F495694

General Info

Members Datasets Scaffolds Average Seq Length
1785 861 1462 380

Family's Representative Sequence

Representative Sequence 3300037471|Ga0395905_0000106|Ga0395905_0000106_132604_133914
Length 436
Sequence MQAAVLLALAAWRADGVVDERFGHGFLRRKTQYIHFTKRTLGKNLAGDTMIERTLFTPDHEAFRDAFRRFVDKEIAPHHDAWEEQGYIDRELWRKAGANGFLCMTLPEEYGGSGADKLYSVVQMEELARGNYTGVGFGLHSEIVAPYILHYGTDEQKRRWLPRLASGEMIGAIAMSEPAAGSDLQGIKTTAIRQPDGSYLVNGSKTFITNGWHADLVVVVAKTDPQAGAKGTSLVVVERGMKGFEKGQRLKKVGLKAQDTSELFFDNVRVPAGNLLGGAAFENQGFVCLMEQLPWERMQIAVTAIASAQAAIDWTLAYTKDRKVFGQSVASFQNTRYTLAELQTEVQIGRVFVDKCLELVCAGKLDTATASMAKYWTTDLQCKVMDECVQLHGGYGYMWEYPVARAYADARVQRIYGGTNEIMKEVITRAMGIGGR

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
3 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
4 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
5 2511231004 Pseudomonas sp. GM102 Isolate Nodule
6 2511231006 Pseudomonas sp. GM17 Isolate Nodule
7 2511231007 Pseudomonas sp. GM18 Isolate Nodule
8 2511231008 Pseudomonas sp. GM21 Isolate Nodule
9 2511231010 Pseudomonas sp. GM25 Isolate Nodule
10 2511231011 Pseudomonas sp. GM30 Isolate Nodule
11 2511231012 Pseudomonas sp. GM33 Isolate Nodule
12 2511231014 Pseudomonas sp. GM48 Isolate Nodule
13 2511231015 Pseudomonas sp. GM49 Isolate Nodule
14 2511231016 Pseudomonas sp. GM50 Isolate Nodule
15 2511231017 Pseudomonas sp. GM55 Isolate Nodule
16 2511231018 Pseudomonas sp. GM60 Isolate Nodule
17 2511231019 Pseudomonas sp. GM67 Isolate Nodule
18 2511231020 Pseudomonas sp. GM74 Isolate Nodule
19 2511231021 Pseudomonas sp. GM78 Isolate Nodule
20 2511231022 Pseudomonas sp. GM79 Isolate Nodule
21 2511231023 Pseudomonas sp. GM80 Isolate Nodule
22 2511231031 Pseudomonas sp. GM16 Isolate Nodule
23 2511231156 Pseudomonas ogarae F113 Isolate Rhizosphere
24 2512047018 Pseudomonas chlororaphis chlororaphis GP72 Isolate Rhizosphere
25 2547132374 Acidovorax radicis N35 Isolate Unclassified
26 2547132424 Nocardia nova SH22a Isolate Unclassified
27 2554235132 Pseudomonas aeruginosa PGPR2 Isolate Unclassified
28 2554235341 Pseudomonas protegens CHA0 Isolate Rhizosphere
29 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
30 2582581279 Caulobacter henricii OK261 Isolate Rhizosphere
31 2585428106 Caulobacter sp. OV484 Isolate Rhizosphere
32 2597489887 Pseudomonas chlororaphis aureofaciens 30-84 Isolate Rhizosphere
33 2597489888 Pseudomonas fluorescens SS101 Isolate Rhizosphere
34 2599185160 Pseudomonas sp. NFPP25 Isolate Rhizoplane
35 2599185161 Pseudomonas sp. NFPP09 Isolate Rhizoplane
36 2599185162 Pseudomonas sp. NFPP10 Isolate Rhizoplane
37 2599185163 Pseudomonas sp. NFPP12 Isolate Rhizoplane
38 2599185164 Pseudomonas sp. NFPP13 Isolate Rhizoplane
39 2599185165 Pseudomonas sp. NFPP18 Isolate Rhizoplane
40 2599185166 Pseudomonas sp. NFPP08 Isolate Rhizoplane
41 2599185168 Pseudomonas sp. NFPP05 Isolate Rhizoplane
42 2599185181 Pseudomonas sp. NFPP17 Isolate Rhizoplane
43 2599185182 Pseudomonas sp. NFPP19 Isolate Rhizoplane
44 2599185185 Pseudomonas sp. NFPP07 Isolate Rhizoplane
45 2599185186 Pseudomonas sp. NFPP15 Isolate Rhizoplane
46 2599185188 Pseudomonas sp. NFACC45 Isolate Rhizoplane
47 2599185189 Pseudomonas sp. NFPP02 Isolate Rhizoplane
48 2599185190 Pseudomonas sp. NFPP04 Isolate Rhizoplane
49 2599185212 Pseudomonas sp. NFACC15-1 Isolate Rhizoplane
50 2599185248 Pseudomonas sp. NFACC08-1 Isolate Rhizoplane
51 2599185257 Pseudomonas sp. NFACC41-3 Isolate Rhizoplane
52 2599185288 Pseudomonas sp. NFACC25 Isolate Rhizoplane
53 2599185289 Pseudomonas sp. NFACC51 Isolate Rhizoplane
54 2599185290 Pseudomonas sp. NFPP11 Isolate Rhizoplane
55 2599185291 Pseudomonas sp. NFACC48-1 Isolate Rhizoplane
56 2599185300 Pseudomonas sp. NFACC39-1 Isolate Rhizoplane
57 2599185302 Pseudomonas sp. NFACC43 Isolate Rhizoplane
58 2599185303 Pseudomonas sp. NFACC42-2 Isolate Rhizoplane
59 2599185304 Pseudomonas sp. NFACC47-1 Isolate Rhizoplane
60 2599185305 Pseudomonas sp. NFACC07-1 Isolate Rhizoplane
61 2599185306 Pseudomonas sp. NFACC16-2 Isolate Rhizoplane
62 2599185308 Pseudomonas sp. NFACC17-2 Isolate Rhizoplane
63 2599185309 Pseudomonas sp. NFACC49-2 Isolate Rhizoplane
64 2599185310 Pseudomonas sp. NFACC09-4 Isolate Rhizoplane
65 2599185311 Pseudomonas sp. NFACC04-2 Isolate Rhizoplane
66 2599185312 Pseudomonas sp. NFACC32-1 Isolate Rhizoplane
67 2599185313 Pseudomonas sp. NFACC05-1 Isolate Rhizoplane
68 2599185314 Pseudomonas sp. NFACC23-1 Isolate Rhizoplane
69 2599185315 Pseudomonas sp. NFACC44-2 Isolate Rhizoplane
70 2599185316 Pseudomonas sp. NFACC52 Isolate Rhizoplane
71 2599185317 Pseudomonas sp. NFACC06-1 Isolate Rhizoplane
72 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
73 2599185320 Pseudomonas sp. NFACC36 Isolate Rhizoplane
74 2599185321 Pseudomonas sp. NFACC54 Isolate Rhizoplane
75 2599185322 Pseudomonas sp. NFACC14 Isolate Rhizoplane
76 2599185323 Pseudomonas sp. NFACC37-1 Isolate Rhizoplane
77 2599185324 Pseudomonas sp. NFACC46-3 Isolate Rhizoplane
78 2599185325 Pseudomonas sp. NFACC56-3 Isolate Rhizoplane
79 2599185356 Pseudomonas sp. NFPP14 Isolate Rhizoplane
80 2600254930 Pseudomonas sp. NFIX10 Isolate Rhizoplane
81 2600254931 Pseudomonas sp. NFIX28 Isolate Rhizoplane
82 2600254954 Pseudomonas sp. NFACC19-2 Isolate Rhizoplane
83 2600255283 Pseudomonas sp. NFR16 Isolate Rhizoplane
84 2600255296 Pseudomonas sp. NFR02 Isolate Rhizoplane
85 2600255313 Pseudomonas sp. NFPP16 Isolate Rhizoplane
86 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
87 2600255389 Pseudomonas sp. NFPP33 Isolate Rhizoplane
88 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
89 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
90 2606217733 Pseudomonas aeruginosa NFHH01 Isolate Rhizoplane
91 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
92 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
93 2643221541 Sphingomonas sp. Root50 Isolate Unclassified
94 2643221565 Pseudomonas sp. Root562 Isolate Unclassified
95 2643221570 Acidovorax sp. Root568 Isolate Unclassified
96 2643221589 Pseudomonas sp. Root68 Isolate Unclassified
97 2643221596 Acidovorax sp. Root70 Isolate Unclassified
98 2643221602 Pseudomonas sp. Root71 Isolate Unclassified
99 2643221604 Nocardioides sp. Root190 Isolate Unclassified
100 2643221606 Sphingomonas sp. Root720 Isolate Unclassified
101 2643221609 Acidovorax sp. Root217 Isolate Unclassified
102 2643221611 Acidovorax sp. Root219 Isolate Unclassified
103 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
104 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
105 2643221640 Caulobacter sp. Root342 Isolate Unclassified
106 2643221642 Caulobacter sp. Root343 Isolate Unclassified
107 2643221645 Massilia sp. Root351 Isolate Unclassified
108 2643221650 Pseudomonas sp. Root401 Isolate Unclassified
109 2643221652 Acidovorax sp. Root402 Isolate Unclassified
110 2643221658 Variovorax sp. Root411 Isolate Unclassified
111 2643221664 Massilia sp. Root418 Isolate Unclassified
112 2643221671 Sphingomonas sp. Root1294 Isolate Unclassified
113 2643221683 Variovorax sp. Root473 Isolate Unclassified
114 2643221713 Pseudomonas sp. Root9 Isolate Unclassified
115 2643221714 Streptomyces sp. Root264 Isolate Unclassified
116 2643221717 Acidovorax sp. Root267 Isolate Unclassified
117 2651869719 Genome Sequence of Pseudomonas fluorescens UM270 Isolate Rhizosphere
118 2667528170 Pseudomonas sp. NFACC50-1 Isolate Rhizoplane
119 2667528171 Pseudomonas sp. NFPP22 Isolate Rhizoplane
120 2667528176 Pseudomonas sp. NFACC11-2 Isolate Rhizoplane
121 2671180172 Pseudomonas sp. NFIX51 Isolate Rhizoplane
122 2671180195 Frankia sp. CcI49 Isolate Nodule
123 2675903420 Pseudomonas fluorescens Ps006 Isolate Unclassified
124 2675903515 Pseudomonas thivervalensis DSM 13194 Isolate Unclassified
125 2713897148 Pseudomonas fluorescens SF39a Isolate Rhizosphere
126 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
127 2718217725 Pseudomonas fluorescens CREA-C16 Isolate Rhizosphere
128 2721755607 Pseudomonas fluorescens Pt14 Isolate Rhizosphere
129 2738541280 Massilia sp. GV090 Isolate Unclassified
130 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
131 2738541300 Massilia sp. GV016 Isolate Unclassified
132 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
133 2738543004 Pseudomonas sp. GV085 Isolate Unclassified
134 2738543012 Acidovorax sp. CF301 Isolate Unclassified
135 2738543013 Variovorax sp. BT01 Isolate Unclassified
136 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
137 2738543018 Massilia sp. GV045 Isolate Unclassified
138 2738543025 Pseudomonas sp. GV091 Isolate Unclassified
139 2738543030 Massilia sp. GV097 Isolate Unclassified
140 2739367653 Kocuria sp. OV113 Isolate Unclassified
141 2740892503 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
142 2744054611 Aldersonia kunmingensis DSM 45001 Isolate Rhizosphere
143 2744054620 Pseudomonas thivervalensis LMG 21626 Isolate Unclassified
144 2772190715 Micromonospora chokoriensis NRRL B-24750 Isolate Unclassified
145 2773857670 Pseudomonas sp. 478 Isolate Unclassified
146 2773857673 Pseudomonas sp. 443 Isolate Unclassified
147 2773857922 Frankia sp. CcI49 Isolate Nodule
148 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
149 2784132063 Pseudomonas sp. 424 Isolate Unclassified
150 2784132072 Pseudomonas sp. 460 Isolate Unclassified
151 2784132109 Dermacoccus sp. DS28 SAI-028 Isolate Unclassified
152 2791355048 Caulobacter flavus CGMCC1 15093 Isolate Rhizosphere
153 2791355199
154 2791355520 Pseudomonas sp. s211(2017) Isolate Unclassified
155 2808606361 Pseudomonas sp. SJZ075 Isolate Rhizosphere
156 2808606365 Phycicoccus sp. SLBN-51 Isolate Unclassified
157 2808606376 Pseudomonas sp. SJZ074 Isolate Rhizosphere
158 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
159 2808606378 Pseudomonas sp. SJZ078 Isolate Rhizosphere
160 2808606379 Pseudomonas sp. SJZ079 Isolate Rhizosphere
161 2808606380 Pseudomonas sp. SJZ085 Isolate Rhizosphere
162 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
163 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
164 2808606383 Pseudomonas sp. SJZ124 Isolate Rhizosphere
165 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
166 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
167 2808606389 Pseudomonas sp. SJZ101 Isolate Rhizosphere
168 2808606445 Pseudomonas sp. SJZ131 Isolate Rhizosphere
169 2811994881 Pseudomonas sp. SLBN-26 Isolate Unclassified
170 2816332133 Acidovorax radicis 2721A Isolate Unclassified
171 2816332139 Pseudonocardia kunmingensis DSM 45301 Isolate Unclassified
172 2816332305 Kocuria rhizophila FDAARGOS_302 Isolate Rhizosphere
173 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
174 2818991464 Pseudomonas protegens 3295 Isolate Rhizosphere
175 2823421272 Pseudomonas mendocina S5.2 Isolate Rhizoplane
176 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
177 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
178 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
179 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
180 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
181 2825651385 Pseudomonas brassicacearum L13-6-12 Isolate Rhizosphere
182 2834028612 Pseudomonas fluorescens 513 Isolate Unclassified
183 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
184 2842677519 Variovorax sp. R-72495 Isolate Unclassified
185 2842826826 Pseudomonas sp. R-72172 Isolate Unclassified
186 2842832357 Pseudomonas sp. R-72164 Isolate Unclassified
187 2842837860 Pseudomonas sp. R-72102 Isolate Unclassified
188 2842843487 Pseudomonas sp. R-72074 Isolate Unclassified
189 2842854478 Pseudomonas sp. R-71998 Isolate Unclassified
190 2843744320 Caulobacter flavus RHGG3 Isolate Unclassified
191 2844665904 Pseudomonas protegens H1F10C Isolate Unclassified
192 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
193 2849560528 Caulobacter zeae 410 Isolate Unclassified
194 2851153111 Caulobacter radicis 736 Isolate Unclassified
195 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
196 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
197 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
198 2855670206 Micromonospora noduli Lupac 07 Isolate Nodule
199 2855676851 Micromonospora saelicesensis GAR05 Isolate Unclassified
200 2857288857 Micromonospora noduli ONO23 Isolate Unclassified
201 2857504554 Caulobacter sp. R-72291 Isolate Unclassified
202 2857727296 Kocuria sp. R-72562 Isolate Unclassified
203 2858848962 Micromonospora saelicesensis GAR06 Isolate Unclassified
204 2858882152 Micromonospora noduli MED15 Isolate Nodule
205 2858888857 Micromonospora saelicesensis Lupac 06 Isolate Unclassified
206 2858895516 Micromonospora saelicesensis PSN13 Isolate Unclassified
207 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
208 2860867994 Pseudomonas sp. R1-43-08 Isolate Rhizosphere
209 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
210 2867302475 Micromonospora globbae WPS1-2 Isolate Unclassified
211 2867312974 Micromonospora musae NGC1-4 Isolate Unclassified
212 2867319477 Micromonospora musae MS1-9 Isolate Unclassified
213 2869048445 Micromonospora saelicesensis PSN01 Isolate Unclassified
214 2869061728 Micromonospora noduli ONO86 Isolate Unclassified
215 2869068681 Micromonospora noduli GUI43 Isolate Unclassified
216 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
217 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
218 2880489317 Micromonospora ureilytica DSM 101692 Isolate Unclassified
219 2880495981 Micromonospora vinacea DSM 101695 Isolate Unclassified
220 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
221 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
222 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
223 2898329390 Caulobacter sp. 602-2 Isolate Rhizosphere
224 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
225 2904456579 Variovorax sp. 2002 Isolate Unclassified
226 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
227 2904550169 Stutzerimonas stutzeri 1099 Isolate Rhizosphere
228 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
229 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
230 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
231 2913036834 Pseudomonas viciae 11K1 Isolate Rhizosphere
232 2916699645 Acinetobacter ursingii M3 Isolate Unclassified
233 2917070673 Pseudomonas protegens CHA0 Isolate Rhizosphere
234 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
235 2919385768 Pseudomonas sp. 2957 Isolate Unclassified
236 2919446982 Phycicoccus sp. 3266 Isolate Rhizosphere
237 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
238 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
239 2919481497 Pseudomonas brassicacearum 3432 Isolate Unclassified
240 2919487758 Pseudomonas koreensis 3441 Isolate Unclassified
241 2919501602 Pseudomonas alcaliphila 3512 Isolate Unclassified
242 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
243 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
244 2919713450 Nocardia kruczakiae 4272 Isolate Rhizosphere
245 2923153595 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
246 2923519811 Pseudomonas otitidis SLBN-103 Isolate Rhizosphere
247 2923586266 Pseudomonas fluorescens 1550 Isolate Rhizosphere
248 2926063275 Pseudomonas sp. 3400 Isolate Unclassified
249 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere
250 2929144301 Pseudomonas sp. R-71838 Hybrid assembly Isolate Unclassified
251 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
252 2929219909 Micromonospora sp. R-75348 Hybrid assembly Isolate Unclassified
253 2929226422 Micromonospora sp. R-74116 Hybrid assembly Isolate Unclassified
254 2929520902 Variovorax beijingensis 502 Isolate Unclassified
255 2931369376 Pseudomonas fluorescens DR133 Isolate Rhizosphere
256 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
257 2935353572 Pseudomonas protegens TECH19 Isolate Unclassified
258 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
259 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
260 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
261 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
262 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
263 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
264 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
265 2939636861 Pseudomonas sp. 2725 Isolate Rhizosphere
266 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
267 2945928738 Pseudomonas cedrina W1I11 Isolate Rhizosphere
268 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
269 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
270 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
271 2969304461 Pseudomonas sp. R84 Isolate Rhizosphere
272 2974289157 Pseudomonas fluorescens SORGH_AS 191 Isolate Unclassified
273 2984286254 Pseudomonas chlororaphis aurantiaca JD37 Isolate Rhizosphere
274 2984568884 Acinetobacter baylyi SORGH_AS893 Isolate Aerial Root
275 2988728565 Pseudomonas corrugata RM1-1-4 Isolate Rhizosphere
276 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere
277 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
278 3007395558 Pseudomonas chlororaphis PCL1601 Isolate Rhizosphere
279 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
280 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
281 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
282 3007855910 Pseudomonas khorasanensis SWRI153 Isolate Rhizosphere
283 3007861166 Pseudomonas hamedanensis SWRI65 Isolate Rhizosphere
284 3007866637 Pseudomonas marvdashtae SWRI102 Isolate Rhizosphere
285 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
286 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
287 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
288 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
289 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
290 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
291 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
292 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
293 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
294 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
295 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
296 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
297 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
298 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
299 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
300 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
301 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
302 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
303 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
304 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
305 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
306 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
307 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
308 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
309 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
310 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
311 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
312 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
313 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
314 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
315 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
316 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
317 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
318 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
319 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
320 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
321 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
322 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
323 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
324 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
325 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
326 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
327 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
328 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
329 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
330 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
331 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
332 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
333 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
334 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
335 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
336 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
337 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
338 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
339 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
340 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
341 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
342 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
343 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
344 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
345 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
346 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
347 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
348 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
349 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
350 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
351 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
352 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
353 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
354 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
355 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
356 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
357 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
358 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
359 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
360 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
361 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
362 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
363 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
364 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
365 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
366 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
367 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
368 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
369 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
370 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
371 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
372 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
373 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
374 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
375 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
376 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
377 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
378 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
379 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
380 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
381 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
382 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
383 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
384 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
385 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
386 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
387 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
388 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
389 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
390 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
391 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
392 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
393 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
394 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
395 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
396 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
397 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
398 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
399 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
400 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
401 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
402 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
403 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
404 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
405 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
406 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
407 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
408 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
409 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
410 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
411 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
412 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
413 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
414 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
415 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
416 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
417 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
418 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
419 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
420 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
421 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
422 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
423 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
424 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
425 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
426 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
427 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
428 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
429 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
430 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
431 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
432 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
433 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
434 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
435 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
436 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
437 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
438 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
439 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
440 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
441 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
442 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
443 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
444 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
445 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
446 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
447 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
448 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
449 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
450 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
451 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
452 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
453 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
454 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
455 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
456 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
457 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
458 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
459 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
460 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
461 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
462 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
463 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
464 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
465 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
466 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
467 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
468 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
469 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
470 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
471 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
472 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
473 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
474 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
475 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
476 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
477 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
478 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
479 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
480 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
481 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
482 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
483 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
484 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
485 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
486 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
487 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
488 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
489 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
490 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
491 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
492 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
493 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
494 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
495 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
496 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
497 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
498 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
499 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
500 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
501 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
502 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
503 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
504 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
505 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
506 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
507 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
508 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
509 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
510 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
511 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
512 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
513 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
514 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
515 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
516 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
517 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
518 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
519 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
520 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
521 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
522 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
523 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
524 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
525 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
526 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
527 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
528 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
529 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
530 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
531 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
532 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
533 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
534 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
535 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
536 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
537 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
538 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
539 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
540 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
541 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
542 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
543 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
544 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
545 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
546 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
547 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
548 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
549 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
550 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
551 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
552 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
553 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
554 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
555 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
556 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
557 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
558 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
559 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
560 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
561 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
562 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
563 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
564 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
565 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
566 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
567 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
568 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
569 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
570 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
571 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
572 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
573 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
574 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
575 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
576 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
577 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
578 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
579 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
580 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
581 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
582 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
583 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
584 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
585 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
586 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
587 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
588 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
589 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
590 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
591 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
592 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
593 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
594 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
595 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
596 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
597 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
598 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
599 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
600 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
601 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
602 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
603 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
604 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
605 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
606 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
607 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
608 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
609 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
610 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
611 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
612 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
613 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
614 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
615 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
616 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
617 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
618 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
619 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
620 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
621 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
622 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
623 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
624 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
625 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
626 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
627 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
628 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
629 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
630 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
631 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
632 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
633 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
634 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
635 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
636 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
637 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
638 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
639 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
640 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
641 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
642 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
643 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
644 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
645 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
646 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
647 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
648 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
649 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
650 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
651 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
652 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
653 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
654 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
655 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
656 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
657 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
658 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
659 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
660 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
661 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
662 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
663 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
664 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
665 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
666 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
667 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
668 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
669 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
670 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
671 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
672 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
673 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
674 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
675 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
676 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
677 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
678 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
679 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
680 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
681 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
682 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
683 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
684 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
685 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
686 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
687 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
688 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
689 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
690 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
691 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
692 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
693 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
694 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
695 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
696 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
697 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
698 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
699 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
700 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
701 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
702 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
703 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
704 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
705 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
706 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
707 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
708 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
709 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
710 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
711 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
712 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
713 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
714 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
715 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
716 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
717 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
718 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
719 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
720 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
721 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
722 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
723 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
724 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
725 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
726 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
727 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
728 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
729 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
730 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
731 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
732 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
733 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
734 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
735 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
736 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
737 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
738 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
739 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
740 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
741 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
742 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
743 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
744 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
745 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
746 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
747 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
748 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
749 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
750 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
751 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
752 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
753 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
754 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
755 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
756 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
757 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
758 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
759 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
760 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
761 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
762 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
763 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
764 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
765 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
766 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
767 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
768 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
769 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
770 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
771 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
772 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
773 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
774 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
775 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
776 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
777 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
778 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
779 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
780 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
781 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
782 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
783 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
784 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
785 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
786 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
787 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
788 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
789 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
790 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
791 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
792 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
793 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
794 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
795 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
796 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
797 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
798 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
799 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
800 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
801 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
802 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
803 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
804 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
805 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
806 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
807 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
808 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
809 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
810 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
811 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
812 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
813 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
814 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
815 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
816 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
817 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
818 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
819 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
820 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
821 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
822 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
823 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
824 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
825 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
826 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
827 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
828 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
829 637000220 Pseudomonas protegens Pf-5 Isolate Rhizoplane
830 8002775197 Frankia nepalensis CN7 Isolate Nodule
831 8002784119 Frankia sp. AgB1.9 Isolate Nodule
832 8003830390 Micromonospora parastrephiae STR1_7 Isolate Rhizosphere
833 8003870546 Micromonospora tarensis STR1s_6 Isolate Rhizosphere
834 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
835 8011350971 Pseudomonas sp. 30_B Isolate Rhizosphere
836 8015687852 Pseudomonas chlororaphis aurantiaca RP4 Isolate Rhizosphere
837 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
838 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
839 8019769354 Pseudomonas sp. MSSRFD41 Isolate Rhizosphere
840 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
841 8029995093 Pseudomonas atacamensis SM1 Isolate Rhizosphere
842 8034962539 Pseudomonas sediminis PI11 Isolate Rhizosphere
843 8054347763 Pseudomonas carnis NWU Be30 Isolate Unclassified
844 8054503363 Pseudomonas sivasensis BsEB-1 Isolate Unclassified
845 8054704163 Micromonospora trifolii NIE79 Isolate Nodule
846 8054727385 Micromonospora alfalfae MED01 Isolate Nodule
847 8054734606 Micromonospora hortensis NIE111 Isolate Nodule
848 8055770955 Pseudomonas chlororaphis qlu-1 Isolate Rhizosphere
849 8055817908 Pseudomonas pergaminensis 1008 Isolate Rhizosphere
850 8056125926 Pseudomonas azerbaijanorientalis SWRI123 Isolate Rhizosphere
851 8056131705 Pseudomonas asgharzadehiana SWRI132 Isolate Rhizosphere
852 8056143049 Pseudomonas alvandae SWRI17 Isolate Rhizosphere
853 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere
854 8056161164 Pseudomonas azadiae SWRI103 Isolate Rhizosphere
855 8056166840 Pseudomonas triticicola SWRI88 Isolate Rhizosphere
856 8056172158 Pseudomonas ekonensis COR58 Isolate Rhizosphere
857 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere
858 8056569372 Pseudomonas serboccidentalis IT-P374 Isolate Rhizosphere
859 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
860 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule
861 8057798959 Pseudomonas piscis BW16M1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 81.5
Metatranscriptomes 0.5
Isolates 17.99

Biome Distribution

Category Percentage (%)
Aerial Root 0.06
Bulb 0
Endosphere 12.27
Nodule 2.97
Rhizoplane 5.21
Rhizosphere 66.95
Stem 0
Stem Tuber 0
Unclassified 12.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_3359380 2162886007 Bacteria 4051
2 SwRhRL2b_contig_451342 2162886007 Bacteria 1539
3 JGI24739J22299_10027560 3300001989 Bacteria 1985
4 JGI24738J21930_10013006 3300002075 Bacteria 1808
5 JGI25155J39150_1000002 3300002704 Bacteria 292156
6 JGI25156J39149_1000003 3300002705 Bacteria 305434
7 JGI25162J39368_1000194 3300002737 Bacteria 63841
8 JGI25162J39368_1000671 3300002737 Bacteria 24136
9 JGI25154J39366_1000009 3300002738 Bacteria 305408
10 JGI25157J39369_1000002 3300002741 Bacteria 305434
11 JGI25163J39215_1000690 3300002771 Bacteria 8910
12 JGI25163J39215_1001497 3300002771 Bacteria 3723
13 JGI25164J39214_1000160 3300002772 Bacteria 63841
14 JGI25164J39214_1000417 3300002772 Bacteria 24136
15 JGI25150J39212_1004255 3300002774 Bacteria 3211
16 JGI25150J39212_1005462 3300002774 Bacteria 2709
17 JGI25159J45721_1001036 3300002987 Bacteria 11877
18 JGI25159J45721_1012731 3300002987 Bacteria 1988
19 JGI25151J46595_10009599 3300003187 Bacteria 4566
20 JGI25165J46597_1000290 3300003214 Bacteria 63841
21 JGI25165J46597_1000470 3300003214 Bacteria 39839
22 JGI25165J46597_1000770 3300003214 Bacteria 24485
23 JGI25153J46596_10037698 3300003215 Bacteria 1533
24 rootH2_10012126 3300003320 Bacteria 23852
25 rootH1_10147960 3300003323 Bacteria 8308
26 JGI25160J50197_1000305 3300003354 Bacteria 34747
27 JGI25161J50226_1000018 3300003374 Bacteria 172599
28 Ga0055538_1000036 3300003751 Bacteria 190579
29 Ga0055539_1000047 3300003752 Bacteria 190579
30 Ga0055533_1000058 3300003756 Bacteria 190579
31 Ga0055532_1000087 3300003758 Bacteria 107251
32 Ga0055525_1000209 3300003759 Bacteria 65994
33 Ga0055535_1003122 3300003761 Bacteria 4974
34 Ga0055537_1000127 3300003773 Bacteria 58289
35 Ga0055536_1002216 3300003781 Bacteria 11061
36 Ga0055536_1004611 3300003781 Bacteria 6982
37 Ga0055536_1004659 3300003781 Bacteria 6932
38 Ga0055536_1004690 3300003781 Bacteria 6890
39 Ga0055534_1000340 3300003784 Bacteria 30297
40 Ga0055534_1005703 3300003784 Bacteria 3278
41 Ga0055528_1001503 3300003790 Bacteria 14133
42 Ga0055530_10001779 3300003791 Bacteria 14985
43 Ga0055530_10004594 3300003791 Bacteria 7037
44 Ga0055530_10005180 3300003791 Bacteria 6346
45 Ga0055540_1001314 3300003792 Bacteria 14985
46 Ga0055540_1002441 3300003792 Bacteria 9802
47 Ga0055540_1003847 3300003792 Bacteria 7045
48 Ga0055540_1005246 3300003792 Bacteria 5527
49 Ga0055540_1009711 3300003792 Bacteria 3288
50 Ga0055531_10000348 3300003794 Bacteria 45293
51 Ga0055531_10001138 3300003794 Bacteria 20582
52 Ga0055541_1000034 3300003841 Bacteria 190579
53 Ga0055543_1000418 3300004625 Bacteria 26839
54 Ga0065165_1002126 3300005262 Bacteria 18020
55 Ga0065714_10004456 3300005288 Bacteria 4902
56 Ga0065714_10013374 3300005288 Bacteria 2920
57 Ga0065714_10028410 3300005288 Bacteria 1462
58 Ga0065714_10068674 3300005288 Bacteria 4597
59 Ga0065714_10068918 3300005288 Bacteria 4476
60 Ga0065714_10078586 3300005288 Bacteria 2586
61 Ga0065714_10078707 3300005288 Bacteria 2576
62 Ga0065714_10085116 3300005288 Bacteria 2164
63 Ga0065704_10001910 3300005289 Bacteria 7577
64 Ga0065704_10005418 3300005289 Bacteria 5517
65 Ga0065712_10011733 3300005290 Bacteria 3213
66 Ga0065712_10073972 3300005290 Bacteria 4222
67 Ga0065715_10092771 3300005293 Bacteria 4948
68 Ga0065707_10015660 3300005295 Bacteria 1835
69 Ga0070658_10147124 3300005327 Bacteria 1970
70 Ga0070658_10156080 3300005327 Bacteria 1913
71 Ga0070676_10001154 3300005328 Bacteria 13192
72 Ga0070676_10072377 3300005328 Bacteria 2072
73 Ga0070683_100024533 3300005329 Bacteria 5403
74 Ga0070683_100080286 3300005329 Bacteria 3053
75 Ga0070670_100102289 3300005331 Bacteria 2467
76 Ga0068869_100009902 3300005334 Bacteria 6192
77 Ga0070680_100113882 3300005336 Bacteria 2253
78 Ga0070682_100053087 3300005337 Bacteria 2539
79 Ga0068868_100016222 3300005338 Bacteria 5527
80 Ga0068868_100061632 3300005338 Bacteria 2972
81 Ga0070660_100013873 3300005339 Bacteria 5797
82 Ga0070661_100018565 3300005344 Bacteria 4946
83 Ga0070661_100059704 3300005344 Bacteria 2797
84 Ga0070692_10000512 3300005345 Bacteria 11948
85 Ga0070668_100009698 3300005347 Bacteria 7139
86 Ga0070669_100024903 3300005353 Bacteria 4295
87 Ga0070675_100260801 3300005354 Bacteria 1519
88 Ga0070671_100041590 3300005355 Bacteria 3820
89 Ga0070673_100020456 3300005364 Bacteria 4775
90 Ga0070659_100173768 3300005366 Bacteria 1766
91 Ga0070659_100210719 3300005366 Bacteria 1601
92 Ga0070667_100020196 3300005367 Bacteria 5530
93 Ga0070709_10162048 3300005434 Bacteria 1556
94 Ga0070714_100059826 3300005435 Bacteria 3267
95 Ga0070714_100313253 3300005435 Bacteria 1466
96 Ga0070711_100051889 3300005439 Bacteria 2820
97 Ga0070705_100017433 3300005440 Bacteria 3749
98 Ga0070700_100033850 3300005441 Bacteria 3081
99 Ga0070694_100001309 3300005444 Bacteria 14482
100 Ga0070708_100395296 3300005445 Bacteria 1303
101 Ga0070663_100032125 3300005455 Bacteria 3615
102 Ga0070663_100038070 3300005455 Bacteria 3352
103 Ga0070662_100007601 3300005457 Bacteria 7035
104 Ga0070662_100063517 3300005457 Bacteria 2701
105 Ga0070681_10000400 3300005458 Bacteria 35179
106 Ga0068867_100032250 3300005459 Bacteria 3787
107 Ga0070685_10147476 3300005466 Bacteria 1488
108 Ga0070706_100030535 3300005467 Bacteria 4967
109 Ga0070706_100054161 3300005467 Bacteria 3703
110 Ga0070698_100001061 3300005471 Bacteria 30184
111 Ga0070698_100002279 3300005471 Bacteria 21244
112 Ga0070698_100123942 3300005471 Bacteria 2541
113 Ga0070699_100008172 3300005518 Bacteria 9079
114 Ga0070699_100341163 3300005518 Bacteria 1348
115 Ga0070697_100346371 3300005536 Bacteria 1283
116 Ga0068853_100043783 3300005539 Bacteria 3830
117 Ga0068853_100152766 3300005539 Bacteria 2079
118 Ga0070665_100023785 3300005548 Bacteria 6172
119 Ga0070665_100027573 3300005548 Bacteria 5720
120 Ga0070665_100102347 3300005548 Bacteria 2867
121 Ga0070665_100130171 3300005548 Bacteria 2519
122 Ga0070704_100159796 3300005549 Bacteria 1781
123 Ga0068855_100036615 3300005563 Bacteria 5839
124 Ga0068855_100053696 3300005563 Bacteria 4739
125 Ga0068855_100090213 3300005563 Bacteria 3537
126 Ga0068855_100104660 3300005563 Bacteria 3255
127 Ga0068855_100113368 3300005563 Bacteria 3110
128 Ga0068855_100127821 3300005563 Bacteria 2904
129 Ga0068855_100269037 3300005563 Bacteria 1895
130 Ga0070664_100023382 3300005564 Bacteria 5104
131 Ga0068854_100003802 3300005578 Bacteria 9439
132 Ga0068856_100032092 3300005614 Bacteria 5141
133 Ga0068856_100093249 3300005614 Bacteria 2996
134 Ga0068856_100195683 3300005614 Bacteria 2036
135 Ga0068856_100359627 3300005614 Bacteria 1474
136 Ga0068852_100032842 3300005616 Bacteria 4302
137 Ga0068852_100038545 3300005616 Bacteria 4017
138 Ga0068859_100055102 3300005617 Bacteria 4001
139 Ga0068864_100018695 3300005618 Bacteria 5791
140 Ga0068861_100005124 3300005719 Bacteria 8834
141 Ga0068861_100084712 3300005719 Bacteria 2489
142 Ga0068861_100150464 3300005719 Bacteria 1909
143 Ga0068863_100188142 3300005841 Bacteria 1984
144 Ga0068858_100015717 3300005842 Bacteria 7119
145 Ga0068858_100082134 3300005842 Bacteria 2995
146 Ga0068860_100001000 3300005843 Bacteria 31313
147 Ga0068860_100003227 3300005843 Bacteria 16817
148 Ga0068860_100039138 3300005843 Bacteria 4535
149 Ga0068860_100245381 3300005843 Bacteria 1742
150 Ga0068862_100008139 3300005844 Bacteria 8669
151 Ga0068862_100070727 3300005844 Bacteria 3012
152 Ga0068862_100164663 3300005844 Bacteria 1981
153 Ga0081455_10000535 3300005937 Bacteria 49312
154 Ga0081455_10002583 3300005937 Bacteria 21474
155 Ga0081455_10003074 3300005937 Bacteria 19454
156 Ga0081455_10006365 3300005937 Bacteria 12673
157 Ga0081455_10076181 3300005937 Bacteria 2764
158 Ga0081538_10000336 3300005981 Bacteria 53233
159 Ga0081538_10104838 3300005981 Bacteria 1409
160 Ga0081540_1005124 3300005983 Bacteria 9820
161 Ga0081540_1016510 3300005983 Bacteria 4615
162 Ga0081540_1018707 3300005983 Bacteria 4239
163 Ga0081539_10000322 3300005985 Bacteria 106875
164 Ga0081539_10001500 3300005985 Bacteria 39463
165 Ga0081539_10010735 3300005985 Bacteria 7381
166 Ga0081539_10055915 3300005985 Bacteria 2193
167 Ga0075365_10001038 3300006038 Bacteria 11956
168 Ga0075365_10002515 3300006038 Bacteria 9035
169 Ga0075365_10147569 3300006038 Bacteria 1635
170 Ga0075365_10151217 3300006038 Bacteria 1615
171 Ga0075365_10153319 3300006038 Bacteria 1603
172 Ga0075368_10028500 3300006042 Bacteria 2157
173 Ga0075363_100063220 3300006048 Bacteria 1997
174 Ga0075363_100064246 3300006048 Bacteria 1982
175 Ga0075363_100072682 3300006048 Bacteria 1870
176 Ga0075364_10056443 3300006051 Bacteria 2571
177 Ga0075364_10099254 3300006051 Bacteria 1938
178 Ga0075432_10000475 3300006058 Bacteria 11942
179 Ga0075432_10001254 3300006058 Bacteria 8177
180 Ga0075432_10004055 3300006058 Bacteria 5000
181 Ga0075432_10009780 3300006058 Bacteria 3261
182 Ga0075432_10019754 3300006058 Bacteria 2303
183 Ga0075362_10003219 3300006177 Bacteria 5659
184 Ga0075362_10009581 3300006177 Bacteria 3751
185 Ga0075362_10024455 3300006177 Bacteria 2562
186 Ga0075362_10081741 3300006177 Bacteria 1490
187 Ga0075367_10001008 3300006178 Bacteria 11566
188 Ga0075367_10114691 3300006178 Bacteria 1656
189 Ga0075369_10000014 3300006186 Bacteria 63974
190 Ga0075369_10013629 3300006186 Bacteria 3233
191 Ga0075369_10019212 3300006186 Bacteria 2788
192 Ga0075369_10020019 3300006186 Bacteria 2738
193 Ga0075369_10067738 3300006186 Bacteria 1568
194 Ga0075366_10007780 3300006195 Bacteria 5932
195 Ga0075366_10022363 3300006195 Bacteria 3677
196 Ga0075366_10030145 3300006195 Bacteria 3188
197 Ga0075366_10031183 3300006195 Bacteria 3137
198 Ga0075366_10034453 3300006195 Bacteria 2982
199 Ga0075366_10078636 3300006195 Bacteria 1968
200 Ga0075366_10078687 3300006195 Bacteria 1968
201 Ga0097621_100321685 3300006237 Bacteria 1370
202 Ga0075370_10000325 3300006353 Bacteria 17244
203 Ga0075370_10003407 3300006353 Bacteria 7560
204 Ga0075370_10004598 3300006353 Bacteria 6730
205 Ga0075370_10006184 3300006353 Bacteria 6007
206 Ga0075370_10034028 3300006353 Bacteria 2855
207 Ga0075370_10041253 3300006353 Bacteria 2605
208 Ga0075370_10124616 3300006353 Bacteria 1501
209 Ga0075428_100092590 3300006844 Bacteria 3295
210 Ga0075434_100000910 3300006871 Bacteria 23742
211 Ga0075434_100337786 3300006871 Bacteria 1527
212 Ga0075429_100202575 3300006880 Bacteria 1739
213 Ga0075436_100001623 3300006914 Bacteria 15389
214 Ga0075436_100061626 3300006914 Bacteria 2592
215 Ga0075436_100112691 3300006914 Bacteria 1899
216 Ga0097620_100055105 3300006931 Bacteria 4001
217 Ga0079104_1000259 3300006946 Bacteria 70490
218 Ga0079104_1001901 3300006946 Bacteria 12606
219 Ga0079104_1012883 3300006946 Bacteria 2603
220 Ga0099826_10005506 3300006948 Bacteria 9091
221 Ga0075435_100003979 3300007076 Bacteria 10099
222 Ga0075435_100145488 3300007076 Bacteria 1991
223 Ga0099794_10000175 3300007265 Bacteria 23393
224 Ga0099794_10004144 3300007265 Bacteria 5649
225 Ga0099795_10001474 3300007788 Bacteria 5122
226 Ga0099795_10003195 3300007788 Bacteria 4024
227 Ga0099795_10010610 3300007788 Bacteria 2719
228 Ga0105251_10000030 3300009011 Bacteria 124407
229 Ga0105251_10000152 3300009011 Bacteria 70853
230 Ga0105251_10024552 3300009011 Bacteria 3094
231 Ga0105251_10032369 3300009011 Bacteria 2607
232 Ga0105251_10041514 3300009011 Bacteria 2238
233 Ga0105251_10065625 3300009011 Bacteria 1698
234 Ga0105251_10071251 3300009011 Bacteria 1617
235 Ga0105244_10002080 3300009036 Bacteria 15407
236 Ga0105244_10017319 3300009036 Bacteria 4074
237 Ga0105244_10031407 3300009036 Bacteria 2818
238 Ga0105244_10061539 3300009036 Bacteria 1889
239 Ga0105244_10067547 3300009036 Bacteria 1788
240 Ga0105244_10088231 3300009036 Bacteria 1528
241 Ga0105244_10094234 3300009036 Bacteria 1470
242 Ga0105250_10003748 3300009092 Bacteria 7140
243 Ga0105250_10003832 3300009092 Bacteria 7052
244 Ga0105250_10021069 3300009092 Bacteria 2632
245 Ga0105250_10023281 3300009092 Bacteria 2496
246 Ga0105250_10046896 3300009092 Bacteria 1733
247 Ga0105240_10043773 3300009093 Bacteria 5693
248 Ga0105240_10046877 3300009093 Bacteria 5473
249 Ga0105240_10197731 3300009093 Bacteria 2358
250 Ga0111539_10000980 3300009094 Bacteria 37481
251 Ga0111539_10144775 3300009094 Bacteria 2782
252 Ga0111539_10293622 3300009094 Bacteria 1891
253 Ga0105245_10027202 3300009098 Bacteria 5039
254 Ga0105245_10098259 3300009098 Bacteria 2705
255 Ga0105245_10166475 3300009098 Bacteria 2096
256 Ga0105247_10000503 3300009101 Bacteria 32160
257 Ga0105247_10001684 3300009101 Bacteria 15604
258 Ga0105243_10000655 3300009148 Bacteria 34289
259 Ga0105243_10009254 3300009148 Bacteria 7521
260 Ga0105243_10012936 3300009148 Bacteria 6306
261 Ga0105243_10041601 3300009148 Bacteria 3594
262 Ga0105243_10109570 3300009148 Bacteria 2307
263 Ga0105241_10037920 3300009174 Bacteria 3633
264 Ga0105241_10054340 3300009174 Bacteria 3065
265 Ga0105241_10061580 3300009174 Bacteria 2890
266 Ga0105241_10063731 3300009174 Bacteria 2845
267 Ga0105242_10000361 3300009176 Bacteria 36302
268 Ga0105248_10044791 3300009177 Bacteria 4962
269 Ga0105248_10120457 3300009177 Bacteria 2960
270 Ga0105237_10000304 3300009545 Bacteria 68213
271 Ga0105237_10034592 3300009545 Bacteria 5116
272 Ga0105237_10046264 3300009545 Bacteria 4377
273 Ga0105238_10042238 3300009551 Bacteria 4618
274 Ga0105238_10065111 3300009551 Bacteria 3645
275 Ga0105249_10013528 3300009553 Bacteria 7206
276 Ga0105249_10025312 3300009553 Bacteria 5341
277 Ga0105249_10025451 3300009553 Bacteria 5328
278 Ga0105249_10035390 3300009553 Bacteria 4530
279 Ga0105249_10183864 3300009553 Bacteria 2035
280 Ga0099796_10000071 3300010159 Bacteria 18016
281 Ga0099796_10005817 3300010159 Bacteria 3108
282 Ga0105239_10011662 3300010375 Bacteria 9810
283 Ga0105239_10028219 3300010375 Bacteria 6174
284 Ga0105239_10037516 3300010375 Bacteria 5310
285 Ga0105239_10051508 3300010375 Bacteria 4513
286 Ga0105239_10058071 3300010375 Bacteria 4245
287 Ga0105239_10483861 3300010375 Bacteria 1406
288 Ga0105246_10006848 3300011119 Bacteria 6970
289 Ga0105246_10019968 3300011119 Bacteria 4293
290 Ga0105246_10031877 3300011119 Bacteria 3491
291 Ga0105246_10035944 3300011119 Bacteria 3315
292 Ga0105246_10059559 3300011119 Bacteria 2650
293 Ga0105246_10098707 3300011119 Bacteria 2122
294 Ga0157345_1000313 3300012498 Bacteria 6192
295 Ga0157373_10013085 3300013100 Bacteria 6089
296 Ga0157373_10017472 3300013100 Bacteria 5224
297 Ga0157373_10053162 3300013100 Bacteria 2880
298 Ga0157373_10055121 3300013100 Bacteria 2824
299 Ga0157373_10059368 3300013100 Bacteria 2710
300 Ga0157373_10069451 3300013100 Bacteria 2491
301 Ga0157373_10073727 3300013100 Bacteria 2408
302 Ga0157373_10074182 3300013100 Bacteria 2400
303 Ga0157373_10077737 3300013100 Bacteria 2341
304 Ga0157373_10077887 3300013100 Bacteria 2339
305 Ga0157373_10093958 3300013100 Bacteria 2112
306 Ga0157371_10010968 3300013102 Bacteria 7023
307 Ga0157371_10013341 3300013102 Bacteria 6247
308 Ga0157371_10031628 3300013102 Bacteria 3813
309 Ga0157370_10021210 3300013104 Bacteria 6477
310 Ga0157370_10046488 3300013104 Bacteria 4161
311 Ga0157370_10088370 3300013104 Bacteria 2910
312 Ga0157370_10140117 3300013104 Bacteria 2253
313 Ga0157370_10344520 3300013104 Bacteria 1374
314 Ga0157369_10046843 3300013105 Bacteria 4698
315 Ga0157369_10071871 3300013105 Bacteria 3713
316 Ga0157369_10091976 3300013105 Bacteria 3237
317 Ga0157369_10191438 3300013105 Bacteria 2149
318 Ga0157378_10017744 3300013297 Bacteria 6249
319 Ga0157378_10018043 3300013297 Bacteria 6196
320 Ga0163162_10027887 3300013306 Bacteria 5585
321 Ga0163162_10057535 3300013306 Unclassified 3916
322 Ga0163162_10071260 3300013306 Bacteria 3528
323 Ga0163162_10105479 3300013306 Bacteria 2913
324 Ga0157372_10074657 3300013307 Bacteria 3824
325 Ga0157375_10051881 3300013308 Bacteria 4030
326 Ga0157375_10157882 3300013308 Bacteria 2408
327 Ga0157375_10161590 3300013308 Bacteria 2382
328 Ga0157375_10198054 3300013308 Bacteria 2164
329 Ga0157375_10465470 3300013308 Bacteria 1430
330 Ga0163163_10074657 3300014325 Bacteria 3383
331 Ga0157380_10009376 3300014326 Bacteria 7010
332 Ga0182008_10000118 3300014497 Bacteria 59429
333 Ga0182008_10004546 3300014497 Bacteria 8094
334 Ga0182008_10012781 3300014497 Bacteria 4426
335 Ga0182008_10013518 3300014497 Bacteria 4292
336 Ga0182008_10015320 3300014497 Bacteria 4002
337 Ga0182008_10015537 3300014497 Bacteria 3970
338 Ga0182008_10041546 3300014497 Bacteria 2294
339 Ga0182008_10048088 3300014497 Bacteria 2118
340 Ga0182008_10122169 3300014497 Bacteria 1295
341 Ga0157379_10207440 3300014968 Bacteria 1773
342 Ga0157376_10003956 3300014969 Bacteria 10251
343 Ga0157376_10242683 3300014969 Bacteria 1679
344 Ga0182006_1004584 3300015261 Bacteria 6788
345 Ga0182006_1005243 3300015261 Bacteria 6205
346 Ga0182006_1008050 3300015261 Bacteria 4788
347 Ga0182006_1009122 3300015261 Bacteria 4459
348 Ga0182006_1015792 3300015261 Bacteria 3230
349 Ga0182006_1071688 3300015261 Bacteria 1283
350 Ga0182007_10006325 3300015262 Bacteria 5094
351 Ga0182005_1008720 3300015265 Bacteria 2977
352 Ga0182005_1012383 3300015265 Bacteria 2411
353 Ga0182005_1013939 3300015265 Bacteria 2256
354 Ga0183362_10009 3300015683 Bacteria 154236
355 Ga0163161_10004717 3300017792 Bacteria 9480
356 Ga0163161_10005146 3300017792 Bacteria 9094
357 Ga0163161_10018973 3300017792 Bacteria 4821
358 Ga0163161_10079763 3300017792 Bacteria 2408
359 Ga0163161_10084671 3300017792 Bacteria 2338
360 Ga0163161_10101313 3300017792 Bacteria 2144
361 Ga0163161_10123266 3300017792 Bacteria 1949
362 Ga0163161_10129480 3300017792 Bacteria 1902
363 Ga0163161_10135634 3300017792 Bacteria 1860
364 Ga0213872_10000052 3300021361 Bacteria 106278
365 Ga0213872_10000094 3300021361 Bacteria 82769
366 Ga0213872_10000146 3300021361 Bacteria 64624
367 Ga0213872_10000918 3300021361 Bacteria 20961
368 Ga0213872_10009810 3300021361 Bacteria 4576
369 Ga0213872_10083774 3300021361 Bacteria 1431
370 Ga0213876_10096573 3300021384 Bacteria 1565
371 Ga0224712_10005870 3300022467 Bacteria 3459
372 Ga0209435_100001 3300025206 Bacteria 1424171
373 Ga0209760_100085 3300025207 Bacteria 74397
374 Ga0209760_100408 3300025207 Bacteria 10541
375 Ga0209784_100050 3300025224 Bacteria 191780
376 Ga0209566_100063 3300025225 Bacteria 191780
377 Ga0209674_100084 3300025226 Bacteria 191780
378 Ga0209147_100083 3300025229 Bacteria 191212
379 Ga0209563_100084 3300025230 Bacteria 191780
380 Ga0209563_100623 3300025230 Bacteria 11450
381 Ga0207427_100007 3300025231 Bacteria 746220
382 Ga0207427_100038 3300025231 Bacteria 292975
383 Ga0209437_100006 3300025233 Bacteria 1042724
384 Ga0209437_100009 3300025233 Bacteria 915954
385 Ga0209258_100113 3300025242 Bacteria 191178
386 Ga0207425_1004215 3300025245 Bacteria 4368
387 Ga0209646_1000001 3300025246 Bacteria 3092932
388 Ga0209646_1000302 3300025246 Bacteria 40042
389 Ga0209026_1000003 3300025250 Bacteria 1060571
390 Ga0209677_100047 3300025253 Bacteria 191780
391 Ga0209759_1000001 3300025256 Bacteria 2799452
392 Ga0209759_1004130 3300025256 Bacteria 5536
393 Ga0209233_1000059 3300025261 Bacteria 414562
394 Ga0209233_1000074 3300025261 Bacteria 357367
395 Ga0209233_1000155 3300025261 Bacteria 167981
396 Ga0209565_1000070 3300025263 Bacteria 168957
397 Ga0209565_1000418 3300025263 Bacteria 34964
398 Ga0209673_1000234 3300025273 Bacteria 107514
399 Ga0209673_1014753 3300025273 Bacteria 3010
400 Ga0209130_1000050 3300025284 Bacteria 222092
401 Ga0209130_1002622 3300025284 Bacteria 8657
402 Ga0209675_1000069 3300025291 Bacteria 170538
403 Ga0209675_1000643 3300025291 Bacteria 24820
404 Ga0209675_1004382 3300025291 Bacteria 6294
405 Ga0209675_1005889 3300025291 Bacteria 5029
406 Ga0209676_1000006 3300025292 Bacteria 1039588
407 Ga0209676_1000010 3300025292 Bacteria 954025
408 Ga0209676_1000376 3300025292 Bacteria 82203
409 Ga0209676_1001281 3300025292 Bacteria 26028
410 Ga0209676_1002525 3300025292 Bacteria 12767
411 Ga0209676_1002985 3300025292 Bacteria 11008
412 Ga0209676_1006892 3300025292 Bacteria 5490
413 Ga0209676_1008984 3300025292 Bacteria 4377
414 Ga0209676_1009706 3300025292 Bacteria 4118
415 Ga0209676_1033370 3300025292 Bacteria 1534
416 Ga0209025_1000113 3300025294 Bacteria 218943
417 Ga0209025_1001851 3300025294 Bacteria 24838
418 Ga0209025_1041557 3300025294 Bacteria 1967
419 Ga0209025_1049694 3300025294 Bacteria 1684
420 Ga0209050_1000019 3300025298 Bacteria 608757
421 Ga0209050_1000027 3300025298 Bacteria 483261
422 Ga0209050_1000494 3300025298 Bacteria 67818
423 Ga0209050_1002573 3300025298 Bacteria 15095
424 Ga0209050_1007216 3300025298 Bacteria 6310
425 Ga0209050_1014545 3300025298 Bacteria 3380
426 Ga0209256_1002634 3300025299 Bacteria 14142
427 Ga0207426_1000071 3300025302 Bacteria 329539
428 Ga0207426_1015277 3300025302 Bacteria 2788
429 Ga0209051_1000102 3300025303 Bacteria 162911
430 Ga0209051_1000356 3300025303 Bacteria 67818
431 Ga0209051_1000367 3300025303 Bacteria 65677
432 Ga0209051_1000383 3300025303 Bacteria 62847
433 Ga0209051_1000506 3300025303 Bacteria 49427
434 Ga0209051_1000975 3300025303 Bacteria 27889
435 Ga0209051_1008938 3300025303 Bacteria 5231
436 Ga0209051_1011394 3300025303 Bacteria 4392
437 Ga0209257_1000012 3300025304 Bacteria 1111138
438 Ga0209257_1000357 3300025304 Bacteria 93431
439 Ga0209257_1006431 3300025304 Bacteria 7573
440 Ga0209257_1008166 3300025304 Bacteria 6061
441 Ga0207696_1000052 3300025711 Bacteria 272880
442 Ga0207696_1000054 3300025711 Bacteria 266962
443 Ga0207696_1000213 3300025711 Bacteria 87128
444 Ga0207696_1003518 3300025711 Bacteria 7082
445 Ga0207696_1006973 3300025711 Bacteria 4477
446 Ga0207696_1016721 3300025711 Bacteria 2447
447 Ga0207696_1025093 3300025711 Bacteria 1862
448 Ga0207655_1003610 3300025728 Bacteria 11441
449 Ga0207655_1003693 3300025728 Bacteria 11274
450 Ga0207655_1007731 3300025728 Bacteria 6934
451 Ga0207655_1014269 3300025728 Bacteria 4502
452 Ga0207655_1021841 3300025728 Bacteria 3231
453 Ga0207655_1028430 3300025728 Bacteria 2638
454 Ga0207655_1028973 3300025728 Bacteria 2601
455 Ga0207655_1030543 3300025728 Bacteria 2504
456 Ga0207655_1037648 3300025728 Bacteria 2127
457 Ga0207713_1000013 3300025735 Bacteria 475751
458 Ga0207713_1010035 3300025735 Bacteria 5280
459 Ga0207713_1011872 3300025735 Bacteria 4700
460 Ga0207713_1025915 3300025735 Bacteria 2697
461 Ga0207713_1029894 3300025735 Bacteria 2433
462 Ga0207713_1030331 3300025735 Bacteria 2409
463 Ga0207653_10004328 3300025885 Bacteria 4462
464 Ga0207692_10006623 3300025898 Bacteria 4707
465 Ga0207710_10000929 3300025900 Bacteria 15612
466 Ga0207688_10003465 3300025901 Bacteria 8609
467 Ga0207680_10064388 3300025903 Bacteria 2247
468 Ga0207647_10006579 3300025904 Bacteria 8442
469 Ga0207647_10099355 3300025904 Bacteria 1728
470 Ga0207647_10148515 3300025904 Bacteria 1371
471 Ga0207645_10056064 3300025907 Bacteria 2516
472 Ga0207645_10076737 3300025907 Bacteria 2140
473 Ga0207684_10098803 3300025910 Bacteria 2493
474 Ga0207684_10139138 3300025910 Bacteria 2086
475 Ga0207654_10017811 3300025911 Bacteria 3721
476 Ga0207654_10111953 3300025911 Bacteria 1700
477 Ga0207707_10052071 3300025912 Bacteria 3565
478 Ga0207671_10000295 3300025914 Bacteria 73382
479 Ga0207671_10021914 3300025914 Bacteria 4840
480 Ga0207671_10157044 3300025914 Bacteria 1760
481 Ga0207693_10068379 3300025915 Bacteria 2780
482 Ga0207663_10102138 3300025916 Bacteria 1928
483 Ga0207657_10020579 3300025919 Bacteria 6231
484 Ga0207657_10080794 3300025919 Bacteria 2732
485 Ga0207657_10258386 3300025919 Bacteria 1387
486 Ga0207649_10020234 3300025920 Bacteria 3814
487 Ga0207649_10026837 3300025920 Bacteria 3373
488 Ga0207652_10060219 3300025921 Bacteria 3275
489 Ga0207681_10117514 3300025923 Bacteria 1945
490 Ga0207681_10138791 3300025923 Bacteria 1808
491 Ga0207694_10012539 3300025924 Bacteria 6390
492 Ga0207694_10015367 3300025924 Bacteria 5774
493 Ga0207694_10067030 3300025924 Bacteria 2802
494 Ga0207650_10000575 3300025925 Bacteria 29658
495 Ga0207700_10020622 3300025928 Bacteria 4481
496 Ga0207664_10024049 3300025929 Bacteria 4574
497 Ga0207664_10215329 3300025929 Bacteria 1664
498 Ga0207644_10098875 3300025931 Bacteria 2188
499 Ga0207690_10100236 3300025932 Bacteria 2067
500 Ga0207706_10013343 3300025933 Bacteria 7473
501 Ga0207706_10018193 3300025933 Bacteria 6322
502 Ga0207706_10027670 3300025933 Bacteria 5069
503 Ga0207686_10000422 3300025934 Bacteria 28890
504 Ga0207709_10000224 3300025935 Bacteria 71687
505 Ga0207709_10000259 3300025935 Bacteria 63214
506 Ga0207709_10002095 3300025935 Bacteria 12847
507 Ga0207709_10052206 3300025935 Bacteria 2510
508 Ga0207709_10070423 3300025935 Bacteria 2218
509 Ga0207709_10089043 3300025935 Bacteria 2011
510 Ga0207669_10068168 3300025937 Bacteria 2221
511 Ga0207665_10036669 3300025939 Bacteria 3262
512 Ga0207711_10074730 3300025941 Bacteria 2948
513 Ga0207711_10104954 3300025941 Bacteria 2505
514 Ga0207689_10008566 3300025942 Bacteria 8912
515 Ga0207667_10039611 3300025949 Bacteria 5022
516 Ga0207667_10048683 3300025949 Bacteria 4480
517 Ga0207667_10056651 3300025949 Bacteria 4117
518 Ga0207667_10118152 3300025949 Bacteria 2733
519 Ga0207667_10142833 3300025949 Bacteria 2465
520 Ga0207651_10123234 3300025960 Bacteria 1970
521 Ga0207712_10000615 3300025961 Bacteria 28133
522 Ga0207712_10103052 3300025961 Bacteria 2126
523 Ga0207712_10221159 3300025961 Bacteria 1514
524 Ga0207668_10012628 3300025972 Bacteria 5177
525 Ga0207640_10049644 3300025981 Bacteria 2718
526 Ga0207658_10165783 3300025986 Bacteria 1815
527 Ga0207658_10263303 3300025986 Bacteria 1470
528 Ga0207677_10010989 3300026023 Bacteria 5143
529 Ga0207703_10005208 3300026035 Bacteria 10509
530 Ga0207703_10071366 3300026035 Bacteria 2868
531 Ga0207639_10148435 3300026041 Bacteria 1961
532 Ga0207639_10149851 3300026041 Bacteria 1953
533 Ga0207678_10002939 3300026067 Bacteria 15441
534 Ga0207678_10036589 3300026067 Bacteria 4273
535 Ga0207678_10090542 3300026067 Bacteria 2614
536 Ga0207708_10055402 3300026075 Bacteria 3023
537 Ga0207708_10109741 3300026075 Bacteria 2141
538 Ga0207641_10013381 3300026088 Bacteria 6728
539 Ga0207648_10007662 3300026089 Bacteria 10568
540 Ga0207648_10135581 3300026089 Bacteria 2168
541 Ga0207676_10049626 3300026095 Bacteria 3266
542 Ga0207674_10077343 3300026116 Bacteria 3333
543 Ga0207674_10167153 3300026116 Bacteria 2153
544 Ga0207674_10403555 3300026116 Bacteria 1321
545 Ga0207675_100007150 3300026118 Bacteria 10547
546 Ga0207675_100062183 3300026118 Bacteria 3486
547 Ga0207675_100089155 3300026118 Bacteria 2898
548 Ga0207675_100310072 3300026118 Bacteria 1539
549 Ga0207683_10004481 3300026121 Bacteria 12058
550 Ga0207683_10019750 3300026121 Bacteria 5756
551 Ga0207683_10033130 3300026121 Bacteria 4487
552 Ga0207683_10047584 3300026121 Bacteria 3756
553 Ga0207698_10028300 3300026142 Bacteria 3994
554 Ga0207698_10335607 3300026142 Bacteria 1422
555 Ga0209281_1000015 3300027111 Bacteria 590084
556 Ga0209281_1000228 3300027111 Bacteria 118988
557 Ga0209281_1007083 3300027111 Bacteria 2839
558 Ga0209981_1002891 3300027378 Bacteria 2207
559 Ga0209179_1002693 3300027512 Bacteria 2446
560 Ga0209179_1002990 3300027512 Bacteria 2371
561 Ga0209282_1000561 3300027666 Bacteria 18044
562 Ga0209588_1001992 3300027671 Bacteria 5489
563 Ga0209588_1005473 3300027671 Bacteria 3644
564 Ga0209588_1012327 3300027671 Bacteria 2594
565 Ga0209813_10024784 3300027866 Bacteria 1719
566 Ga0207428_10000407 3300027907 Bacteria 53529
567 Ga0207428_10046285 3300027907 Bacteria 3499
568 Ga0207428_10094763 3300027907 Bacteria 2313
569 Ga0207428_10097940 3300027907 Bacteria 2270
570 Ga0268266_10016663 3300028379 Bacteria 6279
571 Ga0268266_10016765 3300028379 Bacteria 6261
572 Ga0268266_10043060 3300028379 Bacteria 3857
573 Ga0268266_10083205 3300028379 Bacteria 2793
574 Ga0268265_10185946 3300028380 Bacteria 1789
575 Ga0268264_10000860 3300028381 Bacteria 32169
576 Ga0268264_10009372 3300028381 Bacteria 8103
577 Ga0268264_10017159 3300028381 Bacteria 5928
578 Ga0268264_10041558 3300028381 Bacteria 3804
579 Ga0265334_10031233 3300028573 Bacteria 2129
580 Ga0307515_10000651 3300028794 Bacteria 80257
581 Ga0307515_10021511 3300028794 Bacteria 11431
582 Ga0307515_10077307 3300028794 Bacteria 4398
583 Ga0307511_10000022 3300030521 Bacteria 116875
584 Ga0307511_10000355 3300030521 Bacteria 48642
585 Ga0307511_10081071 3300030521 Bacteria 2281
586 Ga0307511_10170050 3300030521 Bacteria 1200
587 Ga0316177_1002614 3300030731 Bacteria 3613
588 Ga0316177_1165457 3300030731 Bacteria 1619
589 Ga0316176_1145635 3300030732 Bacteria 2577
590 Ga0314311_1019612 3300030733 Bacteria 3806
591 Ga0314311_1084958 3300030733 Bacteria 7213
592 Ga0316178_1061339 3300030735 Bacteria 40218
593 Ga0316183_1093439 3300030742 Bacteria 4401
594 Ga0316183_1162789 3300030742 Bacteria 3297
595 Ga0316183_1174315 3300030742 Bacteria 2125
596 Ga0316181_1090505 3300030744 Bacteria 3179
597 Ga0265330_10000116 3300031235 Bacteria 64622
598 Ga0265332_10000003 3300031238 Bacteria 482849
599 Ga0265332_10000012 3300031238 Bacteria 272641
600 Ga0265332_10000033 3300031238 Bacteria 153334
601 Ga0265325_10007177 3300031241 Bacteria 6702
602 Ga0265340_10056000 3300031247 Bacteria 1898
603 Ga0265331_10000006 3300031250 Bacteria 418907
604 Ga0265327_10000001 3300031251 Bacteria 894475
605 Ga0265327_10000049 3300031251 Bacteria 268046
606 Ga0265327_10000798 3300031251 Bacteria 48300
607 Ga0265327_10044922 3300031251 Bacteria 2351
608 Ga0307513_10000014 3300031456 Bacteria 303157
609 Ga0307513_10000019 3300031456 Bacteria 231194
610 Ga0307513_10012715 3300031456 Bacteria 10366
611 Ga0307513_10019068 3300031456 Bacteria 8177
612 Ga0307513_10147427 3300031456 Bacteria 2269
613 Ga0307513_10148518 3300031456 Bacteria 2258
614 Ga0307513_10176591 3300031456 Bacteria 2005
615 Ga0307509_10071671 3300031507 Bacteria 3613
616 Ga0307509_10179427 3300031507 Bacteria 1985
617 Ga0307408_100000020 3300031548 Bacteria 340408
618 Ga0307408_100011048 3300031548 Bacteria 5959
619 Ga0307408_100024832 3300031548 Bacteria 4097
620 Ga0307408_100035977 3300031548 Bacteria 3477
621 Ga0307408_100044323 3300031548 Bacteria 3169
622 Ga0307408_100075697 3300031548 Bacteria 2501
623 Ga0307408_100080766 3300031548 Bacteria 2429
624 Ga0307408_100150165 3300031548 Bacteria 1838
625 Ga0307408_100278762 3300031548 Bacteria 1391
626 Ga0307408_100295096 3300031548 Bacteria 1355
627 Ga0307508_10112483 3300031616 Bacteria 2323
628 Ga0307514_10001125 3300031649 Bacteria 37028
629 Ga0307514_10008781 3300031649 Bacteria 8559
630 Ga0307514_10106507 3300031649 Bacteria 1999
631 Ga0316575_10000138 3300031665 Bacteria 18312
632 Ga0316575_10029883 3300031665 Bacteria 2129
633 Ga0316579_10025936 3300031691 Bacteria 2649
634 Ga0316579_10027749 3300031691 Unclassified 2573
635 Ga0316579_10030600 3300031691 Bacteria 2461
636 Ga0265314_10000029 3300031711 Bacteria 272506
637 Ga0265314_10005268 3300031711 Bacteria 11703
638 Ga0265314_10024671 3300031711 Bacteria 4554
639 Ga0265314_10034512 3300031711 Bacteria 3698
640 Ga0316576_10000111 3300031727 Bacteria 30423
641 Ga0316576_10004205 3300031727 Bacteria 8597
642 Ga0316576_10037777 3300031727 Bacteria 3459
643 Ga0316576_10090890 3300031727 Bacteria 2274
644 Ga0316576_10161610 3300031727 Bacteria 1689
645 Ga0316578_10002226 3300031728 Bacteria 8394
646 Ga0316578_10033864 3300031728 Bacteria 2930
647 Ga0316578_10077036 3300031728 Bacteria 1980
648 Ga0307516_10006735 3300031730 Bacteria 13430
649 Ga0307516_10043969 3300031730 Bacteria 4423
650 Ga0307405_10002086 3300031731 Bacteria 8717
651 Ga0307405_10004473 3300031731 Bacteria 6609
652 Ga0307405_10015127 3300031731 Bacteria 4169
653 Ga0307405_10032537 3300031731 Bacteria 3083
654 Ga0307405_10077115 3300031731 Bacteria 2164
655 Ga0316577_10062893 3300031733 Bacteria 2072
656 Ga0316577_10074258 3300031733 Bacteria 1899
657 Ga0307413_10004156 3300031824 Bacteria 6249
658 Ga0307413_10057078 3300031824 Bacteria 2385
659 Ga0307518_10131298 3300031838 Bacteria 1760
660 Ga0307410_10001553 3300031852 Bacteria 10471
661 Ga0307406_10000178 3300031901 Bacteria 38000
662 Ga0307406_10000505 3300031901 Bacteria 22399
663 Ga0307406_10008832 3300031901 Bacteria 5632
664 Ga0307406_10248885 3300031901 Bacteria 1337
665 Ga0307407_10003421 3300031903 Bacteria 6503
666 Ga0307407_10062192 3300031903 Bacteria 2185
667 Ga0307407_10094250 3300031903 Bacteria 1843
668 Ga0307412_10002073 3300031911 Bacteria 11130
669 Ga0307412_10031473 3300031911 Bacteria 3351
670 Ga0307412_10054709 3300031911 Bacteria 2650
671 Ga0307412_10061526 3300031911 Bacteria 2524
672 Ga0307412_10072118 3300031911 Bacteria 2359
673 Ga0307412_10086868 3300031911 Bacteria 2177
674 Ga0307412_10100552 3300031911 Bacteria 2044
675 Ga0307409_100000015 3300031995 Bacteria 61871
676 Ga0307409_100035588 3300031995 Bacteria 3651
677 Ga0307409_100047441 3300031995 Bacteria 3260
678 Ga0307416_100000138 3300032002 Bacteria 42771
679 Ga0307414_10037379 3300032004 Bacteria 3250
680 Ga0307414_10120348 3300032004 Bacteria 2017
681 Ga0307414_10146213 3300032004 Bacteria 1857
682 Ga0307411_10042190 3300032005 Bacteria 2908
683 Ga0307411_10123617 3300032005 Bacteria 1877
684 Ga0307415_100001768 3300032126 Bacteria 10562
685 Ga0307415_100048368 3300032126 Bacteria 2870
686 Ga0316583_10005041 3300032133 Bacteria 4728
687 Ga0316583_10033410 3300032133 Bacteria 1827
688 Ga0316583_10045324 3300032133 Bacteria 1553
689 Ga0316580_10007364 3300032139 Bacteria 3276
690 Ga0316593_10015135 3300032168 Bacteria 2316
691 Ga0307507_10000090 3300033179 Bacteria 142457
692 Ga0307510_10000009 3300033180 Bacteria 409702
693 Ga0307510_10016374 3300033180 Bacteria 8750
694 Ga0307510_10030629 3300033180 Bacteria 6096
695 Ga0316592_1009497 3300033524 Bacteria 1948
696 Ga0316586_1004284 3300033527 Bacteria 1937
697 Ga0316586_1007462 3300033527 Bacteria 1595
698 Ga0316587_1004502 3300033529 Bacteria 2032
699 Ga0316587_1016477 3300033529 Bacteria 1233
700 Ga0316596_1010863 3300033541 Bacteria 2214
701 Ga0316596_1020885 3300033541 Bacteria 1667
702 Ga0373944_0003538 3300035089 Bacteria 4039
703 Ga0373936_0018269 3300035113 Bacteria 2706
704 Ga0373945_0000855 3300035116 Bacteria 8962
705 Ga0373954_0042059 3300035118 Bacteria 2131
706 Ga0373943_0002078 3300035170 Bacteria 9090
707 Ga0373946_0004768 3300035171 Bacteria 4878
708 Ga0373942_0004061 3300035207 Bacteria 3416
709 Ga0316574_0003852 3300035398 Bacteria 7796
710 Ga0316574_0006709 3300035398 Bacteria 6248
711 Ga0316574_0025896 3300035398 Bacteria 3524
712 Ga0316574_0077729 3300035398 Bacteria 2103
713 Ga0373924_0009036 3300035410 Bacteria 3644
714 Ga0373935_0016263 3300035692 Bacteria 4503
715 Ga0373927_0003917 3300035695 Bacteria 10551
716 Ga0373927_0149454 3300035695 Bacteria 1530
717 Ga0373947_0078367 3300035725 Bacteria 2039
718 Ga0373937_0013115 3300036401 Bacteria 7299
719 Ga0316582_0000873 3300036647 Bacteria 12317
720 Ga0316582_0016084 3300036647 Bacteria 4295
721 Ga0316582_0043181 3300036647 Bacteria 2827
722 Ga0316584_0008780 3300036712 Bacteria 6980
723 Ga0316584_0032725 3300036712 Bacteria 3849
724 Ga0316584_0099844 3300036712 Bacteria 2173
725 Ga0316584_0151414 3300036712 Bacteria 1727
726 Ga0373925_0003143 3300037068 Bacteria 12957
727 Ga0373925_0004751 3300037068 Bacteria 10231
728 Ga0395899_0012444 3300037312 Bacteria 6518
729 Ga0395899_0139380 3300037312 Bacteria 1727
730 Ga0395900_0007913 3300037418 Bacteria 10946
731 Ga0395900_0058978 3300037418 Bacteria 3951
732 Ga0395900_0245020 3300037418 Bacteria 1796
733 Ga0395900_0290311 3300037418 Bacteria 1624
734 Ga0395900_0324384 3300037418 Bacteria 1519
735 Ga0395898_0008707 3300037466 Bacteria 10706
736 Ga0395898_0041290 3300037466 Bacteria 4557
737 Ga0395898_0087958 3300037466 Bacteria 2992
738 Ga0395905_0000106 3300037471 Bacteria 140180
739 Ga0395905_0000421 3300037471 Bacteria 59264
740 Ga0395905_0006752 3300037471 Bacteria 11492
741 Ga0395905_0074312 3300037471 Bacteria 3185
742 Ga0395905_0152648 3300037471 Bacteria 2172
743 Ga0436364_0049303 3300037853 Bacteria 3274
744 Ga0395901_0016740 3300038443 Bacteria 7470
745 Ga0395901_0120638 3300038443 Bacteria 2755
746 Ga0395901_0207423 3300038443 Bacteria 2052
747 Ga0400490_03855 3300038726 Bacteria 16037
748 Ga0400483_017318 3300039062 Bacteria 2209
749 Ga0400483_101085 3300039062 Bacteria 2068
750 Ga0400483_147535 3300039062 Bacteria 2801
751 Ga0400483_268849 3300039062 Bacteria 1271
752 Ga0436360_1263943 3300039438 Bacteria 1862
753 Ga0436361_0160207 3300039447 Bacteria 1369
754 Ga0436361_0200270 3300039447 Bacteria 32952
755 Ga0436361_0442101 3300039447 Bacteria 6881
756 Ga0436361_0544128 3300039447 Bacteria 1689
757 Ga0436361_0572917 3300039447 Bacteria 1843
758 Ga0436361_1148233 3300039447 Bacteria 10382
759 Ga0439436_0000138 3300041404 Bacteria 16615
760 Ga0439436_0001818 3300041404 Bacteria 6278
761 Ga0439438_001842 3300041405 Bacteria 9282
762 Ga0439438_001948 3300041405 Bacteria 9012
763 Ga0439438_002481 3300041405 Bacteria 7845
764 Ga0439438_006466 3300041405 Bacteria 4125
765 Ga0439438_007515 3300041405 Bacteria 3719
766 Ga0439438_010612 3300041405 Bacteria 2903
767 Ga0439438_012365 3300041405 Bacteria 2619
768 Ga0439438_014653 3300041405 Bacteria 2328
769 Ga0439438_019261 3300041405 Bacteria 1930
770 Ga0439438_022238 3300041405 Bacteria 1760
771 Ga0439438_022371 3300041405 Bacteria 1754
772 Ga0439447_001126 3300041407 Bacteria 9721
773 Ga0439447_006157 3300041407 Bacteria 3917
774 Ga0439447_006722 3300041407 Bacteria 3702
775 Ga0439447_017208 3300041407 Bacteria 1970
776 Ga0439466_0001318 3300041411 Bacteria 9674
777 Ga0439466_0001689 3300041411 Bacteria 8615
778 Ga0439466_0005601 3300041411 Bacteria 4792
779 Ga0439466_0007320 3300041411 Bacteria 4181
780 Ga0439466_0013558 3300041411 Bacteria 2983
781 Ga0439466_0013846 3300041411 Bacteria 2947
782 Ga0439466_0014258 3300041411 Bacteria 2897
783 Ga0439466_0030847 3300041411 Bacteria 1836
784 Ga0439466_0031853 3300041411 Bacteria 1801
785 Ga0451791_0140369 3300041451 Bacteria 1463
786 Ga0451853_2692520 3300041512 Bacteria 3798
787 Ga0451853_3310022 3300041512 Bacteria 1625
788 Ga0439442_001679 3300042002 Bacteria 4344
789 Ga0439442_003187 3300042002 Bacteria 3246
790 Ga0439442_005695 3300042002 Bacteria 2495
791 Ga0439442_007164 3300042002 Bacteria 2242
792 Ga0439445_0001026 3300042004 Bacteria 5950
793 Ga0439448_0056989 3300042005 Bacteria 1287
794 Ga0439432_014042 3300042006 Bacteria 2713
795 Ga0439432_015231 3300042006 Bacteria 2597
796 Ga0439432_020579 3300042006 Bacteria 2191
797 Ga0439432_050335 3300042006 Bacteria 1300
798 Ga0439449_0004493 3300042007 Bacteria 5389
799 Ga0439449_0004625 3300042007 Bacteria 5316
800 Ga0439451_005260 3300042009 Bacteria 2635
801 Ga0439452_001086 3300042010 Bacteria 11983
802 Ga0439452_002005 3300042010 Bacteria 7790
803 Ga0439452_005451 3300042010 Bacteria 4093
804 Ga0439452_020021 3300042010 Bacteria 1760
805 Ga0439456_001525 3300042013 Bacteria 4665
806 Ga0439456_021075 3300042013 Bacteria 1377
807 Ga0439463_003818 3300042016 Bacteria 3799
808 Ga0439463_006913 3300042016 Bacteria 2798
809 Ga0450911_000723 3300042115 Bacteria 9607
810 Ga0450911_002416 3300042115 Bacteria 3667
811 Ga0450920_003684 3300042122 Bacteria 2664
812 Ga0450920_021789 3300042122 Bacteria 1240
813 Ga0450922_001378 3300042124 Bacteria 2390
814 Ga0450890_004121 3300042127 Bacteria 1909
815 Ga0450898_008554 3300042134 Bacteria 1618
816 Ga0450903_002198 3300042138 Bacteria 3484
817 Ga0450903_003627 3300042138 Bacteria 2665
818 Ga0450906_001427 3300042145 Bacteria 5200
819 Ga0450906_002475 3300042145 Bacteria 4041
820 Ga0450907_004153 3300042146 Bacteria 2507
821 Ga0450907_006980 3300042146 Bacteria 1883
822 Ga0450907_010887 3300042146 Bacteria 1510
823 Ga0450908_000493 3300042184 Bacteria 7592
824 Ga0450908_002247 3300042184 Bacteria 3773
825 Ga0450908_005161 3300042184 Bacteria 2504
826 Ga0450908_006674 3300042184 Bacteria 2184
827 Ga0439434_0006636 3300042435 Bacteria 3384
828 Ga0439434_0022258 3300042435 Bacteria 1905
829 Ga0439435_0000022 3300042436 Bacteria 17156
830 Ga0439435_0022174 3300042436 Bacteria 1656
831 Ga0439464_0004446 3300042439 Bacteria 3589
832 Ga0439464_0007291 3300042439 Bacteria 2890
833 Ga0439464_0029767 3300042439 Bacteria 1526
834 Ga0450918_001411 3300042531 Bacteria 4777
835 Ga0451577_0187857 3300042876 Bacteria 1863
836 Ga0466969_0030782 3300044656 Bacteria 2733
837 Ga0453683_0012491 3300044673 Bacteria 5565
838 Ga0453683_0025390 3300044673 Bacteria 3766
839 Ga0453683_0034078 3300044673 Bacteria 3210
840 Ga0466965_0000307 3300044683 Bacteria 16337
841 Ga0466965_0008582 3300044683 Bacteria 4728
842 Ga0466966_0000823 3300044684 Bacteria 19761
843 Ga0466966_0113694 3300044684 Bacteria 1667
844 Ga0466961_0002256 3300044693 Bacteria 11971
845 Ga0466961_0007903 3300044693 Bacteria 6777
846 Ga0466961_0013122 3300044693 Bacteria 5300
847 Ga0466961_0020864 3300044693 Bacteria 4215
848 Ga0466963_0000120 3300044694 Bacteria 29251
849 Ga0466963_0113056 3300044694 Bacteria 1865
850 Ga0466964_0008855 3300044706 Bacteria 3783
851 Ga0453684_0155070 3300044712 Bacteria 2716
852 Ga0453684_0251482 3300044712 Bacteria 2029
853 Ga0466971_0000158 3300044719 Bacteria 25444
854 Ga0466971_0004232 3300044719 Bacteria 6185
855 Ga0466971_0047759 3300044719 Bacteria 1924
856 Ga0466970_0000653 3300044765 Bacteria 17057
857 Ga0466970_0032783 3300044765 Bacteria 2745
858 Ga0466970_0107638 3300044765 Bacteria 1521
859 Ga0466957_0000565 3300044842 Bacteria 18681
860 Ga0466960_0000375 3300044901 Bacteria 15277
861 Ga0466959_0003565 3300045049 Bacteria 10239
862 Ga0466959_0209940 3300045049 Bacteria 1353
863 Ga0451576_0000492 3300045051 Bacteria 87364
864 Ga0451576_0008715 3300045051 Bacteria 11870
865 Ga0451576_0342005 3300045051 Bacteria 1566
866 Ga0466958_0000064 3300045836 Bacteria 31891
867 Ga0466958_0059251 3300045836 Bacteria 2329
868 Ga0466958_0148066 3300045836 Bacteria 1480
869 Ga0466967_0000207 3300045976 Bacteria 24750
870 Ga0466967_0069371 3300045976 Bacteria 3150
871 Ga0495617_000419 3300046452 Bacteria 23175
872 Ga0495617_010992 3300046452 Bacteria 3093
873 Ga0495617_011341 3300046452 Bacteria 3040
874 Ga0495617_045579 3300046452 Bacteria 1461
875 Ga0495627_004232 3300046453 Bacteria 6063
876 Ga0495627_009904 3300046453 Bacteria 3488
877 Ga0495627_015563 3300046453 Bacteria 2623
878 Ga0495627_016444 3300046453 Bacteria 2531
879 Ga0495603_0001278 3300046455 Bacteria 14649
880 Ga0495603_0053806 3300046455 Bacteria 2388
881 Ga0495603_0087552 3300046455 Bacteria 1822
882 Ga0495590_0000311 3300046457 Bacteria 25443
883 Ga0495590_0002272 3300046457 Bacteria 8021
884 Ga0495590_0017911 3300046457 Bacteria 2541
885 Ga0495590_0023350 3300046457 Bacteria 2183
886 Ga0495591_005006 3300046458 Bacteria 6251
887 Ga0495591_005182 3300046458 Bacteria 6107
888 Ga0495591_008931 3300046458 Bacteria 4040
889 Ga0495591_016701 3300046458 Bacteria 2544
890 Ga0495591_026752 3300046458 Bacteria 1787
891 Ga0495629_0001057 3300046459 Bacteria 22014
892 Ga0495638_0000690 3300046460 Bacteria 36616
893 Ga0495638_0005968 3300046460 Bacteria 8939
894 Ga0495638_0009156 3300046460 Bacteria 6964
895 Ga0495638_0021865 3300046460 Bacteria 4205
896 Ga0495638_0022412 3300046460 Bacteria 4147
897 Ga0495638_0050623 3300046460 Bacteria 2593
898 Ga0495638_0094164 3300046460 Bacteria 1800
899 Ga0495638_0125659 3300046460 Bacteria 1511
900 Ga0495638_0201175 3300046460 Bacteria 1124
901 Ga0495641_0020992 3300046461 Bacteria 3296
902 Ga0495651_0000646 3300046462 Bacteria 26896
903 Ga0495651_0120592 3300046462 Bacteria 1927
904 Ga0495653_0040212 3300046463 Bacteria 3656
905 Ga0495653_0043497 3300046463 Bacteria 3491
906 Ga0495653_0047939 3300046463 Bacteria 3301
907 Ga0495653_0065228 3300046463 Bacteria 2741
908 Ga0495653_0077378 3300046463 Bacteria 2470
909 Ga0495650_0000254 3300046471 Bacteria 103512
910 Ga0495650_0010806 3300046471 Bacteria 5063
911 Ga0495650_0015050 3300046471 Bacteria 3989
912 Ga0495650_0058664 3300046471 Bacteria 1552
913 Ga0495650_0058849 3300046471 Bacteria 1549
914 Ga0495650_0073013 3300046471 Bacteria 1341
915 Ga0495605_0000152 3300046474 Bacteria 89123
916 Ga0495605_0003305 3300046474 Bacteria 9653
917 Ga0495605_0009172 3300046474 Bacteria 5563
918 Ga0495605_0054444 3300046474 Bacteria 1937
919 Ga0495605_0056403 3300046474 Bacteria 1895
920 Ga0495639_0003410 3300046475 Bacteria 6886
921 Ga0495662_0024046 3300046476 Bacteria 2940
922 Ga0495584_0003579 3300046491 Bacteria 8482
923 Ga0495584_0011393 3300046491 Bacteria 4554
924 Ga0495584_0023705 3300046491 Bacteria 3111
925 Ga0495584_0059484 3300046491 Bacteria 1922
926 Ga0495584_0066578 3300046491 Bacteria 1811
927 Ga0495584_0072515 3300046491 Bacteria 1730
928 Ga0495584_0095164 3300046491 Bacteria 1503
929 Ga0495584_0143288 3300046491 Bacteria 1213
930 Ga0495585_0002697 3300046492 Bacteria 12444
931 Ga0495585_0004014 3300046492 Bacteria 9689
932 Ga0495585_0016536 3300046492 Bacteria 4274
933 Ga0495585_0017338 3300046492 Bacteria 4161
934 Ga0495585_0028914 3300046492 Bacteria 3158
935 Ga0495585_0049782 3300046492 Bacteria 2325
936 Ga0495585_0117920 3300046492 Bacteria 1406
937 Ga0495594_0025112 3300046499 Bacteria 3202
938 Ga0495594_0050960 3300046499 Bacteria 2278
939 Ga0495594_0056704 3300046499 Bacteria 2162
940 Ga0495596_0004342 3300046500 Bacteria 6931
941 Ga0495607_0008226 3300046501 Bacteria 7138
942 Ga0495607_0024512 3300046501 Bacteria 3760
943 Ga0495607_0032477 3300046501 Bacteria 3185
944 Ga0495607_0047283 3300046501 Bacteria 2521
945 Ga0495607_0056231 3300046501 Bacteria 2259
946 Ga0495607_0073720 3300046501 Bacteria 1896
947 Ga0495607_0099526 3300046501 Bacteria 1559
948 Ga0495607_0117212 3300046501 Bacteria 1403
949 Ga0495583_0018804 3300046506 Bacteria 3626
950 Ga0495583_0021265 3300046506 Bacteria 3342
951 Ga0495583_0024995 3300046506 Bacteria 2991
952 Ga0495583_0028527 3300046506 Bacteria 2742
953 Ga0495583_0034276 3300046506 Bacteria 2433
954 Ga0495583_0053399 3300046506 Bacteria 1834
955 Ga0495583_0083878 3300046506 Bacteria 1381
956 Ga0495606_0004950 3300046507 Bacteria 13005
957 Ga0495606_0008316 3300046507 Bacteria 9045
958 Ga0495606_0021464 3300046507 Bacteria 4729
959 Ga0495606_0025613 3300046507 Bacteria 4220
960 Ga0495606_0036586 3300046507 Bacteria 3341
961 Ga0495606_0051628 3300046507 Bacteria 2681
962 Ga0495606_0067722 3300046507 Bacteria 2259
963 Ga0495606_0071930 3300046507 Bacteria 2175
964 Ga0495606_0146951 3300046507 Bacteria 1387
965 Ga0495608_0162800 3300046511 Bacteria 1418
966 Ga0495610_0004852 3300046512 Bacteria 9782
967 Ga0495610_0023130 3300046512 Bacteria 3385
968 Ga0495610_0025046 3300046512 Bacteria 3211
969 Ga0495610_0034354 3300046512 Bacteria 2612
970 Ga0495610_0045744 3300046512 Bacteria 2164
971 Ga0495616_0002064 3300046513 Bacteria 13495
972 Ga0495616_0010258 3300046513 Bacteria 5429
973 Ga0495616_0018249 3300046513 Bacteria 3854
974 Ga0495616_0038139 3300046513 Bacteria 2468
975 Ga0495616_0057492 3300046513 Bacteria 1917
976 Ga0495616_0061435 3300046513 Bacteria 1842
977 Ga0495620_0013582 3300046515 Bacteria 4165
978 Ga0495620_0019141 3300046515 Bacteria 3374
979 Ga0495620_0029780 3300046515 Bacteria 2522
980 Ga0495630_0083442 3300046517 Bacteria 2412
981 Ga0495631_0003311 3300046518 Bacteria 8860
982 Ga0495631_0006697 3300046518 Bacteria 5919
983 Ga0495631_0016236 3300046518 Bacteria 3554
984 Ga0495632_0014317 3300046519 Bacteria 4490
985 Ga0495632_0034155 3300046519 Bacteria 2605
986 Ga0495632_0036777 3300046519 Bacteria 2488
987 Ga0495632_0047812 3300046519 Bacteria 2120
988 Ga0495632_0052882 3300046519 Bacteria 1995
989 Ga0495632_0081407 3300046519 Bacteria 1544
990 Ga0495637_0001495 3300046520 Bacteria 13703
991 Ga0495637_0012561 3300046520 Bacteria 4046
992 Ga0495637_0016665 3300046520 Bacteria 3433
993 Ga0495637_0022274 3300046520 Bacteria 2891
994 Ga0495637_0023314 3300046520 Bacteria 2815
995 Ga0495637_0031551 3300046520 Bacteria 2342
996 Ga0495637_0039038 3300046520 Bacteria 2052
997 Ga0495637_0072443 3300046520 Bacteria 1387
998 Ga0495643_0032050 3300046522 Bacteria 2920
999 Ga0495643_0037125 3300046522 Bacteria 2674
1000 Ga0495643_0060483 3300046522 Bacteria 2010
1001 Ga0495643_0079608 3300046522 Bacteria 1708
1002 Ga0495644_0037645 3300046523 Bacteria 1825
1003 Ga0495648_0000274 3300046524 Bacteria 57965
1004 Ga0495648_0001541 3300046524 Bacteria 22515
1005 Ga0495648_0006414 3300046524 Bacteria 9604
1006 Ga0495648_0012181 3300046524 Bacteria 6429
1007 Ga0495648_0016062 3300046524 Bacteria 5405
1008 Ga0495648_0023973 3300046524 Bacteria 4166
1009 Ga0495648_0030090 3300046524 Bacteria 3596
1010 Ga0495648_0031607 3300046524 Bacteria 3483
1011 Ga0495648_0046737 3300046524 Bacteria 2680
1012 Ga0495648_0047997 3300046524 Bacteria 2632
1013 Ga0495648_0053072 3300046524 Bacteria 2458
1014 Ga0495648_0054797 3300046524 Bacteria 2407
1015 Ga0495663_0015746 3300046525 Bacteria 2133
1016 Ga0495666_0050817 3300046526 Bacteria 1992
1017 Ga0495642_0002842 3300046528 Bacteria 6910
1018 Ga0495642_0004228 3300046528 Bacteria 5590
1019 Ga0495642_0011523 3300046528 Bacteria 3398
1020 Ga0495642_0015934 3300046528 Bacteria 2926
1021 Ga0495642_0019757 3300046528 Bacteria 2640
1022 Ga0495642_0023678 3300046528 Bacteria 2425
1023 Ga0495652_0050172 3300046529 Bacteria 3569
1024 Ga0495654_0013072 3300046530 Bacteria 4446
1025 Ga0495654_0014527 3300046530 Bacteria 4190
1026 Ga0495654_0022792 3300046530 Bacteria 3247
1027 Ga0495654_0028076 3300046530 Bacteria 2879
1028 Ga0495654_0036253 3300046530 Bacteria 2480
1029 Ga0495654_0036527 3300046530 Bacteria 2468
1030 Ga0495654_0038506 3300046530 Bacteria 2390
1031 Ga0495654_0040898 3300046530 Bacteria 2307
1032 Ga0495654_0052619 3300046530 Bacteria 1981
1033 Ga0495654_0063601 3300046530 Bacteria 1766
1034 Ga0495654_0084069 3300046530 Bacteria 1487
1035 Ga0495654_0097376 3300046530 Bacteria 1358
1036 Ga0495665_0001906 3300046531 Bacteria 11248
1037 Ga0495665_0112556 3300046531 Bacteria 1427
1038 Ga0495586_0079153 3300046535 Bacteria 1804
1039 Ga0495609_0006819 3300046538 Bacteria 5773
1040 Ga0495609_0031484 3300046538 Bacteria 2410
1041 Ga0495609_0032935 3300046538 Bacteria 2352
1042 Ga0495609_0039141 3300046538 Bacteria 2135
1043 Ga0495597_0000477 3300046542 Bacteria 33829
1044 Ga0495597_0001172 3300046542 Bacteria 19661
1045 Ga0495597_0005204 3300046542 Bacteria 6922
1046 Ga0495597_0015990 3300046542 Bacteria 3547
1047 Ga0495597_0019402 3300046542 Bacteria 3182
1048 Ga0495597_0031645 3300046542 Bacteria 2405
1049 Ga0495597_0038142 3300046542 Bacteria 2155
1050 Ga0495597_0039801 3300046542 Bacteria 2103
1051 Ga0495597_0053963 3300046542 Bacteria 1766
1052 Ga0495597_0095733 3300046542 Bacteria 1256
1053 Ga0495645_0002166 3300046543 Bacteria 13340
1054 Ga0495645_0105897 3300046543 Bacteria 1995
1055 Ga0495622_0012351 3300046557 Bacteria 3952
1056 Ga0495622_0032432 3300046557 Bacteria 2439
1057 Ga0495622_0042600 3300046557 Bacteria 2110
1058 Ga0495622_0092611 3300046557 Bacteria 1388
1059 Ga0495633_0018782 3300046558 Bacteria 3504
1060 Ga0495633_0019960 3300046558 Bacteria 3380
1061 Ga0495633_0074594 3300046558 Bacteria 1581
1062 Ga0495667_0106370 3300046559 Bacteria 1813
1063 Ga0495656_0000221 3300046615 Bacteria 20331
1064 Ga0495656_0012748 3300046615 Bacteria 3110
1065 Ga0495656_0023037 3300046615 Bacteria 2446
1066 Ga0495668_0017235 3300046616 Bacteria 4192
1067 Ga0495668_0035550 3300046616 Bacteria 2792
1068 Ga0495668_0054775 3300046616 Bacteria 2203
1069 Ga0495668_0067312 3300046616 Bacteria 1970
1070 Ga0495634_0028485 3300046642 Bacteria 3876
1071 Ga0495611_0004389 3300046648 Bacteria 6108
1072 Ga0495611_0043506 3300046648 Bacteria 2008
1073 Ga0495625_0000197 3300046660 Bacteria 95865
1074 Ga0495625_0007062 3300046660 Bacteria 9868
1075 Ga0495625_0014742 3300046660 Bacteria 6222
1076 Ga0495625_0021990 3300046660 Bacteria 4897
1077 Ga0495625_0032446 3300046660 Bacteria 3870
1078 Ga0495625_0043510 3300046660 Bacteria 3256
1079 Ga0495625_0073312 3300046660 Bacteria 2400
1080 Ga0495625_0125699 3300046660 Bacteria 1741
1081 Ga0495625_0149239 3300046660 Bacteria 1572
1082 Ga0495635_0011014 3300046663 Bacteria 6338
1083 Ga0495635_0026960 3300046663 Bacteria 3997
1084 Ga0495635_0030513 3300046663 Bacteria 3746
1085 Ga0495659_0000040 3300046664 Bacteria 59388
1086 Ga0495659_0025721 3300046664 Bacteria 2016
1087 Ga0495661_0000348 3300046665 Bacteria 50388
1088 Ga0495661_0007080 3300046665 Bacteria 7834
1089 Ga0495661_0009327 3300046665 Bacteria 6737
1090 Ga0495661_0034500 3300046665 Bacteria 3183
1091 Ga0495661_0079320 3300046665 Bacteria 1897
1092 Ga0495661_0098562 3300046665 Bacteria 1649
1093 Ga0495588_0022541 3300046674 Bacteria 3113
1094 Ga0495588_0029999 3300046674 Bacteria 2731
1095 Ga0495588_0063300 3300046674 Bacteria 1918
1096 Ga0495623_0024842 3300046679 Bacteria 3859
1097 Ga0495623_0041129 3300046679 Bacteria 2950
1098 Ga0495646_0090837 3300046680 Bacteria 1763
1099 Ga0495669_0041078 3300046684 Bacteria 2052
1100 Ga0495613_0006465 3300046689 Bacteria 8763
1101 Ga0495613_0047629 3300046689 Bacteria 3166
1102 Ga0495624_0010903 3300046690 Bacteria 6265
1103 Ga0495670_0015225 3300046691 Bacteria 3781
1104 Ga0495670_0019138 3300046691 Bacteria 3374
1105 Ga0495670_0021409 3300046691 Bacteria 3188
1106 Ga0495671_0013014 3300046692 Bacteria 4524
1107 Ga0495671_0027762 3300046692 Bacteria 2919
1108 Ga0495671_0039701 3300046692 Bacteria 2375
1109 Ga0495671_0040390 3300046692 Bacteria 2352
1110 Ga0495671_0054844 3300046692 Bacteria 1975
1111 Ga0495671_0058621 3300046692 Bacteria 1904
1112 Ga0495671_0059730 3300046692 Bacteria 1883
1113 Ga0495671_0095599 3300046692 Bacteria 1453
1114 Ga0495649_0000571 3300046694 Bacteria 31125
1115 Ga0495649_0009534 3300046694 Bacteria 5760
1116 Ga0495649_0018434 3300046694 Bacteria 3927
1117 Ga0495649_0023723 3300046694 Bacteria 3426
1118 Ga0495649_0048384 3300046694 Bacteria 2310
1119 Ga0495649_0070961 3300046694 Bacteria 1867
1120 Ga0495649_0071009 3300046694 Bacteria 1866
1121 Ga0495649_0119615 3300046694 Bacteria 1393
1122 Ga0495589_0014806 3300046794 Bacteria 4011
1123 Ga0495589_0034929 3300046794 Bacteria 2521
1124 Ga0495589_0041163 3300046794 Bacteria 2306
1125 Ga0495589_0089205 3300046794 Bacteria 1497
1126 Ga0495589_0100169 3300046794 Bacteria 1402
1127 Ga0495600_0034578 3300046809 Bacteria 3281
1128 Ga0495600_0043455 3300046809 Bacteria 2930
1129 Ga0495600_0051406 3300046809 Bacteria 2690
1130 Ga0495600_0151359 3300046809 Bacteria 1502
1131 Ga0495600_0212463 3300046809 Bacteria 1239
1132 Ga0495660_0000852 3300046810 Bacteria 22522
1133 Ga0495660_0017765 3300046810 Bacteria 4091
1134 Ga0495660_0024102 3300046810 Bacteria 3467
1135 Ga0495660_0025621 3300046810 Bacteria 3348
1136 Ga0495660_0033046 3300046810 Bacteria 2903
1137 Ga0495660_0042675 3300046810 Bacteria 2505
1138 Ga0495660_0045590 3300046810 Bacteria 2406
1139 Ga0495660_0049378 3300046810 Bacteria 2297
1140 Ga0495660_0051607 3300046810 Bacteria 2237
1141 Ga0495660_0077262 3300046810 Bacteria 1752
1142 Ga0495660_0084517 3300046810 Bacteria 1659
1143 Ga0495660_0102574 3300046810 Bacteria 1470
1144 Ga0495660_0104948 3300046810 Bacteria 1449
1145 Ga0495660_0111350 3300046810 Bacteria 1396
1146 Ga0495660_0132777 3300046810 Bacteria 1247
1147 Ga0495581_0026016 3300047315 Bacteria 3394
1148 Ga0495581_0039125 3300047315 Bacteria 2745
1149 Ga0495581_0056157 3300047315 Bacteria 2273
1150 Ga0495581_0056419 3300047315 Bacteria 2267
1151 Ga0495581_0062217 3300047315 Bacteria 2156
1152 Ga0495581_0189128 3300047315 Bacteria 1204
1153 Ga0495604_0031057 3300047317 Bacteria 4239
1154 Ga0495604_0069025 3300047317 Bacteria 2680
1155 Ga0495674_0003165 3300047319 Bacteria 15977
1156 Ga0495674_0231885 3300047319 Bacteria 1523
1157 Ga0495672_0000136 3300047320 Bacteria 108633
1158 Ga0495672_0028549 3300047320 Bacteria 3528
1159 Ga0495672_0029929 3300047320 Bacteria 3422
1160 Ga0495672_0030524 3300047320 Bacteria 3379
1161 Ga0495672_0031290 3300047320 Bacteria 3323
1162 Ga0495672_0043880 3300047320 Bacteria 2685
1163 Ga0495672_0051294 3300047320 Bacteria 2430
1164 Ga0495672_0057028 3300047320 Bacteria 2269
1165 Ga0495676_0010324 3300047321 Bacteria 8473
1166 Ga0495676_0041144 3300047321 Bacteria 3806
1167 Ga0495676_0055931 3300047321 Bacteria 3124
1168 Ga0495680_0008487 3300047322 Bacteria 9332
1169 Ga0495680_0071799 3300047322 Bacteria 2634
1170 Ga0495680_0073605 3300047322 Bacteria 2596
1171 Ga0495680_0095059 3300047322 Bacteria 2228
1172 Ga0495680_0123845 3300047322 Bacteria 1906
1173 Ga0495683_0014433 3300047323 Bacteria 4115
1174 Ga0495683_0019660 3300047323 Bacteria 3484
1175 Ga0495683_0064884 3300047323 Bacteria 1802
1176 Ga0495687_003317 3300047443 Bacteria 11802
1177 Ga0495687_011357 3300047443 Bacteria 4798
1178 Ga0495687_015066 3300047443 Bacteria 3945
1179 Ga0495687_016835 3300047443 Bacteria 3666
1180 Ga0495675_0034380 3300047444 Bacteria 3236
1181 Ga0495675_0139309 3300047444 Bacteria 1504
1182 Ga0495677_0012467 3300047445 Bacteria 3100
1183 Ga0495679_008826 3300047446 Bacteria 4069
1184 Ga0495679_012135 3300047446 Bacteria 3292
1185 Ga0495679_019635 3300047446 Bacteria 2369
1186 Ga0495679_030992 3300047446 Bacteria 1730
1187 Ga0495685_003555 3300047447 Bacteria 4983
1188 Ga0495673_0000470 3300047469 Bacteria 43772
1189 Ga0495673_0003288 3300047469 Bacteria 10729
1190 Ga0495673_0003698 3300047469 Bacteria 9956
1191 Ga0495673_0004242 3300047469 Bacteria 9047
1192 Ga0495673_0007229 3300047469 Bacteria 6416
1193 Ga0495673_0013100 3300047469 Bacteria 4367
1194 Ga0495673_0013139 3300047469 Bacteria 4360
1195 Ga0495673_0014605 3300047469 Bacteria 4079
1196 Ga0495673_0015571 3300047469 Bacteria 3914
1197 Ga0495673_0019237 3300047469 Bacteria 3424
1198 Ga0495673_0027436 3300047469 Bacteria 2710
1199 Ga0495673_0030250 3300047469 Bacteria 2545
1200 Ga0495673_0030694 3300047469 Bacteria 2522
1201 Ga0495673_0070805 3300047469 Bacteria 1467
1202 Ga0495673_0079593 3300047469 Bacteria 1360
1203 Ga0495681_0007528 3300047470 Bacteria 6938
1204 Ga0495681_0008957 3300047470 Bacteria 6213
1205 Ga0495681_0011782 3300047470 Bacteria 5177
1206 Ga0495681_0015638 3300047470 Bacteria 4286
1207 Ga0495681_0019441 3300047470 Bacteria 3709
1208 Ga0495681_0020884 3300047470 Bacteria 3541
1209 Ga0495681_0030089 3300047470 Bacteria 2770
1210 Ga0495681_0044945 3300047470 Bacteria 2118
1211 Ga0495681_0060150 3300047470 Bacteria 1753
1212 Ga0495684_0010235 3300047471 Bacteria 7254
1213 Ga0495684_0057634 3300047471 Bacteria 2960
1214 Ga0495684_0066398 3300047471 Bacteria 2743
1215 Ga0495686_0001077 3300047472 Bacteria 32501
1216 Ga0495686_0003271 3300047472 Bacteria 14174
1217 Ga0495686_0005700 3300047472 Bacteria 9732
1218 Ga0495686_0023849 3300047472 Bacteria 4026
1219 Ga0495686_0030077 3300047472 Bacteria 3529
1220 Ga0495686_0034795 3300047472 Bacteria 3241
1221 Ga0495686_0053249 3300047472 Bacteria 2536
1222 Ga0495686_0124775 3300047472 Bacteria 1531
1223 Ga0495686_0143086 3300047472 Bacteria 1410
1224 Ga0495593_0067661 3300047673 Bacteria 1859
1225 Ga0495602_0060466 3300048088 Bacteria 3300
1226 Ga0495602_0148492 3300048088 Bacteria 1846
1227 Ga0495602_0226987 3300048088 Bacteria 1405
1228 Ga0495614_0000477 3300048089 Bacteria 16487
1229 Ga0495614_0017584 3300048089 Bacteria 3106
1230 Ga0495626_0002989 3300048091 Bacteria 11207
1231 Ga0495626_0004591 3300048091 Bacteria 8420
1232 Ga0495626_0005932 3300048091 Bacteria 7030
1233 Ga0495626_0005986 3300048091 Bacteria 6999
1234 Ga0495626_0014079 3300048091 Bacteria 4136
1235 Ga0495626_0016898 3300048091 Bacteria 3696
1236 Ga0495626_0018282 3300048091 Bacteria 3523
1237 Ga0495626_0032805 3300048091 Bacteria 2491
1238 Ga0496100_0071260 3300048903 Bacteria 2320
1239 Ga0496101_0003964 3300048904 Bacteria 9261
1240 Ga0496102_0001247 3300048905 Bacteria 22962
1241 Ga0496102_0006177 3300048905 Bacteria 10212
1242 Ga0496102_0008207 3300048905 Bacteria 8938
1243 Ga0496102_0010101 3300048905 Bacteria 8120
1244 Ga0496102_0014650 3300048905 Bacteria 6816
1245 Ga0496102_0112072 3300048905 Bacteria 2544
1246 Ga0496102_0149378 3300048905 Bacteria 2195
1247 Ga0496103_0003305 3300048906 Bacteria 9861
1248 Ga0496103_0009348 3300048906 Bacteria 5807
1249 Ga0496103_0080536 3300048906 Bacteria 2048
1250 Ga0496104_0004823 3300048907 Bacteria 11755
1251 Ga0496104_0038354 3300048907 Bacteria 4483
1252 Ga0496104_0052579 3300048907 Bacteria 3848
1253 Ga0496104_0302236 3300048907 Bacteria 1512
1254 Ga0496105_0002650 3300048908 Bacteria 13031
1255 Ga0496105_0060437 3300048908 Bacteria 3127
1256 Ga0496105_0149548 3300048908 Bacteria 1920
1257 Ga0496105_0152803 3300048908 Bacteria 1897
1258 Ga0496106_0004823 3300048909 Bacteria 9980
1259 Ga0496107_0050128 3300048910 Bacteria 3009
1260 Ga0496108_0087016 3300048911 Bacteria 2653
1261 Ga0496110_0176537 3300048913 Bacteria 1939
1262 Ga0496110_0191882 3300048913 Bacteria 1855
1263 Ga0496112_0005803 3300048915 Bacteria 10741
1264 Ga0496112_0177893 3300048915 Bacteria 2092
1265 Ga0496113_0011897 3300048916 Bacteria 5832
1266 Ga0496115_0130884 3300048918 Bacteria 2068
1267 Ga0496116_0000943 3300048919 Bacteria 35796
1268 Ga0496116_0009275 3300048919 Bacteria 8413
1269 Ga0496116_0011789 3300048919 Bacteria 7196
1270 Ga0496116_0015154 3300048919 Bacteria 6111
1271 Ga0496116_0078289 3300048919 Bacteria 2062
1272 Ga0496116_0135175 3300048919 Bacteria 1398
1273 Ga0496117_0007953 3300048920 Bacteria 10185
1274 Ga0496117_0017503 3300048920 Bacteria 5983
1275 Ga0496117_0021965 3300048920 Bacteria 5137
1276 Ga0496117_0095479 3300048920 Bacteria 1900
1277 Ga0496117_0164845 3300048920 Bacteria 1293
1278 Ga0496118_0004899 3300048921 Bacteria 15562
1279 Ga0496118_0008847 3300048921 Bacteria 10302
1280 Ga0496118_0047119 3300048921 Bacteria 3345
1281 Ga0496118_0077011 3300048921 Bacteria 2367
1282 Ga0496118_0092538 3300048921 Bacteria 2075
1283 Ga0496118_0137542 3300048921 Bacteria 1556
1284 Ga0496119_0001823 3300048922 Bacteria 24690
1285 Ga0496119_0008519 3300048922 Bacteria 8992
1286 Ga0496119_0065325 3300048922 Bacteria 2155
1287 Ga0496120_0000042 3300048923 Bacteria 197055
1288 Ga0496120_0016914 3300048923 Bacteria 4748
1289 Ga0496120_0026078 3300048923 Bacteria 3616
1290 Ga0496121_0004935 3300048924 Bacteria 17501
1291 Ga0496121_0013475 3300048924 Bacteria 8778
1292 Ga0496121_0017904 3300048924 Bacteria 7188
1293 Ga0496121_0032738 3300048924 Bacteria 4719
1294 Ga0496121_0060163 3300048924 Bacteria 3126
1295 Ga0496122_0000224 3300048925 Bacteria 126514
1296 Ga0496122_0001311 3300048925 Bacteria 40819
1297 Ga0496122_0108992 3300048925 Bacteria 1824
1298 Ga0496123_0000187 3300048926 Bacteria 125396
1299 Ga0496123_0002525 3300048926 Bacteria 22460
1300 Ga0496123_0075482 3300048926 Bacteria 2080
1301 Ga0496123_0077598 3300048926 Bacteria 2039
1302 Ga0496124_0005554 3300048927 Bacteria 14125
1303 Ga0496124_0006344 3300048927 Bacteria 12910
1304 Ga0496124_0027632 3300048927 Bacteria 5088
1305 Ga0496124_0039679 3300048927 Bacteria 4078
1306 Ga0496124_0040365 3300048927 Bacteria 4037
1307 Ga0496124_0049974 3300048927 Bacteria 3565
1308 Ga0496124_0053110 3300048927 Bacteria 3438
1309 Ga0496124_0123921 3300048927 Bacteria 2061
1310 Ga0496125_0001129 3300048928 Bacteria 40763
1311 Ga0496125_0014244 3300048928 Bacteria 7751
1312 Ga0496125_0021482 3300048928 Bacteria 6020
1313 Ga0496125_0021884 3300048928 Bacteria 5950
1314 Ga0496125_0026943 3300048928 Bacteria 5220
1315 Ga0496125_0162468 3300048928 Bacteria 1514
1316 Ga0496125_0162616 3300048928 Bacteria 1513
1317 Ga0496125_0186634 3300048928 Bacteria 1374
1318 Ga0496126_0001122 3300048929 Bacteria 44809
1319 Ga0496126_0050559 3300048929 Bacteria 3787
1320 Ga0496126_0058456 3300048929 Bacteria 3476
1321 Ga0496126_0069637 3300048929 Bacteria 3137
1322 Ga0496126_0083261 3300048929 Bacteria 2824
1323 Ga0495678_000734 3300049459 Bacteria 29779
1324 Ga0495678_000892 3300049459 Bacteria 26497
1325 Ga0495678_015103 3300049459 Bacteria 3565
1326 Ga0495678_016346 3300049459 Bacteria 3395
1327 Ga0495678_017940 3300049459 Bacteria 3193
1328 Ga0495678_036984 3300049459 Bacteria 1987
1329 Ga0495678_041186 3300049459 Bacteria 1850
1330 Ga0495678_044098 3300049459 Bacteria 1766
1331 Ga0495678_062713 3300049459 Bacteria 1390
1332 Ga0495682_0010986 3300049460 Bacteria 3490
1333 Ga0495682_0020007 3300049460 Bacteria 2514
1334 Ga0501290_002178 3300049513 Bacteria 2548
1335 Ga0501294_000001 3300049517 Bacteria 34855
1336 Ga0501300_000191 3300049523 Bacteria 9279
1337 Ga0501033_0201174 3300049570 Bacteria 1423
1338 Ga0501034_0000379 3300049571 Bacteria 75837
1339 Ga0501034_0001044 3300049571 Bacteria 39462
1340 Ga0501034_0002761 3300049571 Bacteria 20617
1341 Ga0501034_0100667 3300049571 Bacteria 2884
1342 Ga0501034_0208567 3300049571 Bacteria 1910
1343 Ga0501037_0044681 3300049573 Bacteria 3253
1344 Ga0501039_0011293 3300049575 Bacteria 6802
1345 Ga0501039_0084867 3300049575 Bacteria 2467
1346 Ga0501039_0288979 3300049575 Bacteria 1289
1347 Ga0501042_0026545 3300049578 Bacteria 4069
1348 Ga0501043_0024290 3300049579 Bacteria 4757
1349 Ga0501047_0009469 3300049581 Bacteria 9203
1350 Ga0501047_0009540 3300049581 Bacteria 9173
1351 Ga0501069_0000672 3300049585 Bacteria 15878
1352 Ga0501069_0077776 3300049585 Bacteria 1865
1353 Ga0501070_0076424 3300049586 Bacteria 2772
1354 Ga0501071_0005154 3300049587 Bacteria 8372
1355 Ga0501071_0082388 3300049587 Bacteria 2356
1356 Ga0501072_0085548 3300049588 Bacteria 2501
1357 Ga0501075_0037644 3300049591 Bacteria 3615
1358 Ga0501076_0086908 3300049592 Bacteria 2513
1359 Ga0501206_000314 3300049653 Bacteria 5691
1360 Ga0501235_014775 3300049669 Bacteria 1721
1361 Ga0501225_0003896 3300049705 Bacteria 4470
1362 Ga0501225_0006737 3300049705 Bacteria 3348
1363 Ga0501079_0227591 3300049741 Bacteria 1457
1364 Ga0501080_0001619 3300049742 Bacteria 19144
1365 Ga0501080_0002448 3300049742 Bacteria 16233
1366 Ga0501080_0161824 3300049742 Bacteria 2067
1367 Ga0501083_0010630 3300049744 Bacteria 6479
1368 Ga0501241_005788 3300049758 Bacteria 2294
1369 Ga0501262_000056 3300049759 Bacteria 13717
1370 Ga0501280_008718 3300049776 Bacteria 1412
1371 Ga0501282_000001 3300049778 Bacteria 101349
1372 Ga0501044_0025399 3300049823 Bacteria 6279
1373 nmdc:mga03683_11778_c1 3300050489 Bacteria 3178
1374 nmdc:mga03683_18817_c1 3300050489 Bacteria 2631
1375 nmdc:mga03683_24512_c1 3300050489 Bacteria 2361
1376 nmdc:mga03683_2543_c1 3300050489 Bacteria 5688
1377 nmdc:mga03683_68793_c1 3300050489 Bacteria 1509
1378 nmdc:mga03n38_41052_c1 3300050490 Bacteria 2014
1379 nmdc:mga03n38_54511_c1 3300050490 Bacteria 1797
1380 nmdc:mga03n38_93965_c1 3300050490 Bacteria 1433
1381 nmdc:mga0yw44_110686_c1 3300050492 Bacteria 1759
1382 nmdc:mga0yw44_20037_c1 3300050492 Bacteria 3703
1383 nmdc:mga0yw44_331_c2 3300050492 Bacteria 16251
1384 nmdc:mga0yw44_37630_c1 3300050492 Bacteria 2858
1385 nmdc:mga0yw44_878_c1 3300050492 Bacteria 11320
1386 nmdc:mga0k408_119369_c1 3300050493 Bacteria 1561
1387 nmdc:mga0k408_3816_c1 3300050493 Bacteria 7989
1388 nmdc:mga0k408_42121_c1 3300050493 Bacteria 2630
1389 nmdc:mga0k408_53806_c1 3300050493 Bacteria 2333
1390 nmdc:mga0k408_95516_c1 3300050493 Bacteria 1749
1391 nmdc:mga06z11_5469_c1 3300050494 Bacteria 5099
1392 nmdc:mga04h51_10138_c1 3300050495 Bacteria 2579
1393 nmdc:mga07m45_21074_c1 3300050496 Bacteria 3546
1394 nmdc:mga07m45_26200_c1 3300050496 Bacteria 3204
1395 nmdc:mga07m45_5154_c1 3300050496 Bacteria 6478
1396 nmdc:mga07m45_59483_c1 3300050496 Bacteria 2162
1397 nmdc:mga07m45_65075_c1 3300050496 Bacteria 2070
1398 nmdc:mga07m45_8090_c1 3300050496 Bacteria 5392
1399 nmdc:mga07m45_81849_c1 3300050496 Bacteria 1844
1400 nmdc:mga07m45_83260_c1 3300050496 Bacteria 1828
1401 nmdc:mga07m45_872_c1 3300050496 Bacteria 13146
1402 nmdc:mga07m45_93182_c1 3300050496 Bacteria 1727
1403 nmdc:mga06r32_231803_c1 3300050510 Bacteria 1834
1404 nmdc:mga08y16_11899_c1 3300050511 Bacteria 9139
1405 nmdc:mga08y16_245227_c1 3300050511 Bacteria 1851
1406 nmdc:mga0n895_280_c1 3300050512 Bacteria 33650
1407 nmdc:mga0rr50_179908_c1 3300050513 Bacteria 1728
1408 nmdc:mga0rr50_350_c1 3300050513 Bacteria 25198
1409 nmdc:mga08x19_210498_c1 3300050514 Bacteria 1334
1410 nmdc:mga0a205_1570_c1 3300050515 Bacteria 19575
1411 nmdc:mga0sz30_28123_c1 3300050516 Bacteria 2312
1412 nmdc:mga0sz30_34691_c1 3300050516 Bacteria 2102
1413 nmdc:mga0sz30_492_c1 3300050516 Bacteria 14711
1414 nmdc:mga0sz30_7096_c1 3300050516 Bacteria 4190
1415 Ga0495601_0005164 3300053077 Bacteria 7588
1416 Ga0495601_0057403 3300053077 Bacteria 2466
1417 Ga0495601_0071296 3300053077 Bacteria 2219
1418 Ga0500578_0000597 3300053086 Bacteria 43685
1419 Ga0500578_0089362 3300053086 Bacteria 1955
1420 Ga0500578_0097222 3300053086 Bacteria 1866
1421 Ga0500643_000040 3300053087 Bacteria 168108
1422 Ga0500646_0015646 3300053090 Bacteria 1977
1423 Ga0500583_0037307 3300053092 Bacteria 2182
1424 Ga0500583_0052934 3300053092 Bacteria 1890
1425 Ga0500641_0001787 3300053096 Bacteria 7614
1426 Ga0500641_0017906 3300053096 Bacteria 2657
1427 Ga0500654_050727 3300053099 Bacteria 2237
1428 Ga0500555_005318 3300053103 Bacteria 3652
1429 Ga0500556_0000150 3300053104 Bacteria 57930
1430 Ga0500556_0032001 3300053104 Bacteria 1794
1431 Ga0500562_001784 3300053108 Bacteria 5380
1432 Ga0500562_002430 3300053108 Bacteria 4674
1433 Ga0500569_002375 3300053109 Bacteria 3695
1434 Ga0500572_005648 3300053111 Bacteria 2843
1435 Ga0500594_0000535 3300053118 Bacteria 8241
1436 Ga0500595_012649 3300053119 Bacteria 3256
1437 Ga0500595_013850 3300053119 Bacteria 3078
1438 Ga0500652_003456 3300053131 Bacteria 4791
1439 Ga0500658_0005366 3300053134 Bacteria 4770
1440 Ga0500561_0001399 3300053137 Bacteria 3927
1441 Ga0500564_000387 3300053138 Bacteria 12569
1442 Ga0500568_0004905 3300053139 Bacteria 7044
1443 Ga0500568_0011540 3300053139 Bacteria 4091
1444 Ga0500577_0030551 3300053142 Bacteria 1877
1445 Ga0500600_0024394 3300053149 Bacteria 3603
1446 Ga0500604_0000093 3300053151 Bacteria 28700
1447 Ga0500616_0016933 3300053153 Bacteria 4138
1448 Ga0500622_0003196 3300053156 Bacteria 11161
1449 Ga0500622_0006152 3300053156 Bacteria 7040
1450 Ga0500633_0003384 3300053160 Bacteria 3470
1451 Ga0500634_0016794 3300053161 Bacteria 3911
1452 Ga0500634_0021049 3300053161 Bacteria 3529
1453 Ga0500645_000100 3300053730 Bacteria 68299
1454 Ga0500645_001458 3300053730 Bacteria 11931
1455 Ga0500645_006225 3300053730 Bacteria 4283
1456 Ga0500656_001303 3300053732 Bacteria 2126
1457 Ga0500552_001657 3300053733 Bacteria 2126
1458 Ga0500587_000973 3300053739 Bacteria 3854
1459 Ga0501082_0009073 3300060353 Bacteria 8579
1460 Ga0466962_0001580 3300061719 Bacteria 10655
1461 Ga0466962_0005899 3300061719 Bacteria 5885
1462 Ga0530510_0181580 3300061734 Bacteria 1561

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041451 Ga0451791_0140369 Ga0451791_0140369_513_1436 296
2 3300025935 Ga0207709_10052206 Ga0207709_100522063 306
3 3300025949 Ga0207667_10048683 Ga0207667_100486835 315
4 iso_pu_bacteria 8003870546 8003871321 315
5 3300049705 Ga0501225_0006737 Ga0501225_0006737_1679_2728 316
6 3300032004 Ga0307414_10146213 Ga0307414_101462132 318
7 3300042439 Ga0439464_0029767 Ga0439464_0029767_523_1506 318
8 3300046452 Ga0495617_045579 Ga0495617_045579_466_1449 318
9 3300046471 Ga0495650_0058849 Ga0495650_0058849_540_1523 318
10 3300046491 Ga0495584_0143288 Ga0495584_0143288_212_1195 318
11 3300046809 Ga0495600_0151359 Ga0495600_0151359_478_1461 318
12 3300047315 Ga0495581_0189128 Ga0495581_0189128_16_999 318
13 3300047469 Ga0495673_0070805 Ga0495673_0070805_17_1000 318
14 3300047315 Ga0495581_0062217 Ga0495581_0062217_979_1998 324
15 3300005843 Ga0068860_100003227 Ga0068860_10000322719 337
16 3300028381 Ga0268264_10009372 Ga0268264_100093723 337
17 3300031665 Ga0316575_10000138 Ga0316575_100001385 337
18 3300046529 Ga0495652_0050172 Ga0495652_0050172_1455_2597 337
19 3300005355 Ga0070671_100041590 Ga0070671_1000415903 338
20 3300006237 Ga0097621_100321685 Ga0097621_1003216851 338
21 3300025986 Ga0207658_10165783 Ga0207658_101657832 338
22 3300046528 Ga0495642_0015934 Ga0495642_0015934_1373_2524 338
23 3300048091 Ga0495626_0004591 Ga0495626_0004591_6909_8051 338
24 3300047322 Ga0495680_0073605 Ga0495680_0073605_30_1151 340
25 3300047673 Ga0495593_0067661 Ga0495593_0067661_495_1646 340
26 3300048089 Ga0495614_0017584 Ga0495614_0017584_1111_2253 340
27 3300053077 Ga0495601_0005164 Ga0495601_0005164_3682_4842 340
28 3300046471 Ga0495650_0000254 Ga0495650_0000254_57314_58414 341
29 3300046507 Ga0495606_0004950 Ga0495606_0004950_6602_7702 341
30 3300046528 Ga0495642_0011523 Ga0495642_0011523_654_1805 341
31 3300031251 Ga0265327_10000001 Ga0265327_10000001318 342
32 3300031616 Ga0307508_10112483 Ga0307508_101124833 342
33 3300048918 Ga0496115_0130884 Ga0496115_0130884_534_1673 342
34 3300013297 Ga0157378_10017744 Ga0157378_100177446 343
35 3300031691 Ga0316579_10027749 Ga0316579_100277492 343
36 3300031727 Ga0316576_10037777 Ga0316576_100377772 343
37 3300032133 Ga0316583_10005041 Ga0316583_100050414 343
38 3300035398 Ga0316574_0003852 Ga0316574_0003852_4724_5893 343
39 3300036712 Ga0316584_0008780 Ga0316584_0008780_2154_3323 343
40 3300046528 Ga0495642_0019757 Ga0495642_0019757_995_2137 343
41 3300046665 Ga0495661_0000348 Ga0495661_0000348_36306_37448 343
42 3300048915 Ga0496112_0177893 Ga0496112_0177893_35_1177 343
43 3300048925 Ga0496122_0001311 Ga0496122_0001311_3304_4446 343
44 3300048926 Ga0496123_0002525 Ga0496123_0002525_3257_4399 343
45 3300048928 Ga0496125_0001129 Ga0496125_0001129_36277_37419 343
46 3300046557 Ga0495622_0032432 Ga0495622_0032432_411_1571 344
47 3300031711 Ga0265314_10034512 Ga0265314_100345123 345
48 3300007265 Ga0099794_10004144 Ga0099794_100041443 346
49 3300027671 Ga0209588_1012327 Ga0209588_10123272 346
50 3300031730 Ga0307516_10043969 Ga0307516_100439694 347
51 3300044683 Ga0466965_0000307 Ga0466965_0000307_1843_2985 347
52 3300044684 Ga0466966_0000823 Ga0466966_0000823_10675_11817 347
53 3300044693 Ga0466961_0002256 Ga0466961_0002256_3037_4179 347
54 3300044694 Ga0466963_0000120 Ga0466963_0000120_8056_9198 347
55 3300044706 Ga0466964_0008855 Ga0466964_0008855_1433_2575 347
56 3300044719 Ga0466971_0000158 Ga0466971_0000158_1716_2858 347
57 3300044765 Ga0466970_0000653 Ga0466970_0000653_2214_3356 347
58 3300044842 Ga0466957_0000565 Ga0466957_0000565_1941_3083 347
59 3300045049 Ga0466959_0003565 Ga0466959_0003565_3062_4204 347
60 3300045836 Ga0466958_0000064 Ga0466958_0000064_11579_12721 347
61 3300045976 Ga0466967_0000207 Ga0466967_0000207_11403_12545 347
62 3300046542 Ga0495597_0000477 Ga0495597_0000477_26065_27222 347
63 3300046665 Ga0495661_0007080 Ga0495661_0007080_1931_3103 347
64 3300046694 Ga0495649_0070961 Ga0495649_0070961_563_1705 347
65 3300049581 Ga0501047_0009540 Ga0501047_0009540_6800_7942 347
66 3300061719 Ga0466962_0001580 Ga0466962_0001580_7793_8935 347
67 3300006038 Ga0075365_10002515 Ga0075365_100025152 348
68 3300033180 Ga0307510_10016374 Ga0307510_100163743 348
69 3300048907 Ga0496104_0038354 Ga0496104_0038354_533_1723 348
70 3300048908 Ga0496105_0152803 Ga0496105_0152803_129_1319 348
71 3300048916 Ga0496113_0011897 Ga0496113_0011897_3419_4540 348
72 3300048927 Ga0496124_0027632 Ga0496124_0027632_1245_2366 348
73 3300050492 nmdc:mga0yw44_331_c2 nmdc:mga0yw44_331_c2_7488_8624 348
74 3300053087 Ga0500643_000040 Ga0500643_000040_30682_31863 348
75 3300053092 Ga0500583_0052934 Ga0500583_0052934_50_1231 348
76 3300053103 Ga0500555_005318 Ga0500555_005318_28_1209 348
77 3300053119 Ga0500595_013850 Ga0500595_013850_672_1835 348
78 3300053139 Ga0500568_0004905 Ga0500568_0004905_4876_6057 348
79 3300053142 Ga0500577_0030551 Ga0500577_0030551_180_1361 348
80 3300053161 Ga0500634_0016794 Ga0500634_0016794_736_1917 348
81 3300005614 Ga0068856_100093249 Ga0068856_1000932492 349
82 3300013105 Ga0157369_10191438 Ga0157369_101914381 349
83 3300037418 Ga0395900_0324384 Ga0395900_0324384_92_1258 349
84 3300046660 Ga0495625_0007062 Ga0495625_0007062_5041_6183 349
85 3300048913 Ga0496110_0176537 Ga0496110_0176537_65_1201 349
86 3300013104 Ga0157370_10344520 Ga0157370_103445201 350
87 3300031251 Ga0265327_10000049 Ga0265327_1000004961 350
88 3300031456 Ga0307513_10019068 Ga0307513_100190689 350
89 3300031548 Ga0307408_100024832 Ga0307408_1000248322 350
90 3300031727 Ga0316576_10004205 Ga0316576_100042053 350
91 3300031728 Ga0316578_10033864 Ga0316578_100338642 350
92 3300031731 Ga0307405_10015127 Ga0307405_100151271 350
93 3300031824 Ga0307413_10004156 Ga0307413_100041562 350
94 3300031852 Ga0307410_10001553 Ga0307410_100015536 350
95 3300031901 Ga0307406_10000178 Ga0307406_100001785 350
96 3300031903 Ga0307407_10003421 Ga0307407_100034212 350
97 3300031995 Ga0307409_100000015 Ga0307409_10000001533 350
98 3300032002 Ga0307416_100000138 Ga0307416_10000013811 350
99 3300032126 Ga0307415_100001768 Ga0307415_1000017682 350
100 3300035398 Ga0316574_0006709 Ga0316574_0006709_829_2004 350
101 3300036401 Ga0373937_0013115 Ga0373937_0013115_4870_6030 350
102 3300042005 Ga0439448_0056989 Ga0439448_0056989_23_1165 350
103 3300042016 Ga0439463_003818 Ga0439463_003818_207_1349 350
104 3300042439 Ga0439464_0007291 Ga0439464_0007291_1633_2775 350
105 3300002987 JGI25159J45721_1001036 JGI25159J45721_100103610 351
106 3300003354 JGI25160J50197_1000305 JGI25160J50197_100030528 351
107 3300003374 JGI25161J50226_1000018 JGI25161J50226_100001893 351
108 3300004625 Ga0055543_1000418 Ga0055543_10004187 351
109 3300025284 Ga0209130_1000050 Ga0209130_100005093 351
110 3300025298 Ga0209050_1002573 Ga0209050_100257310 351
111 3300025302 Ga0207426_1000071 Ga0207426_1000071163 351
112 3300053108 Ga0500562_002430 Ga0500562_002430_1789_2931 351
113 3300009545 Ga0105237_10000304 Ga0105237_1000030442 352
114 3300010375 Ga0105239_10058071 Ga0105239_100580713 352
115 3300025303 Ga0209051_1008938 Ga0209051_10089383 352
116 3300044719 Ga0466971_0047759 Ga0466971_0047759_676_1797 352
117 3300046460 Ga0495638_0201175 Ga0495638_0201175_28_1113 352
118 3300053119 Ga0500595_012649 Ga0500595_012649_1865_3019 352
119 3300006186 Ga0075369_10020019 Ga0075369_100200192 353
120 3300039447 Ga0436361_0200270 Ga0436361_0200270_15356_16537 353
121 3300042002 Ga0439442_003187 Ga0439442_003187_1376_2527 353
122 3300046513 Ga0495616_0002064 Ga0495616_0002064_8950_10092 353
123 3300047320 Ga0495672_0000136 Ga0495672_0000136_18859_19968 353
124 3300048919 Ga0496116_0009275 Ga0496116_0009275_102_1256 353
125 3300048925 Ga0496122_0000224 Ga0496122_0000224_83915_85069 353
126 3300048926 Ga0496123_0000187 Ga0496123_0000187_16938_18092 353
127 3300030521 Ga0307511_10000355 Ga0307511_1000035543 354
128 3300044684 Ga0466966_0113694 Ga0466966_0113694_465_1613 354
129 3300044765 Ga0466970_0032783 Ga0466970_0032783_119_1267 354
130 3300045049 Ga0466959_0209940 Ga0466959_0209940_137_1285 354
131 3300036712 Ga0316584_0151414 Ga0316584_0151414_163_1278 355
132 3300046453 Ga0495627_015563 Ga0495627_015563_1301_2443 355
133 3300005328 Ga0070676_10072377 Ga0070676_100723772 356
134 3300005441 Ga0070700_100033850 Ga0070700_1000338502 356
135 3300005459 Ga0068867_100032250 Ga0068867_1000322501 356
136 3300005719 Ga0068861_100005124 Ga0068861_1000051244 356
137 3300005843 Ga0068860_100001000 Ga0068860_10000100029 356
138 3300005844 Ga0068862_100008139 Ga0068862_1000081394 356
139 3300013297 Ga0157378_10018043 Ga0157378_100180437 356
140 3300013306 Ga0163162_10027887 Ga0163162_100278875 356
141 3300013308 Ga0157375_10051881 Ga0157375_100518814 356
142 3300014326 Ga0157380_10009376 Ga0157380_100093763 356
143 3300021384 Ga0213876_10096573 Ga0213876_100965731 356
144 3300025907 Ga0207645_10076737 Ga0207645_100767372 356
145 3300026075 Ga0207708_10055402 Ga0207708_100554024 356
146 3300026089 Ga0207648_10007662 Ga0207648_100076624 356
147 3300026118 Ga0207675_100007150 Ga0207675_1000071509 356
148 3300028381 Ga0268264_10000860 Ga0268264_100008603 356
149 3300039438 Ga0436360_1263943 Ga0436360_1263943_225_1325 356
150 3300046542 Ga0495597_0001172 Ga0495597_0001172_6171_7328 356
151 3300049570 Ga0501033_0201174 Ga0501033_0201174_127_1404 356
152 3300050516 nmdc:mga0sz30_7096_c1 nmdc:mga0sz30_7096_c1_164_1264 356
153 3300003320 rootH2_10012126 rootH2_1001212610 357
154 3300003323 rootH1_10147960 rootH1_101479605 357
155 3300005563 Ga0068855_100090213 Ga0068855_1000902132 357
156 3300005981 Ga0081538_10000336 Ga0081538_1000033643 357
157 3300006058 Ga0075432_10000475 Ga0075432_100004758 357
158 3300006871 Ga0075434_100000910 Ga0075434_1000009103 357
159 3300006914 Ga0075436_100001623 Ga0075436_1000016234 357
160 3300007076 Ga0075435_100003979 Ga0075435_1000039794 357
161 3300009094 Ga0111539_10000980 Ga0111539_100009803 357
162 3300009174 Ga0105241_10063731 Ga0105241_100637312 357
163 3300009545 Ga0105237_10046264 Ga0105237_100462644 357
164 3300021361 Ga0213872_10009810 Ga0213872_100098102 357
165 3300025911 Ga0207654_10111953 Ga0207654_101119531 357
166 3300025914 Ga0207671_10157044 Ga0207671_101570442 357
167 3300025949 Ga0207667_10056651 Ga0207667_100566513 357
168 3300027907 Ga0207428_10000407 Ga0207428_1000040721 357
169 3300039447 Ga0436361_0442101 Ga0436361_0442101_171_1331 357
170 3300047322 Ga0495680_0071799 Ga0495680_0071799_1516_2619 357
171 3300050511 nmdc:mga08y16_11899_c1 nmdc:mga08y16_11899_c1_7829_8971 357
172 3300050512 nmdc:mga0n895_280_c1 nmdc:mga0n895_280_c1_4832_5974 357
173 3300050513 nmdc:mga0rr50_350_c1 nmdc:mga0rr50_350_c1_5888_7030 357
174 3300050515 nmdc:mga0a205_1570_c1 nmdc:mga0a205_1570_c1_294_1436 357
175 iso_pu_bacteria 2808606365 2808874920 357
176 3300009093 Ga0105240_10197731 Ga0105240_101977312 358
177 3300009551 Ga0105238_10042238 Ga0105238_100422382 358
178 3300025919 Ga0207657_10080794 Ga0207657_100807942 358
179 3300025924 Ga0207694_10015367 Ga0207694_100153673 358
180 3300026116 Ga0207674_10403555 Ga0207674_104035551 358
181 3300026142 Ga0207698_10335607 Ga0207698_103356072 358
182 3300030731 Ga0316177_1165457 Ga0316177_11654572 358
183 3300031456 Ga0307513_10012715 Ga0307513_1001271511 358
184 3300031548 Ga0307408_100044323 Ga0307408_1000443231 358
185 3300031548 Ga0307408_100150165 Ga0307408_1001501652 358
186 3300031665 Ga0316575_10029883 Ga0316575_100298832 358
187 3300031691 Ga0316579_10025936 Ga0316579_100259362 358
188 3300031691 Ga0316579_10030600 Ga0316579_100306002 358
189 3300031727 Ga0316576_10090890 Ga0316576_100908902 358
190 3300031727 Ga0316576_10161610 Ga0316576_101616102 358
191 3300031728 Ga0316578_10002226 Ga0316578_100022268 358
192 3300031731 Ga0307405_10032537 Ga0307405_100325372 358
193 3300031733 Ga0316577_10062893 Ga0316577_100628932 358
194 3300031733 Ga0316577_10074258 Ga0316577_100742582 358
195 3300031911 Ga0307412_10054709 Ga0307412_100547092 358
196 3300032133 Ga0316583_10033410 Ga0316583_100334102 358
197 3300032139 Ga0316580_10007364 Ga0316580_100073642 358
198 3300032168 Ga0316593_10015135 Ga0316593_100151351 358
199 3300033524 Ga0316592_1009497 Ga0316592_10094973 358
200 3300033527 Ga0316586_1004284 Ga0316586_10042842 358
201 3300033527 Ga0316586_1007462 Ga0316586_10074622 358
202 3300033529 Ga0316587_1004502 Ga0316587_10045023 358
203 3300033529 Ga0316587_1016477 Ga0316587_10164771 358
204 3300033541 Ga0316596_1010863 Ga0316596_10108633 358
205 3300033541 Ga0316596_1020885 Ga0316596_10208851 358
206 3300035398 Ga0316574_0025896 Ga0316574_0025896_2197_3342 358
207 3300035398 Ga0316574_0077729 Ga0316574_0077729_379_1545 358
208 3300036647 Ga0316582_0016084 Ga0316582_0016084_1692_2858 358
209 3300036647 Ga0316582_0043181 Ga0316582_0043181_310_1455 358
210 3300036712 Ga0316584_0032725 Ga0316584_0032725_979_2124 358
211 3300036712 Ga0316584_0099844 Ga0316584_0099844_746_1912 358
212 3300038443 Ga0395901_0120638 Ga0395901_0120638_939_2093 358
213 3300041512 Ga0451853_2692520 Ga0451853_2692520_2381_3553 358
214 3300045836 Ga0466958_0148066 Ga0466958_0148066_36_1163 358
215 3300048908 Ga0496105_0149548 Ga0496105_0149548_41_1183 358
216 3300049575 Ga0501039_0011293 Ga0501039_0011293_5265_6392 358
217 3300049578 Ga0501042_0026545 Ga0501042_0026545_775_1902 358
218 3300049587 Ga0501071_0082388 Ga0501071_0082388_1091_2218 358
219 3300049588 Ga0501072_0085548 Ga0501072_0085548_82_1209 358
220 3300049591 Ga0501075_0037644 Ga0501075_0037644_2268_3395 358
221 3300049705 Ga0501225_0003896 Ga0501225_0003896_1264_2394 358
222 iso_pu_bacteria 2919446982 2919447276 358
223 3300006844 Ga0075428_100092590 Ga0075428_1000925902 359
224 3300009094 Ga0111539_10293622 Ga0111539_102936221 359
225 3300031250 Ga0265331_10000006 Ga0265331_10000006224 359
226 3300031251 Ga0265327_10000049 Ga0265327_10000049171 359
227 3300031711 Ga0265314_10005268 Ga0265314_100052688 359
228 3300037068 Ga0373925_0003143 Ga0373925_0003143_6008_7177 359
229 3300038726 Ga0400490_03855 Ga0400490_03855_1115_2269 359
230 3300042436 Ga0439435_0022174 Ga0439435_0022174_389_1543 359
231 3300047472 Ga0495686_0143086 Ga0495686_0143086_212_1369 359
232 3300048905 Ga0496102_0006177 Ga0496102_0006177_802_1920 359
233 3300048906 Ga0496103_0003305 Ga0496103_0003305_5455_6573 359
234 3300048924 Ga0496121_0013475 Ga0496121_0013475_6667_7830 359
235 3300048928 Ga0496125_0014244 Ga0496125_0014244_6243_7406 359
236 3300050510 nmdc:mga06r32_231803_c1 nmdc:mga06r32_231803_c1_16_1221 359
237 3300050511 nmdc:mga08y16_245227_c1 nmdc:mga08y16_245227_c1_103_1251 359
238 iso_pu_bacteria 8056967851 8056972170 359
239 3300009176 Ga0105242_10000361 Ga0105242_100003613 360
240 3300013306 Ga0163162_10057535 Ga0163162_100575353 360
241 3300025934 Ga0207686_10000422 Ga0207686_1000042221 360
242 3300030731 Ga0316177_1002614 Ga0316177_10026142 360
243 3300030732 Ga0316176_1145635 Ga0316176_11456353 360
244 3300030733 Ga0314311_1019612 Ga0314311_10196122 360
245 3300031507 Ga0307509_10071671 Ga0307509_100716712 360
246 3300044683 Ga0466965_0008582 Ga0466965_0008582_1957_3069 360
247 3300046616 Ga0495668_0067312 Ga0495668_0067312_356_1531 360
248 3300048908 Ga0496105_0060437 Ga0496105_0060437_771_1898 360
249 3300049585 Ga0501069_0000672 Ga0501069_0000672_8969_10102 360
250 3300049586 Ga0501070_0076424 Ga0501070_0076424_338_1471 360
251 3300049742 Ga0501080_0002448 Ga0501080_0002448_12277_13410 360
252 iso_pu_bacteria 2916699645 2916702836 360
253 iso_pu_bacteria 2929212328 2929212679 360
254 iso_pu_bacteria 2984568884 2984570038 360
255 3300001989 JGI24739J22299_10027560 JGI24739J22299_100275602 361
256 3300002075 JGI24738J21930_10013006 JGI24738J21930_100130061 361
257 3300003781 Ga0055536_1002216 Ga0055536_100221610 361
258 3300003792 Ga0055540_1009711 Ga0055540_10097113 361
259 3300009098 Ga0105245_10098259 Ga0105245_100982593 361
260 3300009101 Ga0105247_10000503 Ga0105247_1000050330 361
261 3300009148 Ga0105243_10000655 Ga0105243_1000065519 361
262 3300010375 Ga0105239_10483861 Ga0105239_104838611 361
263 3300025292 Ga0209676_1001281 Ga0209676_10012815 361
264 3300025303 Ga0209051_1000506 Ga0209051_100050632 361
265 3300025935 Ga0207709_10000259 Ga0207709_1000025919 361
266 3300031727 Ga0316576_10000111 Ga0316576_1000011114 361
267 3300031728 Ga0316578_10077036 Ga0316578_100770362 361
268 3300032126 Ga0307415_100048368 Ga0307415_1000483683 361
269 3300032133 Ga0316583_10045324 Ga0316583_100453241 361
270 3300036647 Ga0316582_0000873 Ga0316582_0000873_3950_5119 361
271 3300037466 Ga0395898_0041290 Ga0395898_0041290_375_1526 361
272 3300037471 Ga0395905_0074312 Ga0395905_0074312_1181_2335 361
273 3300042007 Ga0439449_0004625 Ga0439449_0004625_2547_3701 361
274 3300046455 Ga0495603_0053806 Ga0495603_0053806_884_2044 361
275 3300048924 Ga0496121_0032738 Ga0496121_0032738_1228_2367 361
276 iso_pu_bacteria 2919713450 2919719795 361
277 3300002704 JGI25155J39150_1000002 JGI25155J39150_1000002211 362
278 3300002705 JGI25156J39149_1000003 JGI25156J39149_100000395 362
279 3300002738 JGI25154J39366_1000009 JGI25154J39366_1000009211 362
280 3300002741 JGI25157J39369_1000002 JGI25157J39369_1000002211 362
281 3300002774 JGI25150J39212_1004255 JGI25150J39212_10042553 362
282 3300002774 JGI25150J39212_1005462 JGI25150J39212_10054621 362
283 3300002987 JGI25159J45721_1012731 JGI25159J45721_10127312 362
284 3300003773 Ga0055537_1000127 Ga0055537_100012744 362
285 3300003784 Ga0055534_1000340 Ga0055534_100034016 362
286 3300003784 Ga0055534_1005703 Ga0055534_10057031 362
287 3300003790 Ga0055528_1001503 Ga0055528_100150312 362
288 3300003792 Ga0055540_1002441 Ga0055540_10024415 362
289 3300003794 Ga0055531_10001138 Ga0055531_1000113814 362
290 3300005288 Ga0065714_10013374 Ga0065714_100133742 362
291 3300005288 Ga0065714_10028410 Ga0065714_100284102 362
292 3300005336 Ga0070680_100113882 Ga0070680_1001138822 362
293 3300005338 Ga0068868_100016222 Ga0068868_1000162223 362
294 3300005339 Ga0070660_100013873 Ga0070660_1000138735 362
295 3300005354 Ga0070675_100260801 Ga0070675_1002608012 362
296 3300005367 Ga0070667_100020196 Ga0070667_1000201962 362
297 3300005435 Ga0070714_100059826 Ga0070714_1000598264 362
298 3300005445 Ga0070708_100395296 Ga0070708_1003952961 362
299 3300005466 Ga0070685_10147476 Ga0070685_101474762 362
300 3300005467 Ga0070706_100054161 Ga0070706_1000541613 362
301 3300005471 Ga0070698_100002279 Ga0070698_1000022795 362
302 3300005536 Ga0070697_100346371 Ga0070697_1003463711 362
303 3300005548 Ga0070665_100023785 Ga0070665_1000237853 362
304 3300005548 Ga0070665_100027573 Ga0070665_1000275736 362
305 3300005563 Ga0068855_100036615 Ga0068855_1000366153 362
306 3300005563 Ga0068855_100113368 Ga0068855_1001133682 362
307 3300005563 Ga0068855_100127821 Ga0068855_1001278213 362
308 3300005614 Ga0068856_100359627 Ga0068856_1003596271 362
309 3300005616 Ga0068852_100038545 Ga0068852_1000385453 362
310 3300005937 Ga0081455_10002583 Ga0081455_100025834 362
311 3300005937 Ga0081455_10006365 Ga0081455_100063652 362
312 3300005981 Ga0081538_10104838 Ga0081538_101048381 362
313 3300005985 Ga0081539_10001500 Ga0081539_1000150034 362
314 3300006038 Ga0075365_10001038 Ga0075365_100010387 362
315 3300006038 Ga0075365_10147569 Ga0075365_101475692 362
316 3300006048 Ga0075363_100063220 Ga0075363_1000632203 362
317 3300006048 Ga0075363_100064246 Ga0075363_1000642462 362
318 3300006051 Ga0075364_10099254 Ga0075364_100992542 362
319 3300006058 Ga0075432_10001254 Ga0075432_100012542 362
320 3300006177 Ga0075362_10003219 Ga0075362_100032195 362
321 3300006177 Ga0075362_10009581 Ga0075362_100095813 362
322 3300006177 Ga0075362_10024455 Ga0075362_100244552 362
323 3300006177 Ga0075362_10081741 Ga0075362_100817412 362
324 3300006178 Ga0075367_10114691 Ga0075367_101146912 362
325 3300006186 Ga0075369_10013629 Ga0075369_100136292 362
326 3300006195 Ga0075366_10007780 Ga0075366_100077802 362
327 3300006195 Ga0075366_10022363 Ga0075366_100223632 362
328 3300006195 Ga0075366_10030145 Ga0075366_100301452 362
329 3300006195 Ga0075366_10031183 Ga0075366_100311833 362
330 3300006195 Ga0075366_10034453 Ga0075366_100344532 362
331 3300006195 Ga0075366_10078636 Ga0075366_100786361 362
332 3300006195 Ga0075366_10078687 Ga0075366_100786871 362
333 3300006353 Ga0075370_10000325 Ga0075370_100003252 362
334 3300006353 Ga0075370_10003407 Ga0075370_100034075 362
335 3300006353 Ga0075370_10004598 Ga0075370_100045983 362
336 3300006353 Ga0075370_10034028 Ga0075370_100340283 362
337 3300006880 Ga0075429_100202575 Ga0075429_1002025752 362
338 3300006948 Ga0099826_10005506 Ga0099826_1000550610 362
339 3300009098 Ga0105245_10166475 Ga0105245_101664752 362
340 3300009101 Ga0105247_10001684 Ga0105247_1000168411 362
341 3300009553 Ga0105249_10013528 Ga0105249_100135286 362
342 3300013100 Ga0157373_10017472 Ga0157373_100174725 362
343 3300013104 Ga0157370_10021210 Ga0157370_100212102 362
344 3300013104 Ga0157370_10140117 Ga0157370_101401171 362
345 3300014497 Ga0182008_10041546 Ga0182008_100415462 362
346 3300014497 Ga0182008_10122169 Ga0182008_101221692 362
347 3300014969 Ga0157376_10003956 Ga0157376_100039568 362
348 3300015261 Ga0182006_1005243 Ga0182006_10052432 362
349 3300015683 Ga0183362_10009 Ga0183362_10009106 362
350 3300017792 Ga0163161_10005146 Ga0163161_1000514610 362
351 3300017792 Ga0163161_10135634 Ga0163161_101356342 362
352 3300021361 Ga0213872_10000052 Ga0213872_1000005218 362
353 3300021361 Ga0213872_10000094 Ga0213872_1000009442 362
354 3300021361 Ga0213872_10000146 Ga0213872_1000014650 362
355 3300021361 Ga0213872_10000918 Ga0213872_100009186 362
356 3300021361 Ga0213872_10083774 Ga0213872_100837741 362
357 3300025206 Ga0209435_100001 Ga0209435_100001506 362
358 3300025245 Ga0207425_1004215 Ga0207425_10042153 362
359 3300025246 Ga0209646_1000001 Ga0209646_1000001875 362
360 3300025250 Ga0209026_1000003 Ga0209026_1000003506 362
361 3300025256 Ga0209759_1000001 Ga0209759_1000001506 362
362 3300025263 Ga0209565_1000070 Ga0209565_1000070124 362
363 3300025263 Ga0209565_1000418 Ga0209565_100041812 362
364 3300025273 Ga0209673_1000234 Ga0209673_100023435 362
365 3300025273 Ga0209673_1014753 Ga0209673_10147533 362
366 3300025284 Ga0209130_1002622 Ga0209130_10026225 362
367 3300025291 Ga0209675_1000069 Ga0209675_1000069124 362
368 3300025291 Ga0209675_1000643 Ga0209675_100064315 362
369 3300025291 Ga0209675_1004382 Ga0209675_10043823 362
370 3300025292 Ga0209676_1002525 Ga0209676_100252510 362
371 3300025292 Ga0209676_1009706 Ga0209676_10097064 362
372 3300025292 Ga0209676_1033370 Ga0209676_10333702 362
373 3300025294 Ga0209025_1001851 Ga0209025_10018512 362
374 3300025294 Ga0209025_1041557 Ga0209025_10415572 362
375 3300025294 Ga0209025_1049694 Ga0209025_10496942 362
376 3300025298 Ga0209050_1014545 Ga0209050_10145453 362
377 3300025303 Ga0209051_1000367 Ga0209051_100036719 362
378 3300025303 Ga0209051_1000975 Ga0209051_10009758 362
379 3300025303 Ga0209051_1011394 Ga0209051_10113945 362
380 3300025304 Ga0209257_1000012 Ga0209257_1000012541 362
381 3300025304 Ga0209257_1006431 Ga0209257_10064312 362
382 3300025900 Ga0207710_10000929 Ga0207710_1000092912 362
383 3300025919 Ga0207657_10020579 Ga0207657_100205795 362
384 3300025924 Ga0207694_10067030 Ga0207694_100670304 362
385 3300025937 Ga0207669_10068168 Ga0207669_100681683 362
386 3300025949 Ga0207667_10039611 Ga0207667_100396116 362
387 3300025949 Ga0207667_10118152 Ga0207667_101181522 362
388 3300025961 Ga0207712_10000615 Ga0207712_100006153 362
389 3300025986 Ga0207658_10263303 Ga0207658_102633031 362
390 3300026116 Ga0207674_10077343 Ga0207674_100773432 362
391 3300026118 Ga0207675_100310072 Ga0207675_1003100722 362
392 3300026121 Ga0207683_10004481 Ga0207683_1000448111 362
393 3300026121 Ga0207683_10047584 Ga0207683_100475843 362
394 3300026142 Ga0207698_10028300 Ga0207698_100283002 362
395 3300027378 Ga0209981_1002891 Ga0209981_10028912 362
396 3300027666 Ga0209282_1000561 Ga0209282_10005614 362
397 3300027907 Ga0207428_10046285 Ga0207428_100462852 362
398 3300028379 Ga0268266_10016663 Ga0268266_100166633 362
399 3300028379 Ga0268266_10083205 Ga0268266_100832053 362
400 3300028794 Ga0307515_10000651 Ga0307515_1000065167 362
401 3300028794 Ga0307515_10021511 Ga0307515_100215112 362
402 3300030742 Ga0316183_1093439 Ga0316183_10934392 362
403 3300031238 Ga0265332_10000033 Ga0265332_10000033105 362
404 3300031251 Ga0265327_10000798 Ga0265327_1000079822 362
405 3300031251 Ga0265327_10044922 Ga0265327_100449223 362
406 3300031456 Ga0307513_10000014 Ga0307513_10000014173 362
407 3300031456 Ga0307513_10000019 Ga0307513_10000019150 362
408 3300031456 Ga0307513_10148518 Ga0307513_101485183 362
409 3300031456 Ga0307513_10176591 Ga0307513_101765912 362
410 3300031548 Ga0307408_100080766 Ga0307408_1000807662 362
411 3300031649 Ga0307514_10008781 Ga0307514_100087811 362
412 3300031730 Ga0307516_10006735 Ga0307516_1000673510 362
413 3300031901 Ga0307406_10000505 Ga0307406_1000050515 362
414 3300031903 Ga0307407_10094250 Ga0307407_100942501 362
415 3300031911 Ga0307412_10031473 Ga0307412_100314733 362
416 3300031911 Ga0307412_10072118 Ga0307412_100721183 362
417 3300032004 Ga0307414_10037379 Ga0307414_100373793 362
418 3300035207 Ga0373942_0004061 Ga0373942_0004061_1017_2171 362
419 3300037312 Ga0395899_0012444 Ga0395899_0012444_3846_5009 362
420 3300037312 Ga0395899_0139380 Ga0395899_0139380_486_1625 362
421 3300037418 Ga0395900_0058978 Ga0395900_0058978_1932_3095 362
422 3300037418 Ga0395900_0245020 Ga0395900_0245020_522_1661 362
423 3300037418 Ga0395900_0290311 Ga0395900_0290311_422_1585 362
424 3300037466 Ga0395898_0008707 Ga0395898_0008707_4940_6103 362
425 3300037466 Ga0395898_0087958 Ga0395898_0087958_1077_2216 362
426 3300037471 Ga0395905_0000106 Ga0395905_0000106_132604_133914 362
427 3300037471 Ga0395905_0006752 Ga0395905_0006752_998_2188 362
428 3300037471 Ga0395905_0152648 Ga0395905_0152648_795_1958 362
429 3300038443 Ga0395901_0016740 Ga0395901_0016740_2332_3495 362
430 3300038443 Ga0395901_0207423 Ga0395901_0207423_499_1638 362
431 3300039447 Ga0436361_0160207 Ga0436361_0160207_166_1305 362
432 3300039447 Ga0436361_0572917 Ga0436361_0572917_401_1537 362
433 3300039447 Ga0436361_1148233 Ga0436361_1148233_4105_5241 362
434 3300041404 Ga0439436_0001818 Ga0439436_0001818_1633_2796 362
435 3300041405 Ga0439438_022371 Ga0439438_022371_153_1316 362
436 3300041411 Ga0439466_0013846 Ga0439466_0013846_256_1419 362
437 3300041411 Ga0439466_0014258 Ga0439466_0014258_235_1398 362
438 3300041512 Ga0451853_3310022 Ga0451853_3310022_369_1511 362
439 3300042002 Ga0439442_001679 Ga0439442_001679_2163_3326 362
440 3300042002 Ga0439442_005695 Ga0439442_005695_625_1788 362
441 3300042002 Ga0439442_007164 Ga0439442_007164_622_1785 362
442 3300042004 Ga0439445_0001026 Ga0439445_0001026_446_1609 362
443 3300042006 Ga0439432_050335 Ga0439432_050335_75_1238 362
444 3300042122 Ga0450920_021789 Ga0450920_021789_58_1221 362
445 3300042134 Ga0450898_008554 Ga0450898_008554_117_1280 362
446 3300042145 Ga0450906_001427 Ga0450906_001427_3354_4517 362
447 3300042184 Ga0450908_000493 Ga0450908_000493_5285_6448 362
448 3300042184 Ga0450908_005161 Ga0450908_005161_286_1449 362
449 3300042184 Ga0450908_006674 Ga0450908_006674_476_1639 362
450 3300042435 Ga0439434_0006636 Ga0439434_0006636_552_1715 362
451 3300042436 Ga0439435_0000022 Ga0439435_0000022_1027_2181 362
452 3300042531 Ga0450918_001411 Ga0450918_001411_2553_3716 362
453 3300044656 Ga0466969_0030782 Ga0466969_0030782_198_1361 362
454 3300044673 Ga0453683_0025390 Ga0453683_0025390_319_1461 362
455 3300044693 Ga0466961_0013122 Ga0466961_0013122_3292_4455 362
456 3300044765 Ga0466970_0107638 Ga0466970_0107638_197_1360 362
457 3300045051 Ga0451576_0008715 Ga0451576_0008715_3617_4759 362
458 3300046507 Ga0495606_0071930 Ga0495606_0071930_861_1997 362
459 3300046511 Ga0495608_0162800 Ga0495608_0162800_53_1216 362
460 3300046542 Ga0495597_0019402 Ga0495597_0019402_1135_2271 362
461 3300046615 Ga0495656_0000221 Ga0495656_0000221_3842_5005 362
462 3300046660 Ga0495625_0000197 Ga0495625_0000197_77724_78887 362
463 3300046664 Ga0495659_0000040 Ga0495659_0000040_30675_31811 362
464 3300046674 Ga0495588_0022541 Ga0495588_0022541_1433_2596 362
465 3300046674 Ga0495588_0063300 Ga0495588_0063300_14_1156 362
466 3300046810 Ga0495660_0000852 Ga0495660_0000852_3671_4807 362
467 3300046810 Ga0495660_0049378 Ga0495660_0049378_968_2104 362
468 3300047315 Ga0495581_0056157 Ga0495581_0056157_1083_2246 362
469 3300047315 Ga0495581_0056419 Ga0495581_0056419_933_2075 362
470 3300047472 Ga0495686_0023849 Ga0495686_0023849_2331_3467 362
471 3300048904 Ga0496101_0003964 Ga0496101_0003964_6505_7668 362
472 3300048905 Ga0496102_0008207 Ga0496102_0008207_737_1900 362
473 3300048905 Ga0496102_0010101 Ga0496102_0010101_4787_5926 362
474 3300048906 Ga0496103_0009348 Ga0496103_0009348_2479_3642 362
475 3300048907 Ga0496104_0004823 Ga0496104_0004823_3822_4985 362
476 3300048907 Ga0496104_0052579 Ga0496104_0052579_335_1474 362
477 3300048908 Ga0496105_0002650 Ga0496105_0002650_8401_9564 362
478 3300048909 Ga0496106_0004823 Ga0496106_0004823_1923_3086 362
479 3300048913 Ga0496110_0191882 Ga0496110_0191882_283_1446 362
480 3300048919 Ga0496116_0000943 Ga0496116_0000943_23852_24991 362
481 3300048920 Ga0496117_0017503 Ga0496117_0017503_2664_3803 362
482 3300048921 Ga0496118_0008847 Ga0496118_0008847_6960_8099 362
483 3300048922 Ga0496119_0008519 Ga0496119_0008519_1055_2194 362
484 3300048923 Ga0496120_0016914 Ga0496120_0016914_1408_2547 362
485 3300048924 Ga0496121_0004935 Ga0496121_0004935_15780_16919 362
486 3300049571 Ga0501034_0000379 Ga0501034_0000379_10271_11407 362
487 3300049587 Ga0501071_0005154 Ga0501071_0005154_2456_3613 362
488 3300049592 Ga0501076_0086908 Ga0501076_0086908_56_1192 362
489 3300049741 Ga0501079_0227591 Ga0501079_0227591_268_1425 362
490 3300049759 Ga0501262_000056 Ga0501262_000056_9236_10399 362
491 3300050489 nmdc:mga03683_11778_c1 nmdc:mga03683_11778_c1_1352_2521 362
492 3300050489 nmdc:mga03683_18817_c1 nmdc:mga03683_18817_c1_245_1408 362
493 3300050489 nmdc:mga03683_2543_c1 nmdc:mga03683_2543_c1_4252_5415 362
494 3300050490 nmdc:mga03n38_93965_c1 nmdc:mga03n38_93965_c1_247_1377 362
495 3300050492 nmdc:mga0yw44_20037_c1 nmdc:mga0yw44_20037_c1_1661_2830 362
496 3300050492 nmdc:mga0yw44_37630_c1 nmdc:mga0yw44_37630_c1_1253_2401 362
497 3300050492 nmdc:mga0yw44_878_c1 nmdc:mga0yw44_878_c1_6406_7566 362
498 3300050493 nmdc:mga0k408_119369_c1 nmdc:mga0k408_119369_c1_107_1270 362
499 3300050493 nmdc:mga0k408_3816_c1 nmdc:mga0k408_3816_c1_790_1959 362
500 3300050493 nmdc:mga0k408_42121_c1 nmdc:mga0k408_42121_c1_686_1834 362
501 3300050493 nmdc:mga0k408_53806_c1 nmdc:mga0k408_53806_c1_970_2133 362
502 3300050493 nmdc:mga0k408_95516_c1 nmdc:mga0k408_95516_c1_114_1259 362
503 3300050496 nmdc:mga07m45_21074_c1 nmdc:mga07m45_21074_c1_667_1830 362
504 3300050496 nmdc:mga07m45_26200_c1 nmdc:mga07m45_26200_c1_1137_2300 362
505 3300050496 nmdc:mga07m45_5154_c1 nmdc:mga07m45_5154_c1_2233_3396 362
506 3300050496 nmdc:mga07m45_59483_c1 nmdc:mga07m45_59483_c1_934_2085 362
507 3300050496 nmdc:mga07m45_81849_c1 nmdc:mga07m45_81849_c1_224_1387 362
508 3300050496 nmdc:mga07m45_83260_c1 nmdc:mga07m45_83260_c1_411_1574 362
509 3300050496 nmdc:mga07m45_872_c1 nmdc:mga07m45_872_c1_6565_7728 362
510 3300050516 nmdc:mga0sz30_28123_c1 nmdc:mga0sz30_28123_c1_644_1789 362
511 3300053096 Ga0500641_0001787 Ga0500641_0001787_1233_2372 362
512 3300053139 Ga0500568_0011540 Ga0500568_0011540_2605_3795 362
513 3300053151 Ga0500604_0000093 Ga0500604_0000093_612_1760 362
514 3300053730 Ga0500645_000100 Ga0500645_000100_19727_20977 362
515 3300053730 Ga0500645_001458 Ga0500645_001458_490_1653 362
516 3300053733 Ga0500552_001657 Ga0500552_001657_916_2046 362
517 3300061734 Ga0530510_0181580 Ga0530510_0181580_104_1279 362
518 iso_pu_bacteria 2511231002 2511245776 362
519 iso_pu_bacteria 2511231006 2511267349 362
520 iso_pu_bacteria 2643221628 2644161003 362
521 iso_pu_bacteria 2643221645 2644255010 362
522 iso_pu_bacteria 2643221658 2644328197 362
523 iso_pu_bacteria 2643221664 2644359200 362
524 iso_pu_bacteria 2643221683 2644469585 362
525 iso_pu_bacteria 2738541280 2738738367 362
526 iso_pu_bacteria 2738541300 2738842819 362
527 iso_pu_bacteria 2738543013 2739251636 362
528 iso_pu_bacteria 2738543018 2739273566 362
529 iso_pu_bacteria 2738543030 2739342610 362
530 iso_pu_bacteria 2816332139 2816511757 362
531 iso_pu_bacteria 2842134933 2842137210 362
532 iso_pu_bacteria 2842677519 2842682469 362
533 iso_pu_bacteria 2885192300 2885194260 362
534 iso_pu_bacteria 2904449895 2904455522 362
535 iso_pu_bacteria 2904456579 2904461639 362
536 iso_pu_bacteria 2904456579 2904462133 362
537 iso_pu_bacteria 2919462493 2919464659 362
538 iso_pu_bacteria 2919704043 2919704876 362
539 iso_pu_bacteria 2919713450 2919720268 362
540 iso_pu_bacteria 2929520902 2929526710 362
541 iso_pu_bacteria 2945945610 2945950272 362
542 iso_pu_bacteria 2945972063 2945975074 362
543 iso_pu_bacteria 3007395558 3007396766 362
544 2162886007 SwRhRL2b_contig_451342 SwRhRL2b_0050.00003700 363
545 3300002737 JGI25162J39368_1000194 JGI25162J39368_10001944 363
546 3300002737 JGI25162J39368_1000671 JGI25162J39368_100067125 363
547 3300002771 JGI25163J39215_1000690 JGI25163J39215_10006903 363
548 3300002771 JGI25163J39215_1001497 JGI25163J39215_10014973 363
549 3300002772 JGI25164J39214_1000160 JGI25164J39214_10001604 363
550 3300002772 JGI25164J39214_1000417 JGI25164J39214_10004174 363
551 3300003187 JGI25151J46595_10009599 JGI25151J46595_100095994 363
552 3300003214 JGI25165J46597_1000290 JGI25165J46597_10002904 363
553 3300003214 JGI25165J46597_1000470 JGI25165J46597_100047039 363
554 3300003214 JGI25165J46597_1000770 JGI25165J46597_100077025 363
555 3300003751 Ga0055538_1000036 Ga0055538_1000036128 363
556 3300003752 Ga0055539_1000047 Ga0055539_1000047128 363
557 3300003756 Ga0055533_1000058 Ga0055533_1000058128 363
558 3300003758 Ga0055532_1000087 Ga0055532_100008749 363
559 3300003759 Ga0055525_1000209 Ga0055525_10002095 363
560 3300003761 Ga0055535_1003122 Ga0055535_10031222 363
561 3300003781 Ga0055536_1004611 Ga0055536_10046115 363
562 3300003781 Ga0055536_1004659 Ga0055536_10046595 363
563 3300003781 Ga0055536_1004690 Ga0055536_10046902 363
564 3300003791 Ga0055530_10001779 Ga0055530_100017793 363
565 3300003791 Ga0055530_10004594 Ga0055530_100045945 363
566 3300003791 Ga0055530_10005180 Ga0055530_100051802 363
567 3300003792 Ga0055540_1001314 Ga0055540_10013143 363
568 3300003792 Ga0055540_1003847 Ga0055540_10038472 363
569 3300003792 Ga0055540_1005246 Ga0055540_10052462 363
570 3300003794 Ga0055531_10000348 Ga0055531_100003485 363
571 3300003841 Ga0055541_1000034 Ga0055541_100003449 363
572 3300005262 Ga0065165_1002126 Ga0065165_100212616 363
573 3300005288 Ga0065714_10004456 Ga0065714_100044563 363
574 3300005288 Ga0065714_10068674 Ga0065714_100686742 363
575 3300005288 Ga0065714_10068918 Ga0065714_100689184 363
576 3300005288 Ga0065714_10078586 Ga0065714_100785861 363
577 3300005288 Ga0065714_10078707 Ga0065714_100787071 363
578 3300005288 Ga0065714_10085116 Ga0065714_100851162 363
579 3300005289 Ga0065704_10001910 Ga0065704_100019102 363
580 3300005290 Ga0065712_10011733 Ga0065712_100117333 363
581 3300005290 Ga0065712_10073972 Ga0065712_100739724 363
582 3300005293 Ga0065715_10092771 Ga0065715_100927712 363
583 3300005327 Ga0070658_10156080 Ga0070658_101560801 363
584 3300005329 Ga0070683_100024533 Ga0070683_1000245333 363
585 3300005329 Ga0070683_100080286 Ga0070683_1000802864 363
586 3300005331 Ga0070670_100102289 Ga0070670_1001022891 363
587 3300005334 Ga0068869_100009902 Ga0068869_1000099025 363
588 3300005337 Ga0070682_100053087 Ga0070682_1000530873 363
589 3300005338 Ga0068868_100061632 Ga0068868_1000616322 363
590 3300005344 Ga0070661_100018565 Ga0070661_1000185651 363
591 3300005344 Ga0070661_100059704 Ga0070661_1000597042 363
592 3300005345 Ga0070692_10000512 Ga0070692_100005124 363
593 3300005347 Ga0070668_100009698 Ga0070668_1000096985 363
594 3300005353 Ga0070669_100024903 Ga0070669_1000249032 363
595 3300005364 Ga0070673_100020456 Ga0070673_1000204562 363
596 3300005366 Ga0070659_100173768 Ga0070659_1001737683 363
597 3300005366 Ga0070659_100210719 Ga0070659_1002107191 363
598 3300005434 Ga0070709_10162048 Ga0070709_101620481 363
599 3300005435 Ga0070714_100313253 Ga0070714_1003132531 363
600 3300005439 Ga0070711_100051889 Ga0070711_1000518892 363
601 3300005440 Ga0070705_100017433 Ga0070705_1000174334 363
602 3300005444 Ga0070694_100001309 Ga0070694_1000013095 363
603 3300005455 Ga0070663_100032125 Ga0070663_1000321252 363
604 3300005455 Ga0070663_100038070 Ga0070663_1000380702 363
605 3300005457 Ga0070662_100007601 Ga0070662_1000076013 363
606 3300005457 Ga0070662_100063517 Ga0070662_1000635171 363
607 3300005458 Ga0070681_10000400 Ga0070681_1000040035 363
608 3300005467 Ga0070706_100030535 Ga0070706_1000305352 363
609 3300005471 Ga0070698_100001061 Ga0070698_10000106128 363
610 3300005471 Ga0070698_100123942 Ga0070698_1001239422 363
611 3300005518 Ga0070699_100008172 Ga0070699_1000081724 363
612 3300005518 Ga0070699_100341163 Ga0070699_1003411631 363
613 3300005548 Ga0070665_100130171 Ga0070665_1001301713 363
614 3300005549 Ga0070704_100159796 Ga0070704_1001597962 363
615 3300005563 Ga0068855_100053696 Ga0068855_1000536962 363
616 3300005563 Ga0068855_100104660 Ga0068855_1001046602 363
617 3300005564 Ga0070664_100023382 Ga0070664_1000233824 363
618 3300005614 Ga0068856_100032092 Ga0068856_1000320923 363
619 3300005614 Ga0068856_100195683 Ga0068856_1001956832 363
620 3300005617 Ga0068859_100055102 Ga0068859_1000551023 363
621 3300005618 Ga0068864_100018695 Ga0068864_1000186953 363
622 3300005719 Ga0068861_100084712 Ga0068861_1000847122 363
623 3300005719 Ga0068861_100150464 Ga0068861_1001504642 363
624 3300005841 Ga0068863_100188142 Ga0068863_1001881423 363
625 3300005842 Ga0068858_100015717 Ga0068858_1000157174 363
626 3300005842 Ga0068858_100082134 Ga0068858_1000821343 363
627 3300005843 Ga0068860_100039138 Ga0068860_1000391382 363
628 3300005843 Ga0068860_100245381 Ga0068860_1002453812 363
629 3300005844 Ga0068862_100070727 Ga0068862_1000707272 363
630 3300005844 Ga0068862_100164663 Ga0068862_1001646632 363
631 3300005937 Ga0081455_10000535 Ga0081455_1000053516 363
632 3300005937 Ga0081455_10076181 Ga0081455_100761812 363
633 3300005983 Ga0081540_1005124 Ga0081540_10051242 363
634 3300005983 Ga0081540_1016510 Ga0081540_10165104 363
635 3300005983 Ga0081540_1018707 Ga0081540_10187074 363
636 3300005985 Ga0081539_10000322 Ga0081539_1000032265 363
637 3300005985 Ga0081539_10010735 Ga0081539_100107357 363
638 3300005985 Ga0081539_10055915 Ga0081539_100559152 363
639 3300006038 Ga0075365_10151217 Ga0075365_101512172 363
640 3300006038 Ga0075365_10153319 Ga0075365_101533192 363
641 3300006042 Ga0075368_10028500 Ga0075368_100285002 363
642 3300006048 Ga0075363_100072682 Ga0075363_1000726821 363
643 3300006051 Ga0075364_10056443 Ga0075364_100564431 363
644 3300006058 Ga0075432_10004055 Ga0075432_100040553 363
645 3300006058 Ga0075432_10009780 Ga0075432_100097802 363
646 3300006058 Ga0075432_10019754 Ga0075432_100197542 363
647 3300006178 Ga0075367_10001008 Ga0075367_100010083 363
648 3300006186 Ga0075369_10000014 Ga0075369_1000001433 363
649 3300006186 Ga0075369_10019212 Ga0075369_100192122 363
650 3300006186 Ga0075369_10067738 Ga0075369_100677382 363
651 3300006353 Ga0075370_10006184 Ga0075370_100061843 363
652 3300006353 Ga0075370_10041253 Ga0075370_100412532 363
653 3300006353 Ga0075370_10124616 Ga0075370_101246162 363
654 3300006871 Ga0075434_100337786 Ga0075434_1003377862 363
655 3300006914 Ga0075436_100061626 Ga0075436_1000616263 363
656 3300006914 Ga0075436_100112691 Ga0075436_1001126912 363
657 3300006931 Ga0097620_100055105 Ga0097620_1000551053 363
658 3300006946 Ga0079104_1000259 Ga0079104_100025971 363
659 3300006946 Ga0079104_1001901 Ga0079104_10019012 363
660 3300006946 Ga0079104_1012883 Ga0079104_10128833 363
661 3300007076 Ga0075435_100145488 Ga0075435_1001454883 363
662 3300007265 Ga0099794_10000175 Ga0099794_1000017519 363
663 3300007788 Ga0099795_10001474 Ga0099795_100014743 363
664 3300007788 Ga0099795_10003195 Ga0099795_100031953 363
665 3300007788 Ga0099795_10010610 Ga0099795_100106102 363
666 3300009011 Ga0105251_10000030 Ga0105251_100000303 363
667 3300009011 Ga0105251_10000152 Ga0105251_1000015268 363
668 3300009011 Ga0105251_10024552 Ga0105251_100245522 363
669 3300009011 Ga0105251_10032369 Ga0105251_100323691 363
670 3300009011 Ga0105251_10041514 Ga0105251_100415142 363
671 3300009011 Ga0105251_10065625 Ga0105251_100656251 363
672 3300009011 Ga0105251_10071251 Ga0105251_100712511 363
673 3300009036 Ga0105244_10002080 Ga0105244_100020807 363
674 3300009036 Ga0105244_10017319 Ga0105244_100173192 363
675 3300009036 Ga0105244_10031407 Ga0105244_100314072 363
676 3300009036 Ga0105244_10061539 Ga0105244_100615392 363
677 3300009036 Ga0105244_10067547 Ga0105244_100675472 363
678 3300009036 Ga0105244_10088231 Ga0105244_100882312 363
679 3300009036 Ga0105244_10094234 Ga0105244_100942341 363
680 3300009092 Ga0105250_10003748 Ga0105250_100037485 363
681 3300009092 Ga0105250_10003832 Ga0105250_100038323 363
682 3300009092 Ga0105250_10021069 Ga0105250_100210693 363
683 3300009092 Ga0105250_10023281 Ga0105250_100232811 363
684 3300009092 Ga0105250_10046896 Ga0105250_100468961 363
685 3300009093 Ga0105240_10043773 Ga0105240_100437732 363
686 3300009094 Ga0111539_10144775 Ga0111539_101447753 363
687 3300009098 Ga0105245_10027202 Ga0105245_100272023 363
688 3300009148 Ga0105243_10009254 Ga0105243_100092543 363
689 3300009148 Ga0105243_10012936 Ga0105243_100129365 363
690 3300009148 Ga0105243_10041601 Ga0105243_100416013 363
691 3300009148 Ga0105243_10109570 Ga0105243_101095702 363
692 3300009174 Ga0105241_10037920 Ga0105241_100379203 363
693 3300009174 Ga0105241_10054340 Ga0105241_100543402 363
694 3300009177 Ga0105248_10044791 Ga0105248_100447913 363
695 3300009177 Ga0105248_10120457 Ga0105248_101204572 363
696 3300009545 Ga0105237_10034592 Ga0105237_100345923 363
697 3300009551 Ga0105238_10065111 Ga0105238_100651113 363
698 3300009553 Ga0105249_10025451 Ga0105249_100254514 363
699 3300009553 Ga0105249_10035390 Ga0105249_100353904 363
700 3300009553 Ga0105249_10183864 Ga0105249_101838642 363
701 3300010159 Ga0099796_10000071 Ga0099796_1000007116 363
702 3300010159 Ga0099796_10005817 Ga0099796_100058174 363
703 3300010375 Ga0105239_10011662 Ga0105239_100116622 363
704 3300010375 Ga0105239_10037516 Ga0105239_100375165 363
705 3300010375 Ga0105239_10051508 Ga0105239_100515084 363
706 3300011119 Ga0105246_10006848 Ga0105246_100068485 363
707 3300011119 Ga0105246_10019968 Ga0105246_100199682 363
708 3300011119 Ga0105246_10031877 Ga0105246_100318773 363
709 3300011119 Ga0105246_10035944 Ga0105246_100359442 363
710 3300011119 Ga0105246_10059559 Ga0105246_100595591 363
711 3300011119 Ga0105246_10098707 Ga0105246_100987072 363
712 3300012498 Ga0157345_1000313 Ga0157345_10003132 363
713 3300013100 Ga0157373_10013085 Ga0157373_100130854 363
714 3300013100 Ga0157373_10053162 Ga0157373_100531622 363
715 3300013100 Ga0157373_10055121 Ga0157373_100551211 363
716 3300013100 Ga0157373_10059368 Ga0157373_100593682 363
717 3300013100 Ga0157373_10069451 Ga0157373_100694512 363
718 3300013100 Ga0157373_10073727 Ga0157373_100737271 363
719 3300013100 Ga0157373_10074182 Ga0157373_100741822 363
720 3300013100 Ga0157373_10077737 Ga0157373_100777371 363
721 3300013100 Ga0157373_10077887 Ga0157373_100778872 363
722 3300013102 Ga0157371_10010968 Ga0157371_100109682 363
723 3300013102 Ga0157371_10013341 Ga0157371_100133414 363
724 3300013102 Ga0157371_10031628 Ga0157371_100316282 363
725 3300013104 Ga0157370_10046488 Ga0157370_100464882 363
726 3300013105 Ga0157369_10046843 Ga0157369_100468433 363
727 3300013105 Ga0157369_10071871 Ga0157369_100718711 363
728 3300013105 Ga0157369_10091976 Ga0157369_100919762 363
729 3300013306 Ga0163162_10071260 Ga0163162_100712603 363
730 3300013306 Ga0163162_10105479 Ga0163162_101054793 363
731 3300013307 Ga0157372_10074657 Ga0157372_100746572 363
732 3300013308 Ga0157375_10157882 Ga0157375_101578822 363
733 3300013308 Ga0157375_10161590 Ga0157375_101615902 363
734 3300013308 Ga0157375_10198054 Ga0157375_101980542 363
735 3300013308 Ga0157375_10465470 Ga0157375_104654701 363
736 3300014325 Ga0163163_10074657 Ga0163163_100746572 363
737 3300014497 Ga0182008_10000118 Ga0182008_1000011858 363
738 3300014497 Ga0182008_10004546 Ga0182008_100045462 363
739 3300014497 Ga0182008_10012781 Ga0182008_100127813 363
740 3300014497 Ga0182008_10013518 Ga0182008_100135183 363
741 3300014497 Ga0182008_10015320 Ga0182008_100153203 363
742 3300014497 Ga0182008_10015537 Ga0182008_100155372 363
743 3300014497 Ga0182008_10048088 Ga0182008_100480882 363
744 3300014969 Ga0157376_10242683 Ga0157376_102426832 363
745 3300015261 Ga0182006_1004584 Ga0182006_10045845 363
746 3300015261 Ga0182006_1008050 Ga0182006_10080503 363
747 3300015261 Ga0182006_1009122 Ga0182006_10091222 363
748 3300015261 Ga0182006_1015792 Ga0182006_10157922 363
749 3300015261 Ga0182006_1071688 Ga0182006_10716881 363
750 3300015262 Ga0182007_10006325 Ga0182007_100063254 363
751 3300015265 Ga0182005_1008720 Ga0182005_10087202 363
752 3300015265 Ga0182005_1012383 Ga0182005_10123832 363
753 3300015265 Ga0182005_1013939 Ga0182005_10139392 363
754 3300017792 Ga0163161_10004717 Ga0163161_100047172 363
755 3300017792 Ga0163161_10018973 Ga0163161_100189732 363
756 3300017792 Ga0163161_10079763 Ga0163161_100797632 363
757 3300017792 Ga0163161_10084671 Ga0163161_100846713 363
758 3300017792 Ga0163161_10101313 Ga0163161_101013132 363
759 3300017792 Ga0163161_10123266 Ga0163161_101232662 363
760 3300017792 Ga0163161_10129480 Ga0163161_101294801 363
761 3300025207 Ga0209760_100085 Ga0209760_10008530 363
762 3300025207 Ga0209760_100408 Ga0209760_1004086 363
763 3300025224 Ga0209784_100050 Ga0209784_100050129 363
764 3300025225 Ga0209566_100063 Ga0209566_100063129 363
765 3300025226 Ga0209674_100084 Ga0209674_100084129 363
766 3300025229 Ga0209147_100083 Ga0209147_100083129 363
767 3300025230 Ga0209563_100084 Ga0209563_100084129 363
768 3300025230 Ga0209563_100623 Ga0209563_1006238 363
769 3300025231 Ga0207427_100007 Ga0207427_100007587 363
770 3300025231 Ga0207427_100038 Ga0207427_100038242 363
771 3300025233 Ga0209437_100006 Ga0209437_100006853 363
772 3300025233 Ga0209437_100009 Ga0209437_100009869 363
773 3300025242 Ga0209258_100113 Ga0209258_100113129 363
774 3300025246 Ga0209646_1000302 Ga0209646_100030220 363
775 3300025253 Ga0209677_100047 Ga0209677_100047129 363
776 3300025256 Ga0209759_1004130 Ga0209759_10041306 363
777 3300025261 Ga0209233_1000059 Ga0209233_1000059142 363
778 3300025261 Ga0209233_1000074 Ga0209233_1000074242 363
779 3300025261 Ga0209233_1000155 Ga0209233_100015538 363
780 3300025291 Ga0209675_1005889 Ga0209675_10058892 363
781 3300025292 Ga0209676_1000006 Ga0209676_1000006835 363
782 3300025292 Ga0209676_1000010 Ga0209676_1000010810 363
783 3300025292 Ga0209676_1002985 Ga0209676_10029859 363
784 3300025292 Ga0209676_1006892 Ga0209676_10068922 363
785 3300025292 Ga0209676_1008984 Ga0209676_10089843 363
786 3300025294 Ga0209025_1000113 Ga0209025_100011347 363
787 3300025298 Ga0209050_1000019 Ga0209050_100001953 363
788 3300025298 Ga0209050_1000027 Ga0209050_1000027301 363
789 3300025298 Ga0209050_1000494 Ga0209050_100049467 363
790 3300025298 Ga0209050_1007216 Ga0209050_10072164 363
791 3300025299 Ga0209256_1002634 Ga0209256_100263413 363
792 3300025302 Ga0207426_1015277 Ga0207426_10152773 363
793 3300025303 Ga0209051_1000102 Ga0209051_100010215 363
794 3300025303 Ga0209051_1000356 Ga0209051_100035667 363
795 3300025303 Ga0209051_1000383 Ga0209051_100038314 363
796 3300025304 Ga0209257_1000357 Ga0209257_10003572 363
797 3300025304 Ga0209257_1008166 Ga0209257_10081664 363
798 3300025711 Ga0207696_1000052 Ga0207696_1000052181 363
799 3300025711 Ga0207696_1000054 Ga0207696_1000054191 363
800 3300025711 Ga0207696_1000213 Ga0207696_100021356 363
801 3300025711 Ga0207696_1003518 Ga0207696_10035185 363
802 3300025711 Ga0207696_1006973 Ga0207696_10069732 363
803 3300025711 Ga0207696_1016721 Ga0207696_10167211 363
804 3300025711 Ga0207696_1025093 Ga0207696_10250932 363
805 3300025728 Ga0207655_1003610 Ga0207655_10036103 363
806 3300025728 Ga0207655_1003693 Ga0207655_10036932 363
807 3300025728 Ga0207655_1007731 Ga0207655_10077313 363
808 3300025728 Ga0207655_1014269 Ga0207655_10142693 363
809 3300025728 Ga0207655_1021841 Ga0207655_10218412 363
810 3300025728 Ga0207655_1028430 Ga0207655_10284303 363
811 3300025728 Ga0207655_1028973 Ga0207655_10289731 363
812 3300025728 Ga0207655_1030543 Ga0207655_10305431 363
813 3300025728 Ga0207655_1037648 Ga0207655_10376482 363
814 3300025735 Ga0207713_1000013 Ga0207713_1000013321 363
815 3300025735 Ga0207713_1010035 Ga0207713_10100351 363
816 3300025735 Ga0207713_1011872 Ga0207713_10118722 363
817 3300025735 Ga0207713_1025915 Ga0207713_10259152 363
818 3300025735 Ga0207713_1029894 Ga0207713_10298942 363
819 3300025735 Ga0207713_1030331 Ga0207713_10303312 363
820 3300025885 Ga0207653_10004328 Ga0207653_100043282 363
821 3300025898 Ga0207692_10006623 Ga0207692_100066233 363
822 3300025901 Ga0207688_10003465 Ga0207688_100034656 363
823 3300025903 Ga0207680_10064388 Ga0207680_100643881 363
824 3300025904 Ga0207647_10099355 Ga0207647_100993552 363
825 3300025904 Ga0207647_10148515 Ga0207647_101485151 363
826 3300025907 Ga0207645_10056064 Ga0207645_100560642 363
827 3300025910 Ga0207684_10098803 Ga0207684_100988031 363
828 3300025910 Ga0207684_10139138 Ga0207684_101391382 363
829 3300025911 Ga0207654_10017811 Ga0207654_100178111 363
830 3300025912 Ga0207707_10052071 Ga0207707_100520712 363
831 3300025914 Ga0207671_10021914 Ga0207671_100219144 363
832 3300025915 Ga0207693_10068379 Ga0207693_100683791 363
833 3300025916 Ga0207663_10102138 Ga0207663_101021381 363
834 3300025919 Ga0207657_10258386 Ga0207657_102583862 363
835 3300025920 Ga0207649_10020234 Ga0207649_100202343 363
836 3300025920 Ga0207649_10026837 Ga0207649_100268372 363
837 3300025921 Ga0207652_10060219 Ga0207652_100602192 363
838 3300025923 Ga0207681_10117514 Ga0207681_101175142 363
839 3300025923 Ga0207681_10138791 Ga0207681_101387912 363
840 3300025925 Ga0207650_10000575 Ga0207650_100005753 363
841 3300025928 Ga0207700_10020622 Ga0207700_100206223 363
842 3300025929 Ga0207664_10024049 Ga0207664_100240493 363
843 3300025929 Ga0207664_10215329 Ga0207664_102153291 363
844 3300025931 Ga0207644_10098875 Ga0207644_100988752 363
845 3300025932 Ga0207690_10100236 Ga0207690_101002362 363
846 3300025933 Ga0207706_10013343 Ga0207706_100133433 363
847 3300025933 Ga0207706_10018193 Ga0207706_100181936 363
848 3300025933 Ga0207706_10027670 Ga0207706_100276705 363
849 3300025935 Ga0207709_10000224 Ga0207709_100002249 363
850 3300025935 Ga0207709_10002095 Ga0207709_100020957 363
851 3300025935 Ga0207709_10070423 Ga0207709_100704231 363
852 3300025935 Ga0207709_10089043 Ga0207709_100890432 363
853 3300025939 Ga0207665_10036669 Ga0207665_100366692 363
854 3300025941 Ga0207711_10074730 Ga0207711_100747302 363
855 3300025941 Ga0207711_10104954 Ga0207711_101049542 363
856 3300025942 Ga0207689_10008566 Ga0207689_100085665 363
857 3300025960 Ga0207651_10123234 Ga0207651_101232342 363
858 3300025961 Ga0207712_10103052 Ga0207712_101030521 363
859 3300025961 Ga0207712_10221159 Ga0207712_102211591 363
860 3300025972 Ga0207668_10012628 Ga0207668_100126282 363
861 3300025981 Ga0207640_10049644 Ga0207640_100496442 363
862 3300026023 Ga0207677_10010989 Ga0207677_100109892 363
863 3300026035 Ga0207703_10005208 Ga0207703_100052089 363
864 3300026035 Ga0207703_10071366 Ga0207703_100713661 363
865 3300026041 Ga0207639_10149851 Ga0207639_101498511 363
866 3300026067 Ga0207678_10002939 Ga0207678_100029399 363
867 3300026067 Ga0207678_10036589 Ga0207678_100365894 363
868 3300026075 Ga0207708_10109741 Ga0207708_101097412 363
869 3300026088 Ga0207641_10013381 Ga0207641_100133812 363
870 3300026089 Ga0207648_10135581 Ga0207648_101355811 363
871 3300026095 Ga0207676_10049626 Ga0207676_100496262 363
872 3300026116 Ga0207674_10167153 Ga0207674_101671532 363
873 3300026118 Ga0207675_100062183 Ga0207675_1000621833 363
874 3300026118 Ga0207675_100089155 Ga0207675_1000891553 363
875 3300026121 Ga0207683_10019750 Ga0207683_100197503 363
876 3300026121 Ga0207683_10033130 Ga0207683_100331302 363
877 3300027111 Ga0209281_1000015 Ga0209281_1000015275 363
878 3300027111 Ga0209281_1000228 Ga0209281_1000228114 363
879 3300027111 Ga0209281_1007083 Ga0209281_10070832 363
880 3300027512 Ga0209179_1002693 Ga0209179_10026932 363
881 3300027512 Ga0209179_1002990 Ga0209179_10029902 363
882 3300027671 Ga0209588_1001992 Ga0209588_10019922 363
883 3300027671 Ga0209588_1005473 Ga0209588_10054732 363
884 3300027866 Ga0209813_10024784 Ga0209813_100247842 363
885 3300027907 Ga0207428_10094763 Ga0207428_100947631 363
886 3300027907 Ga0207428_10097940 Ga0207428_100979403 363
887 3300028379 Ga0268266_10016765 Ga0268266_100167655 363
888 3300028379 Ga0268266_10043060 Ga0268266_100430602 363
889 3300028380 Ga0268265_10185946 Ga0268265_101859462 363
890 3300028381 Ga0268264_10017159 Ga0268264_100171592 363
891 3300028381 Ga0268264_10041558 Ga0268264_100415582 363
892 3300028573 Ga0265334_10031233 Ga0265334_100312331 363
893 3300030521 Ga0307511_10000022 Ga0307511_1000002283 363
894 3300030521 Ga0307511_10081071 Ga0307511_100810712 363
895 3300030521 Ga0307511_10170050 Ga0307511_101700501 363
896 3300030733 Ga0314311_1084958 Ga0314311_10849583 363
897 3300030735 Ga0316178_1061339 Ga0316178_106133913 363
898 3300030742 Ga0316183_1162789 Ga0316183_11627892 363
899 3300030742 Ga0316183_1174315 Ga0316183_11743152 363
900 3300030744 Ga0316181_1090505 Ga0316181_10905052 363
901 3300031235 Ga0265330_10000116 Ga0265330_1000011635 363
902 3300031238 Ga0265332_10000003 Ga0265332_1000000332 363
903 3300031238 Ga0265332_10000012 Ga0265332_10000012201 363
904 3300031241 Ga0265325_10007177 Ga0265325_100071773 363
905 3300031247 Ga0265340_10056000 Ga0265340_100560002 363
906 3300031456 Ga0307513_10147427 Ga0307513_101474271 363
907 3300031507 Ga0307509_10179427 Ga0307509_101794272 363
908 3300031548 Ga0307408_100000020 Ga0307408_100000020158 363
909 3300031548 Ga0307408_100011048 Ga0307408_1000110483 363
910 3300031548 Ga0307408_100035977 Ga0307408_1000359772 363
911 3300031548 Ga0307408_100075697 Ga0307408_1000756972 363
912 3300031548 Ga0307408_100278762 Ga0307408_1002787621 363
913 3300031548 Ga0307408_100295096 Ga0307408_1002950961 363
914 3300031649 Ga0307514_10001125 Ga0307514_1000112522 363
915 3300031649 Ga0307514_10106507 Ga0307514_101065072 363
916 3300031711 Ga0265314_10000029 Ga0265314_1000002956 363
917 3300031711 Ga0265314_10024671 Ga0265314_100246712 363
918 3300031731 Ga0307405_10002086 Ga0307405_100020863 363
919 3300031731 Ga0307405_10004473 Ga0307405_100044732 363
920 3300031731 Ga0307405_10077115 Ga0307405_100771152 363
921 3300031824 Ga0307413_10057078 Ga0307413_100570782 363
922 3300031838 Ga0307518_10131298 Ga0307518_101312982 363
923 3300031901 Ga0307406_10008832 Ga0307406_100088323 363
924 3300031901 Ga0307406_10248885 Ga0307406_102488851 363
925 3300031903 Ga0307407_10062192 Ga0307407_100621922 363
926 3300031911 Ga0307412_10002073 Ga0307412_100020738 363
927 3300031911 Ga0307412_10061526 Ga0307412_100615261 363
928 3300031911 Ga0307412_10086868 Ga0307412_100868682 363
929 3300031995 Ga0307409_100035588 Ga0307409_1000355882 363
930 3300031995 Ga0307409_100047441 Ga0307409_1000474412 363
931 3300032004 Ga0307414_10120348 Ga0307414_101203482 363
932 3300032005 Ga0307411_10042190 Ga0307411_100421902 363
933 3300032005 Ga0307411_10123617 Ga0307411_101236172 363
934 3300033179 Ga0307507_10000090 Ga0307507_100000901 363
935 3300033180 Ga0307510_10030629 Ga0307510_100306294 363
936 3300035089 Ga0373944_0003538 Ga0373944_0003538_2119_3276 363
937 3300035113 Ga0373936_0018269 Ga0373936_0018269_1184_2341 363
938 3300035116 Ga0373945_0000855 Ga0373945_0000855_7023_8180 363
939 3300035118 Ga0373954_0042059 Ga0373954_0042059_627_1784 363
940 3300035170 Ga0373943_0002078 Ga0373943_0002078_67_1224 363
941 3300035171 Ga0373946_0004768 Ga0373946_0004768_2601_3758 363
942 3300035410 Ga0373924_0009036 Ga0373924_0009036_721_1878 363
943 3300035692 Ga0373935_0016263 Ga0373935_0016263_745_1902 363
944 3300035695 Ga0373927_0003917 Ga0373927_0003917_1119_2276 363
945 3300035695 Ga0373927_0149454 Ga0373927_0149454_351_1508 363
946 3300035725 Ga0373947_0078367 Ga0373947_0078367_228_1385 363
947 3300037068 Ga0373925_0004751 Ga0373925_0004751_661_1818 363
948 3300037418 Ga0395900_0007913 Ga0395900_0007913_1565_2707 363
949 3300037853 Ga0436364_0049303 Ga0436364_0049303_145_1287 363
950 3300039062 Ga0400483_017318 Ga0400483_017318_138_1292 363
951 3300039062 Ga0400483_101085 Ga0400483_101085_730_1947 363
952 3300039062 Ga0400483_147535 Ga0400483_147535_993_2147 363
953 3300039062 Ga0400483_268849 Ga0400483_268849_48_1193 363
954 3300041404 Ga0439436_0000138 Ga0439436_0000138_5860_6999 363
955 3300041405 Ga0439438_001842 Ga0439438_001842_7568_8704 363
956 3300041405 Ga0439438_001948 Ga0439438_001948_863_1999 363
957 3300041405 Ga0439438_002481 Ga0439438_002481_1628_2764 363
958 3300041405 Ga0439438_006466 Ga0439438_006466_841_1977 363
959 3300041405 Ga0439438_007515 Ga0439438_007515_1045_2184 363
960 3300041405 Ga0439438_010612 Ga0439438_010612_924_2060 363
961 3300041405 Ga0439438_012365 Ga0439438_012365_95_1231 363
962 3300041405 Ga0439438_014653 Ga0439438_014653_1114_2250 363
963 3300041405 Ga0439438_019261 Ga0439438_019261_257_1393 363
964 3300041405 Ga0439438_022238 Ga0439438_022238_208_1344 363
965 3300041407 Ga0439447_001126 Ga0439447_001126_676_1812 363
966 3300041407 Ga0439447_006157 Ga0439447_006157_1993_3129 363
967 3300041407 Ga0439447_006722 Ga0439447_006722_2011_3147 363
968 3300041407 Ga0439447_017208 Ga0439447_017208_132_1268 363
969 3300041411 Ga0439466_0001318 Ga0439466_0001318_7101_8237 363
970 3300041411 Ga0439466_0001689 Ga0439466_0001689_7063_8199 363
971 3300041411 Ga0439466_0005601 Ga0439466_0005601_2716_3855 363
972 3300041411 Ga0439466_0007320 Ga0439466_0007320_1785_2921 363
973 3300041411 Ga0439466_0013558 Ga0439466_0013558_1610_2746 363
974 3300041411 Ga0439466_0030847 Ga0439466_0030847_242_1378 363
975 3300041411 Ga0439466_0031853 Ga0439466_0031853_370_1506 363
976 3300042006 Ga0439432_014042 Ga0439432_014042_1076_2212 363
977 3300042006 Ga0439432_015231 Ga0439432_015231_151_1287 363
978 3300042006 Ga0439432_020579 Ga0439432_020579_812_1948 363
979 3300042007 Ga0439449_0004493 Ga0439449_0004493_1515_2648 363
980 3300042009 Ga0439451_005260 Ga0439451_005260_458_1633 363
981 3300042010 Ga0439452_001086 Ga0439452_001086_9950_11086 363
982 3300042010 Ga0439452_002005 Ga0439452_002005_1415_2551 363
983 3300042010 Ga0439452_005451 Ga0439452_005451_1702_2838 363
984 3300042010 Ga0439452_020021 Ga0439452_020021_417_1553 363
985 3300042013 Ga0439456_001525 Ga0439456_001525_2776_3912 363
986 3300042013 Ga0439456_021075 Ga0439456_021075_43_1179 363
987 3300042016 Ga0439463_006913 Ga0439463_006913_1123_2259 363
988 3300042115 Ga0450911_002416 Ga0450911_002416_1785_2921 363
989 3300042122 Ga0450920_003684 Ga0450920_003684_1459_2595 363
990 3300042124 Ga0450922_001378 Ga0450922_001378_55_1191 363
991 3300042127 Ga0450890_004121 Ga0450890_004121_267_1403 363
992 3300042138 Ga0450903_002198 Ga0450903_002198_1248_2384 363
993 3300042138 Ga0450903_003627 Ga0450903_003627_968_2104 363
994 3300042145 Ga0450906_002475 Ga0450906_002475_1975_3111 363
995 3300042146 Ga0450907_004153 Ga0450907_004153_1164_2300 363
996 3300042146 Ga0450907_006980 Ga0450907_006980_540_1676 363
997 3300042146 Ga0450907_010887 Ga0450907_010887_354_1490 363
998 3300042184 Ga0450908_002247 Ga0450908_002247_1580_2716 363
999 3300042435 Ga0439434_0022258 Ga0439434_0022258_205_1341 363
1000 3300042439 Ga0439464_0004446 Ga0439464_0004446_2270_3427 363
1001 3300044693 Ga0466961_0020864 Ga0466961_0020864_2750_3892 363
1002 3300044694 Ga0466963_0113056 Ga0466963_0113056_708_1850 363
1003 3300044712 Ga0453684_0251482 Ga0453684_0251482_154_1383 363
1004 3300044719 Ga0466971_0004232 Ga0466971_0004232_4999_6141 363
1005 3300044901 Ga0466960_0000375 Ga0466960_0000375_6808_7959 363
1006 3300045976 Ga0466967_0069371 Ga0466967_0069371_1370_2527 363
1007 3300046452 Ga0495617_000419 Ga0495617_000419_20831_21967 363
1008 3300046452 Ga0495617_010992 Ga0495617_010992_131_1267 363
1009 3300046452 Ga0495617_011341 Ga0495617_011341_639_1775 363
1010 3300046453 Ga0495627_004232 Ga0495627_004232_1061_2197 363
1011 3300046453 Ga0495627_009904 Ga0495627_009904_1778_2914 363
1012 3300046453 Ga0495627_016444 Ga0495627_016444_705_1841 363
1013 3300046455 Ga0495603_0087552 Ga0495603_0087552_599_1735 363
1014 3300046457 Ga0495590_0017911 Ga0495590_0017911_279_1415 363
1015 3300046457 Ga0495590_0023350 Ga0495590_0023350_184_1320 363
1016 3300046458 Ga0495591_005006 Ga0495591_005006_3832_4968 363
1017 3300046458 Ga0495591_005182 Ga0495591_005182_1059_2195 363
1018 3300046458 Ga0495591_008931 Ga0495591_008931_2105_3241 363
1019 3300046458 Ga0495591_016701 Ga0495591_016701_1134_2270 363
1020 3300046458 Ga0495591_026752 Ga0495591_026752_490_1626 363
1021 3300046460 Ga0495638_0005968 Ga0495638_0005968_677_1813 363
1022 3300046460 Ga0495638_0009156 Ga0495638_0009156_4579_5715 363
1023 3300046460 Ga0495638_0021865 Ga0495638_0021865_385_1527 363
1024 3300046460 Ga0495638_0022412 Ga0495638_0022412_1818_2960 363
1025 3300046460 Ga0495638_0050623 Ga0495638_0050623_184_1320 363
1026 3300046460 Ga0495638_0094164 Ga0495638_0094164_479_1615 363
1027 3300046460 Ga0495638_0125659 Ga0495638_0125659_186_1322 363
1028 3300046461 Ga0495641_0020992 Ga0495641_0020992_829_1986 363
1029 3300046462 Ga0495651_0120592 Ga0495651_0120592_383_1540 363
1030 3300046463 Ga0495653_0040212 Ga0495653_0040212_1269_2405 363
1031 3300046463 Ga0495653_0043497 Ga0495653_0043497_947_2083 363
1032 3300046463 Ga0495653_0047939 Ga0495653_0047939_848_1984 363
1033 3300046463 Ga0495653_0065228 Ga0495653_0065228_1572_2729 363
1034 3300046463 Ga0495653_0077378 Ga0495653_0077378_556_1692 363
1035 3300046471 Ga0495650_0010806 Ga0495650_0010806_2643_3779 363
1036 3300046471 Ga0495650_0015050 Ga0495650_0015050_1454_2590 363
1037 3300046471 Ga0495650_0058664 Ga0495650_0058664_217_1353 363
1038 3300046471 Ga0495650_0073013 Ga0495650_0073013_58_1194 363
1039 3300046474 Ga0495605_0000152 Ga0495605_0000152_1793_2929 363
1040 3300046474 Ga0495605_0003305 Ga0495605_0003305_7302_8438 363
1041 3300046474 Ga0495605_0009172 Ga0495605_0009172_182_1318 363
1042 3300046474 Ga0495605_0054444 Ga0495605_0054444_186_1322 363
1043 3300046474 Ga0495605_0056403 Ga0495605_0056403_209_1345 363
1044 3300046475 Ga0495639_0003410 Ga0495639_0003410_1215_2351 363
1045 3300046476 Ga0495662_0024046 Ga0495662_0024046_427_1584 363
1046 3300046491 Ga0495584_0003579 Ga0495584_0003579_6086_7222 363
1047 3300046491 Ga0495584_0011393 Ga0495584_0011393_1258_2394 363
1048 3300046491 Ga0495584_0023705 Ga0495584_0023705_379_1515 363
1049 3300046491 Ga0495584_0059484 Ga0495584_0059484_252_1388 363
1050 3300046491 Ga0495584_0066578 Ga0495584_0066578_493_1629 363
1051 3300046491 Ga0495584_0072515 Ga0495584_0072515_495_1631 363
1052 3300046491 Ga0495584_0095164 Ga0495584_0095164_182_1318 363
1053 3300046492 Ga0495585_0002697 Ga0495585_0002697_1238_2374 363
1054 3300046492 Ga0495585_0004014 Ga0495585_0004014_1140_2276 363
1055 3300046492 Ga0495585_0016536 Ga0495585_0016536_560_1696 363
1056 3300046492 Ga0495585_0017338 Ga0495585_0017338_492_1628 363
1057 3300046492 Ga0495585_0028914 Ga0495585_0028914_1445_2581 363
1058 3300046492 Ga0495585_0049782 Ga0495585_0049782_1004_2140 363
1059 3300046492 Ga0495585_0117920 Ga0495585_0117920_240_1382 363
1060 3300046499 Ga0495594_0025112 Ga0495594_0025112_416_1558 363
1061 3300046499 Ga0495594_0050960 Ga0495594_0050960_339_1475 363
1062 3300046499 Ga0495594_0056704 Ga0495594_0056704_199_1335 363
1063 3300046500 Ga0495596_0004342 Ga0495596_0004342_4511_5647 363
1064 3300046501 Ga0495607_0008226 Ga0495607_0008226_4580_5716 363
1065 3300046501 Ga0495607_0024512 Ga0495607_0024512_783_1919 363
1066 3300046501 Ga0495607_0032477 Ga0495607_0032477_1044_2180 363
1067 3300046501 Ga0495607_0047283 Ga0495607_0047283_175_1311 363
1068 3300046501 Ga0495607_0056231 Ga0495607_0056231_844_1980 363
1069 3300046501 Ga0495607_0073720 Ga0495607_0073720_186_1322 363
1070 3300046501 Ga0495607_0099526 Ga0495607_0099526_175_1311 363
1071 3300046501 Ga0495607_0117212 Ga0495607_0117212_84_1220 363
1072 3300046506 Ga0495583_0018804 Ga0495583_0018804_1214_2350 363
1073 3300046506 Ga0495583_0021265 Ga0495583_0021265_536_1672 363
1074 3300046506 Ga0495583_0024995 Ga0495583_0024995_961_2097 363
1075 3300046506 Ga0495583_0028527 Ga0495583_0028527_889_2025 363
1076 3300046506 Ga0495583_0034276 Ga0495583_0034276_123_1259 363
1077 3300046506 Ga0495583_0053399 Ga0495583_0053399_189_1325 363
1078 3300046506 Ga0495583_0083878 Ga0495583_0083878_61_1197 363
1079 3300046507 Ga0495606_0008316 Ga0495606_0008316_7185_8321 363
1080 3300046507 Ga0495606_0021464 Ga0495606_0021464_2317_3453 363
1081 3300046507 Ga0495606_0025613 Ga0495606_0025613_1248_2384 363
1082 3300046507 Ga0495606_0036586 Ga0495606_0036586_1407_2543 363
1083 3300046507 Ga0495606_0051628 Ga0495606_0051628_138_1274 363
1084 3300046507 Ga0495606_0067722 Ga0495606_0067722_908_2044 363
1085 3300046512 Ga0495610_0004852 Ga0495610_0004852_1200_2336 363
1086 3300046512 Ga0495610_0023130 Ga0495610_0023130_1118_2254 363
1087 3300046512 Ga0495610_0025046 Ga0495610_0025046_1141_2277 363
1088 3300046512 Ga0495610_0034354 Ga0495610_0034354_208_1344 363
1089 3300046512 Ga0495610_0045744 Ga0495610_0045744_909_2045 363
1090 3300046513 Ga0495616_0010258 Ga0495616_0010258_3678_4814 363
1091 3300046513 Ga0495616_0018249 Ga0495616_0018249_983_2119 363
1092 3300046513 Ga0495616_0038139 Ga0495616_0038139_1215_2351 363
1093 3300046513 Ga0495616_0057492 Ga0495616_0057492_630_1766 363
1094 3300046513 Ga0495616_0061435 Ga0495616_0061435_15_1136 363
1095 3300046515 Ga0495620_0013582 Ga0495620_0013582_1119_2255 363
1096 3300046515 Ga0495620_0019141 Ga0495620_0019141_621_1757 363
1097 3300046515 Ga0495620_0029780 Ga0495620_0029780_896_2032 363
1098 3300046517 Ga0495630_0083442 Ga0495630_0083442_1068_2225 363
1099 3300046518 Ga0495631_0006697 Ga0495631_0006697_3542_4678 363
1100 3300046518 Ga0495631_0016236 Ga0495631_0016236_1681_2817 363
1101 3300046519 Ga0495632_0014317 Ga0495632_0014317_1106_2242 363
1102 3300046519 Ga0495632_0034155 Ga0495632_0034155_106_1242 363
1103 3300046519 Ga0495632_0036777 Ga0495632_0036777_175_1311 363
1104 3300046519 Ga0495632_0047812 Ga0495632_0047812_479_1615 363
1105 3300046519 Ga0495632_0052882 Ga0495632_0052882_685_1821 363
1106 3300046519 Ga0495632_0081407 Ga0495632_0081407_251_1387 363
1107 3300046520 Ga0495637_0001495 Ga0495637_0001495_11142_12278 363
1108 3300046520 Ga0495637_0012561 Ga0495637_0012561_663_1799 363
1109 3300046520 Ga0495637_0016665 Ga0495637_0016665_1679_2815 363
1110 3300046520 Ga0495637_0022274 Ga0495637_0022274_369_1505 363
1111 3300046520 Ga0495637_0023314 Ga0495637_0023314_494_1630 363
1112 3300046520 Ga0495637_0031551 Ga0495637_0031551_988_2124 363
1113 3300046520 Ga0495637_0039038 Ga0495637_0039038_385_1521 363
1114 3300046520 Ga0495637_0072443 Ga0495637_0072443_173_1309 363
1115 3300046522 Ga0495643_0032050 Ga0495643_0032050_1285_2421 363
1116 3300046522 Ga0495643_0037125 Ga0495643_0037125_281_1423 363
1117 3300046522 Ga0495643_0060483 Ga0495643_0060483_132_1268 363
1118 3300046522 Ga0495643_0079608 Ga0495643_0079608_509_1645 363
1119 3300046523 Ga0495644_0037645 Ga0495644_0037645_504_1640 363
1120 3300046524 Ga0495648_0001541 Ga0495648_0001541_20193_21329 363
1121 3300046524 Ga0495648_0006414 Ga0495648_0006414_1161_2297 363
1122 3300046524 Ga0495648_0016062 Ga0495648_0016062_3636_4772 363
1123 3300046524 Ga0495648_0023973 Ga0495648_0023973_854_1990 363
1124 3300046524 Ga0495648_0030090 Ga0495648_0030090_1841_2977 363
1125 3300046524 Ga0495648_0031607 Ga0495648_0031607_626_1762 363
1126 3300046524 Ga0495648_0046737 Ga0495648_0046737_1284_2420 363
1127 3300046524 Ga0495648_0047997 Ga0495648_0047997_983_2119 363
1128 3300046524 Ga0495648_0053072 Ga0495648_0053072_90_1226 363
1129 3300046524 Ga0495648_0054797 Ga0495648_0054797_754_1890 363
1130 3300046525 Ga0495663_0015746 Ga0495663_0015746_16_1134 363
1131 3300046526 Ga0495666_0050817 Ga0495666_0050817_120_1256 363
1132 3300046528 Ga0495642_0002842 Ga0495642_0002842_4528_5664 363
1133 3300046528 Ga0495642_0004228 Ga0495642_0004228_4394_5530 363
1134 3300046528 Ga0495642_0023678 Ga0495642_0023678_111_1247 363
1135 3300046530 Ga0495654_0013072 Ga0495654_0013072_2272_3408 363
1136 3300046530 Ga0495654_0014527 Ga0495654_0014527_1893_3029 363
1137 3300046530 Ga0495654_0022792 Ga0495654_0022792_523_1659 363
1138 3300046530 Ga0495654_0028076 Ga0495654_0028076_1230_2366 363
1139 3300046530 Ga0495654_0036253 Ga0495654_0036253_1205_2341 363
1140 3300046530 Ga0495654_0036527 Ga0495654_0036527_288_1424 363
1141 3300046530 Ga0495654_0038506 Ga0495654_0038506_804_1940 363
1142 3300046530 Ga0495654_0040898 Ga0495654_0040898_1156_2292 363
1143 3300046530 Ga0495654_0052619 Ga0495654_0052619_738_1874 363
1144 3300046530 Ga0495654_0063601 Ga0495654_0063601_175_1311 363
1145 3300046530 Ga0495654_0084069 Ga0495654_0084069_194_1330 363
1146 3300046530 Ga0495654_0097376 Ga0495654_0097376_160_1296 363
1147 3300046531 Ga0495665_0001906 Ga0495665_0001906_8166_9323 363
1148 3300046531 Ga0495665_0112556 Ga0495665_0112556_148_1305 363
1149 3300046538 Ga0495609_0006819 Ga0495609_0006819_3431_4567 363
1150 3300046538 Ga0495609_0031484 Ga0495609_0031484_231_1367 363
1151 3300046538 Ga0495609_0032935 Ga0495609_0032935_1065_2201 363
1152 3300046538 Ga0495609_0039141 Ga0495609_0039141_152_1288 363
1153 3300046542 Ga0495597_0005204 Ga0495597_0005204_1283_2419 363
1154 3300046542 Ga0495597_0015990 Ga0495597_0015990_1582_2718 363
1155 3300046542 Ga0495597_0031645 Ga0495597_0031645_520_1656 363
1156 3300046542 Ga0495597_0038142 Ga0495597_0038142_16_1152 363
1157 3300046542 Ga0495597_0039801 Ga0495597_0039801_882_2018 363
1158 3300046542 Ga0495597_0053963 Ga0495597_0053963_517_1653 363
1159 3300046542 Ga0495597_0095733 Ga0495597_0095733_36_1178 363
1160 3300046543 Ga0495645_0002166 Ga0495645_0002166_8986_10128 363
1161 3300046543 Ga0495645_0105897 Ga0495645_0105897_112_1248 363
1162 3300046557 Ga0495622_0012351 Ga0495622_0012351_990_2126 363
1163 3300046557 Ga0495622_0042600 Ga0495622_0042600_241_1377 363
1164 3300046557 Ga0495622_0092611 Ga0495622_0092611_49_1227 363
1165 3300046558 Ga0495633_0018782 Ga0495633_0018782_1628_2764 363
1166 3300046558 Ga0495633_0019960 Ga0495633_0019960_1580_2716 363
1167 3300046558 Ga0495633_0074594 Ga0495633_0074594_415_1557 363
1168 3300046559 Ga0495667_0106370 Ga0495667_0106370_500_1657 363
1169 3300046615 Ga0495656_0012748 Ga0495656_0012748_45_1163 363
1170 3300046615 Ga0495656_0023037 Ga0495656_0023037_40_1176 363
1171 3300046616 Ga0495668_0017235 Ga0495668_0017235_2509_3645 363
1172 3300046616 Ga0495668_0035550 Ga0495668_0035550_1285_2421 363
1173 3300046616 Ga0495668_0054775 Ga0495668_0054775_269_1405 363
1174 3300046642 Ga0495634_0028485 Ga0495634_0028485_1208_2344 363
1175 3300046648 Ga0495611_0004389 Ga0495611_0004389_1085_2221 363
1176 3300046648 Ga0495611_0043506 Ga0495611_0043506_536_1672 363
1177 3300046660 Ga0495625_0014742 Ga0495625_0014742_1007_2143 363
1178 3300046660 Ga0495625_0032446 Ga0495625_0032446_965_2101 363
1179 3300046660 Ga0495625_0043510 Ga0495625_0043510_332_1468 363
1180 3300046660 Ga0495625_0073312 Ga0495625_0073312_808_1986 363
1181 3300046660 Ga0495625_0125699 Ga0495625_0125699_158_1294 363
1182 3300046660 Ga0495625_0149239 Ga0495625_0149239_373_1509 363
1183 3300046663 Ga0495635_0011014 Ga0495635_0011014_5149_6306 363
1184 3300046663 Ga0495635_0026960 Ga0495635_0026960_2421_3578 363
1185 3300046663 Ga0495635_0030513 Ga0495635_0030513_1572_2708 363
1186 3300046664 Ga0495659_0025721 Ga0495659_0025721_184_1320 363
1187 3300046665 Ga0495661_0009327 Ga0495661_0009327_4492_5628 363
1188 3300046665 Ga0495661_0034500 Ga0495661_0034500_559_1695 363
1189 3300046665 Ga0495661_0079320 Ga0495661_0079320_671_1807 363
1190 3300046665 Ga0495661_0098562 Ga0495661_0098562_260_1396 363
1191 3300046674 Ga0495588_0029999 Ga0495588_0029999_567_1703 363
1192 3300046679 Ga0495623_0024842 Ga0495623_0024842_606_1742 363
1193 3300046679 Ga0495623_0041129 Ga0495623_0041129_94_1230 363
1194 3300046680 Ga0495646_0090837 Ga0495646_0090837_15_1151 363
1195 3300046684 Ga0495669_0041078 Ga0495669_0041078_876_2012 363
1196 3300046689 Ga0495613_0047629 Ga0495613_0047629_565_1701 363
1197 3300046690 Ga0495624_0010903 Ga0495624_0010903_988_2124 363
1198 3300046691 Ga0495670_0015225 Ga0495670_0015225_1747_2883 363
1199 3300046691 Ga0495670_0019138 Ga0495670_0019138_381_1523 363
1200 3300046691 Ga0495670_0021409 Ga0495670_0021409_530_1666 363
1201 3300046692 Ga0495671_0013014 Ga0495671_0013014_1265_2401 363
1202 3300046692 Ga0495671_0027762 Ga0495671_0027762_217_1353 363
1203 3300046692 Ga0495671_0039701 Ga0495671_0039701_760_1896 363
1204 3300046692 Ga0495671_0040390 Ga0495671_0040390_1092_2228 363
1205 3300046692 Ga0495671_0058621 Ga0495671_0058621_298_1434 363
1206 3300046692 Ga0495671_0059730 Ga0495671_0059730_562_1698 363
1207 3300046692 Ga0495671_0095599 Ga0495671_0095599_186_1322 363
1208 3300046694 Ga0495649_0000571 Ga0495649_0000571_28784_29920 363
1209 3300046694 Ga0495649_0009534 Ga0495649_0009534_3341_4477 363
1210 3300046694 Ga0495649_0018434 Ga0495649_0018434_1586_2722 363
1211 3300046694 Ga0495649_0023723 Ga0495649_0023723_530_1666 363
1212 3300046694 Ga0495649_0048384 Ga0495649_0048384_777_1913 363
1213 3300046694 Ga0495649_0071009 Ga0495649_0071009_489_1625 363
1214 3300046694 Ga0495649_0119615 Ga0495649_0119615_50_1186 363
1215 3300046794 Ga0495589_0014806 Ga0495589_0014806_1797_2933 363
1216 3300046794 Ga0495589_0034929 Ga0495589_0034929_1211_2347 363
1217 3300046794 Ga0495589_0041163 Ga0495589_0041163_609_1745 363
1218 3300046794 Ga0495589_0089205 Ga0495589_0089205_265_1401 363
1219 3300046794 Ga0495589_0100169 Ga0495589_0100169_226_1362 363
1220 3300046809 Ga0495600_0034578 Ga0495600_0034578_685_1821 363
1221 3300046809 Ga0495600_0043455 Ga0495600_0043455_546_1682 363
1222 3300046809 Ga0495600_0212463 Ga0495600_0212463_33_1190 363
1223 3300046810 Ga0495660_0017765 Ga0495660_0017765_749_1885 363
1224 3300046810 Ga0495660_0024102 Ga0495660_0024102_566_1702 363
1225 3300046810 Ga0495660_0025621 Ga0495660_0025621_666_1802 363
1226 3300046810 Ga0495660_0033046 Ga0495660_0033046_743_1879 363
1227 3300046810 Ga0495660_0042675 Ga0495660_0042675_1219_2355 363
1228 3300046810 Ga0495660_0045590 Ga0495660_0045590_880_2016 363
1229 3300046810 Ga0495660_0051607 Ga0495660_0051607_157_1293 363
1230 3300046810 Ga0495660_0077262 Ga0495660_0077262_323_1465 363
1231 3300046810 Ga0495660_0084517 Ga0495660_0084517_144_1280 363
1232 3300046810 Ga0495660_0102574 Ga0495660_0102574_153_1289 363
1233 3300046810 Ga0495660_0104948 Ga0495660_0104948_162_1298 363
1234 3300046810 Ga0495660_0111350 Ga0495660_0111350_63_1199 363
1235 3300046810 Ga0495660_0132777 Ga0495660_0132777_11_1192 363
1236 3300047315 Ga0495581_0039125 Ga0495581_0039125_40_1191 363
1237 3300047317 Ga0495604_0031057 Ga0495604_0031057_1251_2387 363
1238 3300047319 Ga0495674_0003165 Ga0495674_0003165_1170_2327 363
1239 3300047319 Ga0495674_0231885 Ga0495674_0231885_38_1195 363
1240 3300047320 Ga0495672_0028549 Ga0495672_0028549_781_1917 363
1241 3300047320 Ga0495672_0029929 Ga0495672_0029929_1809_2945 363
1242 3300047320 Ga0495672_0030524 Ga0495672_0030524_1448_2584 363
1243 3300047320 Ga0495672_0031290 Ga0495672_0031290_484_1620 363
1244 3300047320 Ga0495672_0043880 Ga0495672_0043880_311_1447 363
1245 3300047320 Ga0495672_0051294 Ga0495672_0051294_1164_2300 363
1246 3300047320 Ga0495672_0057028 Ga0495672_0057028_208_1344 363
1247 3300047321 Ga0495676_0010324 Ga0495676_0010324_5095_6252 363
1248 3300047321 Ga0495676_0041144 Ga0495676_0041144_1754_2890 363
1249 3300047321 Ga0495676_0055931 Ga0495676_0055931_546_1682 363
1250 3300047322 Ga0495680_0008487 Ga0495680_0008487_8025_9182 363
1251 3300047322 Ga0495680_0095059 Ga0495680_0095059_914_2050 363
1252 3300047322 Ga0495680_0123845 Ga0495680_0123845_290_1426 363
1253 3300047323 Ga0495683_0014433 Ga0495683_0014433_1936_3072 363
1254 3300047323 Ga0495683_0019660 Ga0495683_0019660_1670_2806 363
1255 3300047323 Ga0495683_0064884 Ga0495683_0064884_472_1608 363
1256 3300047443 Ga0495687_003317 Ga0495687_003317_1201_2337 363
1257 3300047443 Ga0495687_011357 Ga0495687_011357_1797_2939 363
1258 3300047443 Ga0495687_015066 Ga0495687_015066_1595_2731 363
1259 3300047443 Ga0495687_016835 Ga0495687_016835_1223_2359 363
1260 3300047444 Ga0495675_0034380 Ga0495675_0034380_867_2003 363
1261 3300047444 Ga0495675_0139309 Ga0495675_0139309_181_1317 363
1262 3300047445 Ga0495677_0012467 Ga0495677_0012467_33_1169 363
1263 3300047446 Ga0495679_008826 Ga0495679_008826_768_1904 363
1264 3300047446 Ga0495679_012135 Ga0495679_012135_519_1655 363
1265 3300047446 Ga0495679_019635 Ga0495679_019635_67_1203 363
1266 3300047446 Ga0495679_030992 Ga0495679_030992_317_1453 363
1267 3300047447 Ga0495685_003555 Ga0495685_003555_1704_2846 363
1268 3300047469 Ga0495673_0003288 Ga0495673_0003288_1243_2379 363
1269 3300047469 Ga0495673_0003698 Ga0495673_0003698_8738_9874 363
1270 3300047469 Ga0495673_0004242 Ga0495673_0004242_586_1722 363
1271 3300047469 Ga0495673_0007229 Ga0495673_0007229_3331_4467 363
1272 3300047469 Ga0495673_0013100 Ga0495673_0013100_1939_3075 363
1273 3300047469 Ga0495673_0013139 Ga0495673_0013139_1826_2962 363
1274 3300047469 Ga0495673_0014605 Ga0495673_0014605_827_1963 363
1275 3300047469 Ga0495673_0015571 Ga0495673_0015571_1217_2353 363
1276 3300047469 Ga0495673_0019237 Ga0495673_0019237_2051_3169 363
1277 3300047469 Ga0495673_0027436 Ga0495673_0027436_596_1732 363
1278 3300047469 Ga0495673_0030250 Ga0495673_0030250_1266_2402 363
1279 3300047469 Ga0495673_0030694 Ga0495673_0030694_1212_2348 363
1280 3300047469 Ga0495673_0079593 Ga0495673_0079593_60_1196 363
1281 3300047470 Ga0495681_0007528 Ga0495681_0007528_4521_5657 363
1282 3300047470 Ga0495681_0008957 Ga0495681_0008957_1214_2350 363
1283 3300047470 Ga0495681_0011782 Ga0495681_0011782_3213_4349 363
1284 3300047470 Ga0495681_0015638 Ga0495681_0015638_1756_2898 363
1285 3300047470 Ga0495681_0019441 Ga0495681_0019441_1305_2441 363
1286 3300047470 Ga0495681_0020884 Ga0495681_0020884_744_1880 363
1287 3300047470 Ga0495681_0044945 Ga0495681_0044945_786_1922 363
1288 3300047470 Ga0495681_0060150 Ga0495681_0060150_152_1288 363
1289 3300047471 Ga0495684_0010235 Ga0495684_0010235_907_2064 363
1290 3300047471 Ga0495684_0057634 Ga0495684_0057634_371_1507 363
1291 3300047471 Ga0495684_0066398 Ga0495684_0066398_891_2027 363
1292 3300047472 Ga0495686_0005700 Ga0495686_0005700_1179_2315 363
1293 3300047472 Ga0495686_0030077 Ga0495686_0030077_1792_2928 363
1294 3300047472 Ga0495686_0034795 Ga0495686_0034795_182_1318 363
1295 3300047472 Ga0495686_0053249 Ga0495686_0053249_1311_2453 363
1296 3300047472 Ga0495686_0124775 Ga0495686_0124775_264_1400 363
1297 3300048088 Ga0495602_0060466 Ga0495602_0060466_1509_2645 363
1298 3300048088 Ga0495602_0148492 Ga0495602_0148492_648_1832 363
1299 3300048088 Ga0495602_0226987 Ga0495602_0226987_73_1230 363
1300 3300048091 Ga0495626_0002989 Ga0495626_0002989_1233_2369 363
1301 3300048091 Ga0495626_0005932 Ga0495626_0005932_4610_5746 363
1302 3300048091 Ga0495626_0005986 Ga0495626_0005986_1234_2370 363
1303 3300048091 Ga0495626_0014079 Ga0495626_0014079_1283_2419 363
1304 3300048091 Ga0495626_0016898 Ga0495626_0016898_1789_2925 363
1305 3300048091 Ga0495626_0018282 Ga0495626_0018282_600_1736 363
1306 3300048091 Ga0495626_0032805 Ga0495626_0032805_1181_2317 363
1307 3300048903 Ga0496100_0071260 Ga0496100_0071260_625_1803 363
1308 3300048905 Ga0496102_0014650 Ga0496102_0014650_1205_2341 363
1309 3300048905 Ga0496102_0112072 Ga0496102_0112072_448_1629 363
1310 3300048905 Ga0496102_0149378 Ga0496102_0149378_910_2088 363
1311 3300048906 Ga0496103_0080536 Ga0496103_0080536_242_1423 363
1312 3300048907 Ga0496104_0302236 Ga0496104_0302236_250_1428 363
1313 3300048910 Ga0496107_0050128 Ga0496107_0050128_419_1597 363
1314 3300048911 Ga0496108_0087016 Ga0496108_0087016_1216_2394 363
1315 3300048915 Ga0496112_0005803 Ga0496112_0005803_8946_10124 363
1316 3300048919 Ga0496116_0011789 Ga0496116_0011789_4506_5642 363
1317 3300048919 Ga0496116_0015154 Ga0496116_0015154_3933_5069 363
1318 3300048919 Ga0496116_0078289 Ga0496116_0078289_190_1326 363
1319 3300048919 Ga0496116_0135175 Ga0496116_0135175_107_1294 363
1320 3300048920 Ga0496117_0007953 Ga0496117_0007953_1717_2850 363
1321 3300048920 Ga0496117_0021965 Ga0496117_0021965_1423_2559 363
1322 3300048920 Ga0496117_0095479 Ga0496117_0095479_276_1412 363
1323 3300048920 Ga0496117_0164845 Ga0496117_0164845_100_1236 363
1324 3300048921 Ga0496118_0004899 Ga0496118_0004899_8820_9953 363
1325 3300048921 Ga0496118_0047119 Ga0496118_0047119_1535_2671 363
1326 3300048921 Ga0496118_0077011 Ga0496118_0077011_1142_2278 363
1327 3300048921 Ga0496118_0092538 Ga0496118_0092538_664_1800 363
1328 3300048921 Ga0496118_0137542 Ga0496118_0137542_245_1423 363
1329 3300048922 Ga0496119_0065325 Ga0496119_0065325_593_1729 363
1330 3300048923 Ga0496120_0026078 Ga0496120_0026078_598_1734 363
1331 3300048924 Ga0496121_0017904 Ga0496121_0017904_4494_5630 363
1332 3300048924 Ga0496121_0060163 Ga0496121_0060163_1452_2588 363
1333 3300048925 Ga0496122_0108992 Ga0496122_0108992_500_1636 363
1334 3300048926 Ga0496123_0075482 Ga0496123_0075482_277_1413 363
1335 3300048926 Ga0496123_0077598 Ga0496123_0077598_583_1719 363
1336 3300048927 Ga0496124_0005554 Ga0496124_0005554_9500_10642 363
1337 3300048927 Ga0496124_0039679 Ga0496124_0039679_1798_2934 363
1338 3300048927 Ga0496124_0040365 Ga0496124_0040365_1797_2933 363
1339 3300048927 Ga0496124_0049974 Ga0496124_0049974_1202_2338 363
1340 3300048927 Ga0496124_0123921 Ga0496124_0123921_348_1484 363
1341 3300048928 Ga0496125_0021884 Ga0496125_0021884_1122_2258 363
1342 3300048928 Ga0496125_0162468 Ga0496125_0162468_112_1248 363
1343 3300048928 Ga0496125_0162616 Ga0496125_0162616_284_1420 363
1344 3300048928 Ga0496125_0186634 Ga0496125_0186634_180_1316 363
1345 3300048929 Ga0496126_0001122 Ga0496126_0001122_13719_14870 363
1346 3300048929 Ga0496126_0050559 Ga0496126_0050559_1963_3135 363
1347 3300048929 Ga0496126_0069637 Ga0496126_0069637_380_1516 363
1348 3300049459 Ga0495678_015103 Ga0495678_015103_1838_2974 363
1349 3300049459 Ga0495678_016346 Ga0495678_016346_1027_2163 363
1350 3300049459 Ga0495678_017940 Ga0495678_017940_599_1735 363
1351 3300049459 Ga0495678_036984 Ga0495678_036984_700_1836 363
1352 3300049459 Ga0495678_041186 Ga0495678_041186_563_1699 363
1353 3300049459 Ga0495678_044098 Ga0495678_044098_161_1297 363
1354 3300049459 Ga0495678_062713 Ga0495678_062713_175_1311 363
1355 3300049460 Ga0495682_0010986 Ga0495682_0010986_1612_2748 363
1356 3300049460 Ga0495682_0020007 Ga0495682_0020007_1213_2349 363
1357 3300049571 Ga0501034_0001044 Ga0501034_0001044_23556_24698 363
1358 3300049571 Ga0501034_0002761 Ga0501034_0002761_14755_15897 363
1359 3300049571 Ga0501034_0100667 Ga0501034_0100667_106_1242 363
1360 3300049571 Ga0501034_0208567 Ga0501034_0208567_149_1327 363
1361 3300049575 Ga0501039_0084867 Ga0501039_0084867_799_1980 363
1362 3300049585 Ga0501069_0077776 Ga0501069_0077776_432_1577 363
1363 3300049742 Ga0501080_0161824 Ga0501080_0161824_639_1820 363
1364 3300049758 Ga0501241_005788 Ga0501241_005788_564_1700 363
1365 3300050489 nmdc:mga03683_24512_c1 nmdc:mga03683_24512_c1_548_1684 363
1366 3300050489 nmdc:mga03683_68793_c1 nmdc:mga03683_68793_c1_197_1375 363
1367 3300050490 nmdc:mga03n38_41052_c1 nmdc:mga03n38_41052_c1_648_1823 363
1368 3300050490 nmdc:mga03n38_54511_c1 nmdc:mga03n38_54511_c1_466_1608 363
1369 3300050492 nmdc:mga0yw44_110686_c1 nmdc:mga0yw44_110686_c1_529_1710 363
1370 3300050494 nmdc:mga06z11_5469_c1 nmdc:mga06z11_5469_c1_1010_2179 363
1371 3300050495 nmdc:mga04h51_10138_c1 nmdc:mga04h51_10138_c1_280_1434 363
1372 3300050496 nmdc:mga07m45_65075_c1 nmdc:mga07m45_65075_c1_501_1679 363
1373 3300050496 nmdc:mga07m45_8090_c1 nmdc:mga07m45_8090_c1_1640_2773 363
1374 3300050496 nmdc:mga07m45_93182_c1 nmdc:mga07m45_93182_c1_550_1701 363
1375 3300050513 nmdc:mga0rr50_179908_c1 nmdc:mga0rr50_179908_c1_330_1508 363
1376 3300050514 nmdc:mga08x19_210498_c1 nmdc:mga08x19_210498_c1_37_1194 363
1377 3300050516 nmdc:mga0sz30_34691_c1 nmdc:mga0sz30_34691_c1_423_1604 363
1378 3300050516 nmdc:mga0sz30_492_c1 nmdc:mga0sz30_492_c1_3241_4416 363
1379 3300053077 Ga0495601_0057403 Ga0495601_0057403_1300_2448 363
1380 3300053077 Ga0495601_0071296 Ga0495601_0071296_51_1172 363
1381 3300053086 Ga0500578_0089362 Ga0500578_0089362_493_1635 363
1382 3300053086 Ga0500578_0097222 Ga0500578_0097222_372_1553 363
1383 3300053090 Ga0500646_0015646 Ga0500646_0015646_200_1381 363
1384 3300053092 Ga0500583_0037307 Ga0500583_0037307_154_1332 363
1385 3300053099 Ga0500654_050727 Ga0500654_050727_743_1885 363
1386 3300053104 Ga0500556_0000150 Ga0500556_0000150_17734_18888 363
1387 3300053104 Ga0500556_0032001 Ga0500556_0032001_13_1194 363
1388 3300053109 Ga0500569_002375 Ga0500569_002375_693_1835 363
1389 3300053111 Ga0500572_005648 Ga0500572_005648_1582_2718 363
1390 3300053131 Ga0500652_003456 Ga0500652_003456_1954_3096 363
1391 3300053134 Ga0500658_0005366 Ga0500658_0005366_1867_3009 363
1392 3300053137 Ga0500561_0001399 Ga0500561_0001399_1570_2712 363
1393 3300053149 Ga0500600_0024394 Ga0500600_0024394_1701_2843 363
1394 3300053153 Ga0500616_0016933 Ga0500616_0016933_1266_2408 363
1395 3300053160 Ga0500633_0003384 Ga0500633_0003384_1657_2799 363
1396 3300053161 Ga0500634_0021049 Ga0500634_0021049_1990_3132 363
1397 3300053730 Ga0500645_006225 Ga0500645_006225_63_1244 363
1398 3300053732 Ga0500656_001303 Ga0500656_001303_889_2031 363
1399 3300053739 Ga0500587_000973 Ga0500587_000973_1920_3062 363
1400 3300061719 Ga0466962_0005899 Ga0466962_0005899_2689_3831 363
1401 iso_pu_bacteria 2508501009 2508541121 363
1402 iso_pu_bacteria 2508501128 2509154290 363
1403 iso_pu_bacteria 2511231004 2511257289 363
1404 iso_pu_bacteria 2511231006 2511266924 363
1405 iso_pu_bacteria 2511231007 2511272915 363
1406 iso_pu_bacteria 2511231008 2511278956 363
1407 iso_pu_bacteria 2511231010 2511291227 363
1408 iso_pu_bacteria 2511231011 2511293764 363
1409 iso_pu_bacteria 2511231012 2511300525 363
1410 iso_pu_bacteria 2511231014 2511315498 363
1411 iso_pu_bacteria 2511231015 2511320331 363
1412 iso_pu_bacteria 2511231016 2511323560 363
1413 iso_pu_bacteria 2511231017 2511330717 363
1414 iso_pu_bacteria 2511231018 2511336795 363
1415 iso_pu_bacteria 2511231019 2511342573 363
1416 iso_pu_bacteria 2511231020 2511348117 363
1417 iso_pu_bacteria 2511231021 2511357038 363
1418 iso_pu_bacteria 2511231022 2511363215 363
1419 iso_pu_bacteria 2511231023 2511368309 363
1420 iso_pu_bacteria 2511231031 2511414952 363
1421 iso_pu_bacteria 2511231156 2511826800 363
1422 iso_pu_bacteria 2512047018 2512324394 363
1423 iso_pu_bacteria 2547132374 2548499292 363
1424 iso_pu_bacteria 2547132424 2548697355 363
1425 iso_pu_bacteria 2554235132 2554817284 363
1426 iso_pu_bacteria 2554235341 2555672003 363
1427 iso_pu_bacteria 2582580891 2583794499 363
1428 iso_pu_bacteria 2597489887 2597860084 363
1429 iso_pu_bacteria 2597489888 2597862099 363
1430 iso_pu_bacteria 2599185160 2599353832 363
1431 iso_pu_bacteria 2599185161 2599360490 363
1432 iso_pu_bacteria 2599185162 2599366812 363
1433 iso_pu_bacteria 2599185163 2599373601 363
1434 iso_pu_bacteria 2599185164 2599378940 363
1435 iso_pu_bacteria 2599185165 2599386082 363
1436 iso_pu_bacteria 2599185166 2599392460 363
1437 iso_pu_bacteria 2599185168 2599404226 363
1438 iso_pu_bacteria 2599185181 2599460666 363
1439 iso_pu_bacteria 2599185182 2599470212 363
1440 iso_pu_bacteria 2599185185 2599482923 363
1441 iso_pu_bacteria 2599185186 2599489687 363
1442 iso_pu_bacteria 2599185188 2599502845 363
1443 iso_pu_bacteria 2599185189 2599508014 363
1444 iso_pu_bacteria 2599185190 2599510967 363
1445 iso_pu_bacteria 2599185212 2599615126 363
1446 iso_pu_bacteria 2599185248 2599771322 363
1447 iso_pu_bacteria 2599185257 2599803372 363
1448 iso_pu_bacteria 2599185288 2599879433 363
1449 iso_pu_bacteria 2599185289 2599888735 363
1450 iso_pu_bacteria 2599185290 2599890341 363
1451 iso_pu_bacteria 2599185291 2599900744 363
1452 iso_pu_bacteria 2599185300 2599930127 363
1453 iso_pu_bacteria 2599185302 2599945348 363
1454 iso_pu_bacteria 2599185303 2599947931 363
1455 iso_pu_bacteria 2599185304 2599955620 363
1456 iso_pu_bacteria 2599185305 2599960988 363
1457 iso_pu_bacteria 2599185306 2599969443 363
1458 iso_pu_bacteria 2599185308 2599980874 363
1459 iso_pu_bacteria 2599185309 2599985830 363
1460 iso_pu_bacteria 2599185310 2599990627 363
1461 iso_pu_bacteria 2599185311 2599996384 363
1462 iso_pu_bacteria 2599185312 2600001987 363
1463 iso_pu_bacteria 2599185313 2600005716 363
1464 iso_pu_bacteria 2599185314 2600014750 363
1465 iso_pu_bacteria 2599185315 2600020638 363
1466 iso_pu_bacteria 2599185316 2600027170 363
1467 iso_pu_bacteria 2599185317 2600027867 363
1468 iso_pu_bacteria 2599185318 2600033414 363
1469 iso_pu_bacteria 2599185320 2600049332 363
1470 iso_pu_bacteria 2599185321 2600055171 363
1471 iso_pu_bacteria 2599185322 2600061597 363
1472 iso_pu_bacteria 2599185323 2600064214 363
1473 iso_pu_bacteria 2599185324 2600071094 363
1474 iso_pu_bacteria 2599185325 2600080604 363
1475 iso_pu_bacteria 2599185356 2600213280 363
1476 iso_pu_bacteria 2600254930 2600357034 363
1477 iso_pu_bacteria 2600254931 2600365355 363
1478 iso_pu_bacteria 2600254954 2600443513 363
1479 iso_pu_bacteria 2600255283 2601625917 363
1480 iso_pu_bacteria 2600255296 2601690697 363
1481 iso_pu_bacteria 2600255313 2601773447 363
1482 iso_pu_bacteria 2600255318 2601799695 363
1483 iso_pu_bacteria 2600255389 2602009033 363
1484 iso_pu_bacteria 2603880185 2606074120 363
1485 iso_pu_bacteria 2603880199 2606126235 363
1486 iso_pu_bacteria 2606217733 2608382928 363
1487 iso_pu_bacteria 2623620443 2624482665 363
1488 iso_pu_bacteria 2623620446 2624490270 363
1489 iso_pu_bacteria 2643221565 2643842015 363
1490 iso_pu_bacteria 2643221570 2643866125 363
1491 iso_pu_bacteria 2643221589 2643955425 363
1492 iso_pu_bacteria 2643221596 2643994115 363
1493 iso_pu_bacteria 2643221602 2644023777 363
1494 iso_pu_bacteria 2643221604 2644033156 363
1495 iso_pu_bacteria 2643221609 2644057651 363
1496 iso_pu_bacteria 2643221611 2644072262 363
1497 iso_pu_bacteria 2643221633 2644185880 363
1498 iso_pu_bacteria 2643221650 2644285812 363
1499 iso_pu_bacteria 2643221652 2644292939 363
1500 iso_pu_bacteria 2643221713 2644623784 363
1501 iso_pu_bacteria 2643221714 2644631475 363
1502 iso_pu_bacteria 2643221717 2644647955 363
1503 iso_pu_bacteria 2651869719 2652543785 363
1504 iso_pu_bacteria 2667528170 2671093027 363
1505 iso_pu_bacteria 2667528171 2671096411 363
1506 iso_pu_bacteria 2667528176 2671125653 363
1507 iso_pu_bacteria 2671180172 2671771059 363
1508 iso_pu_bacteria 2671180195 2671840256 363
1509 iso_pu_bacteria 2675903420 2677898652 363
1510 iso_pu_bacteria 2675903515 2678265173 363
1511 iso_pu_bacteria 2713897148 2715752007 363
1512 iso_pu_bacteria 2713897149 2715755363 363
1513 iso_pu_bacteria 2718217725 2718635877 363
1514 iso_pu_bacteria 2721755607 2723246990 363
1515 iso_pu_bacteria 2738541294 2738808891 363
1516 iso_pu_bacteria 2738541309 2738896251 363
1517 iso_pu_bacteria 2738543004 2739196484 363
1518 iso_pu_bacteria 2738543012 2739241925 363
1519 iso_pu_bacteria 2738543015 2739257458 363
1520 iso_pu_bacteria 2738543025 2739314469 363
1521 iso_pu_bacteria 2740892503 2743739618 363
1522 iso_pu_bacteria 2744054611 2744954099 363
1523 iso_pu_bacteria 2744054620 2745005630 363
1524 iso_pu_bacteria 2773857670 2774122081 363
1525 iso_pu_bacteria 2773857673 2774133546 363
1526 iso_pu_bacteria 2773857922 2774858412 363
1527 iso_pu_bacteria 2775506901 2776259538 363
1528 iso_pu_bacteria 2784132063 2784262567 363
1529 iso_pu_bacteria 2784132072 2784314326 363
1530 iso_pu_bacteria 2784132109 2784471052 363
1531 iso_pu_bacteria 2791355199 2793076490 363
1532 iso_pu_bacteria 2791355520 2794595523 363
1533 iso_pu_bacteria 2808606361 2808855810 363
1534 iso_pu_bacteria 2808606376 2808921982 363
1535 iso_pu_bacteria 2808606377 2808933366 363
1536 iso_pu_bacteria 2808606378 2808935891 363
1537 iso_pu_bacteria 2808606379 2808942301 363
1538 iso_pu_bacteria 2808606380 2808944103 363
1539 iso_pu_bacteria 2808606381 2808955452 363
1540 iso_pu_bacteria 2808606382 2808959672 363
1541 iso_pu_bacteria 2808606383 2808964317 363
1542 iso_pu_bacteria 2808606385 2808975026 363
1543 iso_pu_bacteria 2808606388 2808991335 363
1544 iso_pu_bacteria 2808606389 2808999205 363
1545 iso_pu_bacteria 2808606445 2809218571 363
1546 iso_pu_bacteria 2811994881 2812368563 363
1547 iso_pu_bacteria 2816332133 2816470773 363
1548 iso_pu_bacteria 2818991456 2819654232 363
1549 iso_pu_bacteria 2818991464 2819701504 363
1550 iso_pu_bacteria 2823421272 2823425123 363
1551 iso_pu_bacteria 2824671348 2824672921 363
1552 iso_pu_bacteria 2824687955 2824689435 363
1553 iso_pu_bacteria 2824704595 2824705347 363
1554 iso_pu_bacteria 2824753945 2824755512 363
1555 iso_pu_bacteria 2824763712 2824763796 363
1556 iso_pu_bacteria 2825651385 2825655934 363
1557 iso_pu_bacteria 2834028612 2834028789 363
1558 iso_pu_bacteria 2842826826 2842830101 363
1559 iso_pu_bacteria 2842832357 2842837520 363
1560 iso_pu_bacteria 2842837860 2842838901 363
1561 iso_pu_bacteria 2842843487 2842845304 363
1562 iso_pu_bacteria 2842854478 2842856336 363
1563 iso_pu_bacteria 2844665904 2844666169 363
1564 iso_pu_bacteria 2847930680 2847935653 363
1565 iso_pu_bacteria 2852612431 2852615724 363
1566 iso_pu_bacteria 2852657418 2852660590 363
1567 iso_pu_bacteria 2852667396 2852670692 363
1568 iso_pu_bacteria 2860339153 2860344534 363
1569 iso_pu_bacteria 2860867994 2860868824 363
1570 iso_pu_bacteria 2862507626 2862513857 363
1571 iso_pu_bacteria 2878029506 2878034595 363
1572 iso_pu_bacteria 2880230671 2880235242 363
1573 iso_pu_bacteria 2881665667 2881673405 363
1574 iso_pu_bacteria 2885409591 2885412063 363
1575 iso_pu_bacteria 2904518522 2904521615 363
1576 iso_pu_bacteria 2904550169 2904552976 363
1577 iso_pu_bacteria 2904690495 2904698543 363
1578 iso_pu_bacteria 2904711408 2904716530 363
1579 iso_pu_bacteria 2908756301 2908762446 363
1580 iso_pu_bacteria 2913036834 2913041779 363
1581 iso_pu_bacteria 2917070673 2917075876 363
1582 iso_pu_bacteria 2919063839 2919069586 363
1583 iso_pu_bacteria 2919385768 2919388663 363
1584 iso_pu_bacteria 2919456309 2919459646 363
1585 iso_pu_bacteria 2919481497 2919487450 363
1586 iso_pu_bacteria 2919487758 2919490016 363
1587 iso_pu_bacteria 2919501602 2919501840 363
1588 iso_pu_bacteria 2919697872 2919703766 363
1589 iso_pu_bacteria 2923153595 2923158704 363
1590 iso_pu_bacteria 2923519811 2923522621 363
1591 iso_pu_bacteria 2923586266 2923590424 363
1592 iso_pu_bacteria 2926063275 2926063513 363
1593 iso_pu_bacteria 2929144301 2929149097 363
1594 iso_pu_bacteria 2931369376 2931373480 363
1595 iso_pu_bacteria 2931396565 2931397304 363
1596 iso_pu_bacteria 2935353572 2935356862 363
1597 iso_pu_bacteria 2935675223 2935678648 363
1598 iso_pu_bacteria 2935684952 2935687861 363
1599 iso_pu_bacteria 2935713505 2935714881 363
1600 iso_pu_bacteria 2935722832 2935726554 363
1601 iso_pu_bacteria 2935732158 2935733699 363
1602 iso_pu_bacteria 2935741537 2935743078 363
1603 iso_pu_bacteria 2935750917 2935754883 363
1604 iso_pu_bacteria 2939636861 2939636954 363
1605 iso_pu_bacteria 2940556831 2940559740 363
1606 iso_pu_bacteria 2945928738 2945929769 363
1607 iso_pu_bacteria 2945961074 2945966019 363
1608 iso_pu_bacteria 2969304461 2969309391 363
1609 iso_pu_bacteria 2974289157 2974289250 363
1610 iso_pu_bacteria 2984286254 2984287465 363
1611 iso_pu_bacteria 2988728565 2988730700 363
1612 iso_pu_bacteria 2990710928 2990714180 363
1613 iso_pu_bacteria 2998139840 2998144652 363
1614 iso_pu_bacteria 3007395558 3007398335 363
1615 iso_pu_bacteria 3007511990 3007516416 363
1616 iso_pu_bacteria 3007614139 3007615658 363
1617 iso_pu_bacteria 3007619802 3007622775 363
1618 iso_pu_bacteria 3007855910 3007858365 363
1619 iso_pu_bacteria 3007861166 3007866119 363
1620 iso_pu_bacteria 3007866637 3007867560 363
1621 iso_pu_bacteria 637000220 637322419 363
1622 iso_pu_bacteria 8002775197 8002783916 363
1623 iso_pu_bacteria 8002784119 8002789688 363
1624 iso_pu_bacteria 8006984368 8006987614 363
1625 iso_pu_bacteria 8011350971 8011354864 363
1626 iso_pu_bacteria 8015687852 8015692790 363
1627 iso_pu_bacteria 8019619141 8019619231 363
1628 iso_pu_bacteria 8019629233 8019633888 363
1629 iso_pu_bacteria 8019769354 8019773660 363
1630 iso_pu_bacteria 8019775933 8019782059 363
1631 iso_pu_bacteria 8029995093 8029996227 363
1632 iso_pu_bacteria 8034962539 8034963096 363
1633 iso_pu_bacteria 8054347763 8054352773 363
1634 iso_pu_bacteria 8054503363 8054504403 363
1635 iso_pu_bacteria 8055770955 8055776024 363
1636 iso_pu_bacteria 8055817908 8055818832 363
1637 iso_pu_bacteria 8056125926 8056130894 363
1638 iso_pu_bacteria 8056131705 8056132723 363
1639 iso_pu_bacteria 8056143049 8056144289 363
1640 iso_pu_bacteria 8056155041 8056155673 363
1641 iso_pu_bacteria 8056161164 8056161425 363
1642 iso_pu_bacteria 8056166840 8056171904 363
1643 iso_pu_bacteria 8056172158 8056172585 363
1644 iso_pu_bacteria 8056177738 8056179784 363
1645 iso_pu_bacteria 8056569372 8056574915 363
1646 iso_pu_bacteria 8056689827 8056692469 363
1647 iso_pu_bacteria 8057798959 8057804908 363
1648 2162886007 SwRhRL2b_contig_3359380 SwRhRL2b_0724.00002630 364
1649 3300003215 JGI25153J46596_10037698 JGI25153J46596_100376982 364
1650 3300005289 Ga0065704_10005418 Ga0065704_100054183 364
1651 3300005295 Ga0065707_10015660 Ga0065707_100156601 364
1652 3300005327 Ga0070658_10147124 Ga0070658_101471242 364
1653 3300005328 Ga0070676_10001154 Ga0070676_1000115412 364
1654 3300005539 Ga0068853_100043783 Ga0068853_1000437832 364
1655 3300005539 Ga0068853_100152766 Ga0068853_1001527662 364
1656 3300005548 Ga0070665_100102347 Ga0070665_1001023472 364
1657 3300005563 Ga0068855_100269037 Ga0068855_1002690372 364
1658 3300005578 Ga0068854_100003802 Ga0068854_1000038025 364
1659 3300005616 Ga0068852_100032842 Ga0068852_1000328422 364
1660 3300005937 Ga0081455_10003074 Ga0081455_1000307412 364
1661 3300009093 Ga0105240_10046877 Ga0105240_100468773 364
1662 3300009174 Ga0105241_10061580 Ga0105241_100615802 364
1663 3300009553 Ga0105249_10025312 Ga0105249_100253121 364
1664 3300010375 Ga0105239_10028219 Ga0105239_100282194 364
1665 3300013100 Ga0157373_10093958 Ga0157373_100939582 364
1666 3300013104 Ga0157370_10088370 Ga0157370_100883702 364
1667 3300014968 Ga0157379_10207440 Ga0157379_102074402 364
1668 3300022467 Ga0224712_10005870 Ga0224712_100058701 364
1669 3300025292 Ga0209676_1000376 Ga0209676_100037635 364
1670 3300025904 Ga0207647_10006579 Ga0207647_100065793 364
1671 3300025914 Ga0207671_10000295 Ga0207671_1000029535 364
1672 3300025924 Ga0207694_10012539 Ga0207694_100125395 364
1673 3300025949 Ga0207667_10142833 Ga0207667_101428332 364
1674 3300026041 Ga0207639_10148435 Ga0207639_101484352 364
1675 3300026067 Ga0207678_10090542 Ga0207678_100905422 364
1676 3300028794 Ga0307515_10077307 Ga0307515_100773074 364
1677 3300031911 Ga0307412_10100552 Ga0307412_101005522 364
1678 3300033180 Ga0307510_10000009 Ga0307510_10000009352 364
1679 3300037471 Ga0395905_0000421 Ga0395905_0000421_30314_31465 364
1680 3300039447 Ga0436361_0544128 Ga0436361_0544128_132_1277 364
1681 3300042115 Ga0450911_000723 Ga0450911_000723_1569_2732 364
1682 3300042876 Ga0451577_0187857 Ga0451577_0187857_521_1663 364
1683 3300044673 Ga0453683_0012491 Ga0453683_0012491_2120_3244 364
1684 3300044673 Ga0453683_0034078 Ga0453683_0034078_518_1642 364
1685 3300044693 Ga0466961_0007903 Ga0466961_0007903_4967_6112 364
1686 3300044712 Ga0453684_0155070 Ga0453684_0155070_110_1252 364
1687 3300045051 Ga0451576_0000492 Ga0451576_0000492_25483_26631 364
1688 3300045051 Ga0451576_0342005 Ga0451576_0342005_64_1206 364
1689 3300045836 Ga0466958_0059251 Ga0466958_0059251_445_1590 364
1690 3300046455 Ga0495603_0001278 Ga0495603_0001278_9984_11144 364
1691 3300046457 Ga0495590_0000311 Ga0495590_0000311_14359_15522 364
1692 3300046457 Ga0495590_0002272 Ga0495590_0002272_4359_5516 364
1693 3300046459 Ga0495629_0001057 Ga0495629_0001057_6851_8011 364
1694 3300046460 Ga0495638_0000690 Ga0495638_0000690_34534_35697 364
1695 3300046462 Ga0495651_0000646 Ga0495651_0000646_23401_24558 364
1696 3300046507 Ga0495606_0146951 Ga0495606_0146951_183_1346 364
1697 3300046518 Ga0495631_0003311 Ga0495631_0003311_5894_7057 364
1698 3300046524 Ga0495648_0000274 Ga0495648_0000274_782_1945 364
1699 3300046524 Ga0495648_0012181 Ga0495648_0012181_3037_4194 364
1700 3300046535 Ga0495586_0079153 Ga0495586_0079153_77_1246 364
1701 3300046660 Ga0495625_0021990 Ga0495625_0021990_722_1885 364
1702 3300046689 Ga0495613_0006465 Ga0495613_0006465_6026_7186 364
1703 3300046692 Ga0495671_0054844 Ga0495671_0054844_250_1413 364
1704 3300046809 Ga0495600_0051406 Ga0495600_0051406_330_1487 364
1705 3300047315 Ga0495581_0026016 Ga0495581_0026016_1179_2333 364
1706 3300047317 Ga0495604_0069025 Ga0495604_0069025_406_1563 364
1707 3300047469 Ga0495673_0000470 Ga0495673_0000470_3472_4635 364
1708 3300047470 Ga0495681_0030089 Ga0495681_0030089_917_2080 364
1709 3300047472 Ga0495686_0001077 Ga0495686_0001077_3570_4733 364
1710 3300047472 Ga0495686_0003271 Ga0495686_0003271_7474_8640 364
1711 3300048089 Ga0495614_0000477 Ga0495614_0000477_8472_9632 364
1712 3300048905 Ga0496102_0001247 Ga0496102_0001247_18509_19657 364
1713 3300048922 Ga0496119_0001823 Ga0496119_0001823_15613_16761 364
1714 3300048923 Ga0496120_0000042 Ga0496120_0000042_72868_74016 364
1715 3300048927 Ga0496124_0006344 Ga0496124_0006344_1248_2387 364
1716 3300048927 Ga0496124_0053110 Ga0496124_0053110_795_1949 364
1717 3300048928 Ga0496125_0021482 Ga0496125_0021482_557_1690 364
1718 3300048928 Ga0496125_0026943 Ga0496125_0026943_3537_4670 364
1719 3300048929 Ga0496126_0058456 Ga0496126_0058456_1252_2385 364
1720 3300048929 Ga0496126_0083261 Ga0496126_0083261_1370_2533 364
1721 3300049459 Ga0495678_000734 Ga0495678_000734_4301_5464 364
1722 3300049459 Ga0495678_000892 Ga0495678_000892_21124_22281 364
1723 3300049513 Ga0501290_002178 Ga0501290_002178_295_1425 364
1724 3300049517 Ga0501294_000001 Ga0501294_000001_31525_32655 364
1725 3300049523 Ga0501300_000191 Ga0501300_000191_686_1816 364
1726 3300049573 Ga0501037_0044681 Ga0501037_0044681_1799_2962 364
1727 3300049575 Ga0501039_0288979 Ga0501039_0288979_19_1149 364
1728 3300049579 Ga0501043_0024290 Ga0501043_0024290_58_1221 364
1729 3300049581 Ga0501047_0009469 Ga0501047_0009469_1039_2202 364
1730 3300049653 Ga0501206_000314 Ga0501206_000314_2487_3617 364
1731 3300049669 Ga0501235_014775 Ga0501235_014775_109_1239 364
1732 3300049742 Ga0501080_0001619 Ga0501080_0001619_11614_12777 364
1733 3300049744 Ga0501083_0010630 Ga0501083_0010630_3621_4784 364
1734 3300049776 Ga0501280_008718 Ga0501280_008718_227_1357 364
1735 3300049778 Ga0501282_000001 Ga0501282_000001_13301_14431 364
1736 3300049823 Ga0501044_0025399 Ga0501044_0025399_821_1984 364
1737 3300053086 Ga0500578_0000597 Ga0500578_0000597_6020_7183 364
1738 3300053096 Ga0500641_0017906 Ga0500641_0017906_695_1837 364
1739 3300053108 Ga0500562_001784 Ga0500562_001784_617_1780 364
1740 3300053118 Ga0500594_0000535 Ga0500594_0000535_4224_5387 364
1741 3300053138 Ga0500564_000387 Ga0500564_000387_7823_8986 364
1742 3300053156 Ga0500622_0003196 Ga0500622_0003196_8927_10090 364
1743 3300053156 Ga0500622_0006152 Ga0500622_0006152_2258_3421 364
1744 3300060353 Ga0501082_0009073 Ga0501082_0009073_2470_3633 364
1745 iso_pu_bacteria 2582581279 2585149561 364
1746 iso_pu_bacteria 2585428106 2587919883 364
1747 iso_pu_bacteria 2643221541 2643731952 364
1748 iso_pu_bacteria 2643221606 2644041721 364
1749 iso_pu_bacteria 2643221640 2644223488 364
1750 iso_pu_bacteria 2643221642 2644237230 364
1751 iso_pu_bacteria 2643221671 2644394636 364
1752 iso_pu_bacteria 2739367653 2739603677 364
1753 iso_pu_bacteria 2772190715 2772641521 364
1754 iso_pu_bacteria 2791355048 2792462166 364
1755 iso_pu_bacteria 2816332305 2817510206 364
1756 iso_pu_bacteria 2842677519 2842680418 364
1757 iso_pu_bacteria 2843744320 2843746074 364
1758 iso_pu_bacteria 2849560528 2849561674 364
1759 iso_pu_bacteria 2851153111 2851156755 364
1760 iso_pu_bacteria 2855670206 2855672093 364
1761 iso_pu_bacteria 2855676851 2855682864 364
1762 iso_pu_bacteria 2857288857 2857294674 364
1763 iso_pu_bacteria 2857504554 2857505865 364
1764 iso_pu_bacteria 2857727296 2857728166 364
1765 iso_pu_bacteria 2858848962 2858854342 364
1766 iso_pu_bacteria 2858882152 2858888398 364
1767 iso_pu_bacteria 2858888857 2858891704 364
1768 iso_pu_bacteria 2858895516 2858899157 364
1769 iso_pu_bacteria 2867302475 2867304125 364
1770 iso_pu_bacteria 2867312974 2867313460 364
1771 iso_pu_bacteria 2867319477 2867322719 364
1772 iso_pu_bacteria 2869048445 2869054918 364
1773 iso_pu_bacteria 2869061728 2869066597 364
1774 iso_pu_bacteria 2869068681 2869072949 364
1775 iso_pu_bacteria 2880489317 2880493917 364
1776 iso_pu_bacteria 2880495981 2880498424 364
1777 iso_pu_bacteria 2898329390 2898330778 364
1778 iso_pu_bacteria 2928531327 2928532030 364
1779 iso_pu_bacteria 2929219909 2929220462 364
1780 iso_pu_bacteria 2929226422 2929227014 364
1781 iso_pu_bacteria 2945945610 2945947911 364
1782 iso_pu_bacteria 8003830390 8003835212 364
1783 iso_pu_bacteria 8054704163 8054710129 364
1784 iso_pu_bacteria 8054727385 8054731124 364
1785 iso_pu_bacteria 8054734606 8054735262 364

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00441

Acyl-CoA_dh_1

Acyl-CoA dehydrogenase, C-terminal domain

283

432

0.99

PF02771

Acyl-CoA_dh_N

Acyl-CoA dehydrogenase, N-terminal domain

57

168

0.98

PF02770

Acyl-CoA_dh_M

Acyl-CoA dehydrogenase, middle domain

172

268

0.95

PF08028

Acyl-CoA_dh_2

Acyl-CoA dehydrogenase, C-terminal domain

298

421

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
2pg0-assembly1.cif.gz_A crystal structure of acyl-coa dehydrogenase from geobacillus kaustophilus 0.9579 1 363
2pg0-assembly1.cif.gz_A crystal structure of acyl-coa dehydrogenase from geobacillus kaustophilus 0.9528 1 363
1ivh-assembly1.cif.gz_B structure of human isovaleryl-coa dehydrogenase at 2.6 angstroms resolution: structural basis for substrate specificity 0.949 1 363
5ol2-assembly2.cif.gz_F the electron transferring flavoprotein/butyryl-coa dehydrogenase complex from clostridium difficile 0.9459 2 363
4l1f-assembly1.cif.gz_A electron transferring flavoprotein of acidaminococcus fermentans: towards a mechanism of flavin-based electron bifurcation 0.9453 1 363
ID Description Score Start End Superfamily
af_O33229_243_386_1.20.140.10 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Butyryl-CoA Dehydrogenase, subunit A, domain 3 0.991 224 363 1.20.140.10
af_P28330_285_428_1.20.140.10 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Butyryl-CoA Dehydrogenase, subunit A, domain 3 0.9893 224 363 1.20.140.10
af_A0A0R0F201_274_433_1.20.140.10 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Butyryl-CoA Dehydrogenase, subunit A, domain 3 0.9801 220 363 1.20.140.10
af_Q9VSL9_273_416_1.20.140.10 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Butyryl-CoA Dehydrogenase, subunit A, domain 3 0.9749 223 363 1.20.140.10
af_Q86A74_271_424_1.20.140.10 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Butyryl-CoA Dehydrogenase, subunit A, domain 3 0.9731 224 363 1.20.140.10
ID Description Score Start End GO Terms
AF-A0A1V4Q524-F1-model_v4 Acyl-CoA dehydrogenase 0.9946 261 363 GO:0003995
GO:0005737
GO:0033539
GO:0050660
AF-A0A848DKD1-F1-model_v4 Acyl-CoA dehydrogenase 0.9918 201 363 GO:0003995
GO:0005737
GO:0033539
GO:0050660
AF-A0A351SK13-F1-model_v4 Acyl-CoA dehydrogenase 0.9917 200 363 GO:0003995
GO:0005737
GO:0033539
GO:0050660
AF-A0A7S1CJ75-F1-model_v4 Acyl-CoA dehydrogenase/oxidase C-terminal domain-containing protein 0.9865 216 364 GO:0004466
GO:0005739
GO:0016401
GO:0019254
GO:0033539
GO:0042758
GO:0050660
AF-A0A3D3T7N8-F1-model_v4 Acyl-CoA dehydrogenase 0.9789 233 363 GO:0003995
GO:0005737
GO:0033539
GO:0050660

Feature Viewer

pLDDT pTM Quality
92.69 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map