_10029994 Ga0081455_100299941 239
289 3300005983 Ga0081540_1000778 Ga0081540_100077822 239
290 3300006844 Ga0075428_100259142 Ga0075428_1002591423 239
291 3300025933 Ga0207706_10252353 Ga0207706_102523532 239
292 3300034819 Ga0373958_0033968 Ga0373958_0033968_132_887 239
293 3300035170 Ga0373943_0051525 Ga0373943_0051525_607_1341 239
294 3300042012 Ga0439455_0001844 Ga0439455_0001844_1978_2712 239
295 3300044712 Ga0453684_0319178 Ga0453684_0319178_588_1325 239
296 3300044735 Ga0466968_0085106 Ga0466968_0085106_232_981 239
297 3300045051 Ga0451576_0007972 Ga0451576_0007972_954_1709 239
298 3300046472 Ga0495580_0189443 Ga0495580_0189443_130_864 239
299 3300046501 Ga0495607_0021677 Ga0495607_0021677_1284_2051 239
300 3300046683 Ga0495658_0019973 Ga0495658_0019973_2628_3362 239
301 3300049128 Ga0501308_005631 Ga0501308_005631_148_897 239
302 3300005328 Ga0070676_10059283 Ga0070676_100592833 240
303 3300005331 Ga0070670_100150273 Ga0070670_1001502733 240
304 3300005334 Ga0068869_100223687 Ga0068869_1002236872 240
305 3300005347 Ga0070668_100030062 Ga0070668_1000300622 240
306 3300005347 Ga0070668_100068441 Ga0070668_1000684412 240
307 3300005347 Ga0070668_100421454 Ga0070668_1004214541 240
308 3300005367 Ga0070667_100307674 Ga0070667_1003076742 240
309 3300005459 Ga0068867_100273716 Ga0068867_1002737162 240
310 3300005536 Ga0070697_100000561 Ga0070697_10000056120 240
311 3300005543 Ga0070672_100071348 Ga0070672_1000713483 240
312 3300005543 Ga0070672_100288116 Ga0070672_1002881162 240
313 3300005548 Ga0070665_100217554 Ga0070665_1002175542 240
314 3300005548 Ga0070665_100499306 Ga0070665_1004993062 240
315 3300005719 Ga0068861_100054679 Ga0068861_1000546793 240
316 3300005843 Ga0068860_100009879 Ga0068860_1000098797 240
317 3300005844 Ga0068862_100046061 Ga0068862_1000460615 240
318 3300007265 Ga0099794_10023823 Ga0099794_100238235 240
319 3300013306 Ga0163162_10490145 Ga0163162_104901452 240
320 3300013308 Ga0157375_10871657 Ga0157375_108716572 240
321 3300025923 Ga0207681_10158962 Ga0207681_101589623 240
322 3300025925 Ga0207650_10169670 Ga0207650_101696702 240
323 3300025942 Ga0207689_10264633 Ga0207689_102646333 240
324 3300025960 Ga0207651_10276350 Ga0207651_102763502 240
325 3300025972 Ga0207668_10306195 Ga0207668_103061952 240
326 3300026088 Ga0207641_10020593 Ga0207641_100205937 240
327 3300026088 Ga0207641_10126684 Ga0207641_101266841 240
328 3300026089 Ga0207648_10110473 Ga0207648_101104731 240
329 3300026118 Ga0207675_100020033 Ga0207675_1000200336 240
330 3300028379 Ga0268266_10082833 Ga0268266_100828333 240
331 3300028380 Ga0268265_10028139 Ga0268265_100281395 240
332 3300031691 Ga0316579_10000317 Ga0316579_1000031711 240
333 3300031691 Ga0316579_10021774 Ga0316579_100217741 240
334 3300031728 Ga0316578_10008573 Ga0316578_100085734 240
335 3300032168 Ga0316593_10001425 Ga0316593_100014253 240
336 3300032168 Ga0316593_10021052 Ga0316593_100210522 240
337 3300032168 Ga0316593_10026747 Ga0316593_100267472 240
338 3300033529 Ga0316587_1006816 Ga0316587_10068162 240
339 3300033541 Ga0316596_1010266 Ga0316596_10102662 240
340 3300033541 Ga0316596_1015403 Ga0316596_10154032 240
341 3300035398 Ga0316574_0237261 Ga0316574_0237261_283_1020 240
342 3300036647 Ga0316582_0002348 Ga0316582_0002348_4612_5349 240
343 3300036712 Ga0316584_0012345 Ga0316584_0012345_4999_5736 240
344 3300036712 Ga0316584_0306418 Ga0316584_0306418_32_769 240
345 3300042001 Ga0439441_014725 Ga0439441_014725_457_1224 240
346 3300042876 Ga0451577_0001148 Ga0451577_0001148_31156_31953 240
347 3300044712 Ga0453684_0000419 Ga0453684_0000419_7633_8391 240
348 3300044712 Ga0453684_0003824 Ga0453684_0003824_1283_2080 240
349 3300045051 Ga0451576_0740926 Ga0451576_0740926_192_950 240
350 3300049161 Ga0501305_002547 Ga0501305_002547_369_1121 240
351 iso_pu_bacteria 2513237150 2513953180 240
352 iso_pu_bacteria 2513237165 2514042145 240
353 iso_pu_bacteria 2846033681 2846037042 240
354 iso_pu_bacteria 2894414249 2894414648 240
355 iso_pu_bacteria 644736347 644747125 240
356 iso_pu_bacteria 8002745576 8002747903 240
357 3300001989 JGI24739J22299_10007598 JGI24739J22299_100075985 241
358 3300005563 Ga0068855_100155534 Ga0068855_1001555342 241
359 3300028577 Ga0265318_10092476 Ga0265318_100924762 241
360 3300031250 Ga0265331_10059719 Ga0265331_100597193 241
361 3300031344 Ga0265316_10197819 Ga0265316_101978193 241
362 3300031665 Ga0316575_10035622 Ga0316575_100356222 241
363 3300031691 Ga0316579_10020194 Ga0316579_100201943 241
364 3300031727 Ga0316576_10001368 Ga0316576_1000136812 241
365 3300031727 Ga0316576_10069720 Ga0316576_100697203 241
366 3300031727 Ga0316576_10130349 Ga0316576_101303493 241
367 3300031727 Ga0316576_10154118 Ga0316576_101541182 241
368 3300031728 Ga0316578_10065209 Ga0316578_100652091 241
369 3300032137 Ga0316585_10032912 Ga0316585_100329123 241
370 3300032139 Ga0316580_10007606 Ga0316580_100076063 241
371 3300032139 Ga0316580_10009440 Ga0316580_100094403 241
372 3300032168 Ga0316593_10009511 Ga0316593_100095114 241
373 3300032168 Ga0316593_10019079 Ga0316593_100190793 241
374 3300032168 Ga0316593_10026969 Ga0316593_100269693 241
375 3300032168 Ga0316593_10027882 Ga0316593_100278822 241
376 3300032168 Ga0316593_10028085 Ga0316593_100280852 241
377 3300032168 Ga0316593_10040703 Ga0316593_100407032 241
378 3300033524 Ga0316592_1002557 Ga0316592_10025573 241
379 3300033524 Ga0316592_1008886 Ga0316592_10088862 241
380 3300033524 Ga0316592_1013362 Ga0316592_10133622 241
381 3300033524 Ga0316592_1026549 Ga0316592_10265492 241
382 3300033527 Ga0316586_1001418 Ga0316586_10014183 241
383 3300033527 Ga0316586_1002226 Ga0316586_10022263 241
384 3300033527 Ga0316586_1003553 Ga0316586_10035531 241
385 3300033527 Ga0316586_1007210 Ga0316586_10072103 241
386 3300033528 Ga0316588_1003893 Ga0316588_10038932 241
387 3300033528 Ga0316588_1004524 Ga0316588_10045243 241
388 3300033528 Ga0316588_1013330 Ga0316588_10133302 241
389 3300033529 Ga0316587_1001625 Ga0316587_10016253 241
390 3300033529 Ga0316587_1001728 Ga0316587_10017283 241
391 3300033529 Ga0316587_1002587 Ga0316587_10025873 241
392 3300033541 Ga0316596_1001143 Ga0316596_10011435 241
393 3300033541 Ga0316596_1003514 Ga0316596_10035142 241
394 3300033541 Ga0316596_1005947 Ga0316596_10059473 241
395 3300033541 Ga0316596_1009326 Ga0316596_10093263 241
396 3300035398 Ga0316574_0000519 Ga0316574_0000519_5559_6338 241
397 3300035398 Ga0316574_0001141 Ga0316574_0001141_8807_9586 241
398 3300036647 Ga0316582_0001446 Ga0316582_0001446_5869_6648 241
399 3300036647 Ga0316582_0032390 Ga0316582_0032390_1178_1957 241
400 3300036712 Ga0316584_0001564 Ga0316584_0001564_11758_12537 241
401 3300042876 Ga0451577_0000852 Ga0451577_0000852_4449_5210 241
402 3300044712 Ga0453684_0000348 Ga0453684_0000348_113217_113978 241
403 3300044712 Ga0453684_0002092 Ga0453684_0002092_40319_41080 241
404 3300045051 Ga0451576_0279211 Ga0451576_0279211_794_1555 241
405 3300049568 Ga0501031_0149859 Ga0501031_0149859_41_802 241
406 3300049572 Ga0501036_0328518 Ga0501036_0328518_69_830 241
407 3300049587 Ga0501071_0068531 Ga0501071_0068531_1437_2198 241
408 3300049588 Ga0501072_0075815 Ga0501072_0075815_867_1628 241
409 3300049591 Ga0501075_0143193 Ga0501075_0143193_820_1581 241
410 iso_pu_bacteria 2511231006 2511266537 241
411 iso_pu_bacteria 2511231015 2511320490 241
412 iso_pu_bacteria 2511231023 2511369125 241
413 iso_pu_bacteria 2511231031 2511411098 241
414 iso_pu_bacteria 2512047018 2512328328 241
415 iso_pu_bacteria 2582580891 2583790500 241
416 iso_pu_bacteria 2597489887 2597856273 241
417 iso_pu_bacteria 2599185185 2599483471 241
418 iso_pu_bacteria 2599185257 2599805377 241
419 iso_pu_bacteria 2600254931 2600364083 241
420 iso_pu_bacteria 2671180172 2671767887 241
421 iso_pu_bacteria 2713897148 2715750794 241
422 iso_pu_bacteria 2718217725 2718632724 241
423 iso_pu_bacteria 2734482264 2735833480 241
424 iso_pu_bacteria 2738543025 2739316443 241
425 iso_pu_bacteria 2740892503 2743735682 241
426 iso_pu_bacteria 2808606379 2808943050 241
427 iso_pu_bacteria 2842832357 2842835691 241
428 iso_pu_bacteria 2842843487 2842847438 241
429 iso_pu_bacteria 2919385768 2919385856 241
430 iso_pu_bacteria 2919404418 2919406093 241
431 iso_pu_bacteria 2919487758 2919490641 241
432 iso_pu_bacteria 2923153595 2923154691 241
433 iso_pu_bacteria 2969304461 2969305626 241
434 iso_pu_bacteria 2974289157 2974292741 241
435 iso_pu_bacteria 2984286254 2984291338 241
436 iso_pu_bacteria 2998139840 2998141069 241
437 iso_pu_bacteria 2998344455 2998348353 241
438 iso_pu_bacteria 3007252601 3007256036 241
439 iso_pu_bacteria 3007315729 3007319893 241
440 iso_pu_bacteria 3007395558 3007400221 241
441 iso_pu_bacteria 3007419365 3007420705 241
442 iso_pu_bacteria 3007614139 3007619695 241
443 iso_pu_bacteria 3007855910 3007860950 241
444 iso_pu_bacteria 3007861166 3007863710 241
445 iso_pu_bacteria 8015687852 8015688927 241
446 iso_pu_bacteria 8029995093 8029999693 241
447 iso_pu_bacteria 8055770955 8055772044 241
448 iso_pu_bacteria 8056166840 8056169982 241
449 3300002737 JGI25162J39368_1000257 JGI25162J39368_100025730 242
450 3300002772 JGI25164J39214_1000202 JGI25164J39214_100020223 242
451 3300003214 JGI25165J46597_1000361 JGI25165J46597_100036123 242
452 3300003322 rootL2_10105381 rootL2_101053812 242
453 3300006048 Ga0075363_100042233 Ga0075363_1000422333 242
454 3300009036 Ga0105244_10085977 Ga0105244_100859773 242
455 3300013100 Ga0157373_10071342 Ga0157373_100713424 242
456 3300013102 Ga0157371_10014172 Ga0157371_100141722 242
457 3300013104 Ga0157370_10415832 Ga0157370_104158322 242
458 3300015261 Ga0182006_1006387 Ga0182006_10063873 242
459 3300015261 Ga0182006_1046769 Ga0182006_10467691 242
460 3300025207 Ga0209760_100055 Ga0209760_10005521 242
461 3300025231 Ga0207427_100004 Ga0207427_100004379 242
462 3300025233 Ga0209437_100028 Ga0209437_100028215 242
463 3300025256 Ga0209759_1016594 Ga0209759_10165943 242
464 3300025261 Ga0209233_1000008 Ga0209233_1000008926 242
465 3300025292 Ga0209676_1000056 Ga0209676_100005680 242
466 3300025292 Ga0209676_1000101 Ga0209676_1000101179 242
467 3300025728 Ga0207655_1000005 Ga0207655_1000005279 242
468 3300025728 Ga0207655_1000015 Ga0207655_1000015368 242
469 3300025728 Ga0207655_1000166 Ga0207655_1000166113 242
470 3300025935 Ga0207709_10000134 Ga0207709_100001343 242
471 3300026067 Ga0207678_10177580 Ga0207678_101775802 242
472 3300027111 Ga0209281_1004884 Ga0209281_10048844 242
473 3300027312 Ga0209371_1000197 Ga0209371_100019724 242
474 3300027360 Ga0209969_1002912 Ga0209969_10029123 242
475 3300027424 Ga0209984_1000926 Ga0209984_10009264 242
476 3300027471 Ga0209995_1000280 Ga0209995_10002807 242
477 3300027526 Ga0209968_1004656 Ga0209968_10046563 242
478 3300027552 Ga0209982_1001566 Ga0209982_10015664 242
479 3300027614 Ga0209970_1001836 Ga0209970_10018362 242
480 3300027665 Ga0209983_1000494 Ga0209983_10004942 242
481 3300027682 Ga0209971_1000099 Ga0209971_100009911 242
482 3300027876 Ga0209974_10002860 Ga0209974_100028605 242
483 3300030500 Ga0268256_1000147 Ga0268256_100014730 242
484 3300030734 Ga0316179_1058374 Ga0316179_10583743 242
485 3300030735 Ga0316178_1149128 Ga0316178_11491285 242
486 3300031548 Ga0307408_100000045 Ga0307408_1000000457 242
487 3300031665 Ga0316575_10001754 Ga0316575_100017549 242
488 3300031665 Ga0316575_10008938 Ga0316575_100089384 242
489 3300031691 Ga0316579_10000043 Ga0316579_1000004316 242
490 3300031727 Ga0316576_10114325 Ga0316576_101143252 242
491 3300031727 Ga0316576_10210742 Ga0316576_102107422 242
492 3300031727 Ga0316576_10342639 Ga0316576_103426392 242
493 3300031728 Ga0316578_10003074 Ga0316578_100030743 242
494 3300031730 Ga0307516_10000386 Ga0307516_1000038623 242
495 3300031730 Ga0307516_10054707 Ga0307516_100547074 242
496 3300031733 Ga0316577_10001045 Ga0316577_1000104513 242
497 3300031733 Ga0316577_10282142 Ga0316577_102821421 242
498 3300031824 Ga0307413_10111219 Ga0307413_101112194 242
499 3300032137 Ga0316585_10000368 Ga0316585_100003683 242
500 3300032139 Ga0316580_10011538 Ga0316580_100115383 242
501 3300032168 Ga0316593_10000980 Ga0316593_100009806 242
502 3300032168 Ga0316593_10003419 Ga0316593_100034194 242
503 3300032168 Ga0316593_10025794 Ga0316593_100257943 242
504 3300032168 Ga0316593_10053218 Ga0316593_100532182 242
505 3300033524 Ga0316592_1000863 Ga0316592_10008635 242
506 3300033524 Ga0316592_1004759 Ga0316592_10047593 242
507 3300033528 Ga0316588_1000832 Ga0316588_10008325 242
508 3300033528 Ga0316588_1006413 Ga0316588_10064133 242
509 3300033528 Ga0316588_1030522 Ga0316588_10305222 242
510 3300033529 Ga0316587_1002672 Ga0316587_10026723 242
511 3300033529 Ga0316587_1006257 Ga0316587_10062572 242
512 3300033541 Ga0316596_1000224 Ga0316596_10002247 242
513 3300033541 Ga0316596_1001775 Ga0316596_10017753 242
514 3300035398 Ga0316574_0000879 Ga0316574_0000879_6911_7702 242
515 3300035398 Ga0316574_0217935 Ga0316574_0217935_193_936 242
516 3300036647 Ga0316582_0002490 Ga0316582_0002490_973_1764 242
517 3300036647 Ga0316582_0207547 Ga0316582_0207547_25_768 242
518 3300036647 Ga0316582_0236814 Ga0316582_0236814_243_1034 242
519 3300036712 Ga0316584_0007606 Ga0316584_0007606_5959_6750 242
520 3300038705 Ga0237819_01204 Ga0237819_01204_2910_3662 242
521 3300041464 Ga0451808_17140 Ga0451808_17140_334_1086 242
522 3300042439 Ga0439464_0002592 Ga0439464_0002592_245_988 242
523 3300042439 Ga0439464_0004445 Ga0439464_0004445_1253_2005 242
524 3300046453 Ga0495627_000074 Ga0495627_000074_43054_43806 242
525 3300046458 Ga0495591_000142 Ga0495591_000142_42619_43371 242
526 3300046542 Ga0495597_0000040 Ga0495597_0000040_74396_75148 242
527 3300048927 Ga0496124_0084629 Ga0496124_0084629_1015_1758 242
528 3300053137 Ga0500561_0014856 Ga0500561_0014856_797_1555 242
529 3300053158 Ga0500627_0119526 Ga0500627_0119526_217_975 242
530 iso_pu_bacteria 2687453130 2687583772 242
531 3300002737 JGI25162J39368_1000029 JGI25162J39368_100002934 243
532 3300005548 Ga0070665_100250182 Ga0070665_1002501823 243
533 3300032004 Ga0307414_10351179 Ga0307414_103511792 243
534 3300032005 Ga0307411_10385626 Ga0307411_103856262 243
535 3300032168 Ga0316593_10018656 Ga0316593_100186563 243
536 3300033527 Ga0316586_1002983 Ga0316586_10029833 243
537 3300047318 Ga0495636_0090633 Ga0495636_0090633_295_1056 243
538 3300049576 Ga0501040_0009977 Ga0501040_0009977_2759_3511 243
539 3300049577 Ga0501041_0105148 Ga0501041_0105148_295_1050 243
540 3300049578 Ga0501042_0037272 Ga0501042_0037272_2547_3299 243
541 3300049589 Ga0501073_0204491 Ga0501073_0204491_532_1275 243
542 iso_pu_bacteria 2593339238 2595446802 243
543 iso_pu_bacteria 2593339239 2595449564 243
544 iso_pu_bacteria 2718218334 2721026525 243
545 iso_pu_bacteria 2738543009 2739229481 243
546 iso_pu_bacteria 2818991440 2819563958 243
547 iso_pu_bacteria 2842914999 2842918502 243
548 iso_pu_bacteria 2842918807 2842919876 243
549 iso_pu_bacteria 2884338543 2884341474 243
550 iso_pu_bacteria 2895395659 2895397666 243
551 iso_pu_bacteria 2904463128 2904464594 243
552 iso_pu_bacteria 2919085039 2919088324 243
553 iso_pu_bacteria 2941471342 2941472924 243
554 iso_pu_bacteria 2953994433 2953995173 243
555 3300003187 JGI25151J46595_10002568 JGI25151J46595_1000256810 244
556 3300003187 JGI25151J46595_10011802 JGI25151J46595_100118025 244
557 3300003187 JGI25151J46595_10024630 JGI25151J46595_100246304 244
558 3300003771 Ga0055526_1018820 Ga0055526_10188201 244
559 3300003771 Ga0055526_1026663 Ga0055526_10266633 244
560 3300003775 Ga0055524_1001415 Ga0055524_10014155 244
561 3300003775 Ga0055524_1013467 Ga0055524_10134672 244
562 3300003781 Ga0055536_1000020 Ga0055536_1000020182 244
563 3300003784 Ga0055534_1001148 Ga0055534_10011482 244
564 3300003784 Ga0055534_1003594 Ga0055534_10035941 244
565 3300005445 Ga0070708_100018903 Ga0070708_1000189036 244
566 3300005467 Ga0070706_100067931 Ga0070706_1000679315 244
567 3300005471 Ga0070698_100041165 Ga0070698_1000411655 244
568 3300005518 Ga0070699_100032858 Ga0070699_1000328585 244
569 3300005536 Ga0070697_100031854 Ga0070697_1000318544 244
570 3300005842 Ga0068858_100001163 Ga0068858_10000116313 244
571 3300006948 Ga0099826_10000004 Ga0099826_10000004734 244
572 3300009093 Ga0105240_10301359 Ga0105240_103013592 244
573 3300009174 Ga0105241_10183109 Ga0105241_101831092 244
574 3300009177 Ga0105248_10184190 Ga0105248_101841903 244
575 3300009551 Ga0105238_10010394 Ga0105238_100103944 244
576 3300009553 Ga0105249_10271332 Ga0105249_102713322 244
577 3300013105 Ga0157369_10523965 Ga0157369_105239652 244
578 3300013296 Ga0157374_10061587 Ga0157374_100615875 244
579 3300013307 Ga0157372_10038893 Ga0157372_100388934 244
580 3300014968 Ga0157379_10001006 Ga0157379_1000100620 244
581 3300014968 Ga0157379_10207665 Ga0157379_102076652 244
582 3300014969 Ga0157376_10088038 Ga0157376_100880384 244
583 3300025245 Ga0207425_1017100 Ga0207425_10171002 244
584 3300025263 Ga0209565_1000136 Ga0209565_100013648 244
585 3300025263 Ga0209565_1002813 Ga0209565_10028136 244
586 3300025284 Ga0209130_1012206 Ga0209130_10122063 244
587 3300025291 Ga0209675_1000587 Ga0209675_10005872 244
588 3300025291 Ga0209675_1006760 Ga0209675_10067604 244
589 3300025291 Ga0209675_1009558 Ga0209675_10095582 244
590 3300025292 Ga0209676_1000066 Ga0209676_1000066196 244
591 3300025294 Ga0209025_1000471 Ga0209025_100047129 244
592 3300025294 Ga0209025_1000711 Ga0209025_100071132 244
593 3300025294 Ga0209025_1001264 Ga0209025_10012646 244
594 3300025294 Ga0209025_1001519 Ga0209025_100151929 244
595 3300025294 Ga0209025_1068236 Ga0209025_10682362 244
596 3300025295 Ga0209564_1003271 Ga0209564_10032712 244
597 3300025295 Ga0209564_1003275 Ga0209564_10032752 244
598 3300025295 Ga0209564_1003554 Ga0209564_100355413 244
599 3300025297 Ga0209758_1018326 Ga0209758_10183264 244
600 3300025299 Ga0209256_1001248 Ga0209256_100124810 244
601 3300025299 Ga0209256_1003130 Ga0209256_10031305 244
602 3300025303 Ga0209051_1064040 Ga0209051_10640402 244
603 3300025910 Ga0207684_10000874 Ga0207684_1000087432 244
604 3300025922 Ga0207646_10001150 Ga0207646_1000115013 244
605 3300025986 Ga0207658_10018272 Ga0207658_100182722 244
606 3300026035 Ga0207703_10003470 Ga0207703_1000347016 244
607 3300027666 Ga0209282_1000051 Ga0209282_100005137 244
608 3300027876 Ga0209974_10050802 Ga0209974_100508022 244
609 3300031548 Ga0307408_100002332 Ga0307408_10000233215 244
610 3300031730 Ga0307516_10088520 Ga0307516_100885204 244
611 3300031901 Ga0307406_10061681 Ga0307406_100616813 244
612 3300032168 Ga0316593_10006108 Ga0316593_100061083 244
613 3300039062 Ga0400483_043964 Ga0400483_043964_969_1742 244
614 3300039062 Ga0400483_173977 Ga0400483_173977_3873_4646 244
615 3300041452 Ga0451793_1663964 Ga0451793_1663964_504_1328 244
616 3300041460 Ga0451802_0477990 Ga0451802_0477990_1034_1858 244
617 3300042129 Ga0450891_002252 Ga0450891_002252_889_1662 244
618 3300042876 Ga0451577_0013868 Ga0451577_0013868_2912_3664 244
619 3300046474 Ga0495605_0003518 Ga0495605_0003518_1645_2427 244
620 3300046500 Ga0495596_0002137 Ga0495596_0002137_6845_7627 244
621 3300046512 Ga0495610_0004004 Ga0495610_0004004_3419_4201 244
622 3300046513 Ga0495616_0008261 Ga0495616_0008261_3232_4014 244
623 3300046524 Ga0495648_0009285 Ga0495648_0009285_4661_5443 244
624 3300046538 Ga0495609_0002596 Ga0495609_0002596_6855_7637 244
625 3300046692 Ga0495671_0002703 Ga0495671_0002703_3446_4228 244
626 3300046694 Ga0495649_0040058 Ga0495649_0040058_86_868 244
627 3300048919 Ga0496116_0005928 Ga0496116_0005928_6992_7774 244
628 3300048919 Ga0496116_0040912 Ga0496116_0040912_84_866 244
629 3300048924 Ga0496121_0025245 Ga0496121_0025245_1662_2444 244
630 3300048925 Ga0496122_0008492 Ga0496122_0008492_3450_4232 244
631 3300048926 Ga0496123_0006599 Ga0496123_0006599_3357_4139 244
632 3300048929 Ga0496126_0528490 Ga0496126_0528490_119_901 244
633 3300049571 Ga0501034_0000411 Ga0501034_0000411_7854_8636 244
634 3300003565 Ga0006560J51390_1028717 Ga0006560J51390_10287172 245
635 3300005327 Ga0070658_10297438 Ga0070658_102974382 245
636 3300005355 Ga0070671_100183076 Ga0070671_1001830763 245
637 3300005539 Ga0068853_100139695 Ga0068853_1001396951 245
638 3300005985 Ga0081539_10004036 Ga0081539_100040365 245
639 3300006186 Ga0075369_10005288 Ga0075369_100052886 245
640 3300013306 Ga0163162_10000003 Ga0163162_10000003493 245
641 3300013308 Ga0157375_10127593 Ga0157375_101275932 245
642 3300025304 Ga0209257_1025065 Ga0209257_10250653 245
643 3300025909 Ga0207705_10265431 Ga0207705_102654312 245
644 3300035088 Ga0373940_0111018 Ga0373940_0111018_65_823 245
645 3300044683 Ga0466965_0006406 Ga0466965_0006406_243_1010 245
646 3300044684 Ga0466966_0002423 Ga0466966_0002423_3772_4539 245
647 3300044693 Ga0466961_0001662 Ga0466961_0001662_2979_3746 245
648 3300045049 Ga0466959_0005674 Ga0466959_0005674_6170_6937 245
649 3300046472 Ga0495580_0379156 Ga0495580_0379156_19_774 245
650 3300046499 Ga0495594_0358867 Ga0495594_0358867_45_791 245
651 3300046557 Ga0495622_0157027 Ga0495622_0157027_104_850 245
652 3300048928 Ga0496125_0234616 Ga0496125_0234616_315_1055 245
653 iso_pu_bacteria 2524614729 2525555961 245
654 iso_pu_bacteria 2627854209 2630650975 245
655 iso_pu_bacteria 2739367700 2739730256 245
656 iso_pu_bacteria 2884411467 2884412148 245
657 iso_pu_bacteria 2928963466 2928967692 245
658 3300001904 JGI24736J21556_1010588 JGI24736J21556_10105882 246
659 3300002077 JGI24744J21845_10016356 JGI24744J21845_100163562 246
660 3300005327 Ga0070658_10518964 Ga0070658_105189641 246
661 3300005331 Ga0070670_100009753 Ga0070670_1000097536 246
662 3300005335 Ga0070666_10000109 Ga0070666_1000010918 246
663 3300005335 Ga0070666_10003252 Ga0070666_100032526 246
664 3300005338 Ga0068868_100145667 Ga0068868_1001456672 246
665 3300005344 Ga0070661_100011087 Ga0070661_1000110874 246
666 3300005344 Ga0070661_100031058 Ga0070661_1000310583 246
667 3300005355 Ga0070671_100141142 Ga0070671_1001411422 246
668 3300005365 Ga0070688_100109365 Ga0070688_1001093653 246
669 3300005366 Ga0070659_100035435 Ga0070659_1000354354 246
670 3300005367 Ga0070667_100036335 Ga0070667_1000363355 246
671 3300005367 Ga0070667_100258782 Ga0070667_1002587822 246
672 3300005445 Ga0070708_100414067 Ga0070708_1004140672 246
673 3300005455 Ga0070663_100023092 Ga0070663_1000230922 246
674 3300005457 Ga0070662_100066979 Ga0070662_1000669792 246
675 3300005459 Ga0068867_100117777 Ga0068867_1001177773 246
676 3300005466 Ga0070685_10007066 Ga0070685_100070664 246
677 3300005539 Ga0068853_100060929 Ga0068853_1000609294 246
678 3300005539 Ga0068853_100097425 Ga0068853_1000974254 246
679 3300005548 Ga0070665_100000838 Ga0070665_10000083816 246
680 3300005563 Ga0068855_100034536 Ga0068855_1000345364 246
681 3300005563 Ga0068855_100159346 Ga0068855_1001593463 246
682 3300005578 Ga0068854_100047075 Ga0068854_1000470753 246
683 3300005614 Ga0068856_100049386 Ga0068856_1000493864 246
684 3300005614 Ga0068856_100055647 Ga0068856_1000556474 246
685 3300005616 Ga0068852_100020193 Ga0068852_1000201936 246
686 3300005616 Ga0068852_100167375 Ga0068852_1001673753 246
687 3300005617 Ga0068859_100583789 Ga0068859_1005837891 246
688 3300005834 Ga0068851_10016464 Ga0068851_100164642 246
689 3300005841 Ga0068863_100090958 Ga0068863_1000909583 246
690 3300005841 Ga0068863_100518929 Ga0068863_1005189291 246
691 3300005842 Ga0068858_100024853 Ga0068858_1000248533 246
692 3300005842 Ga0068858_100220414 Ga0068858_1002204142 246
693 3300005843 Ga0068860_100012175 Ga0068860_1000121755 246
694 3300005843 Ga0068860_100653003 Ga0068860_1006530032 246
695 3300005983 Ga0081540_1002617 Ga0081540_10026179 246
696 3300006028 Ga0070717_10356078 Ga0070717_103560782 246
697 3300006881 Ga0068865_100237310 Ga0068865_1002373102 246
698 3300006931 Ga0097620_100583927 Ga0097620_1005839272 246
699 3300009093 Ga0105240_10000931 Ga0105240_1000093116 246
700 3300009093 Ga0105240_10018571 Ga0105240_100185718 246
701 3300009093 Ga0105240_10130805 Ga0105240_101308054 246
702 3300009098 Ga0105245_10058222 Ga0105245_100582224 246
703 3300009174 Ga0105241_10034302 Ga0105241_100343024 246
704 3300009545 Ga0105237_10008004 Ga0105237_1000800411 246
705 3300009551 Ga0105238_10027655 Ga0105238_100276553 246
706 3300009551 Ga0105238_10035391 Ga0105238_100353914 246
707 3300009551 Ga0105238_10042220 Ga0105238_100422205 246
708 3300009551 Ga0105238_10107765 Ga0105238_101077652 246
709 3300010375 Ga0105239_10015419 Ga0105239_100154193 246
710 3300010375 Ga0105239_10094117 Ga0105239_100941173 246
711 3300010375 Ga0105239_10101282 Ga0105239_101012824 246
712 3300010375 Ga0105239_10174525 Ga0105239_101745254 246
713 3300010375 Ga0105239_10239301 Ga0105239_102393012 246
714 3300013104 Ga0157370_10029943 Ga0157370_100299434 246
715 3300013104 Ga0157370_10047259 Ga0157370_100472594 246
716 3300013105 Ga0157369_10004837 Ga0157369_1000483710 246
717 3300013105 Ga0157369_10877909 Ga0157369_108779091 246
718 3300013296 Ga0157374_10022868 Ga0157374_100228683 246
719 3300013296 Ga0157374_10125394 Ga0157374_101253942 246
720 3300013307 Ga0157372_10005613 Ga0157372_100056134 246
721 3300013307 Ga0157372_10879031 Ga0157372_108790311 246
722 3300014325 Ga0163163_10002153 Ga0163163_100021536 246
723 3300014969 Ga0157376_10039337 Ga0157376_100393373 246
724 3300014969 Ga0157376_10396833 Ga0157376_103968332 246
725 3300015685 Ga0183369_1007 Ga0183369_1007374 246
726 3300021384 Ga0213876_10044835 Ga0213876_100448352 246
727 3300025261 Ga0209233_1004515 Ga0209233_10045153 246
728 3300025321 Ga0207656_10044372 Ga0207656_100443723 246
729 3300025903 Ga0207680_10000255 Ga0207680_1000025522 246
730 3300025904 Ga0207647_10007302 Ga0207647_100073022 246
731 3300025911 Ga0207654_10001950 Ga0207654_100019503 246
732 3300025911 Ga0207654_10007889 Ga0207654_100078894 246
733 3300025911 Ga0207654_10091337 Ga0207654_100913372 246
734 3300025913 Ga0207695_10000007 Ga0207695_10000007550 246
735 3300025913 Ga0207695_10001750 Ga0207695_1000175043 246
736 3300025913 Ga0207695_10070350 Ga0207695_100703502 246
737 3300025914 Ga0207671_10003503 Ga0207671_100035035 246
738 3300025914 Ga0207671_10065748 Ga0207671_100657483 246
739 3300025914 Ga0207671_10080968 Ga0207671_100809683 246
740 3300025920 Ga0207649_10000847 Ga0207649_100008479 246
741 3300025920 Ga0207649_10159121 Ga0207649_101591212 246
742 3300025924 Ga0207694_10009064 Ga0207694_100090642 246
743 3300025924 Ga0207694_10022629 Ga0207694_100226292 246
744 3300025924 Ga0207694_10023759 Ga0207694_100237594 246
745 3300025925 Ga0207650_10006670 Ga0207650_100066704 246
746 3300025927 Ga0207687_10105282 Ga0207687_101052822 246
747 3300025931 Ga0207644_10245162 Ga0207644_102451622 246
748 3300025932 Ga0207690_10030674 Ga0207690_100306744 246
749 3300025933 Ga0207706_10045071 Ga0207706_100450715 246
750 3300025949 Ga0207667_10054635 Ga0207667_100546354 246
751 3300025961 Ga0207712_10033417 Ga0207712_100334174 246
752 3300025981 Ga0207640_10050569 Ga0207640_100505693 246
753 3300025986 Ga0207658_10020586 Ga0207658_100205863 246
754 3300025986 Ga0207658_10228535 Ga0207658_102285352 246
755 3300026023 Ga0207677_10137076 Ga0207677_101370761 246
756 3300026035 Ga0207703_10011783 Ga0207703_100117835 246
757 3300026041 Ga0207639_10004097 Ga0207639_100040972 246
758 3300026041 Ga0207639_10008407 Ga0207639_100084078 246
759 3300026067 Ga0207678_10016606 Ga0207678_100166063 246
760 3300026067 Ga0207678_10036895 Ga0207678_100368955 246
761 3300026078 Ga0207702_10013254 Ga0207702_100132543 246
762 3300026078 Ga0207702_10112765 Ga0207702_101127653 246
763 3300026088 Ga0207641_10087126 Ga0207641_100871263 246
764 3300026088 Ga0207641_10099047 Ga0207641_100990473 246
765 3300026142 Ga0207698_10065485 Ga0207698_100654854 246
766 3300026142 Ga0207698_10112145 Ga0207698_101121453 246
767 3300028379 Ga0268266_10000006 Ga0268266_10000006306 246
768 3300028380 Ga0268265_10612088 Ga0268265_106120882 246
769 3300028381 Ga0268264_10020911 Ga0268264_100209113 246
770 3300031616 Ga0307508_10251269 Ga0307508_102512692 246
771 3300031730 Ga0307516_10027880 Ga0307516_100278806 246
772 3300032168 Ga0316593_10000550 Ga0316593_100005504 246
773 3300032168 Ga0316593_10004705 Ga0316593_100047053 246
774 3300037418 Ga0395900_0138444 Ga0395900_0138444_375_1142 246
775 3300037466 Ga0395898_0257020 Ga0395898_0257020_182_949 246
776 3300037471 Ga0395905_0014636 Ga0395905_0014636_425_1225 246
777 3300037471 Ga0395905_0240238 Ga0395905_0240238_606_1373 246
778 3300039437 Ga0436365_0191135 Ga0436365_0191135_1158_1898 246
779 3300046452 Ga0495617_000939 Ga0495617_000939_4710_5456 246
780 3300046457 Ga0495590_0002633 Ga0495590_0002633_778_1578 246
781 3300046457 Ga0495590_0024655 Ga0495590_0024655_319_1065 246
782 3300046460 Ga0495638_0000153 Ga0495638_0000153_96075_96821 246
783 3300046501 Ga0495607_0002313 Ga0495607_0002313_3960_4706 246
784 3300046506 Ga0495583_0018274 Ga0495583_0018274_2871_3617 246
785 3300046519 Ga0495632_0053890 Ga0495632_0053890_976_1722 246
786 3300046538 Ga0495609_0025461 Ga0495609_0025461_1660_2406 246
787 3300046648 Ga0495611_0000001 Ga0495611_0000001_2167281_2168027 246
788 3300046660 Ga0495625_0000022 Ga0495625_0000022_88756_89502 246
789 3300046692 Ga0495671_0000372 Ga0495671_0000372_22843_23589 246
790 3300046794 Ga0495589_0000059 Ga0495589_0000059_53997_54743 246
791 3300046810 Ga0495660_0057098 Ga0495660_0057098_947_1693 246
792 3300047446 Ga0495679_000004 Ga0495679_000004_278053_278799 246
793 3300047472 Ga0495686_0001206 Ga0495686_0001206_15055_15801 246
794 3300048906 Ga0496103_0021319 Ga0496103_0021319_774_1514 246
795 3300048906 Ga0496103_0418985 Ga0496103_0418985_109_849 246
796 3300048918 Ga0496115_0000062 Ga0496115_0000062_40314_41054 246
797 3300048921 Ga0496118_0016919 Ga0496118_0016919_4778_5518 246
798 3300048921 Ga0496118_0044429 Ga0496118_0044429_968_1708 246
799 3300048929 Ga0496126_0000057 Ga0496126_0000057_15347_16087 246
800 3300049459 Ga0495678_000237 Ga0495678_000237_25537_26283 246
801 3300049460 Ga0495682_0010154 Ga0495682_0010154_60_806 246
802 3300049569 Ga0501032_0123687 Ga0501032_0123687_237_977 246
803 3300049571 Ga0501034_0001357 Ga0501034_0001357_18052_18792 246
804 3300049571 Ga0501034_0295390 Ga0501034_0295390_674_1447 246
805 3300049571 Ga0501034_0397917 Ga0501034_0397917_520_1260 246
806 3300049579 Ga0501043_0081864 Ga0501043_0081864_128_868 246
807 3300049580 Ga0501046_0012744 Ga0501046_0012744_6250_7023 246
808 3300049580 Ga0501046_0045092 Ga0501046_0045092_1283_2068 246
809 3300049580 Ga0501046_0086828 Ga0501046_0086828_1660_2400 246
810 3300049581 Ga0501047_0000748 Ga0501047_0000748_18775_19515 246
811 3300049581 Ga0501047_0080934 Ga0501047_0080934_653_1426 246
812 3300049582 Ga0501048_0049453 Ga0501048_0049453_1562_2323 246
813 3300049583 Ga0501067_0000969 Ga0501067_0000969_511_1251 246
814 3300049584 Ga0501068_0108801 Ga0501068_0108801_418_1158 246
815 3300049584 Ga0501068_0165665 Ga0501068_0165665_198_971 246
816 3300049585 Ga0501069_0008226 Ga0501069_0008226_2573_3313 246
817 3300049585 Ga0501069_0137842 Ga0501069_0137842_22_795 246
818 3300049586 Ga0501070_0000511 Ga0501070_0000511_21089_21829 246
819 3300049586 Ga0501070_0007466 Ga0501070_0007466_5122_5862 246
820 3300049586 Ga0501070_0156042 Ga0501070_0156042_484_1224 246
821 3300049588 Ga0501072_0009507 Ga0501072_0009507_5336_6076 246
822 3300049589 Ga0501073_0013953 Ga0501073_0013953_3848_4621 246
823 3300049589 Ga0501073_0020861 Ga0501073_0020861_3568_4308 246
824 3300049590 Ga0501074_0007085 Ga0501074_0007085_7229_7969 246
825 3300049590 Ga0501074_0086594 Ga0501074_0086594_20_760 246
826 3300049590 Ga0501074_0175423 Ga0501074_0175423_646_1419 246
827 3300049741 Ga0501079_0224337 Ga0501079_0224337_250_1023 246
828 3300049741 Ga0501079_0310252 Ga0501079_0310252_284_1024 246
829 3300049742 Ga0501080_0001987 Ga0501080_0001987_800_1540 246
830 3300049742 Ga0501080_0026489 Ga0501080_0026489_1291_2031 246
831 3300049742 Ga0501080_0058835 Ga0501080_0058835_35_808 246
832 3300049742 Ga0501080_0119095 Ga0501080_0119095_820_1560 246
833 3300049744 Ga0501083_0012064 Ga0501083_0012064_592_1332 246
834 3300049822 Ga0501035_0225887 Ga0501035_0225887_631_1410 246
835 3300049823 Ga0501044_0009007 Ga0501044_0009007_3261_4001 246
836 3300049823 Ga0501044_0189331 Ga0501044_0189331_1073_1846 246
837 3300049823 Ga0501044_0476047 Ga0501044_0476047_166_951 246
838 3300050511 nmdc:mga08y16_288964_c1 nmdc:mga08y16_288964_c1_382_1128 246
839 3300050514 nmdc:mga08x19_193477_c1 nmdc:mga08x19_193477_c1_34_798 246
840 3300053087 Ga0500643_000020 Ga0500643_000020_23430_24176 246
841 3300053103 Ga0500555_000336 Ga0500555_000336_7011_7757 246
842 3300053131 Ga0500652_085216 Ga0500652_085216_227_973 246
843 3300060353 Ga0501082_0160299 Ga0501082_0160299_587_1327 246
844 iso_pu_bacteria 2687453129 2687580517 246
845 3300003763 Ga0055529_1005126 Ga0055529_10051262 247
846 3300003792 Ga0055540_1025844 Ga0055540_10258442 247
847 3300005327 Ga0070658_10079714 Ga0070658_100797143 247
848 3300005334 Ga0068869_100046919 Ga0068869_1000469193 247
849 3300005337 Ga0070682_100014093 Ga0070682_1000140932 247
850 3300005338 Ga0068868_100183755 Ga0068868_1001837552 247
851 3300005347 Ga0070668_100013598 Ga0070668_1000135985 247
852 3300005353 Ga0070669_100068181 Ga0070669_1000681813 247
853 3300005364 Ga0070673_100073836 Ga0070673_1000738362 247
854 3300005439 Ga0070711_100190947 Ga0070711_1001909472 247
855 3300005455 Ga0070663_100003691 Ga0070663_1000036916 247
856 3300005539 Ga0068853_100003605 Ga0068853_1000036055 247
857 3300005539 Ga0068853_100487258 Ga0068853_1004872582 247
858 3300005543 Ga0070672_100161959 Ga0070672_1001619592 247
859 3300005546 Ga0070696_100069181 Ga0070696_1000691811 247
860 3300005547 Ga0070693_100204112 Ga0070693_1002041122 247
861 3300005563 Ga0068855_100100139 Ga0068855_1001001393 247
862 3300005614 Ga0068856_100001887 Ga0068856_10000188724 247
863 3300005614 Ga0068856_100144506 Ga0068856_1001445062 247
864 3300005844 Ga0068862_100248880 Ga0068862_1002488802 247
865 3300006881 Ga0068865_100171583 Ga0068865_1001715832 247
866 3300009093 Ga0105240_10014485 Ga0105240_1001448512 247
867 3300009093 Ga0105240_10171297 Ga0105240_101712973 247
868 3300009098 Ga0105245_10368152 Ga0105245_103681522 247
869 3300009174 Ga0105241_10107632 Ga0105241_101076322 247
870 3300009176 Ga0105242_10000940 Ga0105242_1000094013 247
871 3300009545 Ga0105237_10000007 Ga0105237_10000007159 247
872 3300009545 Ga0105237_10096955 Ga0105237_100969553 247
873 3300009551 Ga0105238_10001307 Ga0105238_100013073 247
874 3300009551 Ga0105238_10122721 Ga0105238_101227213 247
875 3300009551 Ga0105238_10439323 Ga0105238_104393232 247
876 3300010375 Ga0105239_10090670 Ga0105239_100906702 247
877 3300010375 Ga0105239_10159178 Ga0105239_101591784 247
878 3300010375 Ga0105239_10184573 Ga0105239_101845734 247
879 3300010375 Ga0105239_10241998 Ga0105239_102419982 247
880 3300013102 Ga0157371_10192929 Ga0157371_101929292 247
881 3300013104 Ga0157370_10019411 Ga0157370_100194114 247
882 3300013104 Ga0157370_10061424 Ga0157370_100614244 247
883 3300013105 Ga0157369_10000195 Ga0157369_1000019554 247
884 3300013105 Ga0157369_10000509 Ga0157369_1000050918 247
885 3300013105 Ga0157369_10975698 Ga0157369_109756981 247
886 3300013105 Ga0157369_10975699 Ga0157369_109756991 247
887 3300013297 Ga0157378_10000043 Ga0157378_1000004315 247
888 3300013308 Ga0157375_10000940 Ga0157375_100009408 247
889 3300014497 Ga0182008_10002353 Ga0182008_100023533 247
890 3300014497 Ga0182008_10033435 Ga0182008_100334353 247
891 3300015261 Ga0182006_1000085 Ga0182006_100008572 247
892 3300015261 Ga0182006_1001966 Ga0182006_10019662 247
893 3300015262 Ga0182007_10003021 Ga0182007_100030218 247
894 3300015265 Ga0182005_1000028 Ga0182005_1000028141 247
895 3300015265 Ga0182005_1004956 Ga0182005_10049563 247
896 3300017792 Ga0163161_10001533 Ga0163161_1000153316 247
897 3300020070 Ga0206356_10073673 Ga0206356_100736733 247
898 3300020082 Ga0206353_11830696 Ga0206353_118306962 247
899 3300025206 Ga0209435_110491 Ga0209435_1104911 247
900 3300025233 Ga0209437_100476 Ga0209437_10047626 247
901 3300025250 Ga0209026_1000391 Ga0209026_100039135 247
902 3300025254 Ga0209148_1002604 Ga0209148_10026043 247
903 3300025256 Ga0209759_1002641 Ga0209759_10026416 247
904 3300025258 Ga0209129_1005589 Ga0209129_10055892 247
905 3300025272 Ga0209455_1000344 Ga0209455_100034433 247
906 3300025297 Ga0209758_1004728 Ga0209758_10047287 247
907 3300025299 Ga0209256_1012253 Ga0209256_10122534 247
908 3300025303 Ga0209051_1003162 Ga0209051_10031626 247
909 3300025904 Ga0207647_10000512 Ga0207647_1000051218 247
910 3300025904 Ga0207647_10042751 Ga0207647_100427513 247
911 3300025906 Ga0207699_10199183 Ga0207699_101991832 247
912 3300025907 Ga0207645_10016221 Ga0207645_100162214 247
913 3300025909 Ga0207705_10175935 Ga0207705_101759352 247
914 3300025909 Ga0207705_10305881 Ga0207705_103058812 247
915 3300025913 Ga0207695_10042664 Ga0207695_100426642 247
916 3300025913 Ga0207695_10069722 Ga0207695_100697224 247
917 3300025914 Ga0207671_10000074 Ga0207671_10000074100 247
918 3300025914 Ga0207671_10001147 Ga0207671_1000114723 247
919 3300025916 Ga0207663_10352093 Ga0207663_103520932 247
920 3300025919 Ga0207657_10014538 Ga0207657_100145381 247
921 3300025924 Ga0207694_10000162 Ga0207694_1000016232 247
922 3300025924 Ga0207694_10136232 Ga0207694_101362322 247
923 3300025924 Ga0207694_10370239 Ga0207694_103702392 247
924 3300025934 Ga0207686_10073323 Ga0207686_100733233 247
925 3300025940 Ga0207691_10033298 Ga0207691_100332983 247
926 3300025942 Ga0207689_10166996 Ga0207689_101669962 247
927 3300025949 Ga0207667_10054076 Ga0207667_100540763 247
928 3300025981 Ga0207640_10020709 Ga0207640_100207093 247
929 3300026041 Ga0207639_10003979 Ga0207639_100039794 247
930 3300026041 Ga0207639_10103696 Ga0207639_101036963 247
931 3300026067 Ga0207678_10007556 Ga0207678_100075566 247
932 3300026067 Ga0207678_10122985 Ga0207678_101229853 247
933 3300026078 Ga0207702_10000185 Ga0207702_1000018539 247
934 3300026078 Ga0207702_10004362 Ga0207702_100043628 247
935 3300026089 Ga0207648_10056639 Ga0207648_100566393 247
936 3300026121 Ga0207683_10018309 Ga0207683_100183092 247
937 3300028379 Ga0268266_10343959 Ga0268266_103439592 247
938 3300031727 Ga0316576_10100835 Ga0316576_101008352 247
939 3300031728 Ga0316578_10049852 Ga0316578_100498523 247
940 3300031731 Ga0307405_10066722 Ga0307405_100667222 247
941 3300031911 Ga0307412_10017964 Ga0307412_100179642 247
942 3300032005 Ga0307411_10373142 Ga0307411_103731422 247
943 3300032133 Ga0316583_10003786 Ga0316583_100037866 247
944 3300032168 Ga0316593_10015674 Ga0316593_100156742 247
945 3300035398 Ga0316574_0001723 Ga0316574_0001723_8368_9126 247
946 3300035398 Ga0316574_0341579 Ga0316574_0341579_130_882 247
947 3300036647 Ga0316582_0022499 Ga0316582_0022499_1775_2527 247
948 3300036712 Ga0316584_0058976 Ga0316584_0058976_607_1359 247
949 3300037418 Ga0395900_0002611 Ga0395900_0002611_17041_17808 247
950 3300041404 Ga0439436_0000030 Ga0439436_0000030_31664_32425 247
951 3300041413 Ga0439465_0000405 Ga0439465_0000405_4349_5110 247
952 3300041452 Ga0451793_0740756 Ga0451793_0740756_998_1759 247
953 3300041456 Ga0451795_0260148 Ga0451795_0260148_547_1329 247
954 3300042184 Ga0450908_001816 Ga0450908_001816_779_1561 247
955 3300042438 Ga0439459_0000122 Ga0439459_0000122_5804_6565 247
956 3300044735 Ga0466968_0057632 Ga0466968_0057632_325_1083 247
957 3300044842 Ga0466957_0308180 Ga0466957_0308180_27_809 247
958 3300046452 Ga0495617_000586 Ga0495617_000586_3925_4707 247
959 3300046459 Ga0495629_0120610 Ga0495629_0120610_276_1019 247
960 3300046460 Ga0495638_0000038 Ga0495638_0000038_171934_172695 247
961 3300046471 Ga0495650_0001596 Ga0495650_0001596_12745_13527 247
962 3300046473 Ga0495582_0098622 Ga0495582_0098622_464_1240 247
963 3300046491 Ga0495584_0002465 Ga0495584_0002465_4553_5335 247
964 3300046492 Ga0495585_0000104 Ga0495585_0000104_59758_60540 247
965 3300046492 Ga0495585_0082489 Ga0495585_0082489_877_1659 247
966 3300046501 Ga0495607_0000211 Ga0495607_0000211_57047_57829 247
967 3300046507 Ga0495606_0000338 Ga0495606_0000338_146_928 247
968 3300046507 Ga0495606_0009207 Ga0495606_0009207_7210_7971 247
969 3300046507 Ga0495606_0024882 Ga0495606_0024882_2828_3610 247
970 3300046507 Ga0495606_0078131 Ga0495606_0078131_783_1565 247
971 3300046512 Ga0495610_0000482 Ga0495610_0000482_24498_25259 247
972 3300046512 Ga0495610_0015960 Ga0495610_0015960_1881_2663 247
973 3300046513 Ga0495616_0000086 Ga0495616_0000086_12985_13767 247
974 3300046515 Ga0495620_0001045 Ga0495620_0001045_16089_16871 247
975 3300046515 Ga0495620_0001112 Ga0495620_0001112_14589_15371 247
976 3300046518 Ga0495631_0064213 Ga0495631_0064213_136_918 247
977 3300046519 Ga0495632_0000004 Ga0495632_0000004_154327_155109 247
978 3300046519 Ga0495632_0147550 Ga0495632_0147550_255_1037 247
979 3300046522 Ga0495643_0058644 Ga0495643_0058644_299_1081 247
980 3300046524 Ga0495648_0030047 Ga0495648_0030047_2241_3023 247
981 3300046543 Ga0495645_0072485 Ga0495645_0072485_318_1061 247
982 3300046616 Ga0495668_0003978 Ga0495668_0003978_7163_7945 247
983 3300046648 Ga0495611_0000105 Ga0495611_0000105_26429_27211 247
984 3300046665 Ga0495661_0000199 Ga0495661_0000199_39867_40649 247
985 3300046683 Ga0495658_0013679 Ga0495658_0013679_2709_3452 247
986 3300046694 Ga0495649_0013612 Ga0495649_0013612_3645_4406 247
987 3300047319 Ga0495674_0160703 Ga0495674_0160703_27_770 247
988 3300047469 Ga0495673_0000004 Ga0495673_0000004_113152_113934 247
989 3300047469 Ga0495673_0000048 Ga0495673_0000048_79066_79848 247
990 3300047472 Ga0495686_0000017 Ga0495686_0000017_197035_197817 247
991 3300047472 Ga0495686_0013830 Ga0495686_0013830_3639_4421 247
992 3300047472 Ga0495686_0013909 Ga0495686_0013909_2488_3270 247
993 3300048903 Ga0496100_0009393 Ga0496100_0009393_361_1122 247
994 3300048904 Ga0496101_0000776 Ga0496101_0000776_2570_3331 247
995 3300048905 Ga0496102_0216773 Ga0496102_0216773_436_1218 247
996 3300048907 Ga0496104_0000011 Ga0496104_0000011_263333_264166 247
997 3300048908 Ga0496105_0000071 Ga0496105_0000071_42486_43319 247
998 3300048909 Ga0496106_0001299 Ga0496106_0001299_5772_6554 247
999 3300048919 Ga0496116_0034533 Ga0496116_0034533_1735_2517 247
1000 3300048919 Ga0496116_0065855 Ga0496116_0065855_1404_2186 247
1001 3300048920 Ga0496117_0015531 Ga0496117_0015531_1141_1923 247
1002 3300048920 Ga0496117_0187842 Ga0496117_0187842_194_976 247
1003 3300048921 Ga0496118_0001694 Ga0496118_0001694_2295_3077 247
1004 3300048921 Ga0496118_0005974 Ga0496118_0005974_11989_12771 247
1005 3300048923 Ga0496120_0026146 Ga0496120_0026146_269_1030 247
1006 3300048924 Ga0496121_0000878 Ga0496121_0000878_17917_18699 247
1007 3300048924 Ga0496121_0005536 Ga0496121_0005536_11435_12217 247
1008 3300048924 Ga0496121_0019136 Ga0496121_0019136_4709_5491 247
1009 3300048925 Ga0496122_0006843 Ga0496122_0006843_3811_4593 247
1010 3300048925 Ga0496122_0034716 Ga0496122_0034716_2431_3213 247
1011 3300048925 Ga0496122_0260417 Ga0496122_0260417_66_827 247
1012 3300048926 Ga0496123_0007233 Ga0496123_0007233_3256_4038 247
1013 3300048926 Ga0496123_0044685 Ga0496123_0044685_251_1033 247
1014 3300048926 Ga0496123_0053734 Ga0496123_0053734_457_1218 247
1015 3300048926 Ga0496123_0208601 Ga0496123_0208601_69_845 247
1016 3300048927 Ga0496124_0001044 Ga0496124_0001044_496_1278 247
1017 3300048927 Ga0496124_0022236 Ga0496124_0022236_4542_5324 247
1018 3300048928 Ga0496125_0007864 Ga0496125_0007864_10135_10917 247
1019 3300048929 Ga0496126_0011781 Ga0496126_0011781_2078_2860 247
1020 3300048929 Ga0496126_0122123 Ga0496126_0122123_628_1410 247
1021 3300049570 Ga0501033_0003729 Ga0501033_0003729_7230_7982 247
1022 3300049572 Ga0501036_0482795 Ga0501036_0482795_197_949 247
1023 3300049574 Ga0501038_0224483 Ga0501038_0224483_83_835 247
1024 3300049575 Ga0501039_0137852 Ga0501039_0137852_497_1249 247
1025 3300049578 Ga0501042_0325065 Ga0501042_0325065_316_1068 247
1026 3300049589 Ga0501073_0073633 Ga0501073_0073633_604_1356 247
1027 3300049822 Ga0501035_0466818 Ga0501035_0466818_243_995 247
1028 3300049823 Ga0501044_0088501 Ga0501044_0088501_165_917 247
1029 3300049823 Ga0501044_0545866 Ga0501044_0545866_243_995 247
1030 3300049824 Ga0501045_0196647 Ga0501045_0196647_339_1091 247
1031 3300050516 nmdc:mga0sz30_9663_c1 nmdc:mga0sz30_9663_c1_1953_2735 247
1032 3300053160 Ga0500633_0000702 Ga0500633_0000702_2328_3110 247
1033 3300053730 Ga0500645_001746 Ga0500645_001746_7163_7945 247
1034 iso_pu_bacteria 2537561836 2538832269 247
1035 iso_pu_bacteria 2643221562 2643830279 247
1036 iso_pu_bacteria 2643221577 2643896784 247
1037 iso_pu_bacteria 2643221685 2644478989 247
1038 iso_pu_bacteria 2939611941 2939612519 247
1039 3300003316 rootH1_10003782 rootH1_100037822 248
1040 3300005262 Ga0065165_1000587 Ga0065165_100058745 248
1041 3300005577 Ga0068857_100454352 Ga0068857_1004543522 248
1042 3300009148 Ga0105243_10247287 Ga0105243_102472873 248
1043 3300025936 Ga0207670_10340721 Ga0207670_103407212 248
1044 3300026041 Ga0207639_10580621 Ga0207639_105806212 248
1045 3300035692 Ga0373935_0111045 Ga0373935_0111045_486_1277 248
1046 3300037068 Ga0373925_0188164 Ga0373925_0188164_268_1059 248
1047 3300037068 Ga0373925_0275217 Ga0373925_0275217_87_833 248
1048 3300037312 Ga0395899_0293868 Ga0395899_0293868_200_958 248
1049 3300037418 Ga0395900_0419903 Ga0395900_0419903_199_957 248
1050 3300038443 Ga0395901_0449792 Ga0395901_0449792_365_1123 248
1051 3300041453 Ga0451797_1461544 Ga0451797_1461544_512_1258 248
1052 3300041486 Ga0451807_0735864 Ga0451807_0735864_1437_2183 248
1053 3300044658 Ga0466972_0073090 Ga0466972_0073090_264_1019 248
1054 3300044672 Ga0466982_0000003 Ga0466982_0000003_325794_326549 248
1055 3300044683 Ga0466965_0025791 Ga0466965_0025791_1209_1964 248
1056 3300044684 Ga0466966_0034789 Ga0466966_0034789_1046_1801 248
1057 3300044706 Ga0466964_0001374 Ga0466964_0001374_3967_4722 248
1058 3300044719 Ga0466971_0001052 Ga0466971_0001052_1551_2306 248
1059 3300044735 Ga0466968_0018034 Ga0466968_0018034_673_1428 248
1060 3300044765 Ga0466970_0063568 Ga0466970_0063568_746_1501 248
1061 3300045836 Ga0466958_0106742 Ga0466958_0106742_975_1730 248
1062 3300049571 Ga0501034_0123873 Ga0501034_0123873_1762_2517 248
1063 3300049581 Ga0501047_0119717 Ga0501047_0119717_1515_2273 248
1064 3300049586 Ga0501070_0169190 Ga0501070_0169190_29_799 248
1065 3300053093 Ga0500651_0000592 Ga0500651_0000592_2816_3562 248
1066 3300002067 JGI24735J21928_10011929 JGI24735J21928_100119293 249
1067 3300002705 JGI25156J39149_1004589 JGI25156J39149_10045895 249
1068 3300002737 JGI25162J39368_1000686 JGI25162J39368_100068624 249
1069 3300002737 JGI25162J39368_1005350 JGI25162J39368_10053503 249
1070 3300002737 JGI25162J39368_1006243 JGI25162J39368_10062433 249
1071 3300002738 JGI25154J39366_1002591 JGI25154J39366_10025912 249
1072 3300002741 JGI25157J39369_1001342 JGI25157J39369_100134210 249
1073 3300002741 JGI25157J39369_1002698 JGI25157J39369_10026983 249
1074 3300002771 JGI25163J39215_1000989 JGI25163J39215_10009892 249
1075 3300002772 JGI25164J39214_1000045 JGI25164J39214_100004593 249
1076 3300002772 JGI25164J39214_1001231 JGI25164J39214_10012318 249
1077 3300003214 JGI25165J46597_1000072 JGI25165J46597_100007293 249
1078 3300003214 JGI25165J46597_1002202 JGI25165J46597_10022023 249
1079 3300003751 Ga0055538_1001576 Ga0055538_10015764 249
1080 3300003756 Ga0055533_1000617 Ga0055533_10006175 249
1081 3300003761 Ga0055535_1002327 Ga0055535_10023273 249
1082 3300003761 Ga0055535_1009450 Ga0055535_10094503 249
1083 3300003762 Ga0055542_1006140 Ga0055542_10061403 249
1084 3300003762 Ga0055542_1006760 Ga0055542_10067602 249
1085 3300003762 Ga0055542_1010580 Ga0055542_10105803 249
1086 3300003763 Ga0055529_1001508 Ga0055529_10015088 249
1087 3300003763 Ga0055529_1006222 Ga0055529_10062223 249
1088 3300005337 Ga0070682_100103446 Ga0070682_1001034462 249
1089 3300005340 Ga0070689_100000503 Ga0070689_1000005038 249
1090 3300005344 Ga0070661_100027110 Ga0070661_1000271104 249
1091 3300005365 Ga0070688_100376323 Ga0070688_1003763231 249
1092 3300005459 Ga0068867_100285344 Ga0068867_1002853441 249
1093 3300005466 Ga0070685_10052180 Ga0070685_100521802 249
1094 3300005843 Ga0068860_100471054 Ga0068860_1004710542 249
1095 3300005844 Ga0068862_100048171 Ga0068862_1000481715 249
1096 3300009551 Ga0105238_10128356 Ga0105238_101283562 249
1097 3300013105 Ga0157369_10406107 Ga0157369_104061072 249
1098 3300013306 Ga0163162_10078541 Ga0163162_100785412 249
1099 3300015687 Ga0183368_1003 Ga0183368_1003723 249
1100 3300017792 Ga0163161_10103332 Ga0163161_101033322 249
1101 3300025207 Ga0209760_100585 Ga0209760_1005857 249
1102 3300025224 Ga0209784_100709 Ga0209784_1007093 249
1103 3300025225 Ga0209566_106060 Ga0209566_1060602 249
1104 3300025226 Ga0209674_100012 Ga0209674_100012474 249
1105 3300025228 Ga0209672_100312 Ga0209672_1003126 249
1106 3300025228 Ga0209672_104091 Ga0209672_1040912 249
1107 3300025231 Ga0207427_100055 Ga0207427_100055118 249
1108 3300025231 Ga0207427_100156 Ga0207427_1001563 249
1109 3300025233 Ga0209437_100147 Ga0209437_1001473 249
1110 3300025233 Ga0209437_100161 Ga0209437_100161111 249
1111 3300025233 Ga0209437_100224 Ga0209437_10022444 249
1112 3300025242 Ga0209258_100049 Ga0209258_100049105 249
1113 3300025242 Ga0209258_100186 Ga0209258_10018633 249
1114 3300025242 Ga0209258_101282 Ga0209258_1012825 249
1115 3300025246 Ga0209646_1002608 Ga0209646_10026084 249
1116 3300025246 Ga0209646_1004739 Ga0209646_10047392 249
1117 3300025246 Ga0209646_1010458 Ga0209646_10104582 249
1118 3300025250 Ga0209026_1000099 Ga0209026_1000099168 249
1119 3300025250 Ga0209026_1000375 Ga0209026_100037536 249
1120 3300025254 Ga0209148_1000005 Ga0209148_1000005990 249
1121 3300025254 Ga0209148_1000010 Ga0209148_1000010915 249
1122 3300025254 Ga0209148_1000073 Ga0209148_1000073109 249
1123 3300025256 Ga0209759_1000103 Ga0209759_1000103112 249
1124 3300025256 Ga0209759_1001568 Ga0209759_10015683 249
1125 3300025261 Ga0209233_1000009 Ga0209233_1000009255 249
1126 3300025261 Ga0209233_1000063 Ga0209233_1000063268 249
1127 3300025272 Ga0209455_1000086 Ga0209455_1000086256 249
1128 3300025272 Ga0209455_1000177 Ga0209455_100017733 249
1129 3300025920 Ga0207649_10017567 Ga0207649_100175674 249
1130 3300025924 Ga0207694_10340457 Ga0207694_103404572 249
1131 3300026067 Ga0207678_10010017 Ga0207678_100100172 249
1132 3300028380 Ga0268265_10420735 Ga0268265_104207352 249
1133 3300031548 Ga0307408_100601933 Ga0307408_1006019331 249
1134 3300032004 Ga0307414_10005715 Ga0307414_100057158 249
1135 3300032004 Ga0307414_10031363 Ga0307414_100313632 249
1136 3300037466 Ga0395898_0000049 Ga0395898_0000049_193063_193845 249
1137 3300041413 Ga0439465_0002224 Ga0439465_0002224_2109_2864 249
1138 3300042004 Ga0439445_0003009 Ga0439445_0003009_2459_3214 249
1139 3300042007 Ga0439449_0000048 Ga0439449_0000048_13516_14271 249
1140 3300044673 Ga0453683_0076427 Ga0453683_0076427_382_1146 249
1141 3300046471 Ga0495650_0000337 Ga0495650_0000337_77916_78683 249
1142 3300046507 Ga0495606_0000401 Ga0495606_0000401_35348_36115 249
1143 3300046660 Ga0495625_0080749 Ga0495625_0080749_939_1706 249
1144 3300046694 Ga0495649_0001571 Ga0495649_0001571_15394_16161 249
1145 3300048916 Ga0496113_0002731 Ga0496113_0002731_9116_9883 249
1146 3300048918 Ga0496115_0000503 Ga0496115_0000503_10194_10961 249
1147 3300048924 Ga0496121_0099925 Ga0496121_0099925_867_1634 249
1148 3300048926 Ga0496123_0108715 Ga0496123_0108715_586_1353 249
1149 3300048929 Ga0496126_0085543 Ga0496126_0085543_1142_1909 249
1150 3300049459 Ga0495678_046180 Ga0495678_046180_711_1478 249
1151 3300049823 Ga0501044_0035211 Ga0501044_0035211_568_1320 249
1152 3300001979 JGI24740J21852_10003252 JGI24740J21852_100032524 250
1153 3300001989 JGI24739J22299_10002603 JGI24739J22299_100026035 250
1154 3300001990 JGI24737J22298_10000899 JGI24737J22298_100008995 250
1155 3300002705 JGI25156J39149_1010939 JGI25156J39149_10109394 250
1156 3300002741 JGI25157J39369_1001369 JGI25157J39369_100136911 250
1157 3300003215 JGI25153J46596_10043492 JGI25153J46596_100434921 250
1158 3300003316 rootH1_10052609 rootH1_100526094 250
1159 3300003320 rootH2_10001711 rootH2_100017117 250
1160 3300003578 Ga0006562J51391_1014503 Ga0006562J51391_10145039 250
1161 3300003578 Ga0006562J51391_1014504 Ga0006562J51391_10145048 250
1162 3300003756 Ga0055533_1001801 Ga0055533_10018014 250
1163 3300003759 Ga0055525_1000027 Ga0055525_1000027174 250
1164 3300003760 Ga0055527_1000293 Ga0055527_100029329 250
1165 3300003760 Ga0055527_1000294 Ga0055527_10002945 250
1166 3300003760 Ga0055527_1000694 Ga0055527_100069412 250
1167 3300003761 Ga0055535_1000623 Ga0055535_10006234 250
1168 3300003761 Ga0055535_1001746 Ga0055535_100174611 250
1169 3300003761 Ga0055535_1009433 Ga0055535_10094333 250
1170 3300003762 Ga0055542_1000329 Ga0055542_100032955 250
1171 3300003762 Ga0055542_1000649 Ga0055542_100064930 250
1172 3300003762 Ga0055542_1010547 Ga0055542_10105473 250
1173 3300003763 Ga0055529_1002348 Ga0055529_10023483 250
1174 3300003763 Ga0055529_1006206 Ga0055529_10062063 250
1175 3300005262 Ga0065165_1003615 Ga0065165_10036152 250
1176 3300005327 Ga0070658_10400607 Ga0070658_104006072 250
1177 3300005329 Ga0070683_100187357 Ga0070683_1001873573 250
1178 3300005335 Ga0070666_10216277 Ga0070666_102162772 250
1179 3300005347 Ga0070668_100112657 Ga0070668_1001126572 250
1180 3300005354 Ga0070675_100293549 Ga0070675_1002935491 250
1181 3300005355 Ga0070671_100070009 Ga0070671_1000700095 250
1182 3300005367 Ga0070667_100321454 Ga0070667_1003214542 250
1183 3300005455 Ga0070663_100094637 Ga0070663_1000946372 250
1184 3300005457 Ga0070662_100171880 Ga0070662_1001718803 250
1185 3300005458 Ga0070681_10000122 Ga0070681_1000012218 250
1186 3300005543 Ga0070672_100107701 Ga0070672_1001077011 250
1187 3300005577 Ga0068857_100000591 Ga0068857_10000059126 250
1188 3300005578 Ga0068854_100204707 Ga0068854_1002047073 250
1189 3300005614 Ga0068856_100008425 Ga0068856_1000084255 250
1190 3300005614 Ga0068856_100310128 Ga0068856_1003101282 250
1191 3300005616 Ga0068852_100354288 Ga0068852_1003542882 250
1192 3300005617 Ga0068859_100038947 Ga0068859_1000389473 250
1193 3300005618 Ga0068864_100171677 Ga0068864_1001716774 250
1194 3300005834 Ga0068851_10139662 Ga0068851_101396622 250
1195 3300005834 Ga0068851_10248850 Ga0068851_102488501 250
1196 3300005842 Ga0068858_100023895 Ga0068858_1000238956 250
1197 3300005843 Ga0068860_100499246 Ga0068860_1004992462 250
1198 3300005937 Ga0081455_10048313 Ga0081455_100483134 250
1199 3300006237 Ga0097621_100061006 Ga0097621_1000610062 250
1200 3300006931 Ga0097620_100038946 Ga0097620_1000389464 250
1201 3300009093 Ga0105240_10077509 Ga0105240_100775095 250
1202 3300009093 Ga0105240_10611385 Ga0105240_106113852 250
1203 3300009098 Ga0105245_10579081 Ga0105245_105790811 250
1204 3300009148 Ga0105243_10871699 Ga0105243_108716992 250
1205 3300009545 Ga0105237_10000064 Ga0105237_1000006448 250
1206 3300009545 Ga0105237_10640253 Ga0105237_106402532 250
1207 3300010375 Ga0105239_10010561 Ga0105239_100105614 250
1208 3300010375 Ga0105239_10127734 Ga0105239_101277341 250
1209 3300012502 Ga0157347_1000121 Ga0157347_10001214 250
1210 3300013100 Ga0157373_10081763 Ga0157373_100817631 250
1211 3300013102 Ga0157371_10316741 Ga0157371_103167412 250
1212 3300013105 Ga0157369_10063749 Ga0157369_100637494 250
1213 3300013296 Ga0157374_10356538 Ga0157374_103565382 250
1214 3300013297 Ga0157378_10384416 Ga0157378_103844162 250
1215 3300025226 Ga0209674_100119 Ga0209674_100119107 250
1216 3300025228 Ga0209672_100005 Ga0209672_100005676 250
1217 3300025228 Ga0209672_100016 Ga0209672_100016323 250
1218 3300025228 Ga0209672_100887 Ga0209672_1008876 250
1219 3300025230 Ga0209563_100023 Ga0209563_100023335 250
1220 3300025242 Ga0209258_100006 Ga0209258_100006676 250
1221 3300025242 Ga0209258_100012 Ga0209258_100012464 250
1222 3300025242 Ga0209258_100064 Ga0209258_100064204 250
1223 3300025250 Ga0209026_1000541 Ga0209026_100054111 250
1224 3300025254 Ga0209148_1000012 Ga0209148_1000012676 250
1225 3300025254 Ga0209148_1000014 Ga0209148_1000014192 250
1226 3300025254 Ga0209148_1000142 Ga0209148_100014283 250
1227 3300025256 Ga0209759_1000792 Ga0209759_100079211 250
1228 3300025258 Ga0209129_1004913 Ga0209129_10049134 250
1229 3300025272 Ga0209455_1000008 Ga0209455_1000008676 250
1230 3300025272 Ga0209455_1000014 Ga0209455_100001480 250
1231 3300025297 Ga0209758_1001371 Ga0209758_100137132 250
1232 3300025297 Ga0209758_1079160 Ga0209758_10791601 250
1233 3300025321 Ga0207656_10004478 Ga0207656_100044785 250
1234 3300025903 Ga0207680_10147436 Ga0207680_101474362 250
1235 3300025903 Ga0207680_10157513 Ga0207680_101575132 250
1236 3300025904 Ga0207647_10013553 Ga0207647_100135534 250
1237 3300025907 Ga0207645_10107216 Ga0207645_101072162 250
1238 3300025912 Ga0207707_10000310 Ga0207707_1000031012 250
1239 3300025912 Ga0207707_10214905 Ga0207707_102149052 250
1240 3300025913 Ga0207695_10000780 Ga0207695_1000078065 250
1241 3300025913 Ga0207695_10003105 Ga0207695_1000310521 250
1242 3300025913 Ga0207695_10154475 Ga0207695_101544754 250
1243 3300025913 Ga0207695_10451902 Ga0207695_104519022 250
1244 3300025914 Ga0207671_10000061 Ga0207671_1000006188 250
1245 3300025924 Ga0207694_10096636 Ga0207694_100966362 250
1246 3300025940 Ga0207691_10075826 Ga0207691_100758262 250
1247 3300025945 Ga0207679_10234820 Ga0207679_102348202 250
1248 3300025945 Ga0207679_10389602 Ga0207679_103896022 250
1249 3300025949 Ga0207667_10038148 Ga0207667_100381485 250
1250 3300025949 Ga0207667_10038559 Ga0207667_100385595 250
1251 3300025981 Ga0207640_10000797 Ga0207640_100007976 250
1252 3300025981 Ga0207640_10076264 Ga0207640_100762642 250
1253 3300026035 Ga0207703_10030081 Ga0207703_100300814 250
1254 3300026067 Ga0207678_10038897 Ga0207678_100388972 250
1255 3300026067 Ga0207678_10123140 Ga0207678_101231403 250
1256 3300026078 Ga0207702_10002243 Ga0207702_1000224318 250
1257 3300026089 Ga0207648_10031857 Ga0207648_100318575 250
1258 3300026116 Ga0207674_10000226 Ga0207674_1000022659 250
1259 3300026116 Ga0207674_10064922 Ga0207674_100649223 250
1260 3300026142 Ga0207698_10125951 Ga0207698_101259512 250
1261 3300026142 Ga0207698_10170773 Ga0207698_101707733 250
1262 3300028381 Ga0268264_10156716 Ga0268264_101567162 250
1263 3300028381 Ga0268264_10816942 Ga0268264_108169421 250
1264 3300032004 Ga0307414_10238244 Ga0307414_102382442 250
1265 3300032005 Ga0307411_10206503 Ga0307411_102065031 250
1266 3300037312 Ga0395899_0000108 Ga0395899_0000108_85845_86630 250
1267 3300037312 Ga0395899_0064157 Ga0395899_0064157_1894_2679 250
1268 3300037418 Ga0395900_0000144 Ga0395900_0000144_32891_33676 250
1269 3300037466 Ga0395898_0000018 Ga0395898_0000018_327980_328765 250
1270 3300038443 Ga0395901_0263752 Ga0395901_0263752_407_1192 250
1271 3300038443 Ga0395901_0399852 Ga0395901_0399852_27_812 250
1272 3300044656 Ga0466969_0007454 Ga0466969_0007454_2374_3159 250
1273 3300044663 Ga0466989_0188469 Ga0466989_0188469_337_1122 250
1274 3300044683 Ga0466965_0187235 Ga0466965_0187235_133_918 250
1275 3300044684 Ga0466966_0015597 Ga0466966_0015597_698_1483 250
1276 3300044684 Ga0466966_0019653 Ga0466966_0019653_3615_4400 250
1277 3300044684 Ga0466966_0288483 Ga0466966_0288483_44_829 250
1278 3300044693 Ga0466961_0028191 Ga0466961_0028191_859_1644 250
1279 3300044693 Ga0466961_0035526 Ga0466961_0035526_1017_1802 250
1280 3300044693 Ga0466961_0091880 Ga0466961_0091880_122_907 250
1281 3300044693 Ga0466961_0145599 Ga0466961_0145599_127_912 250
1282 3300044694 Ga0466963_0133386 Ga0466963_0133386_136_921 250
1283 3300044694 Ga0466963_0302871 Ga0466963_0302871_96_881 250
1284 3300044719 Ga0466971_0015307 Ga0466971_0015307_1333_2118 250
1285 3300044719 Ga0466971_0052473 Ga0466971_0052473_661_1446 250
1286 3300044765 Ga0466970_0021855 Ga0466970_0021855_2525_3310 250
1287 3300044765 Ga0466970_0232500 Ga0466970_0232500_122_907 250
1288 3300044765 Ga0466970_0234734 Ga0466970_0234734_179_964 250
1289 3300044842 Ga0466957_0006156 Ga0466957_0006156_2640_3425 250
1290 3300044842 Ga0466957_0108334 Ga0466957_0108334_460_1245 250
1291 3300045049 Ga0466959_0000194 Ga0466959_0000194_22796_23581 250
1292 3300045049 Ga0466959_0031749 Ga0466959_0031749_121_906 250
1293 3300045836 Ga0466958_0010562 Ga0466958_0010562_1636_2421 250
1294 3300045836 Ga0466958_0283288 Ga0466958_0283288_19_804 250
1295 3300045976 Ga0466967_0134565 Ga0466967_0134565_689_1474 250
1296 3300048907 Ga0496104_0072803 Ga0496104_0072803_1438_2211 250
1297 3300048908 Ga0496105_0001886 Ga0496105_0001886_8596_9369 250
1298 3300048918 Ga0496115_0010955 Ga0496115_0010955_3446_4219 250
1299 3300048920 Ga0496117_0002308 Ga0496117_0002308_2811_3584 250
1300 3300048921 Ga0496118_0008410 Ga0496118_0008410_9795_10568 250
1301 3300048922 Ga0496119_0000430 Ga0496119_0000430_37754_38527 250
1302 3300048923 Ga0496120_0001482 Ga0496120_0001482_18645_19418 250
1303 3300048924 Ga0496121_0000743 Ga0496121_0000743_566_1339 250
1304 3300048924 Ga0496121_0011904 Ga0496121_0011904_7416_8195 250
1305 3300048928 Ga0496125_0000330 Ga0496125_0000330_60441_61220 250
1306 3300048929 Ga0496126_0003181 Ga0496126_0003181_831_1604 250
1307 3300049568 Ga0501031_0081639 Ga0501031_0081639_1192_2004 250
1308 3300049569 Ga0501032_0005454 Ga0501032_0005454_2835_3605 250
1309 3300049570 Ga0501033_0000329 Ga0501033_0000329_8564_9334 250
1310 3300049571 Ga0501034_0003703 Ga0501034_0003703_15438_16208 250
1311 3300049571 Ga0501034_0062696 Ga0501034_0062696_2668_3480 250
1312 3300049572 Ga0501036_0005648 Ga0501036_0005648_522_1292 250
1313 3300049573 Ga0501037_0044301 Ga0501037_0044301_1264_2049 250
1314 3300049573 Ga0501037_0186342 Ga0501037_0186342_565_1335 250
1315 3300049574 Ga0501038_0002332 Ga0501038_0002332_8956_9726 250
1316 3300049575 Ga0501039_0003401 Ga0501039_0003401_8214_8984 250
1317 3300049576 Ga0501040_0029928 Ga0501040_0029928_586_1371 250
1318 3300049578 Ga0501042_0104451 Ga0501042_0104451_1240_2025 250
1319 3300049579 Ga0501043_0004587 Ga0501043_0004587_7619_8389 250
1320 3300049579 Ga0501043_0123909 Ga0501043_0123909_917_1729 250
1321 3300049580 Ga0501046_0020233 Ga0501046_0020233_3863_4675 250
1322 3300049580 Ga0501046_0024836 Ga0501046_0024836_4060_4830 250
1323 3300049581 Ga0501047_0085772 Ga0501047_0085772_646_1416 250
1324 3300049581 Ga0501047_0286709 Ga0501047_0286709_104_916 250
1325 3300049582 Ga0501048_0110752 Ga0501048_0110752_320_1105 250
1326 3300049583 Ga0501067_0004300 Ga0501067_0004300_2274_3086 250
1327 3300049584 Ga0501068_0134694 Ga0501068_0134694_361_1131 250
1328 3300049585 Ga0501069_0037712 Ga0501069_0037712_1166_1951 250
1329 3300049585 Ga0501069_0220764 Ga0501069_0220764_216_986 250
1330 3300049586 Ga0501070_0038354 Ga0501070_0038354_2204_2980 250
1331 3300049586 Ga0501070_0052819 Ga0501070_0052819_409_1179 250
1332 3300049586 Ga0501070_0332190 Ga0501070_0332190_53_838 250
1333 3300049587 Ga0501071_0268087 Ga0501071_0268087_350_1120 250
1334 3300049588 Ga0501072_0094580 Ga0501072_0094580_695_1507 250
1335 3300049589 Ga0501073_0046668 Ga0501073_0046668_1349_2119 250
1336 3300049590 Ga0501074_0009292 Ga0501074_0009292_3598_4368 250
1337 3300049590 Ga0501074_0053421 Ga0501074_0053421_361_1173 250
1338 3300049592 Ga0501076_0251135 Ga0501076_0251135_569_1354 250
1339 3300049741 Ga0501079_0079959 Ga0501079_0079959_508_1293 250
1340 3300049741 Ga0501079_0086907 Ga0501079_0086907_1313_2083 250
1341 3300049742 Ga0501080_0024565 Ga0501080_0024565_544_1314 250
1342 3300049742 Ga0501080_0037132 Ga0501080_0037132_2187_2963 250
1343 3300049744 Ga0501083_0093189 Ga0501083_0093189_651_1436 250
1344 3300049822 Ga0501035_0003159 Ga0501035_0003159_14381_15166 250
1345 3300049822 Ga0501035_0065799 Ga0501035_0065799_28_798 250
1346 3300049823 Ga0501044_0006675 Ga0501044_0006675_3275_4060 250
1347 3300049823 Ga0501044_0071532 Ga0501044_0071532_1815_2627 250
1348 3300049823 Ga0501044_0122205 Ga0501044_0122205_1055_1825 250
1349 3300049824 Ga0501045_0165938 Ga0501045_0165938_252_1064 250
1350 3300053139 Ga0500568_0000145 Ga0500568_0000145_7085_7903 250
1351 3300054114 Ga0501084_0077485 Ga0501084_0077485_206_1003 250
1352 3300059504 Ga0587082_000953 Ga0587082_000953_1571_2350 250
1353 3300060353 Ga0501082_0000082 Ga0501082_0000082_51155_51925 250
1354 3300060353 Ga0501082_0197205 Ga0501082_0197205_323_1135 250
1355 3300060353 Ga0501082_0330353 Ga0501082_0330353_136_906 250
1356 3300061719 Ga0466962_0002443 Ga0466962_0002443_3352_4137 250
1357 3300061719 Ga0466962_0061287 Ga0466962_0061287_60_845 250
1358 3300002741 JGI25157J39369_1000996 JGI25157J39369_100099611 251
1359 3300005327 Ga0070658_10004423 Ga0070658_1000442312 251
1360 3300005327 Ga0070658_10131004 Ga0070658_101310043 251
1361 3300005330 Ga0070690_100205152 Ga0070690_1002051522 251
1362 3300005331 Ga0070670_100366514 Ga0070670_1003665142 251
1363 3300005335 Ga0070666_10000005 Ga0070666_10000005125 251
1364 3300005336 Ga0070680_100085679 Ga0070680_1000856793 251
1365 3300005336 Ga0070680_100150299 Ga0070680_1001502992 251
1366 3300005337 Ga0070682_100005998 Ga0070682_1000059986 251
1367 3300005337 Ga0070682_100265407 Ga0070682_1002654072 251
1368 3300005340 Ga0070689_100463040 Ga0070689_1004630402 251
1369 3300005344 Ga0070661_100037672 Ga0070661_1000376723 251
1370 3300005344 Ga0070661_100132250 Ga0070661_1001322502 251
1371 3300005347 Ga0070668_100193652 Ga0070668_1001936522 251
1372 3300005353 Ga0070669_100197913 Ga0070669_1001979132 251
1373 3300005354 Ga0070675_100106792 Ga0070675_1001067923 251
1374 3300005356 Ga0070674_100231432 Ga0070674_1002314322 251
1375 3300005364 Ga0070673_100266670 Ga0070673_1002666702 251
1376 3300005366 Ga0070659_100179434 Ga0070659_1001794341 251
1377 3300005367 Ga0070667_100018821 Ga0070667_1000188216 251
1378 3300005435 Ga0070714_100035856 Ga0070714_1000358563 251
1379 3300005435 Ga0070714_100115600 Ga0070714_1001156001 251
1380 3300005436 Ga0070713_100002641 Ga0070713_1000026418 251
1381 3300005444 Ga0070694_100088104 Ga0070694_1000881043 251
1382 3300005455 Ga0070663_100226957 Ga0070663_1002269572 251
1383 3300005456 Ga0070678_100068406 Ga0070678_1000684064 251
1384 3300005457 Ga0070662_100143413 Ga0070662_1001434133 251
1385 3300005458 Ga0070681_10187020 Ga0070681_101870203 251
1386 3300005458 Ga0070681_10348376 Ga0070681_103483762 251
1387 3300005459 Ga0068867_100014624 Ga0068867_1000146245 251
1388 3300005530 Ga0070679_100006031 Ga0070679_1000060319 251
1389 3300005530 Ga0070679_100082714 Ga0070679_1000827144 251
1390 3300005530 Ga0070679_100157157 Ga0070679_1001571572 251
1391 3300005539 Ga0068853_100062449 Ga0068853_1000624494 251
1392 3300005539 Ga0068853_100307837 Ga0068853_1003078372 251
1393 3300005543 Ga0070672_100022870 Ga0070672_1000228702 251
1394 3300005546 Ga0070696_100002542 Ga0070696_1000025424 251
1395 3300005546 Ga0070696_100031811 Ga0070696_1000318113 251
1396 3300005547 Ga0070693_100029136 Ga0070693_1000291363 251
1397 3300005548 Ga0070665_100041503 Ga0070665_1000415033 251
1398 3300005548 Ga0070665_100317672 Ga0070665_1003176722 251
1399 3300005577 Ga0068857_100026022 Ga0068857_1000260225 251
1400 3300005614 Ga0068856_100221061 Ga0068856_1002210613 251
1401 3300005614 Ga0068856_100323501 Ga0068856_1003235012 251
1402 3300005618 Ga0068864_100015261 Ga0068864_1000152616 251
1403 3300005841 Ga0068863_100660228 Ga0068863_1006602282 251
1404 3300005842 Ga0068858_100361783 Ga0068858_1003617832 251
1405 3300006237 Ga0097621_100087245 Ga0097621_1000872453 251
1406 3300006237 Ga0097621_100121627 Ga0097621_1001216272 251
1407 3300006237 Ga0097621_100180020 Ga0097621_1001800202 251
1408 3300006358 Ga0068871_100099326 Ga0068871_1000993262 251
1409 3300006871 Ga0075434_100102288 Ga0075434_1001022882 251
1410 3300009174 Ga0105241_10141839 Ga0105241_101418394 251
1411 3300009177 Ga0105248_10395924 Ga0105248_103959242 251
1412 3300009545 Ga0105237_10049193 Ga0105237_100491932 251
1413 3300009551 Ga0105238_10000924 Ga0105238_1000092410 251
1414 3300009551 Ga0105238_10587977 Ga0105238_105879772 251
1415 3300009553 Ga0105249_10462895 Ga0105249_104628952 251
1416 3300010375 Ga0105239_10450554 Ga0105239_104505542 251
1417 3300013100 Ga0157373_10238248 Ga0157373_102382482 251
1418 3300013104 Ga0157370_10087421 Ga0157370_100874211 251
1419 3300013105 Ga0157369_10034421 Ga0157369_100344214 251
1420 3300013296 Ga0157374_10328522 Ga0157374_103285222 251
1421 3300013297 Ga0157378_10367082 Ga0157378_103670821 251
1422 3300013306 Ga0163162_10000489 Ga0163162_1000048933 251
1423 3300013306 Ga0163162_10009175 Ga0163162_100091759 251
1424 3300013306 Ga0163162_10250967 Ga0163162_102509672 251
1425 3300013306 Ga0163162_10306137 Ga0163162_103061372 251
1426 3300013307 Ga0157372_10001376 Ga0157372_1000137613 251
1427 3300013307 Ga0157372_10065619 Ga0157372_100656194 251
1428 3300013307 Ga0157372_10072607 Ga0157372_100726072 251
1429 3300013308 Ga0157375_10188760 Ga0157375_101887601 251
1430 3300013308 Ga0157375_10492557 Ga0157375_104925572 251
1431 3300014497 Ga0182008_10009625 Ga0182008_100096255 251
1432 3300014497 Ga0182008_10051007 Ga0182008_100510073 251
1433 3300014969 Ga0157376_10207223 Ga0157376_102072232 251
1434 3300014969 Ga0157376_10303334 Ga0157376_103033343 251
1435 3300014969 Ga0157376_10324512 Ga0157376_103245122 251
1436 3300015262 Ga0182007_10035389 Ga0182007_100353892 251
1437 3300017792 Ga0163161_10406621 Ga0163161_104066212 251
1438 3300025226 Ga0209674_100973 Ga0209674_1009737 251
1439 3300025231 Ga0207427_105404 Ga0207427_1054043 251
1440 3300025233 Ga0209437_100020 Ga0209437_100020405 251
1441 3300025250 Ga0209026_1000037 Ga0209026_1000037127 251
1442 3300025256 Ga0209759_1010031 Ga0209759_10100312 251
1443 3300025261 Ga0209233_1000020 Ga0209233_1000020221 251
1444 3300025261 Ga0209233_1000147 Ga0209233_100014744 251
1445 3300025903 Ga0207680_10000005 Ga0207680_10000005483 251
1446 3300025904 Ga0207647_10001940 Ga0207647_100019409 251
1447 3300025909 Ga0207705_10005224 Ga0207705_1000522410 251
1448 3300025909 Ga0207705_10014275 Ga0207705_100142754 251
1449 3300025912 Ga0207707_10013618 Ga0207707_100136184 251
1450 3300025912 Ga0207707_10042934 Ga0207707_100429343 251
1451 3300025912 Ga0207707_10174379 Ga0207707_101743793 251
1452 3300025912 Ga0207707_10414408 Ga0207707_104144082 251
1453 3300025914 Ga0207671_10123741 Ga0207671_101237412 251
1454 3300025919 Ga0207657_10045337 Ga0207657_100453372 251
1455 3300025920 Ga0207649_10035699 Ga0207649_100356992 251
1456 3300025920 Ga0207649_10049981 Ga0207649_100499814 251
1457 3300025921 Ga0207652_10074563 Ga0207652_100745632 251
1458 3300025921 Ga0207652_10228318 Ga0207652_102283182 251
1459 3300025923 Ga0207681_10086448 Ga0207681_100864483 251
1460 3300025924 Ga0207694_10001362 Ga0207694_100013622 251
1461 3300025926 Ga0207659_10202713 Ga0207659_102027133 251
1462 3300025928 Ga0207700_10007782 Ga0207700_100077823 251
1463 3300025928 Ga0207700_10420206 Ga0207700_104202062 251
1464 3300025929 Ga0207664_10000026 Ga0207664_1000002616 251
1465 3300025929 Ga0207664_10168743 Ga0207664_101687432 251
1466 3300025932 Ga0207690_10004311 Ga0207690_100043116 251
1467 3300025932 Ga0207690_10050680 Ga0207690_100506804 251
1468 3300025932 Ga0207690_10505429 Ga0207690_105054291 251
1469 3300025933 Ga0207706_10010437 Ga0207706_100104376 251
1470 3300025934 Ga0207686_10271747 Ga0207686_102717472 251
1471 3300025936 Ga0207670_10355762 Ga0207670_103557622 251
1472 3300025938 Ga0207704_10210700 Ga0207704_102107002 251
1473 3300025940 Ga0207691_10020705 Ga0207691_100207054 251
1474 3300025942 Ga0207689_10263540 Ga0207689_102635402 251
1475 3300025949 Ga0207667_10023112 Ga0207667_100231126 251
1476 3300025960 Ga0207651_10411670 Ga0207651_104116702 251
1477 3300025972 Ga0207668_10111329 Ga0207668_101113292 251
1478 3300026023 Ga0207677_10192173 Ga0207677_101921732 251
1479 3300026041 Ga0207639_10109558 Ga0207639_101095583 251
1480 3300026041 Ga0207639_10229565 Ga0207639_102295653 251
1481 3300026078 Ga0207702_10060932 Ga0207702_100609323 251
1482 3300026078 Ga0207702_10238212 Ga0207702_102382122 251
1483 3300026088 Ga0207641_10471639 Ga0207641_104716392 251
1484 3300026089 Ga0207648_10033541 Ga0207648_100335416 251
1485 3300026116 Ga0207674_10378295 Ga0207674_103782952 251
1486 3300026142 Ga0207698_11030904 Ga0207698_110309041 251
1487 3300028379 Ga0268266_10000004 Ga0268266_100000041050 251
1488 3300028381 Ga0268264_10024072 Ga0268264_100240723 251
1489 3300033180 Ga0307510_10002044 Ga0307510_1000204427 251
1490 3300037466 Ga0395898_0062023 Ga0395898_0062023_840_1622 251
1491 3300037471 Ga0395905_0289328 Ga0395905_0289328_62_844 251
1492 3300038443 Ga0395901_0007439 Ga0395901_0007439_8249_9022 251
1493 3300042012 Ga0439455_0004575 Ga0439455_0004575_1617_2390 251
1494 3300046462 Ga0495651_0307790 Ga0495651_0307790_252_1025 251
1495 3300046471 Ga0495650_0001325 Ga0495650_0001325_5369_6148 251
1496 3300046660 Ga0495625_0135776 Ga0495625_0135776_125_904 251
1497 3300046681 Ga0495647_0056706 Ga0495647_0056706_567_1325 251
1498 3300048924 Ga0496121_0029686 Ga0496121_0029686_3923_4702 251
1499 3300048928 Ga0496125_0141264 Ga0496125_0141264_570_1349 251
1500 3300048929 Ga0496126_0037880 Ga0496126_0037880_1404_2183 251
1501 3300049571 Ga0501034_0037041 Ga0501034_0037041_3872_4645 251
1502 3300049571 Ga0501034_0149559 Ga0501034_0149559_1235_2011 251
1503 3300049572 Ga0501036_0027370 Ga0501036_0027370_2158_2931 251
1504 3300049573 Ga0501037_0007118 Ga0501037_0007118_5831_6604 251
1505 3300049574 Ga0501038_0330702 Ga0501038_0330702_330_1112 251
1506 3300049579 Ga0501043_0079013 Ga0501043_0079013_658_1434 251
1507 3300049579 Ga0501043_0233102 Ga0501043_0233102_80_862 251
1508 3300049580 Ga0501046_0008359 Ga0501046_0008359_7536_8312 251
1509 3300049581 Ga0501047_0238805 Ga0501047_0238805_146_928 251
1510 3300049586 Ga0501070_0111768 Ga0501070_0111768_1208_1981 251
1511 3300049823 Ga0501044_0128713 Ga0501044_0128713_243_1016 251
1512 3300059492 Ga0587073_0002117 Ga0587073_0002117_1120_1893 251
1513 3300059508 Ga0587088_021761 Ga0587088_021761_155_928 251
1514 3300059605 Ga0587106_011083 Ga0587106_011083_112_885 251
1515 3300059645 Ga0587076_002674 Ga0587076_002674_856_1629 251
1516 3300005366 Ga0070659_100277474 Ga0070659_1002774742 252
1517 3300005367 Ga0070667_100011088 Ga0070667_1000110882 252
1518 3300005455 Ga0070663_100411181 Ga0070663_1004111812 252
1519 3300005458 Ga0070681_10114722 Ga0070681_101147223 252
1520 3300005539 Ga0068853_100030340 Ga0068853_1000303403 252
1521 3300005543 Ga0070672_100015511 Ga0070672_1000155114 252
1522 3300005547 Ga0070693_100081272 Ga0070693_1000812721 252
1523 3300005548 Ga0070665_100000057 Ga0070665_100000057232 252
1524 3300005548 Ga0070665_100146563 Ga0070665_1001465632 252
1525 3300005563 Ga0068855_100024413 Ga0068855_1000244137 252
1526 3300005563 Ga0068855_100360132 Ga0068855_1003601323 252
1527 3300005577 Ga0068857_100040303 Ga0068857_1000403034 252
1528 3300005617 Ga0068859_100001188 Ga0068859_10000118810 252
1529 3300005842 Ga0068858_100448019 Ga0068858_1004480192 252
1530 3300005843 Ga0068860_100052752 Ga0068860_1000527523 252
1531 3300005844 Ga0068862_100023439 Ga0068862_1000234397 252
1532 3300006931 Ga0097620_100001188 Ga0097620_10000118810 252
1533 3300009098 Ga0105245_10754806 Ga0105245_107548062 252
1534 3300009177 Ga0105248_10251892 Ga0105248_102518922 252
1535 3300009177 Ga0105248_10976783 Ga0105248_109767831 252
1536 3300009545 Ga0105237_10173710 Ga0105237_101737101 252
1537 3300010375 Ga0105239_10008425 Ga0105239_1000842511 252
1538 3300010375 Ga0105239_10018248 Ga0105239_100182485 252
1539 3300013308 Ga0157375_10001135 Ga0157375_1000113512 252
1540 3300025303 Ga0209051_1039422 Ga0209051_10394222 252
1541 3300025920 Ga0207649_10197151 Ga0207649_101971512 252
1542 3300025927 Ga0207687_10090627 Ga0207687_100906272 252
1543 3300025940 Ga0207691_10024916 Ga0207691_100249164 252
1544 3300025942 Ga0207689_10086754 Ga0207689_100867542 252
1545 3300025949 Ga0207667_10126270 Ga0207667_101262705 252
1546 3300026035 Ga0207703_10129839 Ga0207703_101298393 252
1547 3300026041 Ga0207639_10011963 Ga0207639_100119634 252
1548 3300026067 Ga0207678_10425557 Ga0207678_104255572 252
1549 3300026088 Ga0207641_10115438 Ga0207641_101154382 252
1550 3300026116 Ga0207674_10067399 Ga0207674_100673991 252
1551 3300026118 Ga0207675_100012481 Ga0207675_1000124814 252
1552 3300028379 Ga0268266_10000001 Ga0268266_100000012805 252
1553 3300028380 Ga0268265_10002756 Ga0268265_100027561 252
1554 3300028380 Ga0268265_10506695 Ga0268265_105066952 252
1555 3300028381 Ga0268264_10051695 Ga0268264_100516954 252
1556 3300037418 Ga0395900_0000051 Ga0395900_0000051_136216_136983 252
1557 3300037466 Ga0395898_0159975 Ga0395898_0159975_319_1086 252
1558 3300038443 Ga0395901_0000356 Ga0395901_0000356_54617_55405 252
1559 3300044712 Ga0453684_0000298 Ga0453684_0000298_17176_17937 252
1560 3300045051 Ga0451576_0000033 Ga0451576_0000033_375195_375956 252
1561 3300049589 Ga0501073_0085565 Ga0501073_0085565_326_1117 252
1562 3300055283 Ga0500661_007161 Ga0500661_007161_1271_2050 252
1563 3300001904 JGI24736J21556_1006935 JGI24736J21556_10069351 253
1564 3300001915 JGI24741J21665_1001528 JGI24741J21665_10015283 253
1565 3300001915 JGI24741J21665_1004362 JGI24741J21665_10043623 253
1566 3300001915 JGI24741J21665_1009278 JGI24741J21665_10092784 253
1567 3300001979 JGI24740J21852_10001136 JGI24740J21852_100011369 253
1568 3300001979 JGI24740J21852_10003557 JGI24740J21852_100035577 253
1569 3300005327 Ga0070658_10325742 Ga0070658_103257422 253
1570 3300005329 Ga0070683_100119371 Ga0070683_1001193712 253
1571 3300005329 Ga0070683_100184171 Ga0070683_1001841712 253
1572 3300005329 Ga0070683_100318777 Ga0070683_1003187773 253
1573 3300005329 Ga0070683_100343947 Ga0070683_1003439472 253
1574 3300005336 Ga0070680_100035951 Ga0070680_1000359514 253
1575 3300005336 Ga0070680_100100598 Ga0070680_1001005984 253
1576 3300005336 Ga0070680_100227890 Ga0070680_1002278902 253
1577 3300005336 Ga0070680_100600616 Ga0070680_1006006161 253
1578 3300005337 Ga0070682_100026910 Ga0070682_1000269103 253
1579 3300005339 Ga0070660_100035972 Ga0070660_1000359725 253
1580 3300005339 Ga0070660_100166347 Ga0070660_1001663472 253
1581 3300005339 Ga0070660_100206953 Ga0070660_1002069532 253
1582 3300005341 Ga0070691_10003685 Ga0070691_100036853 253
1583 3300005341 Ga0070691_10119729 Ga0070691_101197293 253
1584 3300005341 Ga0070691_10122129 Ga0070691_101221292 253
1585 3300005344 Ga0070661_100043927 Ga0070661_1000439274 253
1586 3300005344 Ga0070661_100165830 Ga0070661_1001658303 253
1587 3300005344 Ga0070661_100673044 Ga0070661_1006730441 253
1588 3300005345 Ga0070692_10015943 Ga0070692_100159434 253
1589 3300005345 Ga0070692_10018107 Ga0070692_100181071 253
1590 3300005345 Ga0070692_10088543 Ga0070692_100885432 253
1591 3300005354 Ga0070675_100067894 Ga0070675_1000678941 253
1592 3300005366 Ga0070659_100003864 Ga0070659_10000386412 253
1593 3300005366 Ga0070659_100109214 Ga0070659_1001092143 253
1594 3300005366 Ga0070659_100283525 Ga0070659_1002835253 253
1595 3300005367 Ga0070667_100334108 Ga0070667_1003341082 253
1596 3300005455 Ga0070663_100002590 Ga0070663_1000025906 253
1597 3300005455 Ga0070663_100027969 Ga0070663_1000279692 253
1598 3300005455 Ga0070663_100287362 Ga0070663_1002873622 253
1599 3300005455 Ga0070663_100795687 Ga0070663_1007956871 253
1600 3300005457 Ga0070662_100043134 Ga0070662_1000431343 253
1601 3300005458 Ga0070681_10003994 Ga0070681_100039944 253
1602 3300005458 Ga0070681_10044503 Ga0070681_100445033 253
1603 3300005458 Ga0070681_10121667 Ga0070681_101216672 253
1604 3300005458 Ga0070681_10415251 Ga0070681_104152512 253
1605 3300005458 Ga0070681_10453641 Ga0070681_104536412 253
1606 3300005530 Ga0070679_100001153 Ga0070679_1000011534 253
1607 3300005530 Ga0070679_100029564 Ga0070679_1000295643 253
1608 3300005530 Ga0070679_100434738 Ga0070679_1004347382 253
1609 3300005535 Ga0070684_100131879 Ga0070684_1001318792 253
1610 3300005535 Ga0070684_100256986 Ga0070684_1002569863 253
1611 3300005539 Ga0068853_100098452 Ga0068853_1000984522 253
1612 3300005539 Ga0068853_100136503 Ga0068853_1001365032 253
1613 3300005546 Ga0070696_100014375 Ga0070696_1000143752 253
1614 3300005546 Ga0070696_100043559 Ga0070696_1000435593 253
1615 3300005546 Ga0070696_100044652 Ga0070696_1000446524 253
1616 3300005546 Ga0070696_100210264 Ga0070696_1002102642 253
1617 3300005547 Ga0070693_100012046 Ga0070693_1000120464 253
1618 3300005547 Ga0070693_100020805 Ga0070693_1000208053 253
1619 3300005563 Ga0068855_100002399 Ga0068855_1000023994 253
1620 3300005563 Ga0068855_100293923 Ga0068855_1002939232 253
1621 3300005564 Ga0070664_100060997 Ga0070664_1000609974 253
1622 3300005564 Ga0070664_100074821 Ga0070664_1000748214 253
1623 3300005577 Ga0068857_100244529 Ga0068857_1002445293 253
1624 3300005577 Ga0068857_100284186 Ga0068857_1002841862 253
1625 3300005578 Ga0068854_100010672 Ga0068854_1000106724 253
1626 3300005578 Ga0068854_100226578 Ga0068854_1002265782 253
1627 3300005614 Ga0068856_100126308 Ga0068856_1001263082 253
1628 3300005614 Ga0068856_100219979 Ga0068856_1002199793 253
1629 3300005614 Ga0068856_100547304 Ga0068856_1005473041 253
1630 3300005616 Ga0068852_100038168 Ga0068852_1000381683 253
1631 3300005616 Ga0068852_100298511 Ga0068852_1002985113 253
1632 3300005616 Ga0068852_100424242 Ga0068852_1004242422 253
1633 3300005616 Ga0068852_100435473 Ga0068852_1004354732 253
1634 3300005618 Ga0068864_100137235 Ga0068864_1001372353 253
1635 3300005719 Ga0068861_100271260 Ga0068861_1002712602 253
1636 3300005834 Ga0068851_10001445 Ga0068851_100014456 253
1637 3300009093 Ga0105240_10384666 Ga0105240_103846663 253
1638 3300009093 Ga0105240_10525973 Ga0105240_105259732 253
1639 3300009551 Ga0105238_10021154 Ga0105238_100211547 253
1640 3300013100 Ga0157373_10256059 Ga0157373_102560592 253
1641 3300013100 Ga0157373_10361367 Ga0157373_103613671 253
1642 3300013100 Ga0157373_10398631 Ga0157373_103986312 253
1643 3300013102 Ga0157371_10046460 Ga0157371_100464604 253
1644 3300013102 Ga0157371_10148481 Ga0157371_101484813 253
1645 3300013104 Ga0157370_10003005 Ga0157370_100030054 253
1646 3300013104 Ga0157370_10009864 Ga0157370_100098649 253
1647 3300013104 Ga0157370_10210385 Ga0157370_102103853 253
1648 3300013105 Ga0157369_10370628 Ga0157369_103706282 253
1649 3300013105 Ga0157369_10390047 Ga0157369_103900472 253
1650 3300013105 Ga0157369_10706311 Ga0157369_107063111 253
1651 3300013307 Ga0157372_10005944 Ga0157372_100059448 253
1652 3300013307 Ga0157372_10019732 Ga0157372_100197323 253
1653 3300013307 Ga0157372_10397239 Ga0157372_103972393 253
1654 3300013307 Ga0157372_10498585 Ga0157372_104985851 253
1655 3300013307 Ga0157372_10499535 Ga0157372_104995352 253
1656 3300020069 Ga0197907_10112819 Ga0197907_101128193 253
1657 3300020070 Ga0206356_11092931 Ga0206356_110929313 253
1658 3300020070 Ga0206356_11137881 Ga0206356_111378815 253
1659 3300020070 Ga0206356_11619311 Ga0206356_116193113 253
1660 3300020077 Ga0206351_10351414 Ga0206351_103514144 253
1661 3300020078 Ga0206352_10906711 Ga0206352_109067113 253
1662 3300020081 Ga0206354_10103479 Ga0206354_101034794 253
1663 3300020081 Ga0206354_11015677 Ga0206354_110156773 253
1664 3300020082 Ga0206353_10470642 Ga0206353_104706424 253
1665 3300020082 Ga0206353_10873698 Ga0206353_108736984 253
1666 3300020082 Ga0206353_11102501 Ga0206353_111025012 253
1667 3300025904 Ga0207647_10000610 Ga0207647_1000061013 253
1668 3300025904 Ga0207647_10018521 Ga0207647_100185214 253
1669 3300025907 Ga0207645_10122962 Ga0207645_101229622 253
1670 3300025909 Ga0207705_10003418 Ga0207705_100034188 253
1671 3300025909 Ga0207705_10013859 Ga0207705_100138593 253
1672 3300025909 Ga0207705_10067187 Ga0207705_100671873 253
1673 3300025909 Ga0207705_10179726 Ga0207705_101797262 253
1674 3300025911 Ga0207654_10089144 Ga0207654_100891442 253
1675 3300025912 Ga0207707_10000069 Ga0207707_1000006995 253
1676 3300025912 Ga0207707_10001014 Ga0207707_100010147 253
1677 3300025912 Ga0207707_10004786 Ga0207707_100047867 253
1678 3300025912 Ga0207707_10009538 Ga0207707_100095382 253
1679 3300025912 Ga0207707_10185756 Ga0207707_101857563 253
1680 3300025912 Ga0207707_10188585 Ga0207707_101885852 253
1681 3300025913 Ga0207695_10005621 Ga0207695_100056211 253
1682 3300025913 Ga0207695_10059150 Ga0207695_100591504 253
1683 3300025913 Ga0207695_10379157 Ga0207695_103791573 253
1684 3300025917 Ga0207660_10019459 Ga0207660_100194594 253
1685 3300025917 Ga0207660_10027109 Ga0207660_100271093 253
1686 3300025917 Ga0207660_10040839 Ga0207660_100408392 253
1687 3300025917 Ga0207660_10110909 Ga0207660_101109092 253
1688 3300025917 Ga0207660_10149308 Ga0207660_101493083 253
1689 3300025917 Ga0207660_10240301 Ga0207660_102403012 253
1690 3300025919 Ga0207657_10206205 Ga0207657_102062053 253
1691 3300025919 Ga0207657_10206256 Ga0207657_102062562 253
1692 3300025920 Ga0207649_10005305 Ga0207649_100053057 253
1693 3300025920 Ga0207649_10149653 Ga0207649_101496532 253
1694 3300025920 Ga0207649_10184626 Ga0207649_101846262 253
1695 3300025921 Ga0207652_10000394 Ga0207652_1000039432 253
1696 3300025921 Ga0207652_10010725 Ga0207652_100107254 253
1697 3300025921 Ga0207652_10026547 Ga0207652_100265474 253
1698 3300025921 Ga0207652_10055480 Ga0207652_100554803 253
1699 3300025921 Ga0207652_10199817 Ga0207652_101998172 253
1700 3300025924 Ga0207694_10063972 Ga0207694_100639723 253
1701 3300025932 Ga0207690_10001494 Ga0207690_100014944 253
1702 3300025932 Ga0207690_10002715 Ga0207690_100027152 253
1703 3300025932 Ga0207690_10019003 Ga0207690_100190035 253
1704 3300025933 Ga0207706_10095324 Ga0207706_100953243 253
1705 3300025944 Ga0207661_10084908 Ga0207661_100849083 253
1706 3300025944 Ga0207661_10246511 Ga0207661_102465112 253
1707 3300025945 Ga0207679_10312468 Ga0207679_103124682 253
1708 3300025949 Ga0207667_10018815 Ga0207667_100188157 253
1709 3300025949 Ga0207667_10092652 Ga0207667_100926522 253
1710 3300025949 Ga0207667_10126234 Ga0207667_101262342 253
1711 3300025949 Ga0207667_10249823 Ga0207667_102498233 253
1712 3300025949 Ga0207667_10249844 Ga0207667_102498442 253
1713 3300025981 Ga0207640_10006198 Ga0207640_100061986 253
1714 3300025981 Ga0207640_10008720 Ga0207640_100087204 253
1715 3300025981 Ga0207640_10011204 Ga0207640_100112044 253
1716 3300025981 Ga0207640_10038505 Ga0207640_100385053 253
1717 3300025981 Ga0207640_10267166 Ga0207640_102671663 253
1718 3300025986 Ga0207658_10156818 Ga0207658_101568183 253
1719 3300026041 Ga0207639_10003901 Ga0207639_100039015 253
1720 3300026041 Ga0207639_10006175 Ga0207639_100061753 253
1721 3300026041 Ga0207639_10034646 Ga0207639_100346464 253
1722 3300026041 Ga0207639_10238882 Ga0207639_102388822 253
1723 3300026067 Ga0207678_10032508 Ga0207678_100325084 253
1724 3300026067 Ga0207678_10043296 Ga0207678_100432964 253
1725 3300026067 Ga0207678_10303673 Ga0207678_103036732 253
1726 3300026078 Ga0207702_10005659 Ga0207702_100056594 253
1727 3300026078 Ga0207702_10032427 Ga0207702_100324274 253
1728 3300026088 Ga0207641_10150579 Ga0207641_101505792 253
1729 3300026116 Ga0207674_10171398 Ga0207674_101713983 253
1730 3300026116 Ga0207674_10213726 Ga0207674_102137262 253
1731 3300026116 Ga0207674_10311061 Ga0207674_103110613 253
1732 3300026118 Ga0207675_100275153 Ga0207675_1002751532 253
1733 3300026142 Ga0207698_10000529 Ga0207698_1000052912 253
1734 3300026142 Ga0207698_10010039 Ga0207698_100100394 253
1735 3300026142 Ga0207698_10099827 Ga0207698_100998273 253
1736 3300026142 Ga0207698_10362427 Ga0207698_103624271 253
1737 3300032002 Ga0307416_100045064 Ga0307416_1000450642 253
1738 3300037312 Ga0395899_0329021 Ga0395899_0329021_118_879 253
1739 3300037418 Ga0395900_0085695 Ga0395900_0085695_1562_2323 253
1740 3300037466 Ga0395898_0050876 Ga0395898_0050876_772_1533 253
1741 3300037466 Ga0395898_0614016 Ga0395898_0614016_141_908 253
1742 3300037471 Ga0395905_0159906 Ga0395905_0159906_504_1271 253
1743 3300038443 Ga0395901_0065745 Ga0395901_0065745_2279_3040 253
1744 3300038443 Ga0395901_0443936 Ga0395901_0443936_385_1152 253
1745 3300041452 Ga0451793_0077380 Ga0451793_0077380_46_825 253
1746 3300041509 Ga0451843_0137728 Ga0451843_0137728_126_953 253
1747 3300046539 Ga0495621_0023410 Ga0495621_0023410_389_1159 253
1748 3300046615 Ga0495656_0049079 Ga0495656_0049079_102_872 253
1749 3300047472 Ga0495686_0089278 Ga0495686_0089278_53_835 253
1750 3300048904 Ga0496101_0283596 Ga0496101_0283596_54_824 253
1751 3300048909 Ga0496106_0076000 Ga0496106_0076000_791_1561 253
1752 3300048920 Ga0496117_0011079 Ga0496117_0011079_1610_2401 253
1753 3300048921 Ga0496118_0004070 Ga0496118_0004070_875_1666 253
1754 3300049569 Ga0501032_0153567 Ga0501032_0153567_489_1250 253
1755 3300049570 Ga0501033_0186760 Ga0501033_0186760_365_1126 253
1756 3300049571 Ga0501034_0183306 Ga0501034_0183306_898_1674 253
1757 3300049571 Ga0501034_0331371 Ga0501034_0331371_382_1143 253
1758 3300049571 Ga0501034_0727426 Ga0501034_0727426_43_816 253
1759 3300049572 Ga0501036_0045145 Ga0501036_0045145_2700_3461 253
1760 3300049579 Ga0501043_0447378 Ga0501043_0447378_90_851 253
1761 3300049581 Ga0501047_0007229 Ga0501047_0007229_9255_10016 253
1762 3300049581 Ga0501047_0034066 Ga0501047_0034066_937_1698 253
1763 3300049581 Ga0501047_0057135 Ga0501047_0057135_592_1353 253
1764 3300049585 Ga0501069_0008287 Ga0501069_0008287_2901_3662 253
1765 3300049585 Ga0501069_0009860 Ga0501069_0009860_1741_2502 253
1766 3300049585 Ga0501069_0026830 Ga0501069_0026830_1676_2437 253
1767 3300049585 Ga0501069_0359915 Ga0501069_0359915_25_786 253
1768 3300049586 Ga0501070_0000588 Ga0501070_0000588_1135_1896 253
1769 3300049586 Ga0501070_0003969 Ga0501070_0003969_3938_4699 253
1770 3300049586 Ga0501070_0020658 Ga0501070_0020658_725_1486 253
1771 3300049586 Ga0501070_0063480 Ga0501070_0063480_198_959 253
1772 3300049586 Ga0501070_0261498 Ga0501070_0261498_538_1299 253
1773 3300049586 Ga0501070_0341362 Ga0501070_0341362_183_944 253
1774 3300049587 Ga0501071_0205135 Ga0501071_0205135_387_1148 253
1775 3300049589 Ga0501073_0037122 Ga0501073_0037122_2243_3004 253
1776 3300049589 Ga0501073_0051652 Ga0501073_0051652_1861_2622 253
1777 3300049590 Ga0501074_0004544 Ga0501074_0004544_459_1220 253
1778 3300049590 Ga0501074_0013181 Ga0501074_0013181_2117_2878 253
1779 3300049742 Ga0501080_0005078 Ga0501080_0005078_1995_2756 253
1780 3300049742 Ga0501080_0009813 Ga0501080_0009813_2451_3212 253
1781 3300049822 Ga0501035_0004686 Ga0501035_0004686_4526_5287 253
1782 3300049822 Ga0501035_0011530 Ga0501035_0011530_5741_6502 253
1783 3300049822 Ga0501035_0059213 Ga0501035_0059213_1850_2611 253
1784 3300049822 Ga0501035_0310314 Ga0501035_0310314_409_1170 253
1785 3300049823 Ga0501044_0010264 Ga0501044_0010264_2944_3705 253
1786 3300049823 Ga0501044_0030778 Ga0501044_0030778_4448_5209 253
1787 3300053079 Ga0500610_0013261 Ga0500610_0013261_573_1373 253
1788 3300054114 Ga0501084_0315743 Ga0501084_0315743_400_1161 253

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01746

tRNA_m1G_MT

tRNA (Guanine-1)-methyltransferase

55

254

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
4yvg-assembly1.cif.gz_A crystal structure of h. influenzae trmd in complex with adomet 0.9767 1 245
4yvk-assembly1.cif.gz_A crystal structure of h. influenzae trmd in complex with sinefungin and trna variant (g36c) 0.9753 1 244
1uak-assembly1.cif.gz_A crystal structure of trna(m1g37)methyltransferase: insight into trna recognition 0.9751 1 246
4ypx-assembly1.cif.gz_A-2 crystal structure of trmd, a m1g37 trna methyltransferase with sam-competitive compounds 0.9739 1 244
5wyq-assembly1.cif.gz_B crystal structure and catalytic mechanism of the essential m1g37 trna methyltransferase trmd from pseudomonas aeruginosa 0.973 2 244
ID Description Score Start End Superfamily
af_P0A873_166_255_1.10.1270.20 Mainly Alpha;Orthogonal Bundle;Trp Operon Repressor; Chain A;tRNA(m1g37)methyltransferase, domain 2 0.9934 167 252 1.10.1270.20
5wyqB02 Mainly Alpha;Orthogonal Bundle;Trp Operon Repressor; Chain A;tRNA(m1g37)methyltransferase, domain 2 0.9789 170 244 1.10.1270.20
5wyrA01 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.9764 1 162 3.40.1280.10
5wyrA02 Mainly Alpha;Orthogonal Bundle;Trp Operon Repressor; Chain A;tRNA(m1g37)methyltransferase, domain 2 0.9762 169 242 1.10.1270.20
5zhlA02 Mainly Alpha;Orthogonal Bundle;Trp Operon Repressor; Chain A;tRNA(m1g37)methyltransferase, domain 2 0.9735 175 223 1.10.1270.20
ID Description Score Start End GO Terms
AF-A0A2Z7C629-F1-model_v4 tRNA (guanine-N(1)-)-methyltransferase (EC 2.1.1.228) (M1G-methyltransferase) (tRNA [GM37] methyltransferase) 0.9913 19 234 GO:0002939
GO:0003735
GO:0005829
GO:0005840
GO:0006364
GO:0006412
GO:0043022
GO:0052906
GO:1990904
AF-A0A6I7WYU9-F1-model_v4 tRNA (guanine-N(1)-)-methyltransferase (EC 2.1.1.228) (M1G-methyltransferase) (tRNA [GM37] methyltransferase) 0.9907 1 246 GO:0002939
GO:0005829
GO:0052906
AF-A0A0J7YLT4-F1-model_v4 tRNA (guanine-N(1)-)-methyltransferase (EC 2.1.1.228) (M1G-methyltransferase) (tRNA [GM37] methyltransferase) 0.9905 43 250 GO:0002939
GO:0003735
GO:0005829
GO:0005840
GO:0006412
GO:0052906
GO:1990904
AF-A0A259FH75-F1-model_v4 tRNA (guanine-N(1)-)-methyltransferase (EC 2.1.1.228) (M1G-methyltransferase) (tRNA [GM37] methyltransferase) 0.989 1 226 GO:0002939
GO:0005829
GO:0052906
AF-A0A2P5T1L2-F1-model_v4 tRNA (guanine-N(1)-)-methyltransferase (EC 2.1.1.228) (M1G-methyltransferase) (tRNA [GM37] methyltransferase) 0.9888 1 245 GO:0002939
GO:0005829
GO:0052906

Feature Viewer

pLDDT pTM Quality
92.83 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map