F495600
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1758 | 805 | 1524 | 308 |
Family's Representative Sequence
| Representative Sequence | 3300053105|Ga0500557_000029|Ga0500557_000029_8993_10054 |
| Length | 353 |
| Sequence | MACFETIFLSAIAAGQGHSYLRAPLTRPRQVPAFPPQHQPLRLAAIMSSIISVANLSKTYGSGFKALNNVNLDIMSGEIFALLGPNGAGKTTLISIICGIANPSEGKVLVGGENIQTSYRKARSLIGLVPQELHTDAFESVWATVSFSRGLFGKPKNPAHIEKVLKDLSLWDKKDSKIITLSGGMKRRVMIAKALSHEPQILFLDEPTAGVDVELRKGMWEVVRTLQQSGVTIILTTHYIEEAEEMADRIGVINKGEIVLVEDKATLMQKLGKKRLTLHLQGKLDKLPESLGHYELDLCDGGATLVYDYDTKGERTGITSLLGDLRTAGIRFNDLDTTQSSLEDIFVDLVRAS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2209111006 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 | Metagenome | Rhizosphere |
| 2 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 3 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 4 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 5 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 6 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 7 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 8 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 9 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 10 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 11 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 12 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 13 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 14 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 15 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 16 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 17 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 18 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 19 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 20 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 21 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 22 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 23 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 24 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 25 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 26 | 2582581280 | Caulobacter henricii CF287 | Isolate | Rhizosphere |
| 27 | 2582581293 | Caulobacter henricii YR570 | Isolate | Rhizosphere |
| 28 | 2585428106 | Caulobacter sp. OV484 | Isolate | Rhizosphere |
| 29 | 2602042107 | Bradyrhizobium sp. NFR13 | Isolate | Rhizoplane |
| 30 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 31 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 32 | 2643221552 | Caulobacter sp. Root1472 | Isolate | Unclassified |
| 33 | 2643221560 | Sphingopyxis sp. Root1497 | Isolate | Unclassified |
| 34 | 2643221584 | Caulobacter sp. Root656 | Isolate | Unclassified |
| 35 | 2643221640 | Caulobacter sp. Root342 | Isolate | Unclassified |
| 36 | 2643221642 | Caulobacter sp. Root343 | Isolate | Unclassified |
| 37 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 38 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 39 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 40 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 41 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 42 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 43 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 44 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 45 | 2818991435 | Caulobacter henricii 536 | Isolate | Unclassified |
| 46 | 2818991454 | Caulobacter rhizosphaerae 3260 | Isolate | Rhizosphere |
| 47 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 48 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 49 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 50 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 51 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 52 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 53 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 54 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 55 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 56 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 57 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 58 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 59 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 60 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 61 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 62 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 63 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 64 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 65 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 66 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 67 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 68 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 69 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 70 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 71 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 72 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 73 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 74 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 75 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 76 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 77 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 78 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 79 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 80 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 81 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 82 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 83 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 84 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 85 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 86 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 87 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 88 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 89 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 90 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 91 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 92 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 93 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 94 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 95 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 96 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 97 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 98 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 99 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 100 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 101 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 102 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 103 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 104 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 105 | 2893066018 | Tardiphaga sp. P9-11 | Isolate | Unclassified |
| 106 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 107 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 108 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 109 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 110 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 111 | 2904699407 | |||
| 112 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 113 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 114 | 2906610324 | |||
| 115 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 116 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 117 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 118 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 119 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 120 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 121 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 122 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 123 | 2922368715 | |||
| 124 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 125 | 2922425934 | |||
| 126 | 2928531327 | Caulobacter sp. 1776 | Isolate | Rhizosphere |
| 127 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 128 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 129 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 130 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 131 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 132 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 133 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 134 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 135 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 136 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 137 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 138 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 139 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 140 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 141 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 142 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 143 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 144 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 145 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 146 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 147 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 148 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 149 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 150 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 151 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 152 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 153 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 154 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 155 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 156 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 157 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 158 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 159 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 160 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 161 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 162 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 163 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 164 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 165 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 166 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 167 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 168 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 169 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 170 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 171 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 172 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 173 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 174 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 175 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 176 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 177 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 178 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 179 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 180 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 181 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 182 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 183 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 184 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 185 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 186 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 187 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 188 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 189 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 190 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 191 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 192 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 193 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 194 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 195 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 196 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 197 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 198 | 3300000041 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300000042 | Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young | Metagenome | Rhizosphere |
| 200 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 202 | 3300000045 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 204 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 205 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 206 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 207 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 208 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 209 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 210 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 211 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 212 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 213 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 214 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 215 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 216 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 217 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 218 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 219 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 220 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 221 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 222 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 223 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 224 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 225 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 226 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 227 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 228 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 229 | 3300005276 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1 | Metagenome | Rhizosphere |
| 230 | 3300005277 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) | Metagenome | Rhizosphere |
| 231 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 232 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 233 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 234 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 235 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 236 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 237 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 238 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 239 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 240 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 241 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 242 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 243 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 244 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 245 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 246 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 247 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 248 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 249 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 250 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 251 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 252 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 253 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 254 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 255 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 256 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 257 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 258 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 259 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 260 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 261 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 262 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 263 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 264 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 265 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 266 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 267 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 268 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 269 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 270 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 271 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 272 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 273 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 274 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 275 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 276 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 277 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 278 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 279 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 280 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 281 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 282 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 283 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 284 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 285 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 286 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 287 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 288 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 289 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 290 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 291 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 292 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 293 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 294 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 295 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 296 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 297 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 298 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 299 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 300 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 301 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 302 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 303 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 304 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 305 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 306 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 307 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 308 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 309 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 310 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 311 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 312 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 313 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 314 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 315 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 316 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 317 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 318 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 319 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 320 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 321 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 322 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 323 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 324 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 325 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 326 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 327 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 328 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 329 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 330 | 3300006941 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW | Metagenome | Nodule |
| 331 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 332 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 333 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 334 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 335 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 336 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 337 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 338 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 339 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 340 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 341 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 342 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 343 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 344 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 345 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 346 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 347 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 348 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 349 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 350 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 351 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 352 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 353 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 354 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 355 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 356 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 357 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 358 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 359 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 360 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 361 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 362 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 363 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 364 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 365 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 366 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 367 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 368 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 369 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 370 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 371 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 372 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 373 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 374 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 375 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 376 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 377 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 378 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 379 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 380 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 381 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 382 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 383 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 384 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 385 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 386 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 387 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 388 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 389 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 390 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 391 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 392 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 393 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 394 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 395 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 396 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 397 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 398 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 399 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 400 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 401 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 402 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 403 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 404 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 405 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 406 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 407 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 408 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 409 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 410 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 411 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 412 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 413 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 414 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 415 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 416 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 417 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 418 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 419 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 420 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 421 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 422 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 423 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 424 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 425 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 426 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 427 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 428 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 429 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 430 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 431 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 432 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 433 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 434 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 435 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 436 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 437 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 438 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 439 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 440 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 441 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 442 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 443 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 444 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 445 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 446 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 447 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 448 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 449 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 450 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 451 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 452 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 453 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 454 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 455 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 456 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 457 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 458 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 459 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 460 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 461 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 462 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 463 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 464 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 465 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 466 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 467 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 468 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 469 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 470 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 471 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 472 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 473 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 474 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 475 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 476 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 477 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 478 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 479 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 480 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 481 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 482 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 483 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 484 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 485 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 486 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 487 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 488 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 489 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 490 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 491 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 492 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 493 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 494 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 495 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 496 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 497 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 498 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 499 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 500 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 501 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 502 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 503 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 504 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 505 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 506 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 507 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 508 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 509 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 510 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 511 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 512 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 513 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 514 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 515 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 516 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 517 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 518 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 519 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 520 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 521 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 522 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 523 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 524 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 525 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 526 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 527 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 528 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 529 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 530 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 531 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 532 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 533 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 534 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 535 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 536 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 537 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 538 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 539 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 540 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 541 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 542 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 543 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 544 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 545 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 546 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 547 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 548 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 549 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 550 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 551 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 552 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 553 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 554 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 555 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 556 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 557 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 558 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 559 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 560 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 561 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 562 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 563 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 564 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 565 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 566 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 567 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 568 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 569 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 570 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 571 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 572 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 573 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 574 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 575 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 576 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 577 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 578 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 579 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 580 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 581 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 582 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 583 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 584 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 585 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 586 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 587 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 588 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 589 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 590 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 591 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 592 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 593 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 594 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 595 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 596 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 597 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 598 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 599 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 600 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 601 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 602 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 603 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 604 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 605 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 606 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 607 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 608 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 609 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 610 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 611 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 612 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 613 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 614 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 615 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 616 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 617 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 618 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 619 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 620 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 621 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 622 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 623 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 624 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 625 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 626 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 627 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 628 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 629 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 630 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 631 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 632 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 633 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 634 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 635 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 636 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 637 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 638 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 639 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 640 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 641 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 642 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 643 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 644 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 645 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 646 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 647 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 648 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 649 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 650 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 651 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 652 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 653 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 654 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 655 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 656 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 657 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 658 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 659 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 660 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 661 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 662 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 663 | 3300049517 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control | Metagenome | Rhizosphere |
| 664 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 665 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 666 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 667 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 668 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 669 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 670 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 671 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 672 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 673 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 674 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 675 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 676 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 677 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 678 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 679 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 680 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 681 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 682 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 683 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 684 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 685 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 686 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 687 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 688 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 689 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 690 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 691 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 692 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 693 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 694 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 695 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 696 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 697 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 698 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 699 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 700 | 3300049777 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control | Metagenome | Rhizosphere |
| 701 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 702 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 703 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 704 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 705 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 706 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 707 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 708 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 709 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 710 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 711 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 712 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 713 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 714 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 715 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 716 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 717 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 718 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 719 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 720 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 721 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 722 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 723 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 724 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 725 | 3300053089 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere | Metagenome | Endosphere |
| 726 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 727 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 728 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 729 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 730 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 731 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 732 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 733 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 734 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 735 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 736 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 737 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 738 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 739 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 740 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 741 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 742 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 743 | 3300053126 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere | Metagenome | Endosphere |
| 744 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 745 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 746 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 747 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 748 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 749 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 750 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 751 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 752 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 753 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 754 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 755 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 756 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 757 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 758 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 759 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 760 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 761 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 762 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 763 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 764 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 765 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 766 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 767 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 768 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 769 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 770 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 771 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 772 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 773 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 774 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 775 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 776 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 777 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 778 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 779 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 780 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 781 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 782 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 783 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 784 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 785 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 786 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 787 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 788 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 789 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 790 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 791 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 792 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 793 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 794 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 795 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 796 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 797 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 798 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 799 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 800 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 801 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 802 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 803 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
| 804 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
| 805 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 86.89 |
| Metatranscriptomes | 0 |
| Isolates | 13.11 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7.57 |
| Nodule | 10.13 |
| Rhizoplane | 6.48 |
| Rhizosphere | 68.94 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.88 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | 2214600489 | 2209111006 | Bacteria | 5547 |
| 2 | ARcpr5oldR_c000075 | 3300000041 | Bacteria | 18141 |
| 3 | ARSoilYngRDRAFT_c00009 | 3300000042 | Bacteria | 30468 |
| 4 | ARcpr5yngRDRAFT_c000006 | 3300000043 | Bacteria | 44193 |
| 5 | ARSoilOldRDRAFT_c000008 | 3300000044 | Bacteria | 50600 |
| 6 | ARCol0oldRDRAFT_c00242 | 3300000045 | Bacteria | 5115 |
| 7 | ARCol0yngRDRAFT_1000092 | 3300000652 | Bacteria | 16856 |
| 8 | JGI24741J21665_1005717 | 3300001915 | Bacteria | 2563 |
| 9 | JGI24746J21847_1000654 | 3300001977 | Bacteria | 5304 |
| 10 | JGI24740J21852_10001722 | 3300001979 | Bacteria | 10052 |
| 11 | JGI24739J22299_10000092 | 3300001989 | Bacteria | 26283 |
| 12 | JGI24739J22299_10010924 | 3300001989 | Bacteria | 3358 |
| 13 | JGI24739J22299_10050347 | 3300001989 | Bacteria | 1347 |
| 14 | JGI24737J22298_10000325 | 3300001990 | Bacteria | 16017 |
| 15 | JGI24737J22298_10001344 | 3300001990 | Bacteria | 8708 |
| 16 | JGI24737J22298_10003780 | 3300001990 | Bacteria | 5327 |
| 17 | JGI24735J21928_10019123 | 3300002067 | Bacteria | 2107 |
| 18 | JGI24735J21928_10055274 | 3300002067 | Bacteria | 1143 |
| 19 | JGI24750J21931_1000128 | 3300002070 | Bacteria | 12041 |
| 20 | JGI24745J21846_1000019 | 3300002073 | Bacteria | 10205 |
| 21 | JGI24748J21848_1000158 | 3300002074 | Bacteria | 9876 |
| 22 | JGI24738J21930_10000010 | 3300002075 | Bacteria | 37976 |
| 23 | JGI24749J21850_1000653 | 3300002076 | Bacteria | 5028 |
| 24 | JGI24744J21845_10007455 | 3300002077 | Bacteria | 2261 |
| 25 | JGI24035J26624_1000002 | 3300002126 | Bacteria | 16706 |
| 26 | JGI24033J26618_1004382 | 3300002155 | Bacteria | 1523 |
| 27 | JGI24034J26672_10000201 | 3300002239 | Bacteria | 8012 |
| 28 | JGI24742J22300_10000449 | 3300002244 | Bacteria | 6067 |
| 29 | JGI25406J46586_10000417 | 3300003203 | Bacteria | 19537 |
| 30 | JGI25406J46586_10029212 | 3300003203 | Bacteria | 2090 |
| 31 | JGI25165J46597_1004090 | 3300003214 | Bacteria | 3270 |
| 32 | JGI25153J46596_10000758 | 3300003215 | Bacteria | 19728 |
| 33 | JGI25153J46596_10003729 | 3300003215 | Bacteria | 8414 |
| 34 | JGI25153J46596_10014037 | 3300003215 | Bacteria | 3353 |
| 35 | JGI25404J52841_10014829 | 3300003659 | Bacteria | 1692 |
| 36 | Ga0055526_1022934 | 3300003771 | Bacteria | 2102 |
| 37 | Ga0055531_10006207 | 3300003794 | Bacteria | 6823 |
| 38 | Ga0055531_10016346 | 3300003794 | Bacteria | 3206 |
| 39 | JGI25405J52794_10002686 | 3300003911 | Bacteria | 3086 |
| 40 | JGI25405J52794_10019743 | 3300003911 | Bacteria | 1353 |
| 41 | Ga0055543_1002634 | 3300004625 | Bacteria | 5780 |
| 42 | Ga0065165_1003855 | 3300005262 | Bacteria | 9959 |
| 43 | Ga0065165_1003912 | 3300005262 | Bacteria | 9835 |
| 44 | Ga0065717_1000057 | 3300005276 | Bacteria | 6757 |
| 45 | Ga0065716_1001714 | 3300005277 | Bacteria | 3918 |
| 46 | Ga0065712_10000899 | 3300005290 | Bacteria | 8202 |
| 47 | Ga0065712_10068648 | 3300005290 | Bacteria | 9527 |
| 48 | Ga0065715_10000752 | 3300005293 | Bacteria | 15084 |
| 49 | Ga0065715_10000834 | 3300005293 | Bacteria | 8809 |
| 50 | Ga0065715_10099531 | 3300005293 | Bacteria | 3400 |
| 51 | Ga0070658_10000029 | 3300005327 | Bacteria | 156910 |
| 52 | Ga0070683_100001029 | 3300005329 | Bacteria | 20930 |
| 53 | Ga0070683_100001787 | 3300005329 | Bacteria | 16752 |
| 54 | Ga0070683_100014914 | 3300005329 | Bacteria | 6811 |
| 55 | Ga0070683_100106508 | 3300005329 | Bacteria | 2643 |
| 56 | Ga0070690_100002808 | 3300005330 | Bacteria | 9398 |
| 57 | Ga0070690_100020537 | 3300005330 | Bacteria | 4024 |
| 58 | Ga0070670_100017810 | 3300005331 | Bacteria | 6096 |
| 59 | Ga0070677_10000045 | 3300005333 | Bacteria | 38826 |
| 60 | Ga0068869_100000079 | 3300005334 | Bacteria | 44000 |
| 61 | Ga0068869_100036226 | 3300005334 | Bacteria | 3502 |
| 62 | Ga0068869_100042272 | 3300005334 | Bacteria | 3267 |
| 63 | Ga0070666_10019934 | 3300005335 | Bacteria | 4332 |
| 64 | Ga0070680_100080310 | 3300005336 | Bacteria | 2689 |
| 65 | Ga0070680_100101893 | 3300005336 | Bacteria | 2384 |
| 66 | Ga0070680_100205146 | 3300005336 | Bacteria | 1662 |
| 67 | Ga0070682_100000641 | 3300005337 | Bacteria | 21233 |
| 68 | Ga0070682_100048995 | 3300005337 | Bacteria | 2632 |
| 69 | Ga0070682_100082911 | 3300005337 | Bacteria | 2079 |
| 70 | Ga0068868_100002114 | 3300005338 | Bacteria | 13683 |
| 71 | Ga0068868_100010593 | 3300005338 | Bacteria | 6682 |
| 72 | Ga0068868_100116506 | 3300005338 | Bacteria | 2176 |
| 73 | Ga0070660_100000715 | 3300005339 | Bacteria | 21980 |
| 74 | Ga0070660_100004207 | 3300005339 | Bacteria | 9935 |
| 75 | Ga0070660_100067446 | 3300005339 | Bacteria | 2787 |
| 76 | Ga0070660_100109288 | 3300005339 | Bacteria | 2198 |
| 77 | Ga0070660_100164229 | 3300005339 | Bacteria | 1791 |
| 78 | Ga0070689_100003727 | 3300005340 | Bacteria | 10202 |
| 79 | Ga0070689_100052174 | 3300005340 | Bacteria | 3163 |
| 80 | Ga0070691_10000161 | 3300005341 | Bacteria | 21699 |
| 81 | Ga0070691_10006926 | 3300005341 | Bacteria | 5189 |
| 82 | Ga0070687_100000085 | 3300005343 | Bacteria | 30647 |
| 83 | Ga0070661_100000307 | 3300005344 | Bacteria | 39479 |
| 84 | Ga0070661_100132338 | 3300005344 | Bacteria | 1874 |
| 85 | Ga0070661_100186230 | 3300005344 | Bacteria | 1582 |
| 86 | Ga0070692_10007199 | 3300005345 | Bacteria | 4886 |
| 87 | Ga0070692_10119582 | 3300005345 | Bacteria | 1468 |
| 88 | Ga0070668_100000164 | 3300005347 | Bacteria | 42113 |
| 89 | Ga0070668_100033222 | 3300005347 | Bacteria | 3927 |
| 90 | Ga0070668_100051475 | 3300005347 | Bacteria | 3173 |
| 91 | Ga0070668_100165747 | 3300005347 | Bacteria | 1795 |
| 92 | Ga0070668_100216327 | 3300005347 | Bacteria | 1578 |
| 93 | Ga0070669_100000571 | 3300005353 | Bacteria | 27367 |
| 94 | Ga0070669_100107439 | 3300005353 | Bacteria | 2114 |
| 95 | Ga0070675_100002792 | 3300005354 | Bacteria | 13151 |
| 96 | Ga0070671_100000104 | 3300005355 | Bacteria | 53922 |
| 97 | Ga0070671_100082892 | 3300005355 | Bacteria | 2682 |
| 98 | Ga0070674_100000238 | 3300005356 | Bacteria | 27260 |
| 99 | Ga0070674_100071785 | 3300005356 | Bacteria | 2450 |
| 100 | Ga0070674_100111852 | 3300005356 | Bacteria | 2006 |
| 101 | Ga0070673_100000152 | 3300005364 | Bacteria | 33183 |
| 102 | Ga0070673_100119337 | 3300005364 | Bacteria | 2197 |
| 103 | Ga0070673_100122975 | 3300005364 | Bacteria | 2168 |
| 104 | Ga0070688_100001552 | 3300005365 | Bacteria | 11464 |
| 105 | Ga0070688_100004752 | 3300005365 | Bacteria | 7097 |
| 106 | Ga0070688_100140851 | 3300005365 | Bacteria | 1638 |
| 107 | Ga0070688_100148754 | 3300005365 | Bacteria | 1599 |
| 108 | Ga0070688_100267867 | 3300005365 | Bacteria | 1223 |
| 109 | Ga0070659_100000551 | 3300005366 | Bacteria | 27372 |
| 110 | Ga0070659_100021203 | 3300005366 | Bacteria | 4943 |
| 111 | Ga0070659_100029695 | 3300005366 | Bacteria | 4226 |
| 112 | Ga0070659_100139609 | 3300005366 | Bacteria | 1972 |
| 113 | Ga0070659_100178734 | 3300005366 | Bacteria | 1741 |
| 114 | Ga0070659_100290427 | 3300005366 | Bacteria | 1362 |
| 115 | Ga0070667_100002365 | 3300005367 | Bacteria | 16513 |
| 116 | Ga0070667_100159545 | 3300005367 | Bacteria | 1985 |
| 117 | Ga0070667_100214820 | 3300005367 | Bacteria | 1710 |
| 118 | Ga0070703_10002279 | 3300005406 | Bacteria | 5564 |
| 119 | Ga0070709_10000690 | 3300005434 | Bacteria | 19189 |
| 120 | Ga0070709_10154832 | 3300005434 | Bacteria | 1588 |
| 121 | Ga0070714_100010787 | 3300005435 | Bacteria | 7233 |
| 122 | Ga0070714_100075535 | 3300005435 | Bacteria | 2924 |
| 123 | Ga0070714_100224086 | 3300005435 | Bacteria | 1729 |
| 124 | Ga0070713_100001316 | 3300005436 | Bacteria | 15879 |
| 125 | Ga0070713_100020625 | 3300005436 | Bacteria | 5056 |
| 126 | Ga0070713_100046727 | 3300005436 | Bacteria | 3553 |
| 127 | Ga0070710_10227873 | 3300005437 | Bacteria | 1189 |
| 128 | Ga0070701_10000674 | 3300005438 | Bacteria | 12016 |
| 129 | Ga0070711_100008627 | 3300005439 | Bacteria | 6251 |
| 130 | Ga0070711_100031169 | 3300005439 | Bacteria | 3537 |
| 131 | Ga0070711_100295171 | 3300005439 | Bacteria | 1287 |
| 132 | Ga0070705_100000148 | 3300005440 | Bacteria | 41687 |
| 133 | Ga0070700_100000277 | 3300005441 | Bacteria | 27391 |
| 134 | Ga0070700_100025371 | 3300005441 | Bacteria | 3489 |
| 135 | Ga0070700_100195613 | 3300005441 | Bacteria | 1417 |
| 136 | Ga0070694_100003001 | 3300005444 | Bacteria | 10038 |
| 137 | Ga0070708_100038211 | 3300005445 | Bacteria | 4194 |
| 138 | Ga0070663_100001406 | 3300005455 | Bacteria | 13151 |
| 139 | Ga0070663_100023864 | 3300005455 | Bacteria | 4105 |
| 140 | Ga0070663_100028764 | 3300005455 | Bacteria | 3788 |
| 141 | Ga0070663_100039199 | 3300005455 | Bacteria | 3310 |
| 142 | Ga0070663_100045017 | 3300005455 | Bacteria | 3116 |
| 143 | Ga0070663_100063781 | 3300005455 | Bacteria | 2662 |
| 144 | Ga0070663_100099842 | 3300005455 | Bacteria | 2164 |
| 145 | Ga0070678_100008123 | 3300005456 | Bacteria | 6270 |
| 146 | Ga0070678_100033129 | 3300005456 | Bacteria | 3583 |
| 147 | Ga0070678_100035825 | 3300005456 | Bacteria | 3468 |
| 148 | Ga0070678_100444534 | 3300005456 | Bacteria | 1134 |
| 149 | Ga0070662_100005414 | 3300005457 | Bacteria | 8152 |
| 150 | Ga0070662_100007650 | 3300005457 | Bacteria | 7010 |
| 151 | Ga0070662_100010491 | 3300005457 | Bacteria | 6082 |
| 152 | Ga0070662_100136863 | 3300005457 | Bacteria | 1894 |
| 153 | Ga0070681_10003456 | 3300005458 | Bacteria | 14797 |
| 154 | Ga0070681_10037621 | 3300005458 | Bacteria | 4855 |
| 155 | Ga0070681_10074831 | 3300005458 | Bacteria | 3347 |
| 156 | Ga0070681_10146358 | 3300005458 | Bacteria | 2291 |
| 157 | Ga0070681_10232122 | 3300005458 | Bacteria | 1759 |
| 158 | Ga0068867_100004407 | 3300005459 | Bacteria | 9902 |
| 159 | Ga0070685_10001961 | 3300005466 | Bacteria | 10680 |
| 160 | Ga0070685_10034291 | 3300005466 | Bacteria | 2858 |
| 161 | Ga0070685_10141807 | 3300005466 | Bacteria | 1514 |
| 162 | Ga0070699_100147812 | 3300005518 | Bacteria | 2077 |
| 163 | Ga0070679_100000394 | 3300005530 | Bacteria | 37125 |
| 164 | Ga0070679_100083466 | 3300005530 | Bacteria | 3183 |
| 165 | Ga0070679_100110405 | 3300005530 | Bacteria | 2736 |
| 166 | Ga0070684_100001138 | 3300005535 | Bacteria | 19106 |
| 167 | Ga0070684_100004074 | 3300005535 | Bacteria | 11062 |
| 168 | Ga0070684_100255997 | 3300005535 | Bacteria | 1600 |
| 169 | Ga0070697_100228562 | 3300005536 | Bacteria | 1586 |
| 170 | Ga0068853_100002891 | 3300005539 | Bacteria | 13032 |
| 171 | Ga0068853_100022528 | 3300005539 | Bacteria | 5261 |
| 172 | Ga0068853_100177647 | 3300005539 | Bacteria | 1929 |
| 173 | Ga0068853_100215276 | 3300005539 | Bacteria | 1752 |
| 174 | Ga0068853_100265341 | 3300005539 | Bacteria | 1580 |
| 175 | Ga0070672_100000088 | 3300005543 | Bacteria | 44394 |
| 176 | Ga0070686_100000719 | 3300005544 | Bacteria | 19252 |
| 177 | Ga0070686_100013533 | 3300005544 | Bacteria | 4676 |
| 178 | Ga0070686_100380259 | 3300005544 | Bacteria | 1069 |
| 179 | Ga0070695_100000586 | 3300005545 | Bacteria | 19224 |
| 180 | Ga0070695_100003316 | 3300005545 | Bacteria | 9416 |
| 181 | Ga0070695_100044161 | 3300005545 | Bacteria | 2835 |
| 182 | Ga0070695_100191825 | 3300005545 | Bacteria | 1455 |
| 183 | Ga0070696_100000921 | 3300005546 | Bacteria | 19106 |
| 184 | Ga0070696_100108735 | 3300005546 | Bacteria | 1995 |
| 185 | Ga0070693_100000134 | 3300005547 | Bacteria | 33408 |
| 186 | Ga0070693_100061633 | 3300005547 | Bacteria | 2181 |
| 187 | Ga0070693_100123521 | 3300005547 | Bacteria | 1609 |
| 188 | Ga0070665_100016851 | 3300005548 | Bacteria | 7326 |
| 189 | Ga0070665_100146031 | 3300005548 | Bacteria | 2368 |
| 190 | Ga0070665_100169819 | 3300005548 | Bacteria | 2182 |
| 191 | Ga0070704_100000026 | 3300005549 | Bacteria | 48700 |
| 192 | Ga0068855_100006834 | 3300005563 | Bacteria | 13840 |
| 193 | Ga0068855_100009486 | 3300005563 | Bacteria | 11753 |
| 194 | Ga0068855_100328561 | 3300005563 | Bacteria | 1688 |
| 195 | Ga0070664_100001420 | 3300005564 | Bacteria | 19106 |
| 196 | Ga0070664_100155219 | 3300005564 | Bacteria | 2022 |
| 197 | Ga0068857_100001388 | 3300005577 | Bacteria | 19106 |
| 198 | Ga0068857_100039317 | 3300005577 | Bacteria | 4190 |
| 199 | Ga0068857_100053613 | 3300005577 | Bacteria | 3577 |
| 200 | Ga0068857_100112078 | 3300005577 | Bacteria | 2453 |
| 201 | Ga0068854_100000546 | 3300005578 | Bacteria | 22673 |
| 202 | Ga0068854_100027437 | 3300005578 | Bacteria | 3925 |
| 203 | Ga0068854_100030387 | 3300005578 | Bacteria | 3747 |
| 204 | Ga0068854_100129454 | 3300005578 | Bacteria | 1925 |
| 205 | Ga0068856_100000091 | 3300005614 | Bacteria | 85048 |
| 206 | Ga0068856_100002000 | 3300005614 | Bacteria | 21261 |
| 207 | Ga0068856_100012506 | 3300005614 | Bacteria | 8216 |
| 208 | Ga0068856_100015546 | 3300005614 | Bacteria | 7356 |
| 209 | Ga0068856_100429726 | 3300005614 | Bacteria | 1341 |
| 210 | Ga0070702_100000245 | 3300005615 | Bacteria | 18498 |
| 211 | Ga0070702_100012324 | 3300005615 | Bacteria | 4279 |
| 212 | Ga0070702_100028554 | 3300005615 | Bacteria | 3024 |
| 213 | Ga0070702_100173279 | 3300005615 | Bacteria | 1405 |
| 214 | Ga0068852_100002320 | 3300005616 | Bacteria | 13074 |
| 215 | Ga0068859_100006734 | 3300005617 | Bacteria | 11674 |
| 216 | Ga0068859_100049744 | 3300005617 | Bacteria | 4210 |
| 217 | Ga0068864_100000890 | 3300005618 | Bacteria | 25145 |
| 218 | Ga0068864_100124327 | 3300005618 | Bacteria | 2310 |
| 219 | Ga0068864_100216993 | 3300005618 | Bacteria | 1763 |
| 220 | Ga0068864_100400248 | 3300005618 | Bacteria | 1305 |
| 221 | Ga0068864_100415709 | 3300005618 | Bacteria | 1280 |
| 222 | Ga0068866_10000221 | 3300005718 | Bacteria | 27070 |
| 223 | Ga0068866_10079022 | 3300005718 | Bacteria | 1761 |
| 224 | Ga0068861_100000783 | 3300005719 | Bacteria | 19106 |
| 225 | Ga0068861_100122352 | 3300005719 | Bacteria | 2101 |
| 226 | Ga0068851_10008009 | 3300005834 | Bacteria | 4874 |
| 227 | Ga0068851_10052554 | 3300005834 | Bacteria | 2072 |
| 228 | Ga0068870_10000090 | 3300005840 | Bacteria | 29559 |
| 229 | Ga0068863_100000340 | 3300005841 | Bacteria | 47641 |
| 230 | Ga0068863_100061662 | 3300005841 | Bacteria | 3546 |
| 231 | Ga0068858_100000295 | 3300005842 | Bacteria | 53892 |
| 232 | Ga0068858_100031612 | 3300005842 | Bacteria | 4917 |
| 233 | Ga0068860_100000291 | 3300005843 | Bacteria | 71296 |
| 234 | Ga0068860_100001285 | 3300005843 | Bacteria | 27247 |
| 235 | Ga0068860_100425096 | 3300005843 | Bacteria | 1317 |
| 236 | Ga0068860_100431596 | 3300005843 | Bacteria | 1307 |
| 237 | Ga0068862_100003658 | 3300005844 | Bacteria | 13151 |
| 238 | Ga0068862_100043709 | 3300005844 | Bacteria | 3820 |
| 239 | Ga0081455_10000007 | 3300005937 | Bacteria | 269394 |
| 240 | Ga0081455_10007150 | 3300005937 | Bacteria | 11812 |
| 241 | Ga0081455_10019547 | 3300005937 | Bacteria | 6405 |
| 242 | Ga0081455_10089595 | 3300005937 | Bacteria | 2496 |
| 243 | Ga0081538_10027322 | 3300005981 | Bacteria | 3960 |
| 244 | Ga0081540_1000390 | 3300005983 | Bacteria | 43721 |
| 245 | Ga0081540_1016027 | 3300005983 | Bacteria | 4717 |
| 246 | Ga0081540_1018305 | 3300005983 | Bacteria | 4302 |
| 247 | Ga0081540_1082057 | 3300005983 | Bacteria | 1448 |
| 248 | Ga0081539_10000748 | 3300005985 | Bacteria | 64594 |
| 249 | Ga0081539_10001525 | 3300005985 | Bacteria | 38837 |
| 250 | Ga0081539_10036857 | 3300005985 | Bacteria | 2920 |
| 251 | Ga0070717_10008927 | 3300006028 | Bacteria | 7512 |
| 252 | Ga0070717_10009632 | 3300006028 | Bacteria | 7271 |
| 253 | Ga0070717_10045951 | 3300006028 | Bacteria | 3572 |
| 254 | Ga0075365_10028872 | 3300006038 | Bacteria | 3540 |
| 255 | Ga0075365_10038398 | 3300006038 | Bacteria | 3112 |
| 256 | Ga0075365_10063018 | 3300006038 | Bacteria | 2481 |
| 257 | Ga0075365_10187265 | 3300006038 | Bacteria | 1448 |
| 258 | Ga0075368_10037876 | 3300006042 | Bacteria | 1886 |
| 259 | Ga0075363_100037328 | 3300006048 | Bacteria | 2552 |
| 260 | Ga0075363_100055727 | 3300006048 | Bacteria | 2118 |
| 261 | Ga0075364_10347084 | 3300006051 | Bacteria | 1011 |
| 262 | Ga0075432_10005977 | 3300006058 | Bacteria | 4142 |
| 263 | Ga0075432_10044381 | 3300006058 | Bacteria | 1559 |
| 264 | Ga0070715_10076610 | 3300006163 | Bacteria | 1507 |
| 265 | Ga0070716_100029152 | 3300006173 | Bacteria | 2981 |
| 266 | Ga0070716_100067042 | 3300006173 | Bacteria | 2096 |
| 267 | Ga0070712_100000719 | 3300006175 | Bacteria | 19499 |
| 268 | Ga0075362_10007719 | 3300006177 | Bacteria | 4087 |
| 269 | Ga0075427_10000012 | 3300006194 | Bacteria | 11956 |
| 270 | Ga0075366_10004643 | 3300006195 | Bacteria | 7380 |
| 271 | Ga0075366_10008677 | 3300006195 | Bacteria | 5658 |
| 272 | Ga0075366_10011231 | 3300006195 | Bacteria | 5052 |
| 273 | Ga0075366_10109101 | 3300006195 | Bacteria | 1664 |
| 274 | Ga0097621_100000040 | 3300006237 | Bacteria | 66339 |
| 275 | Ga0097621_100070634 | 3300006237 | Bacteria | 2883 |
| 276 | Ga0097621_100216934 | 3300006237 | Bacteria | 1666 |
| 277 | Ga0068871_100000252 | 3300006358 | Bacteria | 37355 |
| 278 | Ga0068871_100012473 | 3300006358 | Bacteria | 6267 |
| 279 | Ga0068871_100070601 | 3300006358 | Bacteria | 2871 |
| 280 | Ga0068871_100074517 | 3300006358 | Bacteria | 2800 |
| 281 | Ga0075430_100018573 | 3300006846 | Bacteria | 5917 |
| 282 | Ga0075431_100181614 | 3300006847 | Bacteria | 2159 |
| 283 | Ga0075433_10000007 | 3300006852 | Bacteria | 75995 |
| 284 | Ga0075434_100002477 | 3300006871 | Bacteria | 16252 |
| 285 | Ga0075434_100002531 | 3300006871 | Bacteria | 16122 |
| 286 | Ga0075434_100157129 | 3300006871 | Bacteria | 2293 |
| 287 | Ga0075434_100307519 | 3300006871 | Bacteria | 1605 |
| 288 | Ga0075429_100002081 | 3300006880 | Bacteria | 16691 |
| 289 | Ga0068865_100000275 | 3300006881 | Bacteria | 28270 |
| 290 | Ga0075436_100090548 | 3300006914 | Bacteria | 2126 |
| 291 | Ga0097620_100006734 | 3300006931 | Bacteria | 11674 |
| 292 | Ga0097620_100049739 | 3300006931 | Bacteria | 4210 |
| 293 | Ga0099825_1018577 | 3300006941 | Bacteria | 5382 |
| 294 | Ga0099824_1003213 | 3300006942 | Bacteria | 23884 |
| 295 | Ga0099824_1004100 | 3300006942 | Bacteria | 21098 |
| 296 | Ga0099822_1000022 | 3300006943 | Bacteria | 64942 |
| 297 | Ga0099823_1033291 | 3300006944 | Bacteria | 4146 |
| 298 | Ga0075435_100001384 | 3300007076 | Bacteria | 15669 |
| 299 | Ga0099794_10031966 | 3300007265 | Bacteria | 2467 |
| 300 | Ga0099794_10060679 | 3300007265 | Bacteria | 1837 |
| 301 | Ga0099794_10131568 | 3300007265 | Bacteria | 1264 |
| 302 | Ga0099795_10000002 | 3300007788 | Bacteria | 161112 |
| 303 | Ga0099795_10009035 | 3300007788 | Bacteria | 2874 |
| 304 | Ga0099795_10013752 | 3300007788 | Bacteria | 2493 |
| 305 | Ga0105251_10036640 | 3300009011 | Bacteria | 2412 |
| 306 | Ga0105250_10025985 | 3300009092 | Bacteria | 2358 |
| 307 | Ga0105240_10008489 | 3300009093 | Bacteria | 14689 |
| 308 | Ga0105240_10012704 | 3300009093 | Bacteria | 11608 |
| 309 | Ga0105240_10370371 | 3300009093 | Bacteria | 1620 |
| 310 | Ga0105240_10458293 | 3300009093 | Bacteria | 1425 |
| 311 | Ga0111539_10000394 | 3300009094 | Bacteria | 54170 |
| 312 | Ga0111539_10003483 | 3300009094 | Bacteria | 20741 |
| 313 | Ga0111539_10101733 | 3300009094 | Bacteria | 3373 |
| 314 | Ga0105245_10000462 | 3300009098 | Bacteria | 37242 |
| 315 | Ga0105245_10105110 | 3300009098 | Bacteria | 2618 |
| 316 | Ga0105245_10146469 | 3300009098 | Bacteria | 2228 |
| 317 | Ga0105247_10000442 | 3300009101 | Bacteria | 35071 |
| 318 | Ga0105247_10007985 | 3300009101 | Bacteria | 6466 |
| 319 | Ga0105247_10063961 | 3300009101 | Bacteria | 2285 |
| 320 | Ga0105247_10186632 | 3300009101 | Bacteria | 1386 |
| 321 | Ga0105247_10206795 | 3300009101 | Bacteria | 1322 |
| 322 | Ga0114129_10001111 | 3300009147 | Bacteria | 35464 |
| 323 | Ga0114129_10397585 | 3300009147 | Bacteria | 1817 |
| 324 | Ga0105243_10000282 | 3300009148 | Bacteria | 56666 |
| 325 | Ga0105243_10034755 | 3300009148 | Bacteria | 3906 |
| 326 | Ga0105243_10050968 | 3300009148 | Bacteria | 3271 |
| 327 | Ga0105241_10000652 | 3300009174 | Bacteria | 26004 |
| 328 | Ga0105241_10008896 | 3300009174 | Bacteria | 7384 |
| 329 | Ga0105241_10062186 | 3300009174 | Bacteria | 2877 |
| 330 | Ga0105241_10065435 | 3300009174 | Bacteria | 2809 |
| 331 | Ga0105241_10258825 | 3300009174 | Bacteria | 1478 |
| 332 | Ga0105242_10001726 | 3300009176 | Bacteria | 17253 |
| 333 | Ga0105242_10033558 | 3300009176 | Bacteria | 4110 |
| 334 | Ga0105242_10076170 | 3300009176 | Bacteria | 2796 |
| 335 | Ga0105248_10388333 | 3300009177 | Bacteria | 1572 |
| 336 | Ga0105248_10419449 | 3300009177 | Bacteria | 1507 |
| 337 | Ga0105248_10505818 | 3300009177 | Bacteria | 1362 |
| 338 | Ga0105248_10508859 | 3300009177 | Bacteria | 1358 |
| 339 | Ga0105237_10004071 | 3300009545 | Bacteria | 17048 |
| 340 | Ga0105237_10008154 | 3300009545 | Bacteria | 11375 |
| 341 | Ga0105237_10025117 | 3300009545 | Bacteria | 6095 |
| 342 | Ga0105237_10042051 | 3300009545 | Bacteria | 4608 |
| 343 | Ga0105237_10183408 | 3300009545 | Bacteria | 2093 |
| 344 | Ga0105237_10353638 | 3300009545 | Bacteria | 1473 |
| 345 | Ga0105238_10003337 | 3300009551 | Bacteria | 16021 |
| 346 | Ga0105238_10014305 | 3300009551 | Bacteria | 8021 |
| 347 | Ga0105238_10023755 | 3300009551 | Bacteria | 6248 |
| 348 | Ga0105238_10030700 | 3300009551 | Bacteria | 5470 |
| 349 | Ga0105238_10171965 | 3300009551 | Bacteria | 2143 |
| 350 | Ga0105238_10386627 | 3300009551 | Bacteria | 1391 |
| 351 | Ga0105249_10001210 | 3300009553 | Bacteria | 22796 |
| 352 | Ga0105249_10010878 | 3300009553 | Bacteria | 7996 |
| 353 | Ga0105249_10139088 | 3300009553 | Bacteria | 2326 |
| 354 | Ga0105249_10293262 | 3300009553 | Bacteria | 1629 |
| 355 | Ga0105249_10331615 | 3300009553 | Bacteria | 1535 |
| 356 | Ga0099796_10000004 | 3300010159 | Bacteria | 77538 |
| 357 | Ga0099796_10004806 | 3300010159 | Bacteria | 3308 |
| 358 | Ga0105239_10006303 | 3300010375 | Bacteria | 13795 |
| 359 | Ga0105239_10013274 | 3300010375 | Bacteria | 9154 |
| 360 | Ga0105239_10013946 | 3300010375 | Bacteria | 8922 |
| 361 | Ga0105239_10024151 | 3300010375 | Bacteria | 6695 |
| 362 | Ga0105239_10084928 | 3300010375 | Bacteria | 3488 |
| 363 | Ga0105239_10108631 | 3300010375 | Bacteria | 3073 |
| 364 | Ga0105239_10310694 | 3300010375 | Bacteria | 1777 |
| 365 | Ga0105239_10328605 | 3300010375 | Bacteria | 1725 |
| 366 | Ga0105239_10358824 | 3300010375 | Bacteria | 1646 |
| 367 | Ga0105246_10000312 | 3300011119 | Bacteria | 25800 |
| 368 | Ga0105246_10009199 | 3300011119 | Bacteria | 6084 |
| 369 | Ga0105246_10033565 | 3300011119 | Bacteria | 3412 |
| 370 | Ga0105246_10140466 | 3300011119 | Bacteria | 1815 |
| 371 | Ga0105246_10191470 | 3300011119 | Bacteria | 1583 |
| 372 | Ga0157373_10026078 | 3300013100 | Bacteria | 4224 |
| 373 | Ga0157373_10088140 | 3300013100 | Bacteria | 2186 |
| 374 | Ga0157371_10011709 | 3300013102 | Bacteria | 6740 |
| 375 | Ga0157371_10016826 | 3300013102 | Bacteria | 5445 |
| 376 | Ga0157370_10149119 | 3300013104 | Bacteria | 2177 |
| 377 | Ga0157369_10024576 | 3300013105 | Bacteria | 6698 |
| 378 | Ga0157369_10103135 | 3300013105 | Bacteria | 3038 |
| 379 | Ga0157374_10001123 | 3300013296 | Bacteria | 23027 |
| 380 | Ga0157378_10000270 | 3300013297 | Bacteria | 50517 |
| 381 | Ga0157378_10187750 | 3300013297 | Bacteria | 1947 |
| 382 | Ga0157378_10494249 | 3300013297 | Bacteria | 1221 |
| 383 | Ga0163162_10000145 | 3300013306 | Bacteria | 65191 |
| 384 | Ga0163162_10053735 | 3300013306 | Bacteria | 4049 |
| 385 | Ga0163162_10065175 | 3300013306 | Bacteria | 3689 |
| 386 | Ga0163162_10442921 | 3300013306 | Bacteria | 1431 |
| 387 | Ga0157372_10004025 | 3300013307 | Bacteria | 15762 |
| 388 | Ga0157375_10000332 | 3300013308 | Bacteria | 42513 |
| 389 | Ga0157375_10080802 | 3300013308 | Bacteria | 3290 |
| 390 | Ga0157375_10427461 | 3300013308 | Bacteria | 1490 |
| 391 | Ga0163163_10000865 | 3300014325 | Bacteria | 25811 |
| 392 | Ga0163163_10010305 | 3300014325 | Bacteria | 8401 |
| 393 | Ga0163163_10020785 | 3300014325 | Bacteria | 6189 |
| 394 | Ga0163163_10083035 | 3300014325 | Bacteria | 3208 |
| 395 | Ga0157380_10003074 | 3300014326 | Bacteria | 11374 |
| 396 | Ga0157380_10128696 | 3300014326 | Bacteria | 2157 |
| 397 | Ga0157380_10354612 | 3300014326 | Bacteria | 1374 |
| 398 | Ga0182008_10070087 | 3300014497 | Bacteria | 1725 |
| 399 | Ga0157377_10000137 | 3300014745 | Bacteria | 46698 |
| 400 | Ga0157379_10001761 | 3300014968 | Bacteria | 17895 |
| 401 | Ga0157379_10036684 | 3300014968 | Bacteria | 4371 |
| 402 | Ga0157379_10058255 | 3300014968 | Bacteria | 3453 |
| 403 | Ga0157379_10092162 | 3300014968 | Bacteria | 2718 |
| 404 | Ga0157376_10000088 | 3300014969 | Bacteria | 70084 |
| 405 | Ga0157376_10088578 | 3300014969 | Bacteria | 2674 |
| 406 | Ga0157376_10190860 | 3300014969 | Bacteria | 1879 |
| 407 | Ga0163161_10000144 | 3300017792 | Bacteria | 64771 |
| 408 | Ga0163161_10066113 | 3300017792 | Bacteria | 2639 |
| 409 | Ga0214544_1000026 | 3300021320 | Bacteria | 161530 |
| 410 | Ga0214542_1000025 | 3300021321 | Bacteria | 183588 |
| 411 | Ga0214545_1000014 | 3300021324 | Bacteria | 183588 |
| 412 | Ga0214543_1000034 | 3300021327 | Bacteria | 183712 |
| 413 | Ga0209148_1000516 | 3300025254 | Bacteria | 38539 |
| 414 | Ga0209233_1010135 | 3300025261 | Bacteria | 2837 |
| 415 | Ga0209233_1011860 | 3300025261 | Bacteria | 2554 |
| 416 | Ga0207666_1000048 | 3300025271 | Bacteria | 23535 |
| 417 | Ga0209673_1036315 | 3300025273 | Bacteria | 1463 |
| 418 | Ga0209564_1000485 | 3300025295 | Bacteria | 66032 |
| 419 | Ga0209564_1006386 | 3300025295 | Bacteria | 6372 |
| 420 | Ga0209564_1014991 | 3300025295 | Bacteria | 3185 |
| 421 | Ga0209758_1000141 | 3300025297 | Bacteria | 172481 |
| 422 | Ga0209758_1001510 | 3300025297 | Bacteria | 27007 |
| 423 | Ga0209758_1002417 | 3300025297 | Bacteria | 19125 |
| 424 | Ga0209758_1002489 | 3300025297 | Bacteria | 18724 |
| 425 | Ga0209758_1002656 | 3300025297 | Bacteria | 17698 |
| 426 | Ga0209758_1002862 | 3300025297 | Bacteria | 16755 |
| 427 | Ga0209256_1020989 | 3300025299 | Bacteria | 2022 |
| 428 | Ga0209256_1030849 | 3300025299 | Bacteria | 1474 |
| 429 | Ga0207426_1001111 | 3300025302 | Bacteria | 24708 |
| 430 | Ga0209257_1000426 | 3300025304 | Bacteria | 81095 |
| 431 | Ga0209257_1005168 | 3300025304 | Bacteria | 9409 |
| 432 | Ga0207697_10000136 | 3300025315 | Bacteria | 35274 |
| 433 | Ga0207697_10048662 | 3300025315 | Bacteria | 1749 |
| 434 | Ga0207656_10122122 | 3300025321 | Bacteria | 1213 |
| 435 | Ga0207696_1018901 | 3300025711 | Bacteria | 2254 |
| 436 | Ga0207696_1043475 | 3300025711 | Bacteria | 1306 |
| 437 | Ga0207653_10008240 | 3300025885 | Bacteria | 3249 |
| 438 | Ga0207682_10000006 | 3300025893 | Bacteria | 94953 |
| 439 | Ga0207642_10000628 | 3300025899 | Bacteria | 10836 |
| 440 | Ga0207642_10114303 | 3300025899 | Bacteria | 1380 |
| 441 | Ga0207710_10001915 | 3300025900 | Bacteria | 9975 |
| 442 | Ga0207710_10004369 | 3300025900 | Bacteria | 6176 |
| 443 | Ga0207710_10019353 | 3300025900 | Bacteria | 2905 |
| 444 | Ga0207688_10000027 | 3300025901 | Bacteria | 48448 |
| 445 | Ga0207688_10003913 | 3300025901 | Bacteria | 8119 |
| 446 | Ga0207688_10017094 | 3300025901 | Bacteria | 3941 |
| 447 | Ga0207688_10202008 | 3300025901 | Bacteria | 1192 |
| 448 | Ga0207680_10013527 | 3300025903 | Bacteria | 4196 |
| 449 | Ga0207680_10025017 | 3300025903 | Bacteria | 3287 |
| 450 | Ga0207647_10005467 | 3300025904 | Bacteria | 9310 |
| 451 | Ga0207647_10005974 | 3300025904 | Bacteria | 8867 |
| 452 | Ga0207647_10008208 | 3300025904 | Bacteria | 7502 |
| 453 | Ga0207647_10018942 | 3300025904 | Bacteria | 4638 |
| 454 | Ga0207685_10069164 | 3300025905 | Bacteria | 1425 |
| 455 | Ga0207699_10079489 | 3300025906 | Bacteria | 2029 |
| 456 | Ga0207645_10000100 | 3300025907 | Bacteria | 64057 |
| 457 | Ga0207645_10062741 | 3300025907 | Bacteria | 2374 |
| 458 | Ga0207643_10000007 | 3300025908 | Bacteria | 171706 |
| 459 | Ga0207705_10000002 | 3300025909 | Bacteria | 2046852 |
| 460 | Ga0207684_10238209 | 3300025910 | Bacteria | 1570 |
| 461 | Ga0207654_10000314 | 3300025911 | Bacteria | 29106 |
| 462 | Ga0207654_10002526 | 3300025911 | Bacteria | 9289 |
| 463 | Ga0207654_10004616 | 3300025911 | Bacteria | 6953 |
| 464 | Ga0207654_10033564 | 3300025911 | Bacteria | 2846 |
| 465 | Ga0207707_10002308 | 3300025912 | Bacteria | 17195 |
| 466 | Ga0207707_10003553 | 3300025912 | Bacteria | 13808 |
| 467 | Ga0207707_10012718 | 3300025912 | Bacteria | 7316 |
| 468 | Ga0207695_10000062 | 3300025913 | Bacteria | 351979 |
| 469 | Ga0207695_10000497 | 3300025913 | Bacteria | 83894 |
| 470 | Ga0207695_10140940 | 3300025913 | Bacteria | 2359 |
| 471 | Ga0207695_10199012 | 3300025913 | Bacteria | 1918 |
| 472 | Ga0207671_10002658 | 3300025914 | Bacteria | 18763 |
| 473 | Ga0207671_10011777 | 3300025914 | Bacteria | 7082 |
| 474 | Ga0207671_10040838 | 3300025914 | Bacteria | 3433 |
| 475 | Ga0207671_10278907 | 3300025914 | Bacteria | 1318 |
| 476 | Ga0207693_10003057 | 3300025915 | Bacteria | 14445 |
| 477 | Ga0207693_10029113 | 3300025915 | Bacteria | 4365 |
| 478 | Ga0207663_10032113 | 3300025916 | Bacteria | 3114 |
| 479 | Ga0207660_10000041 | 3300025917 | Bacteria | 63485 |
| 480 | Ga0207660_10026737 | 3300025917 | Bacteria | 3932 |
| 481 | Ga0207660_10207541 | 3300025917 | Bacteria | 1533 |
| 482 | Ga0207662_10000282 | 3300025918 | Bacteria | 23540 |
| 483 | Ga0207662_10025433 | 3300025918 | Bacteria | 3409 |
| 484 | Ga0207662_10131399 | 3300025918 | Bacteria | 1579 |
| 485 | Ga0207657_10000519 | 3300025919 | Bacteria | 40709 |
| 486 | Ga0207657_10003933 | 3300025919 | Bacteria | 15773 |
| 487 | Ga0207657_10018028 | 3300025919 | Bacteria | 6753 |
| 488 | Ga0207657_10031886 | 3300025919 | Bacteria | 4766 |
| 489 | Ga0207657_10060032 | 3300025919 | Bacteria | 3265 |
| 490 | Ga0207657_10077974 | 3300025919 | Bacteria | 2791 |
| 491 | Ga0207657_10108134 | 3300025919 | Bacteria | 2299 |
| 492 | Ga0207657_10114073 | 3300025919 | Bacteria | 2229 |
| 493 | Ga0207657_10200495 | 3300025919 | Bacteria | 1605 |
| 494 | Ga0207649_10002204 | 3300025920 | Bacteria | 11011 |
| 495 | Ga0207649_10120515 | 3300025920 | Bacteria | 1768 |
| 496 | Ga0207652_10012613 | 3300025921 | Bacteria | 6830 |
| 497 | Ga0207681_10000100 | 3300025923 | Bacteria | 72913 |
| 498 | Ga0207694_10000571 | 3300025924 | Bacteria | 33435 |
| 499 | Ga0207694_10037389 | 3300025924 | Bacteria | 3729 |
| 500 | Ga0207694_10215738 | 3300025924 | Bacteria | 1564 |
| 501 | Ga0207694_10366372 | 3300025924 | Bacteria | 1195 |
| 502 | Ga0207650_10019786 | 3300025925 | Bacteria | 4736 |
| 503 | Ga0207659_10000044 | 3300025926 | Bacteria | 88759 |
| 504 | Ga0207687_10000072 | 3300025927 | Bacteria | 76222 |
| 505 | Ga0207687_10012004 | 3300025927 | Bacteria | 5666 |
| 506 | Ga0207687_10053669 | 3300025927 | Bacteria | 2817 |
| 507 | Ga0207687_10176880 | 3300025927 | Bacteria | 1650 |
| 508 | Ga0207687_10213845 | 3300025927 | Bacteria | 1514 |
| 509 | Ga0207687_10351026 | 3300025927 | Bacteria | 1202 |
| 510 | Ga0207700_10008381 | 3300025928 | Bacteria | 6400 |
| 511 | Ga0207700_10017558 | 3300025928 | Bacteria | 4784 |
| 512 | Ga0207700_10196813 | 3300025928 | Bacteria | 1696 |
| 513 | Ga0207700_10208464 | 3300025928 | Bacteria | 1651 |
| 514 | Ga0207664_10018577 | 3300025929 | Bacteria | 5122 |
| 515 | Ga0207644_10001432 | 3300025931 | Bacteria | 15366 |
| 516 | Ga0207644_10013238 | 3300025931 | Bacteria | 5495 |
| 517 | Ga0207690_10000140 | 3300025932 | Bacteria | 58923 |
| 518 | Ga0207690_10075849 | 3300025932 | Bacteria | 2333 |
| 519 | Ga0207706_10001913 | 3300025933 | Bacteria | 20445 |
| 520 | Ga0207706_10003180 | 3300025933 | Bacteria | 15778 |
| 521 | Ga0207706_10031592 | 3300025933 | Bacteria | 4717 |
| 522 | Ga0207706_10121098 | 3300025933 | Bacteria | 2301 |
| 523 | Ga0207706_10126629 | 3300025933 | Bacteria | 2246 |
| 524 | Ga0207706_10161971 | 3300025933 | Bacteria | 1966 |
| 525 | Ga0207706_10261639 | 3300025933 | Bacteria | 1510 |
| 526 | Ga0207686_10000448 | 3300025934 | Bacteria | 27388 |
| 527 | Ga0207686_10115276 | 3300025934 | Bacteria | 1819 |
| 528 | Ga0207709_10000154 | 3300025935 | Bacteria | 93456 |
| 529 | Ga0207709_10127415 | 3300025935 | Bacteria | 1729 |
| 530 | Ga0207670_10000444 | 3300025936 | Bacteria | 23206 |
| 531 | Ga0207670_10156746 | 3300025936 | Bacteria | 1696 |
| 532 | Ga0207670_10324460 | 3300025936 | Bacteria | 1212 |
| 533 | Ga0207669_10000176 | 3300025937 | Bacteria | 29979 |
| 534 | Ga0207669_10014566 | 3300025937 | Bacteria | 3945 |
| 535 | Ga0207704_10000086 | 3300025938 | Bacteria | 54866 |
| 536 | Ga0207704_10030558 | 3300025938 | Bacteria | 3021 |
| 537 | Ga0207665_10000666 | 3300025939 | Bacteria | 23108 |
| 538 | Ga0207665_10073614 | 3300025939 | Bacteria | 2337 |
| 539 | Ga0207665_10362529 | 3300025939 | Bacteria | 1096 |
| 540 | Ga0207691_10000214 | 3300025940 | Bacteria | 56205 |
| 541 | Ga0207691_10156266 | 3300025940 | Bacteria | 2003 |
| 542 | Ga0207711_10001773 | 3300025941 | Bacteria | 19760 |
| 543 | Ga0207711_10012916 | 3300025941 | Bacteria | 6936 |
| 544 | Ga0207711_10285779 | 3300025941 | Bacteria | 1520 |
| 545 | Ga0207711_10300262 | 3300025941 | Bacteria | 1481 |
| 546 | Ga0207689_10000366 | 3300025942 | Bacteria | 42711 |
| 547 | Ga0207689_10018957 | 3300025942 | Bacteria | 5803 |
| 548 | Ga0207689_10038482 | 3300025942 | Bacteria | 3961 |
| 549 | Ga0207661_10000087 | 3300025944 | Bacteria | 63263 |
| 550 | Ga0207661_10001002 | 3300025944 | Bacteria | 18644 |
| 551 | Ga0207661_10107424 | 3300025944 | Bacteria | 2354 |
| 552 | Ga0207661_10151138 | 3300025944 | Bacteria | 2007 |
| 553 | Ga0207661_10245344 | 3300025944 | Bacteria | 1590 |
| 554 | Ga0207679_10000029 | 3300025945 | Bacteria | 183002 |
| 555 | Ga0207679_10149531 | 3300025945 | Bacteria | 1899 |
| 556 | Ga0207667_10007625 | 3300025949 | Bacteria | 12967 |
| 557 | Ga0207667_10017824 | 3300025949 | Bacteria | 7983 |
| 558 | Ga0207667_10032520 | 3300025949 | Bacteria | 5619 |
| 559 | Ga0207667_10034403 | 3300025949 | Bacteria | 5441 |
| 560 | Ga0207667_10085886 | 3300025949 | Bacteria | 3257 |
| 561 | Ga0207651_10000264 | 3300025960 | Bacteria | 22299 |
| 562 | Ga0207651_10068056 | 3300025960 | Bacteria | 2509 |
| 563 | Ga0207651_10149237 | 3300025960 | Bacteria | 1817 |
| 564 | Ga0207712_10000129 | 3300025961 | Bacteria | 79246 |
| 565 | Ga0207712_10066481 | 3300025961 | Bacteria | 2577 |
| 566 | Ga0207712_10072890 | 3300025961 | Bacteria | 2475 |
| 567 | Ga0207668_10000100 | 3300025972 | Bacteria | 60574 |
| 568 | Ga0207668_10065341 | 3300025972 | Bacteria | 2574 |
| 569 | Ga0207640_10311113 | 3300025981 | Bacteria | 1250 |
| 570 | Ga0207658_10020786 | 3300025986 | Bacteria | 4547 |
| 571 | Ga0207658_10039104 | 3300025986 | Bacteria | 3422 |
| 572 | Ga0207658_10187780 | 3300025986 | Bacteria | 1715 |
| 573 | Ga0207677_10004458 | 3300026023 | Bacteria | 7518 |
| 574 | Ga0207677_10059396 | 3300026023 | Bacteria | 2637 |
| 575 | Ga0207703_10127623 | 3300026035 | Bacteria | 2192 |
| 576 | Ga0207703_10411496 | 3300026035 | Bacteria | 1257 |
| 577 | Ga0207639_10002204 | 3300026041 | Bacteria | 13124 |
| 578 | Ga0207639_10025640 | 3300026041 | Bacteria | 4276 |
| 579 | Ga0207639_10329451 | 3300026041 | Bacteria | 1358 |
| 580 | Ga0207678_10002814 | 3300026067 | Bacteria | 15778 |
| 581 | Ga0207678_10005074 | 3300026067 | Bacteria | 11807 |
| 582 | Ga0207678_10023123 | 3300026067 | Bacteria | 5439 |
| 583 | Ga0207678_10024197 | 3300026067 | Bacteria | 5305 |
| 584 | Ga0207708_10001802 | 3300026075 | Bacteria | 15778 |
| 585 | Ga0207708_10002366 | 3300026075 | Bacteria | 13852 |
| 586 | Ga0207708_10022517 | 3300026075 | Bacteria | 4759 |
| 587 | Ga0207708_10054454 | 3300026075 | Bacteria | 3050 |
| 588 | Ga0207702_10000003 | 3300026078 | Bacteria | 434196 |
| 589 | Ga0207702_10000041 | 3300026078 | Bacteria | 150754 |
| 590 | Ga0207702_10001819 | 3300026078 | Bacteria | 20980 |
| 591 | Ga0207702_10042079 | 3300026078 | Bacteria | 3831 |
| 592 | Ga0207702_10167231 | 3300026078 | Bacteria | 2013 |
| 593 | Ga0207702_10309965 | 3300026078 | Bacteria | 1500 |
| 594 | Ga0207641_10000476 | 3300026088 | Bacteria | 45413 |
| 595 | Ga0207641_10068621 | 3300026088 | Bacteria | 3040 |
| 596 | Ga0207641_10353218 | 3300026088 | Bacteria | 1402 |
| 597 | Ga0207648_10000072 | 3300026089 | Bacteria | 94957 |
| 598 | Ga0207648_10051806 | 3300026089 | Bacteria | 3588 |
| 599 | Ga0207648_10087749 | 3300026089 | Bacteria | 2715 |
| 600 | Ga0207676_10000512 | 3300026095 | Bacteria | 32630 |
| 601 | Ga0207676_10028618 | 3300026095 | Bacteria | 4164 |
| 602 | Ga0207676_10234937 | 3300026095 | Bacteria | 1641 |
| 603 | Ga0207674_10000697 | 3300026116 | Bacteria | 43729 |
| 604 | Ga0207674_10005049 | 3300026116 | Bacteria | 15751 |
| 605 | Ga0207674_10007537 | 3300026116 | Bacteria | 12679 |
| 606 | Ga0207674_10011489 | 3300026116 | Bacteria | 9946 |
| 607 | Ga0207674_10049678 | 3300026116 | Bacteria | 4288 |
| 608 | Ga0207674_10164655 | 3300026116 | Bacteria | 2171 |
| 609 | Ga0207675_100002384 | 3300026118 | Bacteria | 18614 |
| 610 | Ga0207675_100023832 | 3300026118 | Bacteria | 5692 |
| 611 | Ga0207675_100241327 | 3300026118 | Bacteria | 1746 |
| 612 | Ga0207683_10000029 | 3300026121 | Bacteria | 109665 |
| 613 | Ga0207683_10004241 | 3300026121 | Bacteria | 12373 |
| 614 | Ga0207683_10071211 | 3300026121 | Bacteria | 3073 |
| 615 | Ga0207683_10283169 | 3300026121 | Bacteria | 1515 |
| 616 | Ga0207698_10000523 | 3300026142 | Bacteria | 22323 |
| 617 | Ga0207698_10065911 | 3300026142 | Bacteria | 2848 |
| 618 | Ga0207698_10069482 | 3300026142 | Bacteria | 2785 |
| 619 | Ga0209389_1000004 | 3300027296 | Bacteria | 263759 |
| 620 | Ga0209389_1000023 | 3300027296 | Bacteria | 150730 |
| 621 | Ga0209589_1000006 | 3300027357 | Bacteria | 436292 |
| 622 | Ga0209589_1000010 | 3300027357 | Bacteria | 237657 |
| 623 | Ga0209489_100007 | 3300027361 | Bacteria | 436292 |
| 624 | Ga0209489_100011 | 3300027361 | Bacteria | 244710 |
| 625 | Ga0209489_100295 | 3300027361 | Bacteria | 87273 |
| 626 | Ga0209700_100008 | 3300027363 | Bacteria | 436292 |
| 627 | Ga0209700_100013 | 3300027363 | Bacteria | 341906 |
| 628 | Ga0209967_1003594 | 3300027364 | Bacteria | 2042 |
| 629 | Ga0209179_1000003 | 3300027512 | Bacteria | 121837 |
| 630 | Ga0209179_1006366 | 3300027512 | Bacteria | 1899 |
| 631 | Ga0209588_1023972 | 3300027671 | Bacteria | 1926 |
| 632 | Ga0209971_1011541 | 3300027682 | Bacteria | 2093 |
| 633 | Ga0209971_1016573 | 3300027682 | Bacteria | 1747 |
| 634 | Ga0209966_1003460 | 3300027695 | Bacteria | 2655 |
| 635 | Ga0209998_10001339 | 3300027717 | Bacteria | 5989 |
| 636 | Ga0209998_10001839 | 3300027717 | Bacteria | 5030 |
| 637 | Ga0209813_10020926 | 3300027866 | Bacteria | 1835 |
| 638 | Ga0209974_10002749 | 3300027876 | Bacteria | 6378 |
| 639 | Ga0207428_10000100 | 3300027907 | Bacteria | 119495 |
| 640 | Ga0207428_10000115 | 3300027907 | Bacteria | 109072 |
| 641 | Ga0207428_10000228 | 3300027907 | Bacteria | 77812 |
| 642 | Ga0207428_10099010 | 3300027907 | Bacteria | 2255 |
| 643 | Ga0268266_10017979 | 3300028379 | Bacteria | 6027 |
| 644 | Ga0268266_10034519 | 3300028379 | Bacteria | 4302 |
| 645 | Ga0268266_10193385 | 3300028379 | Bacteria | 1858 |
| 646 | Ga0268266_10334645 | 3300028379 | Bacteria | 1420 |
| 647 | Ga0268266_10344906 | 3300028379 | Bacteria | 1398 |
| 648 | Ga0268265_10001240 | 3300028380 | Bacteria | 22083 |
| 649 | Ga0268265_10369761 | 3300028380 | Bacteria | 1315 |
| 650 | Ga0268264_10000093 | 3300028381 | Bacteria | 232057 |
| 651 | Ga0268264_10006796 | 3300028381 | Bacteria | 9610 |
| 652 | Ga0268264_10153478 | 3300028381 | Bacteria | 2067 |
| 653 | Ga0268264_10410743 | 3300028381 | Bacteria | 1303 |
| 654 | Ga0265337_1000401 | 3300028556 | Bacteria | 23329 |
| 655 | Ga0265326_10014656 | 3300028558 | Bacteria | 2283 |
| 656 | Ga0265319_1020513 | 3300028563 | Bacteria | 2448 |
| 657 | Ga0265334_10014240 | 3300028573 | Bacteria | 3315 |
| 658 | Ga0265334_10025525 | 3300028573 | Bacteria | 2391 |
| 659 | Ga0265323_10001197 | 3300028653 | Bacteria | 13220 |
| 660 | Ga0265336_10001290 | 3300028666 | Bacteria | 11766 |
| 661 | Ga0265338_10000328 | 3300028800 | Bacteria | 86546 |
| 662 | Ga0265324_10012383 | 3300029957 | Bacteria | 3216 |
| 663 | Ga0307511_10073605 | 3300030521 | Bacteria | 2469 |
| 664 | Ga0265332_10074214 | 3300031238 | Bacteria | 1447 |
| 665 | Ga0265325_10014793 | 3300031241 | Bacteria | 4403 |
| 666 | Ga0265340_10033136 | 3300031247 | Bacteria | 2574 |
| 667 | Ga0265340_10053977 | 3300031247 | Bacteria | 1939 |
| 668 | Ga0265339_10015453 | 3300031249 | Bacteria | 4574 |
| 669 | Ga0265331_10057063 | 3300031250 | Bacteria | 1853 |
| 670 | Ga0265316_10041124 | 3300031344 | Bacteria | 3702 |
| 671 | Ga0307509_10223657 | 3300031507 | Bacteria | 1692 |
| 672 | Ga0307408_100050931 | 3300031548 | Bacteria | 2980 |
| 673 | Ga0307408_100057956 | 3300031548 | Bacteria | 2814 |
| 674 | Ga0307408_100111005 | 3300031548 | Bacteria | 2106 |
| 675 | Ga0307408_100169313 | 3300031548 | Bacteria | 1743 |
| 676 | Ga0307508_10019334 | 3300031616 | Bacteria | 6191 |
| 677 | Ga0307508_10114972 | 3300031616 | Bacteria | 2291 |
| 678 | Ga0265314_10098892 | 3300031711 | Bacteria | 1881 |
| 679 | Ga0307516_10014917 | 3300031730 | Bacteria | 8197 |
| 680 | Ga0307516_10018834 | 3300031730 | Bacteria | 7166 |
| 681 | Ga0307516_10121810 | 3300031730 | Bacteria | 2397 |
| 682 | Ga0307516_10136943 | 3300031730 | Bacteria | 2222 |
| 683 | Ga0307405_10057297 | 3300031731 | Bacteria | 2447 |
| 684 | Ga0307413_10021873 | 3300031824 | Bacteria | 3433 |
| 685 | Ga0307413_10049793 | 3300031824 | Bacteria | 2513 |
| 686 | Ga0307410_10051828 | 3300031852 | Bacteria | 2768 |
| 687 | Ga0307406_10031430 | 3300031901 | Bacteria | 3233 |
| 688 | Ga0307406_10045124 | 3300031901 | Bacteria | 2765 |
| 689 | Ga0307407_10023000 | 3300031903 | Bacteria | 3245 |
| 690 | Ga0307407_10304918 | 3300031903 | Bacteria | 1112 |
| 691 | Ga0307412_10090894 | 3300031911 | Bacteria | 2135 |
| 692 | Ga0307412_10125753 | 3300031911 | Bacteria | 1854 |
| 693 | Ga0307409_100055014 | 3300031995 | Bacteria | 3069 |
| 694 | Ga0307409_100065630 | 3300031995 | Bacteria | 2857 |
| 695 | Ga0307409_100287308 | 3300031995 | Bacteria | 1523 |
| 696 | Ga0307416_100020106 | 3300032002 | Bacteria | 4755 |
| 697 | Ga0307416_100063313 | 3300032002 | Bacteria | 3028 |
| 698 | Ga0307416_100502261 | 3300032002 | Bacteria | 1277 |
| 699 | Ga0307414_10012904 | 3300032004 | Bacteria | 4959 |
| 700 | Ga0307414_10014760 | 3300032004 | Bacteria | 4695 |
| 701 | Ga0307414_10151270 | 3300032004 | Bacteria | 1831 |
| 702 | Ga0307414_10309643 | 3300032004 | Bacteria | 1340 |
| 703 | Ga0307411_10018956 | 3300032005 | Bacteria | 3961 |
| 704 | Ga0307411_10024990 | 3300032005 | Bacteria | 3570 |
| 705 | Ga0307411_10241280 | 3300032005 | Bacteria | 1415 |
| 706 | Ga0307415_100048009 | 3300032126 | Bacteria | 2878 |
| 707 | Ga0307415_100065146 | 3300032126 | Bacteria | 2538 |
| 708 | Ga0307510_10039371 | 3300033180 | Bacteria | 5208 |
| 709 | Ga0307510_10104983 | 3300033180 | Bacteria | 2596 |
| 710 | Ga0307510_10190883 | 3300033180 | Bacteria | 1597 |
| 711 | Ga0315911_1000010 | 3300033442 | Bacteria | 322197 |
| 712 | Ga0373930_0001541 | 3300034816 | Bacteria | 3451 |
| 713 | Ga0373930_0009273 | 3300034816 | Bacteria | 1739 |
| 714 | Ga0373948_0000346 | 3300034817 | Bacteria | 5681 |
| 715 | Ga0373950_0000453 | 3300034818 | Bacteria | 5029 |
| 716 | Ga0373950_0001749 | 3300034818 | Bacteria | 2883 |
| 717 | Ga0373950_0002953 | 3300034818 | Bacteria | 2396 |
| 718 | Ga0373959_0001859 | 3300034820 | Bacteria | 3367 |
| 719 | Ga0373938_0000565 | 3300034957 | Bacteria | 5981 |
| 720 | Ga0373938_0000859 | 3300034957 | Bacteria | 4895 |
| 721 | Ga0373938_0010089 | 3300034957 | Bacteria | 1726 |
| 722 | Ga0373926_0014990 | 3300035083 | Bacteria | 2640 |
| 723 | Ga0373928_0000893 | 3300035084 | Bacteria | 5857 |
| 724 | Ga0373928_0001974 | 3300035084 | Bacteria | 3998 |
| 725 | Ga0373929_0000957 | 3300035085 | Bacteria | 5608 |
| 726 | Ga0373929_0004742 | 3300035085 | Bacteria | 2437 |
| 727 | Ga0373944_0009683 | 3300035089 | Bacteria | 2617 |
| 728 | Ga0373944_0058790 | 3300035089 | Bacteria | 1229 |
| 729 | Ga0373949_0000284 | 3300035090 | Bacteria | 18664 |
| 730 | Ga0373949_0001993 | 3300035090 | Bacteria | 5459 |
| 731 | Ga0373951_0000560 | 3300035091 | Bacteria | 10396 |
| 732 | Ga0373951_0001866 | 3300035091 | Bacteria | 5430 |
| 733 | Ga0373951_0005206 | 3300035091 | Bacteria | 3035 |
| 734 | Ga0373951_0012273 | 3300035091 | Bacteria | 1927 |
| 735 | Ga0373952_0000135 | 3300035092 | Bacteria | 10680 |
| 736 | Ga0373952_0001907 | 3300035092 | Bacteria | 3782 |
| 737 | Ga0373923_0025425 | 3300035111 | Bacteria | 2346 |
| 738 | Ga0373932_0000172 | 3300035112 | Bacteria | 18943 |
| 739 | Ga0373936_0028869 | 3300035113 | Bacteria | 2182 |
| 740 | Ga0373939_0001475 | 3300035114 | Bacteria | 5702 |
| 741 | Ga0373939_0001827 | 3300035114 | Bacteria | 5121 |
| 742 | Ga0373941_0000081 | 3300035115 | Bacteria | 15592 |
| 743 | Ga0373941_0003306 | 3300035115 | Bacteria | 3640 |
| 744 | Ga0373941_0068864 | 3300035115 | Bacteria | 1170 |
| 745 | Ga0373945_0055460 | 3300035116 | Bacteria | 1467 |
| 746 | Ga0373953_0010918 | 3300035117 | Bacteria | 3174 |
| 747 | Ga0373954_0001018 | 3300035118 | Bacteria | 11098 |
| 748 | Ga0373954_0032596 | 3300035118 | Bacteria | 2409 |
| 749 | Ga0373954_0050234 | 3300035118 | Bacteria | 1957 |
| 750 | Ga0373956_0006210 | 3300035119 | Bacteria | 4781 |
| 751 | Ga0373956_0030833 | 3300035119 | Bacteria | 2346 |
| 752 | Ga0373960_0001722 | 3300035121 | Bacteria | 4895 |
| 753 | Ga0373960_0002628 | 3300035121 | Bacteria | 4063 |
| 754 | Ga0373960_0061296 | 3300035121 | Bacteria | 1142 |
| 755 | Ga0373943_0002389 | 3300035170 | Bacteria | 8514 |
| 756 | Ga0373943_0002637 | 3300035170 | Bacteria | 8160 |
| 757 | Ga0373943_0009573 | 3300035170 | Bacteria | 4344 |
| 758 | Ga0373946_0001719 | 3300035171 | Bacteria | 7639 |
| 759 | Ga0373946_0042235 | 3300035171 | Bacteria | 1873 |
| 760 | Ga0373946_0051785 | 3300035171 | Bacteria | 1719 |
| 761 | Ga0373955_0000505 | 3300035172 | Bacteria | 16570 |
| 762 | Ga0373955_0008965 | 3300035172 | Bacteria | 4669 |
| 763 | Ga0373955_0022067 | 3300035172 | Bacteria | 3223 |
| 764 | Ga0373955_0085117 | 3300035172 | Bacteria | 1794 |
| 765 | Ga0373955_0110363 | 3300035172 | Bacteria | 1590 |
| 766 | Ga0373942_0000173 | 3300035207 | Bacteria | 16049 |
| 767 | Ga0373942_0001874 | 3300035207 | Bacteria | 5278 |
| 768 | Ga0373961_0000196 | 3300035241 | Bacteria | 28662 |
| 769 | Ga0373962_0000151 | 3300035242 | Bacteria | 14355 |
| 770 | Ga0373924_0002965 | 3300035410 | Bacteria | 5768 |
| 771 | Ga0373924_0006538 | 3300035410 | Bacteria | 4180 |
| 772 | Ga0373924_0015542 | 3300035410 | Bacteria | 2896 |
| 773 | Ga0373924_0023993 | 3300035410 | Bacteria | 2399 |
| 774 | Ga0373931_0001253 | 3300035691 | Bacteria | 10836 |
| 775 | Ga0373931_0009230 | 3300035691 | Bacteria | 4710 |
| 776 | Ga0373931_0046680 | 3300035691 | Bacteria | 2290 |
| 777 | Ga0373931_0057582 | 3300035691 | Bacteria | 2084 |
| 778 | Ga0373935_0000383 | 3300035692 | Bacteria | 22734 |
| 779 | Ga0373935_0004350 | 3300035692 | Bacteria | 8312 |
| 780 | Ga0373935_0040168 | 3300035692 | Bacteria | 2935 |
| 781 | Ga0373935_0079441 | 3300035692 | Bacteria | 2129 |
| 782 | Ga0373935_0093548 | 3300035692 | Bacteria | 1971 |
| 783 | Ga0373935_0208501 | 3300035692 | Bacteria | 1353 |
| 784 | Ga0373927_0000339 | 3300035695 | Bacteria | 36731 |
| 785 | Ga0373927_0020380 | 3300035695 | Bacteria | 4348 |
| 786 | Ga0373927_0027756 | 3300035695 | Bacteria | 3696 |
| 787 | Ga0373927_0034997 | 3300035695 | Bacteria | 3266 |
| 788 | Ga0373927_0075379 | 3300035695 | Bacteria | 2184 |
| 789 | Ga0373933_0000697 | 3300035724 | Bacteria | 20663 |
| 790 | Ga0373933_0004299 | 3300035724 | Bacteria | 7822 |
| 791 | Ga0373933_0007968 | 3300035724 | Bacteria | 5778 |
| 792 | Ga0373933_0084401 | 3300035724 | Bacteria | 1951 |
| 793 | Ga0373933_0099221 | 3300035724 | Bacteria | 1805 |
| 794 | Ga0373947_0000623 | 3300035725 | Bacteria | 20940 |
| 795 | Ga0373947_0005753 | 3300035725 | Bacteria | 7230 |
| 796 | Ga0373947_0015465 | 3300035725 | Bacteria | 4381 |
| 797 | Ga0373947_0162450 | 3300035725 | Bacteria | 1445 |
| 798 | Ga0373937_0023630 | 3300036401 | Bacteria | 5538 |
| 799 | Ga0373937_0033607 | 3300036401 | Bacteria | 4659 |
| 800 | Ga0373937_0053653 | 3300036401 | Bacteria | 3697 |
| 801 | Ga0373937_0160918 | 3300036401 | Bacteria | 2104 |
| 802 | Ga0373925_0025049 | 3300037068 | Bacteria | 4358 |
| 803 | Ga0373925_0025122 | 3300037068 | Bacteria | 4350 |
| 804 | Ga0373925_0047978 | 3300037068 | Bacteria | 3181 |
| 805 | Ga0373925_0058161 | 3300037068 | Bacteria | 2898 |
| 806 | Ga0373925_0099769 | 3300037068 | Bacteria | 2230 |
| 807 | Ga0373925_0106024 | 3300037068 | Bacteria | 2166 |
| 808 | Ga0395900_0007473 | 3300037418 | Bacteria | 11297 |
| 809 | Ga0395900_0243302 | 3300037418 | Bacteria | 1804 |
| 810 | Ga0395900_0339552 | 3300037418 | Bacteria | 1478 |
| 811 | Ga0395898_0022639 | 3300037466 | Bacteria | 6363 |
| 812 | Ga0395898_0053860 | 3300037466 | Bacteria | 3928 |
| 813 | Ga0395898_0192273 | 3300037466 | Bacteria | 1950 |
| 814 | Ga0395905_0001381 | 3300037471 | Bacteria | 29391 |
| 815 | Ga0395905_0001880 | 3300037471 | Bacteria | 24197 |
| 816 | Ga0395905_0349531 | 3300037471 | Bacteria | 1370 |
| 817 | Ga0395901_0072458 | 3300038443 | Bacteria | 3591 |
| 818 | Ga0395901_0250401 | 3300038443 | Bacteria | 1846 |
| 819 | Ga0395901_0726349 | 3300038443 | Bacteria | 988 |
| 820 | Ga0436365_0007777 | 3300039437 | Bacteria | 4023 |
| 821 | Ga0436365_1219354 | 3300039437 | Bacteria | 6238 |
| 822 | Ga0436365_1283193 | 3300039437 | Bacteria | 6724 |
| 823 | Ga0436365_1496755 | 3300039437 | Bacteria | 1956 |
| 824 | Ga0436365_1754300 | 3300039437 | Bacteria | 1729 |
| 825 | Ga0436360_0598897 | 3300039438 | Bacteria | 1771 |
| 826 | Ga0436360_1142640 | 3300039438 | Bacteria | 1816 |
| 827 | Ga0436363_0616687 | 3300039450 | Bacteria | 4066 |
| 828 | Ga0451793_0847063 | 3300041452 | Bacteria | 1576 |
| 829 | Ga0439432_017279 | 3300042006 | Bacteria | 2422 |
| 830 | Ga0439435_0049467 | 3300042436 | Bacteria | 1200 |
| 831 | Ga0451577_0025411 | 3300042876 | Bacteria | 5374 |
| 832 | Ga0466969_0058844 | 3300044656 | Bacteria | 1869 |
| 833 | Ga0466969_0107205 | 3300044656 | Bacteria | 1310 |
| 834 | Ga0466966_0015210 | 3300044684 | Bacteria | 5090 |
| 835 | Ga0466961_0000149 | 3300044693 | Bacteria | 47561 |
| 836 | Ga0466964_0175442 | 3300044706 | Bacteria | 1012 |
| 837 | Ga0453684_0235668 | 3300044712 | Bacteria | 2110 |
| 838 | Ga0466960_0152315 | 3300044901 | Bacteria | 1236 |
| 839 | Ga0466959_0036290 | 3300045049 | Bacteria | 3642 |
| 840 | Ga0451576_0184521 | 3300045051 | Bacteria | 2178 |
| 841 | Ga0466958_0246474 | 3300045836 | Bacteria | 1142 |
| 842 | Ga0466967_0015775 | 3300045976 | Bacteria | 5935 |
| 843 | Ga0466967_0072058 | 3300045976 | Bacteria | 3095 |
| 844 | Ga0466967_0224106 | 3300045976 | Bacteria | 1788 |
| 845 | Ga0495617_028012 | 3300046452 | Bacteria | 1895 |
| 846 | Ga0495627_053630 | 3300046453 | Bacteria | 1207 |
| 847 | Ga0495592_0001464 | 3300046454 | Bacteria | 16415 |
| 848 | Ga0495592_0051294 | 3300046454 | Bacteria | 3064 |
| 849 | Ga0495592_0077523 | 3300046454 | Bacteria | 2409 |
| 850 | Ga0495592_0120593 | 3300046454 | Bacteria | 1845 |
| 851 | Ga0495603_0001921 | 3300046455 | Bacteria | 12253 |
| 852 | Ga0495603_0025531 | 3300046455 | Bacteria | 3573 |
| 853 | Ga0495603_0025682 | 3300046455 | Bacteria | 3561 |
| 854 | Ga0495603_0077594 | 3300046455 | Bacteria | 1948 |
| 855 | Ga0495603_0086816 | 3300046455 | Bacteria | 1831 |
| 856 | Ga0495603_0199553 | 3300046455 | Bacteria | 1156 |
| 857 | Ga0495590_0080298 | 3300046457 | Bacteria | 1148 |
| 858 | Ga0495629_0000280 | 3300046459 | Bacteria | 44080 |
| 859 | Ga0495629_0008419 | 3300046459 | Bacteria | 7590 |
| 860 | Ga0495629_0019114 | 3300046459 | Bacteria | 4899 |
| 861 | Ga0495629_0047757 | 3300046459 | Bacteria | 3002 |
| 862 | Ga0495629_0107607 | 3300046459 | Bacteria | 1945 |
| 863 | Ga0495629_0110151 | 3300046459 | Bacteria | 1919 |
| 864 | Ga0495638_0000011 | 3300046460 | Bacteria | 442453 |
| 865 | Ga0495638_0088100 | 3300046460 | Bacteria | 1874 |
| 866 | Ga0495638_0107859 | 3300046460 | Bacteria | 1657 |
| 867 | Ga0495638_0160267 | 3300046460 | Bacteria | 1298 |
| 868 | Ga0495641_0005456 | 3300046461 | Bacteria | 8588 |
| 869 | Ga0495641_0044804 | 3300046461 | Bacteria | 2039 |
| 870 | Ga0495651_0001797 | 3300046462 | Bacteria | 16534 |
| 871 | Ga0495651_0005170 | 3300046462 | Bacteria | 9954 |
| 872 | Ga0495651_0026260 | 3300046462 | Bacteria | 4536 |
| 873 | Ga0495653_0016213 | 3300046463 | Bacteria | 6070 |
| 874 | Ga0495653_0047920 | 3300046463 | Bacteria | 3302 |
| 875 | Ga0495653_0103650 | 3300046463 | Bacteria | 2057 |
| 876 | Ga0495653_0109734 | 3300046463 | Bacteria | 1985 |
| 877 | Ga0495653_0121798 | 3300046463 | Bacteria | 1858 |
| 878 | Ga0495580_0002106 | 3300046472 | Bacteria | 17464 |
| 879 | Ga0495580_0024266 | 3300046472 | Bacteria | 4443 |
| 880 | Ga0495580_0102356 | 3300046472 | Bacteria | 1991 |
| 881 | Ga0495582_0000839 | 3300046473 | Bacteria | 16987 |
| 882 | Ga0495582_0005522 | 3300046473 | Bacteria | 7041 |
| 883 | Ga0495582_0159580 | 3300046473 | Bacteria | 1282 |
| 884 | Ga0495639_0000198 | 3300046475 | Bacteria | 31609 |
| 885 | Ga0495639_0038346 | 3300046475 | Bacteria | 2152 |
| 886 | Ga0495639_0053169 | 3300046475 | Bacteria | 1845 |
| 887 | Ga0495662_0013305 | 3300046476 | Bacteria | 4004 |
| 888 | Ga0495662_0018057 | 3300046476 | Bacteria | 3412 |
| 889 | Ga0495664_0085178 | 3300046477 | Bacteria | 1897 |
| 890 | Ga0495664_0133072 | 3300046477 | Bacteria | 1506 |
| 891 | Ga0495584_0044126 | 3300046491 | Bacteria | 2250 |
| 892 | Ga0495585_0000974 | 3300046492 | Bacteria | 24017 |
| 893 | Ga0495594_0000484 | 3300046499 | Bacteria | 20276 |
| 894 | Ga0495594_0021206 | 3300046499 | Bacteria | 3467 |
| 895 | Ga0495594_0044111 | 3300046499 | Bacteria | 2445 |
| 896 | Ga0495607_0011320 | 3300046501 | Bacteria | 5946 |
| 897 | Ga0495607_0149737 | 3300046501 | Bacteria | 1195 |
| 898 | Ga0495607_0156032 | 3300046501 | Bacteria | 1164 |
| 899 | Ga0495583_0000242 | 3300046506 | Bacteria | 90367 |
| 900 | Ga0495606_0009928 | 3300046507 | Bacteria | 7971 |
| 901 | Ga0495606_0018301 | 3300046507 | Bacteria | 5260 |
| 902 | Ga0495608_0014611 | 3300046511 | Bacteria | 5447 |
| 903 | Ga0495608_0044163 | 3300046511 | Bacteria | 2974 |
| 904 | Ga0495608_0054453 | 3300046511 | Bacteria | 2644 |
| 905 | Ga0495608_0127866 | 3300046511 | Bacteria | 1627 |
| 906 | Ga0495610_0037940 | 3300046512 | Bacteria | 2448 |
| 907 | Ga0495610_0151874 | 3300046512 | Bacteria | 987 |
| 908 | Ga0495618_0015542 | 3300046514 | Bacteria | 4646 |
| 909 | Ga0495618_0058196 | 3300046514 | Bacteria | 2447 |
| 910 | Ga0495618_0174098 | 3300046514 | Bacteria | 1369 |
| 911 | Ga0495618_0180488 | 3300046514 | Bacteria | 1341 |
| 912 | Ga0495620_0039614 | 3300046515 | Bacteria | 2081 |
| 913 | Ga0495628_0003390 | 3300046516 | Bacteria | 14259 |
| 914 | Ga0495628_0010246 | 3300046516 | Bacteria | 7974 |
| 915 | Ga0495628_0018942 | 3300046516 | Bacteria | 5696 |
| 916 | Ga0495628_0071368 | 3300046516 | Bacteria | 2707 |
| 917 | Ga0495628_0085781 | 3300046516 | Bacteria | 2442 |
| 918 | Ga0495630_0004090 | 3300046517 | Bacteria | 10212 |
| 919 | Ga0495630_0013420 | 3300046517 | Bacteria | 5962 |
| 920 | Ga0495630_0080217 | 3300046517 | Bacteria | 2461 |
| 921 | Ga0495632_0000638 | 3300046519 | Bacteria | 32240 |
| 922 | Ga0495632_0038280 | 3300046519 | Bacteria | 2429 |
| 923 | Ga0495643_0016356 | 3300046522 | Bacteria | 4356 |
| 924 | Ga0495644_0002940 | 3300046523 | Bacteria | 6769 |
| 925 | Ga0495648_0000023 | 3300046524 | Bacteria | 240174 |
| 926 | Ga0495648_0001628 | 3300046524 | Bacteria | 21799 |
| 927 | Ga0495648_0003788 | 3300046524 | Bacteria | 13150 |
| 928 | Ga0495648_0005381 | 3300046524 | Bacteria | 10643 |
| 929 | Ga0495648_0024143 | 3300046524 | Bacteria | 4150 |
| 930 | Ga0495663_0016868 | 3300046525 | Bacteria | 2067 |
| 931 | Ga0495663_0075635 | 3300046525 | Bacteria | 1078 |
| 932 | Ga0495666_0004626 | 3300046526 | Bacteria | 6956 |
| 933 | Ga0495666_0023858 | 3300046526 | Bacteria | 3025 |
| 934 | Ga0495666_0033603 | 3300046526 | Bacteria | 2505 |
| 935 | Ga0495666_0067968 | 3300046526 | Bacteria | 1697 |
| 936 | Ga0495652_0034324 | 3300046529 | Bacteria | 4421 |
| 937 | Ga0495652_0037775 | 3300046529 | Bacteria | 4187 |
| 938 | Ga0495652_0044572 | 3300046529 | Bacteria | 3818 |
| 939 | Ga0495652_0184198 | 3300046529 | Bacteria | 1599 |
| 940 | Ga0495665_0000539 | 3300046531 | Bacteria | 19201 |
| 941 | Ga0495665_0024344 | 3300046531 | Bacteria | 3252 |
| 942 | Ga0495665_0030354 | 3300046531 | Bacteria | 2892 |
| 943 | Ga0495640_0004718 | 3300046533 | Bacteria | 10864 |
| 944 | Ga0495640_0022789 | 3300046533 | Bacteria | 4573 |
| 945 | Ga0495640_0027286 | 3300046533 | Bacteria | 4119 |
| 946 | Ga0495640_0028769 | 3300046533 | Bacteria | 3997 |
| 947 | Ga0495640_0039086 | 3300046533 | Bacteria | 3332 |
| 948 | Ga0495587_0002521 | 3300046536 | Bacteria | 12231 |
| 949 | Ga0495587_0118056 | 3300046536 | Bacteria | 1520 |
| 950 | Ga0495587_0177845 | 3300046536 | Bacteria | 1207 |
| 951 | Ga0495598_0009092 | 3300046537 | Bacteria | 2336 |
| 952 | Ga0495645_0002657 | 3300046543 | Bacteria | 12151 |
| 953 | Ga0495645_0015582 | 3300046543 | Bacteria | 5408 |
| 954 | Ga0495645_0021112 | 3300046543 | Bacteria | 4706 |
| 955 | Ga0495645_0031265 | 3300046543 | Bacteria | 3878 |
| 956 | Ga0495645_0226226 | 3300046543 | Bacteria | 1255 |
| 957 | Ga0495622_0005155 | 3300046557 | Bacteria | 6060 |
| 958 | Ga0495622_0036333 | 3300046557 | Bacteria | 2297 |
| 959 | Ga0495622_0043754 | 3300046557 | Bacteria | 2081 |
| 960 | Ga0495622_0152561 | 3300046557 | Bacteria | 1045 |
| 961 | Ga0495633_0002331 | 3300046558 | Bacteria | 13493 |
| 962 | Ga0495633_0005929 | 3300046558 | Bacteria | 7349 |
| 963 | Ga0495667_0002603 | 3300046559 | Bacteria | 12042 |
| 964 | Ga0495667_0009295 | 3300046559 | Bacteria | 6666 |
| 965 | Ga0495667_0090210 | 3300046559 | Bacteria | 1986 |
| 966 | Ga0495656_0000276 | 3300046615 | Bacteria | 18021 |
| 967 | Ga0495668_0029006 | 3300046616 | Bacteria | 3127 |
| 968 | Ga0495668_0125744 | 3300046616 | Bacteria | 1403 |
| 969 | Ga0495634_0000792 | 3300046642 | Bacteria | 30599 |
| 970 | Ga0495634_0024899 | 3300046642 | Bacteria | 4195 |
| 971 | Ga0495634_0028175 | 3300046642 | Bacteria | 3901 |
| 972 | Ga0495634_0062371 | 3300046642 | Bacteria | 2475 |
| 973 | Ga0495611_0004478 | 3300046648 | Bacteria | 6049 |
| 974 | Ga0495611_0084899 | 3300046648 | Bacteria | 1460 |
| 975 | Ga0495625_0055998 | 3300046660 | Bacteria | 2809 |
| 976 | Ga0495625_0106634 | 3300046660 | Bacteria | 1918 |
| 977 | Ga0495635_0000534 | 3300046663 | Bacteria | 24127 |
| 978 | Ga0495635_0002309 | 3300046663 | Bacteria | 12963 |
| 979 | Ga0495635_0012601 | 3300046663 | Bacteria | 5929 |
| 980 | Ga0495635_0022557 | 3300046663 | Bacteria | 4386 |
| 981 | Ga0495635_0080012 | 3300046663 | Bacteria | 2236 |
| 982 | Ga0495635_0104329 | 3300046663 | Bacteria | 1937 |
| 983 | Ga0495635_0128831 | 3300046663 | Bacteria | 1725 |
| 984 | Ga0495588_0005803 | 3300046674 | Bacteria | 5522 |
| 985 | Ga0495588_0012125 | 3300046674 | Bacteria | 4064 |
| 986 | Ga0495588_0044972 | 3300046674 | Bacteria | 2262 |
| 987 | Ga0495657_0012670 | 3300046675 | Bacteria | 6254 |
| 988 | Ga0495657_0013808 | 3300046675 | Bacteria | 5945 |
| 989 | Ga0495657_0037981 | 3300046675 | Bacteria | 3315 |
| 990 | Ga0495599_0011975 | 3300046678 | Bacteria | 5335 |
| 991 | Ga0495599_0023511 | 3300046678 | Bacteria | 3853 |
| 992 | Ga0495599_0056334 | 3300046678 | Bacteria | 2460 |
| 993 | Ga0495599_0098409 | 3300046678 | Bacteria | 1823 |
| 994 | Ga0495599_0199214 | 3300046678 | Bacteria | 1230 |
| 995 | Ga0495599_0237823 | 3300046678 | Bacteria | 1111 |
| 996 | Ga0495623_0013899 | 3300046679 | Bacteria | 5218 |
| 997 | Ga0495623_0061095 | 3300046679 | Bacteria | 2363 |
| 998 | Ga0495623_0089766 | 3300046679 | Bacteria | 1888 |
| 999 | Ga0495646_0006258 | 3300046680 | Bacteria | 7549 |
| 1000 | Ga0495646_0006855 | 3300046680 | Bacteria | 7227 |
| 1001 | Ga0495646_0114495 | 3300046680 | Bacteria | 1532 |
| 1002 | Ga0495647_0001093 | 3300046681 | Bacteria | 8269 |
| 1003 | Ga0495647_0003761 | 3300046681 | Bacteria | 4880 |
| 1004 | Ga0495647_0004239 | 3300046681 | Bacteria | 4644 |
| 1005 | Ga0495647_0065352 | 3300046681 | Bacteria | 1444 |
| 1006 | Ga0495658_0001282 | 3300046683 | Bacteria | 13170 |
| 1007 | Ga0495658_0001614 | 3300046683 | Bacteria | 11745 |
| 1008 | Ga0495658_0012893 | 3300046683 | Bacteria | 4246 |
| 1009 | Ga0495658_0032622 | 3300046683 | Bacteria | 2845 |
| 1010 | Ga0495658_0041311 | 3300046683 | Bacteria | 2568 |
| 1011 | Ga0495658_0091626 | 3300046683 | Bacteria | 1801 |
| 1012 | Ga0495669_0003692 | 3300046684 | Bacteria | 6299 |
| 1013 | Ga0495613_0018666 | 3300046689 | Bacteria | 5171 |
| 1014 | Ga0495613_0044715 | 3300046689 | Bacteria | 3275 |
| 1015 | Ga0495613_0062257 | 3300046689 | Bacteria | 2731 |
| 1016 | Ga0495613_0244584 | 3300046689 | Bacteria | 1253 |
| 1017 | Ga0495624_0002224 | 3300046690 | Bacteria | 14785 |
| 1018 | Ga0495624_0006348 | 3300046690 | Bacteria | 8396 |
| 1019 | Ga0495624_0031131 | 3300046690 | Bacteria | 3472 |
| 1020 | Ga0495624_0037078 | 3300046690 | Bacteria | 3139 |
| 1021 | Ga0495670_0135398 | 3300046691 | Bacteria | 1286 |
| 1022 | Ga0495671_0000012 | 3300046692 | Bacteria | 358632 |
| 1023 | Ga0495671_0006594 | 3300046692 | Bacteria | 6695 |
| 1024 | Ga0495649_0102017 | 3300046694 | Bacteria | 1524 |
| 1025 | Ga0495600_0001341 | 3300046809 | Bacteria | 13567 |
| 1026 | Ga0495600_0013087 | 3300046809 | Bacteria | 5206 |
| 1027 | Ga0495600_0024809 | 3300046809 | Bacteria | 3860 |
| 1028 | Ga0495660_0078731 | 3300046810 | Bacteria | 1732 |
| 1029 | Ga0495581_0000015 | 3300047315 | Bacteria | 59214 |
| 1030 | Ga0495581_0052097 | 3300047315 | Bacteria | 2364 |
| 1031 | Ga0495581_0061591 | 3300047315 | Bacteria | 2168 |
| 1032 | Ga0495581_0089091 | 3300047315 | Bacteria | 1789 |
| 1033 | Ga0495581_0102352 | 3300047315 | Bacteria | 1664 |
| 1034 | Ga0495604_0002055 | 3300047317 | Bacteria | 16241 |
| 1035 | Ga0495604_0007158 | 3300047317 | Bacteria | 8835 |
| 1036 | Ga0495604_0011991 | 3300047317 | Bacteria | 6890 |
| 1037 | Ga0495604_0040475 | 3300047317 | Bacteria | 3659 |
| 1038 | Ga0495604_0049006 | 3300047317 | Bacteria | 3284 |
| 1039 | Ga0495604_0260303 | 3300047317 | Bacteria | 1179 |
| 1040 | Ga0495674_0008391 | 3300047319 | Bacteria | 9846 |
| 1041 | Ga0495674_0011609 | 3300047319 | Bacteria | 8308 |
| 1042 | Ga0495674_0046688 | 3300047319 | Bacteria | 3844 |
| 1043 | Ga0495674_0049830 | 3300047319 | Bacteria | 3697 |
| 1044 | Ga0495674_0058711 | 3300047319 | Bacteria | 3362 |
| 1045 | Ga0495672_0004036 | 3300047320 | Bacteria | 12270 |
| 1046 | Ga0495672_0119074 | 3300047320 | Bacteria | 1406 |
| 1047 | Ga0495676_0025908 | 3300047321 | Bacteria | 5054 |
| 1048 | Ga0495676_0088017 | 3300047321 | Bacteria | 2331 |
| 1049 | Ga0495676_0094959 | 3300047321 | Bacteria | 2220 |
| 1050 | Ga0495680_0004358 | 3300047322 | Bacteria | 13558 |
| 1051 | Ga0495680_0006209 | 3300047322 | Bacteria | 11135 |
| 1052 | Ga0495680_0008847 | 3300047322 | Bacteria | 9107 |
| 1053 | Ga0495680_0016086 | 3300047322 | Bacteria | 6432 |
| 1054 | Ga0495680_0023741 | 3300047322 | Bacteria | 5096 |
| 1055 | Ga0495680_0144672 | 3300047322 | Bacteria | 1737 |
| 1056 | Ga0495687_007506 | 3300047443 | Bacteria | 6409 |
| 1057 | Ga0495675_0013658 | 3300047444 | Bacteria | 5130 |
| 1058 | Ga0495675_0120725 | 3300047444 | Bacteria | 1632 |
| 1059 | Ga0495679_049399 | 3300047446 | Bacteria | 1269 |
| 1060 | Ga0495673_0000029 | 3300047469 | Bacteria | 471019 |
| 1061 | Ga0495684_0001012 | 3300047471 | Bacteria | 22906 |
| 1062 | Ga0495684_0024587 | 3300047471 | Bacteria | 4636 |
| 1063 | Ga0495684_0041830 | 3300047471 | Bacteria | 3511 |
| 1064 | Ga0495684_0041933 | 3300047471 | Bacteria | 3507 |
| 1065 | Ga0495684_0045322 | 3300047471 | Bacteria | 3366 |
| 1066 | Ga0495686_0095766 | 3300047472 | Bacteria | 1797 |
| 1067 | Ga0495686_0141420 | 3300047472 | Bacteria | 1420 |
| 1068 | Ga0495593_0000384 | 3300047673 | Bacteria | 24498 |
| 1069 | Ga0495593_0008133 | 3300047673 | Bacteria | 6104 |
| 1070 | Ga0495593_0010683 | 3300047673 | Bacteria | 5293 |
| 1071 | Ga0495593_0053787 | 3300047673 | Bacteria | 2124 |
| 1072 | Ga0495602_0004518 | 3300048088 | Bacteria | 14518 |
| 1073 | Ga0495602_0007000 | 3300048088 | Bacteria | 11841 |
| 1074 | Ga0495602_0037211 | 3300048088 | Bacteria | 4520 |
| 1075 | Ga0495602_0039351 | 3300048088 | Bacteria | 4355 |
| 1076 | Ga0495602_0115137 | 3300048088 | Bacteria | 2175 |
| 1077 | Ga0495602_0325781 | 3300048088 | Bacteria | 1116 |
| 1078 | Ga0495614_0011280 | 3300048089 | Bacteria | 3932 |
| 1079 | Ga0495614_0048183 | 3300048089 | Bacteria | 1827 |
| 1080 | Ga0495626_0065051 | 3300048091 | Bacteria | 1651 |
| 1081 | Ga0496100_0000530 | 3300048903 | Bacteria | 18154 |
| 1082 | Ga0496100_0010450 | 3300048903 | Bacteria | 5254 |
| 1083 | Ga0496100_0114028 | 3300048903 | Bacteria | 1882 |
| 1084 | Ga0496101_0000189 | 3300048904 | Bacteria | 48416 |
| 1085 | Ga0496101_0006701 | 3300048904 | Bacteria | 7428 |
| 1086 | Ga0496101_0008079 | 3300048904 | Bacteria | 6862 |
| 1087 | Ga0496101_0033067 | 3300048904 | Bacteria | 3645 |
| 1088 | Ga0496101_0068182 | 3300048904 | Bacteria | 2600 |
| 1089 | Ga0496101_0122894 | 3300048904 | Bacteria | 1964 |
| 1090 | Ga0496102_0011342 | 3300048905 | Bacteria | 7677 |
| 1091 | Ga0496102_0012470 | 3300048905 | Bacteria | 7356 |
| 1092 | Ga0496102_0023434 | 3300048905 | Bacteria | 5483 |
| 1093 | Ga0496102_0024990 | 3300048905 | Bacteria | 5314 |
| 1094 | Ga0496102_0041225 | 3300048905 | Bacteria | 4178 |
| 1095 | Ga0496102_0275381 | 3300048905 | Bacteria | 1586 |
| 1096 | Ga0496103_0007850 | 3300048906 | Bacteria | 6343 |
| 1097 | Ga0496103_0045148 | 3300048906 | Bacteria | 2718 |
| 1098 | Ga0496104_0000508 | 3300048907 | Bacteria | 33336 |
| 1099 | Ga0496104_0001997 | 3300048907 | Bacteria | 17701 |
| 1100 | Ga0496104_0006052 | 3300048907 | Bacteria | 10613 |
| 1101 | Ga0496104_0012119 | 3300048907 | Bacteria | 7741 |
| 1102 | Ga0496104_0037267 | 3300048907 | Bacteria | 4548 |
| 1103 | Ga0496104_0059191 | 3300048907 | Bacteria | 3626 |
| 1104 | Ga0496104_0063090 | 3300048907 | Bacteria | 3514 |
| 1105 | Ga0496104_0163695 | 3300048907 | Bacteria | 2133 |
| 1106 | Ga0496104_0197002 | 3300048907 | Bacteria | 1926 |
| 1107 | Ga0496104_0206836 | 3300048907 | Bacteria | 1874 |
| 1108 | Ga0496104_0228172 | 3300048907 | Bacteria | 1774 |
| 1109 | Ga0496104_0321350 | 3300048907 | Bacteria | 1460 |
| 1110 | Ga0496105_0006301 | 3300048908 | Bacteria | 9113 |
| 1111 | Ga0496105_0016135 | 3300048908 | Bacteria | 5958 |
| 1112 | Ga0496105_0040901 | 3300048908 | Bacteria | 3821 |
| 1113 | Ga0496105_0044252 | 3300048908 | Bacteria | 3671 |
| 1114 | Ga0496105_0103867 | 3300048908 | Bacteria | 2347 |
| 1115 | Ga0496105_0122035 | 3300048908 | Bacteria | 2148 |
| 1116 | Ga0496105_0135232 | 3300048908 | Bacteria | 2031 |
| 1117 | Ga0496105_0135683 | 3300048908 | Bacteria | 2027 |
| 1118 | Ga0496105_0144903 | 3300048908 | Bacteria | 1953 |
| 1119 | Ga0496105_0254213 | 3300048908 | Bacteria | 1423 |
| 1120 | Ga0496106_0001465 | 3300048909 | Bacteria | 17755 |
| 1121 | Ga0496106_0012760 | 3300048909 | Bacteria | 6204 |
| 1122 | Ga0496106_0013066 | 3300048909 | Bacteria | 6128 |
| 1123 | Ga0496106_0016847 | 3300048909 | Bacteria | 5407 |
| 1124 | Ga0496106_0017851 | 3300048909 | Bacteria | 5246 |
| 1125 | Ga0496106_0103526 | 3300048909 | Bacteria | 2209 |
| 1126 | Ga0496106_0308532 | 3300048909 | Bacteria | 1269 |
| 1127 | Ga0496106_0438482 | 3300048909 | Bacteria | 1050 |
| 1128 | Ga0496107_0003085 | 3300048910 | Bacteria | 11063 |
| 1129 | Ga0496107_0005112 | 3300048910 | Bacteria | 8947 |
| 1130 | Ga0496107_0005951 | 3300048910 | Bacteria | 8356 |
| 1131 | Ga0496107_0011126 | 3300048910 | Bacteria | 6259 |
| 1132 | Ga0496107_0018052 | 3300048910 | Bacteria | 4963 |
| 1133 | Ga0496107_0079230 | 3300048910 | Bacteria | 2394 |
| 1134 | Ga0496107_0321451 | 3300048910 | Bacteria | 1151 |
| 1135 | Ga0496108_0002465 | 3300048911 | Bacteria | 14815 |
| 1136 | Ga0496108_0003684 | 3300048911 | Bacteria | 12291 |
| 1137 | Ga0496108_0004455 | 3300048911 | Bacteria | 11275 |
| 1138 | Ga0496108_0004887 | 3300048911 | Bacteria | 10820 |
| 1139 | Ga0496108_0018809 | 3300048911 | Bacteria | 5663 |
| 1140 | Ga0496108_0052725 | 3300048911 | Bacteria | 3410 |
| 1141 | Ga0496108_0131162 | 3300048911 | Bacteria | 2154 |
| 1142 | Ga0496108_0138139 | 3300048911 | Bacteria | 2098 |
| 1143 | Ga0496108_0176533 | 3300048911 | Bacteria | 1849 |
| 1144 | Ga0496108_0265285 | 3300048911 | Bacteria | 1494 |
| 1145 | Ga0496109_0000361 | 3300048912 | Bacteria | 42221 |
| 1146 | Ga0496109_0000488 | 3300048912 | Bacteria | 33914 |
| 1147 | Ga0496109_0005024 | 3300048912 | Bacteria | 11051 |
| 1148 | Ga0496109_0006884 | 3300048912 | Bacteria | 9588 |
| 1149 | Ga0496109_0009996 | 3300048912 | Bacteria | 8100 |
| 1150 | Ga0496109_0043459 | 3300048912 | Bacteria | 4073 |
| 1151 | Ga0496109_0064561 | 3300048912 | Bacteria | 3350 |
| 1152 | Ga0496110_0006318 | 3300048913 | Bacteria | 9358 |
| 1153 | Ga0496110_0031059 | 3300048913 | Bacteria | 4607 |
| 1154 | Ga0496110_0039424 | 3300048913 | Bacteria | 4113 |
| 1155 | Ga0496110_0074590 | 3300048913 | Bacteria | 3013 |
| 1156 | Ga0496110_0192564 | 3300048913 | Bacteria | 1852 |
| 1157 | Ga0496110_0308133 | 3300048913 | Bacteria | 1442 |
| 1158 | Ga0496111_0008713 | 3300048914 | Bacteria | 6731 |
| 1159 | Ga0496111_0013217 | 3300048914 | Bacteria | 5612 |
| 1160 | Ga0496111_0020669 | 3300048914 | Bacteria | 4587 |
| 1161 | Ga0496111_0040286 | 3300048914 | Bacteria | 3351 |
| 1162 | Ga0496111_0079806 | 3300048914 | Bacteria | 2387 |
| 1163 | Ga0496111_0083151 | 3300048914 | Bacteria | 2339 |
| 1164 | Ga0496111_0142483 | 3300048914 | Bacteria | 1776 |
| 1165 | Ga0496112_0000008 | 3300048915 | Bacteria | 310323 |
| 1166 | Ga0496112_0002869 | 3300048915 | Bacteria | 14010 |
| 1167 | Ga0496112_0006900 | 3300048915 | Bacteria | 10018 |
| 1168 | Ga0496112_0007908 | 3300048915 | Bacteria | 9472 |
| 1169 | Ga0496112_0018028 | 3300048915 | Bacteria | 6643 |
| 1170 | Ga0496112_0053933 | 3300048915 | Bacteria | 3949 |
| 1171 | Ga0496112_0087946 | 3300048915 | Bacteria | 3074 |
| 1172 | Ga0496112_0135217 | 3300048915 | Bacteria | 2436 |
| 1173 | Ga0496112_0139424 | 3300048915 | Bacteria | 2394 |
| 1174 | Ga0496113_0002209 | 3300048916 | Bacteria | 11223 |
| 1175 | Ga0496113_0002579 | 3300048916 | Bacteria | 10584 |
| 1176 | Ga0496113_0003109 | 3300048916 | Bacteria | 9866 |
| 1177 | Ga0496113_0024919 | 3300048916 | Bacteria | 4259 |
| 1178 | Ga0496113_0043915 | 3300048916 | Bacteria | 3309 |
| 1179 | Ga0496113_0075116 | 3300048916 | Bacteria | 2579 |
| 1180 | Ga0496113_0106377 | 3300048916 | Bacteria | 2179 |
| 1181 | Ga0496113_0309434 | 3300048916 | Bacteria | 1265 |
| 1182 | Ga0496114_0001960 | 3300048917 | Bacteria | 15650 |
| 1183 | Ga0496114_0002928 | 3300048917 | Bacteria | 13087 |
| 1184 | Ga0496114_0006147 | 3300048917 | Bacteria | 9448 |
| 1185 | Ga0496114_0008185 | 3300048917 | Bacteria | 8290 |
| 1186 | Ga0496114_0307180 | 3300048917 | Bacteria | 1401 |
| 1187 | Ga0496115_0002442 | 3300048918 | Bacteria | 13349 |
| 1188 | Ga0496115_0014481 | 3300048918 | Bacteria | 5971 |
| 1189 | Ga0496115_0047309 | 3300048918 | Bacteria | 3439 |
| 1190 | Ga0496115_0076158 | 3300048918 | Bacteria | 2726 |
| 1191 | Ga0496115_0342826 | 3300048918 | Bacteria | 1219 |
| 1192 | Ga0496116_0003172 | 3300048919 | Bacteria | 16473 |
| 1193 | Ga0496117_0008447 | 3300048920 | Bacteria | 9776 |
| 1194 | Ga0496117_0021988 | 3300048920 | Bacteria | 5132 |
| 1195 | Ga0496117_0129765 | 3300048920 | Bacteria | 1530 |
| 1196 | Ga0496117_0175249 | 3300048920 | Bacteria | 1240 |
| 1197 | Ga0496118_0012830 | 3300048921 | Bacteria | 7997 |
| 1198 | Ga0496118_0054949 | 3300048921 | Bacteria | 3010 |
| 1199 | Ga0496118_0091406 | 3300048921 | Bacteria | 2093 |
| 1200 | Ga0496118_0109763 | 3300048921 | Bacteria | 1835 |
| 1201 | Ga0496119_0019927 | 3300048922 | Bacteria | 4914 |
| 1202 | Ga0496119_0067340 | 3300048922 | Bacteria | 2112 |
| 1203 | Ga0496120_0005798 | 3300048923 | Bacteria | 9681 |
| 1204 | Ga0496120_0066833 | 3300048923 | Bacteria | 1987 |
| 1205 | Ga0496121_0000381 | 3300048924 | Bacteria | 90593 |
| 1206 | Ga0496121_0005990 | 3300048924 | Bacteria | 15358 |
| 1207 | Ga0496121_0012055 | 3300048924 | Bacteria | 9497 |
| 1208 | Ga0496121_0020194 | 3300048924 | Bacteria | 6610 |
| 1209 | Ga0496121_0025417 | 3300048924 | Bacteria | 5617 |
| 1210 | Ga0496121_0055052 | 3300048924 | Bacteria | 3318 |
| 1211 | Ga0496123_0101798 | 3300048926 | Bacteria | 1669 |
| 1212 | Ga0496124_0007279 | 3300048927 | Bacteria | 11803 |
| 1213 | Ga0496124_0381178 | 3300048927 | Bacteria | 986 |
| 1214 | Ga0496125_0000654 | 3300048928 | Bacteria | 57851 |
| 1215 | Ga0496125_0001646 | 3300048928 | Bacteria | 31476 |
| 1216 | Ga0496125_0027660 | 3300048928 | Bacteria | 5136 |
| 1217 | Ga0496125_0037567 | 3300048928 | Bacteria | 4208 |
| 1218 | Ga0496125_0093021 | 3300048928 | Bacteria | 2252 |
| 1219 | Ga0496125_0099925 | 3300048928 | Bacteria | 2140 |
| 1220 | Ga0496125_0144663 | 3300048928 | Bacteria | 1646 |
| 1221 | Ga0496125_0146452 | 3300048928 | Bacteria | 1631 |
| 1222 | Ga0496126_0005477 | 3300048929 | Bacteria | 14469 |
| 1223 | Ga0496126_0014823 | 3300048929 | Bacteria | 7863 |
| 1224 | Ga0496126_0021093 | 3300048929 | Bacteria | 6371 |
| 1225 | Ga0496126_0022427 | 3300048929 | Bacteria | 6145 |
| 1226 | Ga0496126_0364499 | 3300048929 | Bacteria | 1179 |
| 1227 | Ga0496126_0424416 | 3300048929 | Bacteria | 1074 |
| 1228 | Ga0496126_0435441 | 3300048929 | Bacteria | 1058 |
| 1229 | Ga0501290_000772 | 3300049513 | Bacteria | 4739 |
| 1230 | Ga0501292_000014 | 3300049515 | Bacteria | 64546 |
| 1231 | Ga0501294_000889 | 3300049517 | Bacteria | 3218 |
| 1232 | Ga0501300_000229 | 3300049523 | Bacteria | 8470 |
| 1233 | Ga0501031_0012923 | 3300049568 | Bacteria | 5452 |
| 1234 | Ga0501031_0017863 | 3300049568 | Bacteria | 4613 |
| 1235 | Ga0501031_0074919 | 3300049568 | Bacteria | 2203 |
| 1236 | Ga0501032_0000269 | 3300049569 | Bacteria | 43721 |
| 1237 | Ga0501032_0011788 | 3300049569 | Bacteria | 6265 |
| 1238 | Ga0501032_0092312 | 3300049569 | Bacteria | 2008 |
| 1239 | Ga0501033_0000249 | 3300049570 | Bacteria | 52045 |
| 1240 | Ga0501033_0007545 | 3300049570 | Bacteria | 8465 |
| 1241 | Ga0501033_0022581 | 3300049570 | Bacteria | 4746 |
| 1242 | Ga0501033_0040028 | 3300049570 | Bacteria | 3499 |
| 1243 | Ga0501033_0085408 | 3300049570 | Bacteria | 2311 |
| 1244 | Ga0501033_0127630 | 3300049570 | Bacteria | 1844 |
| 1245 | Ga0501034_0000039 | 3300049571 | Bacteria | 237357 |
| 1246 | Ga0501034_0000850 | 3300049571 | Bacteria | 45243 |
| 1247 | Ga0501034_0016544 | 3300049571 | Bacteria | 7562 |
| 1248 | Ga0501034_0042660 | 3300049571 | Bacteria | 4592 |
| 1249 | Ga0501034_0058977 | 3300049571 | Bacteria | 3856 |
| 1250 | Ga0501034_0099018 | 3300049571 | Bacteria | 2910 |
| 1251 | Ga0501034_0192062 | 3300049571 | Bacteria | 2004 |
| 1252 | Ga0501034_0205154 | 3300049571 | Bacteria | 1928 |
| 1253 | Ga0501034_0406821 | 3300049571 | Bacteria | 1283 |
| 1254 | Ga0501034_0450712 | 3300049571 | Bacteria | 1204 |
| 1255 | Ga0501036_0000899 | 3300049572 | Bacteria | 22269 |
| 1256 | Ga0501036_0004935 | 3300049572 | Bacteria | 10781 |
| 1257 | Ga0501036_0007504 | 3300049572 | Bacteria | 8897 |
| 1258 | Ga0501036_0046557 | 3300049572 | Bacteria | 3673 |
| 1259 | Ga0501036_0077541 | 3300049572 | Bacteria | 2812 |
| 1260 | Ga0501036_0143194 | 3300049572 | Bacteria | 2016 |
| 1261 | Ga0501036_0179267 | 3300049572 | Bacteria | 1784 |
| 1262 | Ga0501037_0000112 | 3300049573 | Bacteria | 75698 |
| 1263 | Ga0501037_0001864 | 3300049573 | Bacteria | 15310 |
| 1264 | Ga0501037_0015791 | 3300049573 | Bacteria | 5557 |
| 1265 | Ga0501037_0021022 | 3300049573 | Bacteria | 4821 |
| 1266 | Ga0501037_0027622 | 3300049573 | Bacteria | 4193 |
| 1267 | Ga0501037_0033704 | 3300049573 | Bacteria | 3781 |
| 1268 | Ga0501037_0053072 | 3300049573 | Bacteria | 2964 |
| 1269 | Ga0501037_0138099 | 3300049573 | Bacteria | 1745 |
| 1270 | Ga0501038_0000727 | 3300049574 | Bacteria | 29411 |
| 1271 | Ga0501038_0009937 | 3300049574 | Bacteria | 8713 |
| 1272 | Ga0501038_0013255 | 3300049574 | Bacteria | 7517 |
| 1273 | Ga0501038_0017301 | 3300049574 | Bacteria | 6516 |
| 1274 | Ga0501038_0028682 | 3300049574 | Bacteria | 4943 |
| 1275 | Ga0501038_0035710 | 3300049574 | Bacteria | 4364 |
| 1276 | Ga0501038_0044912 | 3300049574 | Bacteria | 3836 |
| 1277 | Ga0501038_0066126 | 3300049574 | Bacteria | 3079 |
| 1278 | Ga0501038_0220246 | 3300049574 | Bacteria | 1514 |
| 1279 | Ga0501038_0323811 | 3300049574 | Bacteria | 1205 |
| 1280 | Ga0501039_0024000 | 3300049575 | Bacteria | 4683 |
| 1281 | Ga0501039_0040832 | 3300049575 | Bacteria | 3581 |
| 1282 | Ga0501039_0049595 | 3300049575 | Bacteria | 3245 |
| 1283 | Ga0501039_0087269 | 3300049575 | Bacteria | 2430 |
| 1284 | Ga0501040_0008040 | 3300049576 | Bacteria | 6850 |
| 1285 | Ga0501040_0146866 | 3300049576 | Bacteria | 1662 |
| 1286 | Ga0501042_0030617 | 3300049578 | Bacteria | 3802 |
| 1287 | Ga0501042_0051603 | 3300049578 | Bacteria | 2933 |
| 1288 | Ga0501042_0097714 | 3300049578 | Bacteria | 2111 |
| 1289 | Ga0501043_0004641 | 3300049579 | Bacteria | 11138 |
| 1290 | Ga0501043_0015869 | 3300049579 | Bacteria | 5904 |
| 1291 | Ga0501043_0018381 | 3300049579 | Bacteria | 5481 |
| 1292 | Ga0501043_0063213 | 3300049579 | Bacteria | 2906 |
| 1293 | Ga0501043_0076108 | 3300049579 | Bacteria | 2636 |
| 1294 | Ga0501043_0124807 | 3300049579 | Bacteria | 2018 |
| 1295 | Ga0501043_0141018 | 3300049579 | Bacteria | 1887 |
| 1296 | Ga0501043_0266974 | 3300049579 | Bacteria | 1314 |
| 1297 | Ga0501046_0006020 | 3300049580 | Bacteria | 10788 |
| 1298 | Ga0501046_0013310 | 3300049580 | Bacteria | 6968 |
| 1299 | Ga0501046_0018899 | 3300049580 | Bacteria | 5723 |
| 1300 | Ga0501046_0037594 | 3300049580 | Bacteria | 3889 |
| 1301 | Ga0501047_0000455 | 3300049581 | Bacteria | 45200 |
| 1302 | Ga0501047_0002128 | 3300049581 | Bacteria | 18968 |
| 1303 | Ga0501047_0025946 | 3300049581 | Bacteria | 5635 |
| 1304 | Ga0501047_0043146 | 3300049581 | Bacteria | 4356 |
| 1305 | Ga0501047_0049002 | 3300049581 | Bacteria | 4079 |
| 1306 | Ga0501047_0054513 | 3300049581 | Bacteria | 3867 |
| 1307 | Ga0501047_0079140 | 3300049581 | Bacteria | 3161 |
| 1308 | Ga0501047_0114372 | 3300049581 | Bacteria | 2580 |
| 1309 | Ga0501047_0133657 | 3300049581 | Bacteria | 2361 |
| 1310 | Ga0501047_0161880 | 3300049581 | Bacteria | 2109 |
| 1311 | Ga0501048_0000677 | 3300049582 | Bacteria | 24715 |
| 1312 | Ga0501048_0001113 | 3300049582 | Bacteria | 20168 |
| 1313 | Ga0501048_0024279 | 3300049582 | Bacteria | 4425 |
| 1314 | Ga0501048_0164118 | 3300049582 | Bacteria | 1572 |
| 1315 | Ga0501067_0003780 | 3300049583 | Bacteria | 8347 |
| 1316 | Ga0501067_0005792 | 3300049583 | Bacteria | 6859 |
| 1317 | Ga0501068_0021310 | 3300049584 | Bacteria | 3784 |
| 1318 | Ga0501068_0041830 | 3300049584 | Bacteria | 2754 |
| 1319 | Ga0501069_0005343 | 3300049585 | Bacteria | 6680 |
| 1320 | Ga0501069_0018370 | 3300049585 | Bacteria | 3773 |
| 1321 | Ga0501070_0005835 | 3300049586 | Bacteria | 10502 |
| 1322 | Ga0501070_0028051 | 3300049586 | Bacteria | 4721 |
| 1323 | Ga0501070_0043105 | 3300049586 | Bacteria | 3756 |
| 1324 | Ga0501070_0071480 | 3300049586 | Bacteria | 2873 |
| 1325 | Ga0501070_0087502 | 3300049586 | Bacteria | 2578 |
| 1326 | Ga0501070_0186535 | 3300049586 | Bacteria | 1706 |
| 1327 | Ga0501071_0044143 | 3300049587 | Bacteria | 3197 |
| 1328 | Ga0501071_0085263 | 3300049587 | Bacteria | 2316 |
| 1329 | Ga0501072_0078654 | 3300049588 | Bacteria | 2611 |
| 1330 | Ga0501073_0000103 | 3300049589 | Bacteria | 53962 |
| 1331 | Ga0501073_0011859 | 3300049589 | Bacteria | 6363 |
| 1332 | Ga0501073_0029119 | 3300049589 | Bacteria | 3946 |
| 1333 | Ga0501073_0052331 | 3300049589 | Bacteria | 2859 |
| 1334 | Ga0501073_0083610 | 3300049589 | Bacteria | 2221 |
| 1335 | Ga0501073_0127602 | 3300049589 | Bacteria | 1763 |
| 1336 | Ga0501073_0129940 | 3300049589 | Bacteria | 1746 |
| 1337 | Ga0501074_0000203 | 3300049590 | Bacteria | 32417 |
| 1338 | Ga0501074_0015716 | 3300049590 | Bacteria | 5503 |
| 1339 | Ga0501074_0031406 | 3300049590 | Bacteria | 3847 |
| 1340 | Ga0501074_0053579 | 3300049590 | Bacteria | 2910 |
| 1341 | Ga0501206_000816 | 3300049653 | Bacteria | 3811 |
| 1342 | Ga0501223_000250 | 3300049663 | Bacteria | 13783 |
| 1343 | Ga0501224_000750 | 3300049664 | Bacteria | 4089 |
| 1344 | Ga0501227_009571 | 3300049665 | Bacteria | 2090 |
| 1345 | Ga0501235_001772 | 3300049669 | Bacteria | 4623 |
| 1346 | Ga0501261_000003 | 3300049690 | Bacteria | 106942 |
| 1347 | Ga0501225_0000710 | 3300049705 | Bacteria | 10467 |
| 1348 | Ga0501245_001564 | 3300049708 | Bacteria | 2979 |
| 1349 | Ga0501079_0009511 | 3300049741 | Bacteria | 7370 |
| 1350 | Ga0501079_0021435 | 3300049741 | Bacteria | 4943 |
| 1351 | Ga0501079_0099424 | 3300049741 | Bacteria | 2254 |
| 1352 | Ga0501080_0002271 | 3300049742 | Bacteria | 16721 |
| 1353 | Ga0501080_0005235 | 3300049742 | Bacteria | 11555 |
| 1354 | Ga0501080_0009477 | 3300049742 | Bacteria | 8881 |
| 1355 | Ga0501080_0034637 | 3300049742 | Bacteria | 4715 |
| 1356 | Ga0501080_0102862 | 3300049742 | Bacteria | 2649 |
| 1357 | Ga0501080_0361282 | 3300049742 | Bacteria | 1310 |
| 1358 | Ga0501083_0000437 | 3300049744 | Bacteria | 26753 |
| 1359 | Ga0501083_0001959 | 3300049744 | Bacteria | 14144 |
| 1360 | Ga0501083_0027454 | 3300049744 | Bacteria | 3928 |
| 1361 | Ga0501279_000007 | 3300049775 | Bacteria | 141756 |
| 1362 | Ga0501280_000284 | 3300049776 | Bacteria | 12940 |
| 1363 | Ga0501281_00155 | 3300049777 | Bacteria | 7997 |
| 1364 | Ga0501035_0000523 | 3300049822 | Bacteria | 43259 |
| 1365 | Ga0501035_0006586 | 3300049822 | Bacteria | 10875 |
| 1366 | Ga0501035_0010086 | 3300049822 | Bacteria | 8769 |
| 1367 | Ga0501035_0011909 | 3300049822 | Bacteria | 8049 |
| 1368 | Ga0501035_0056260 | 3300049822 | Bacteria | 3510 |
| 1369 | Ga0501035_0107764 | 3300049822 | Bacteria | 2442 |
| 1370 | Ga0501044_0000435 | 3300049823 | Bacteria | 51516 |
| 1371 | Ga0501044_0012897 | 3300049823 | Bacteria | 9046 |
| 1372 | Ga0501044_0015397 | 3300049823 | Bacteria | 8236 |
| 1373 | Ga0501044_0074906 | 3300049823 | Bacteria | 3437 |
| 1374 | Ga0501044_0076157 | 3300049823 | Bacteria | 3406 |
| 1375 | Ga0501044_0081364 | 3300049823 | Bacteria | 3278 |
| 1376 | Ga0501044_0083035 | 3300049823 | Bacteria | 3240 |
| 1377 | Ga0501044_0110579 | 3300049823 | Bacteria | 2756 |
| 1378 | Ga0501044_0204578 | 3300049823 | Bacteria | 1931 |
| 1379 | Ga0501044_0206168 | 3300049823 | Bacteria | 1922 |
| 1380 | Ga0501045_0027706 | 3300049824 | Bacteria | 4085 |
| 1381 | nmdc:mga03683_81463_c1 | 3300050489 | Bacteria | 1398 |
| 1382 | nmdc:mga0yw44_33309_c1 | 3300050492 | Bacteria | 3009 |
| 1383 | nmdc:mga0yw44_91919_c1 | 3300050492 | Bacteria | 1919 |
| 1384 | nmdc:mga0k408_14562_c1 | 3300050493 | Bacteria | 4337 |
| 1385 | nmdc:mga0k408_69038_c1 | 3300050493 | Bacteria | 1601 |
| 1386 | nmdc:mga06z11_60341_c1 | 3300050494 | Bacteria | 1974 |
| 1387 | nmdc:mga06z11_85576_c1 | 3300050494 | Bacteria | 1701 |
| 1388 | nmdc:mga07m45_94390_c1 | 3300050496 | Bacteria | 1715 |
| 1389 | nmdc:mga05p37_11853_c1 | 3300050507 | Bacteria | 10392 |
| 1390 | nmdc:mga05p37_347562_c1 | 3300050507 | Bacteria | 1747 |
| 1391 | nmdc:mga05p37_505_c1 | 3300050507 | Bacteria | 42970 |
| 1392 | nmdc:mga0qj67_859_c1 | 3300050509 | Bacteria | 20877 |
| 1393 | nmdc:mga06r32_10551_c1 | 3300050510 | Bacteria | 8331 |
| 1394 | nmdc:mga06r32_225713_c1 | 3300050510 | Bacteria | 1861 |
| 1395 | nmdc:mga06r32_414258_c1 | 3300050510 | Bacteria | 1329 |
| 1396 | nmdc:mga08y16_11105_c1 | 3300050511 | Bacteria | 9458 |
| 1397 | nmdc:mga08y16_66746_c1 | 3300050511 | Bacteria | 3755 |
| 1398 | nmdc:mga08y16_78683_c1 | 3300050511 | Bacteria | 3437 |
| 1399 | nmdc:mga08y16_82852_c1 | 3300050511 | Bacteria | 3344 |
| 1400 | nmdc:mga0n895_13449_c1 | 3300050512 | Bacteria | 7384 |
| 1401 | nmdc:mga0n895_189973_c1 | 3300050512 | Bacteria | 2085 |
| 1402 | nmdc:mga0n895_2584_c1 | 3300050512 | Bacteria | 14215 |
| 1403 | nmdc:mga0n895_3537_c1 | 3300050512 | Bacteria | 12632 |
| 1404 | nmdc:mga0n895_74991_c1 | 3300050512 | Bacteria | 1706 |
| 1405 | nmdc:mga0rr50_1087_c1 | 3300050513 | Bacteria | 14763 |
| 1406 | nmdc:mga0rr50_125753_c1 | 3300050513 | Bacteria | 2047 |
| 1407 | nmdc:mga0rr50_50121_c1 | 3300050513 | Bacteria | 3093 |
| 1408 | nmdc:mga08x19_171419_c1 | 3300050514 | Bacteria | 1478 |
| 1409 | nmdc:mga0a205_1492_c1 | 3300050515 | Bacteria | 19963 |
| 1410 | nmdc:mga0a205_55693_c1 | 3300050515 | Bacteria | 3819 |
| 1411 | nmdc:mga0a205_9612_c1 | 3300050515 | Bacteria | 1817 |
| 1412 | nmdc:mga0sz30_14198_c1 | 3300050516 | Bacteria | 3131 |
| 1413 | nmdc:mga0sz30_16624_c1 | 3300050516 | Bacteria | 2924 |
| 1414 | nmdc:mga0sz30_63339_c2 | 3300050516 | Bacteria | 1166 |
| 1415 | Ga0495601_0000958 | 3300053077 | Bacteria | 15765 |
| 1416 | Ga0495601_0002291 | 3300053077 | Bacteria | 10796 |
| 1417 | Ga0495601_0004285 | 3300053077 | Bacteria | 8240 |
| 1418 | Ga0495601_0004332 | 3300053077 | Bacteria | 8198 |
| 1419 | Ga0495601_0020306 | 3300053077 | Bacteria | 4057 |
| 1420 | Ga0495601_0131025 | 3300053077 | Bacteria | 1633 |
| 1421 | Ga0495601_0217393 | 3300053077 | Bacteria | 1248 |
| 1422 | Ga0495612_0000276 | 3300053078 | Bacteria | 21133 |
| 1423 | Ga0495612_0003620 | 3300053078 | Bacteria | 6406 |
| 1424 | Ga0495612_0006758 | 3300053078 | Bacteria | 4698 |
| 1425 | Ga0495612_0021497 | 3300053078 | Bacteria | 2589 |
| 1426 | Ga0495612_0040437 | 3300053078 | Bacteria | 1899 |
| 1427 | Ga0500635_0009681 | 3300053080 | Bacteria | 2681 |
| 1428 | Ga0495595_0000596 | 3300053084 | Bacteria | 13772 |
| 1429 | Ga0495595_0003189 | 3300053084 | Bacteria | 6502 |
| 1430 | Ga0495619_0000108 | 3300053085 | Bacteria | 62197 |
| 1431 | Ga0495619_0000211 | 3300053085 | Bacteria | 42390 |
| 1432 | Ga0495619_0000763 | 3300053085 | Bacteria | 21009 |
| 1433 | Ga0495619_0005840 | 3300053085 | Bacteria | 7799 |
| 1434 | Ga0495619_0010930 | 3300053085 | Bacteria | 5712 |
| 1435 | Ga0495619_0017139 | 3300053085 | Bacteria | 4589 |
| 1436 | Ga0495619_0020471 | 3300053085 | Bacteria | 4213 |
| 1437 | Ga0495619_0035198 | 3300053085 | Bacteria | 3257 |
| 1438 | Ga0500643_000435 | 3300053087 | Bacteria | 31475 |
| 1439 | Ga0500643_017565 | 3300053087 | Bacteria | 2393 |
| 1440 | Ga0500644_0000896 | 3300053088 | Bacteria | 9597 |
| 1441 | Ga0500644_0020013 | 3300053088 | Bacteria | 1983 |
| 1442 | Ga0500581_163710 | 3300053089 | Bacteria | 1029 |
| 1443 | Ga0500646_0055049 | 3300053090 | Bacteria | 1157 |
| 1444 | Ga0500651_0002754 | 3300053093 | Bacteria | 9399 |
| 1445 | Ga0500651_0006575 | 3300053093 | Bacteria | 6713 |
| 1446 | Ga0500651_0064251 | 3300053093 | Bacteria | 2289 |
| 1447 | Ga0500651_0199738 | 3300053093 | Bacteria | 1180 |
| 1448 | Ga0500566_0000008 | 3300053094 | Bacteria | 143641 |
| 1449 | Ga0500566_0002013 | 3300053094 | Bacteria | 11994 |
| 1450 | Ga0500566_0003961 | 3300053094 | Bacteria | 8834 |
| 1451 | Ga0500566_0019250 | 3300053094 | Bacteria | 4008 |
| 1452 | Ga0500566_0064905 | 3300053094 | Bacteria | 2060 |
| 1453 | Ga0500640_000516 | 3300053095 | Bacteria | 9691 |
| 1454 | Ga0500641_0009748 | 3300053096 | Bacteria | 3456 |
| 1455 | Ga0500641_0087286 | 3300053096 | Bacteria | 1329 |
| 1456 | Ga0500641_0124741 | 3300053096 | Bacteria | 1110 |
| 1457 | Ga0500650_0042653 | 3300053098 | Bacteria | 2096 |
| 1458 | Ga0500650_0048886 | 3300053098 | Bacteria | 1962 |
| 1459 | Ga0500556_0000202 | 3300053104 | Bacteria | 48694 |
| 1460 | Ga0500557_000029 | 3300053105 | Bacteria | 77152 |
| 1461 | Ga0500562_005821 | 3300053108 | Bacteria | 3102 |
| 1462 | Ga0500562_040435 | 3300053108 | Bacteria | 1239 |
| 1463 | Ga0500572_000056 | 3300053111 | Bacteria | 34105 |
| 1464 | Ga0500572_020679 | 3300053111 | Bacteria | 1734 |
| 1465 | Ga0500592_001569 | 3300053116 | Bacteria | 3695 |
| 1466 | Ga0500594_0007592 | 3300053118 | Bacteria | 2456 |
| 1467 | Ga0500595_000002 | 3300053119 | Bacteria | 1074388 |
| 1468 | Ga0500595_000726 | 3300053119 | Bacteria | 19589 |
| 1469 | Ga0500595_010613 | 3300053119 | Bacteria | 3651 |
| 1470 | Ga0500595_020648 | 3300053119 | Bacteria | 2366 |
| 1471 | Ga0500597_149433 | 3300053120 | Bacteria | 1003 |
| 1472 | Ga0500607_121585 | 3300053121 | Bacteria | 1261 |
| 1473 | Ga0500608_003325 | 3300053122 | Bacteria | 6009 |
| 1474 | Ga0500608_037225 | 3300053122 | Bacteria | 2324 |
| 1475 | Ga0500614_003782 | 3300053123 | Bacteria | 3242 |
| 1476 | Ga0500621_069030 | 3300053126 | Bacteria | 1426 |
| 1477 | Ga0500642_0000005 | 3300053130 | Bacteria | 422725 |
| 1478 | Ga0500642_0000333 | 3300053130 | Bacteria | 16200 |
| 1479 | Ga0500652_001078 | 3300053131 | Bacteria | 8837 |
| 1480 | Ga0500559_0000423 | 3300053136 | Bacteria | 30084 |
| 1481 | Ga0500559_0000533 | 3300053136 | Bacteria | 26526 |
| 1482 | Ga0500559_0002351 | 3300053136 | Bacteria | 9883 |
| 1483 | Ga0500564_076426 | 3300053138 | Bacteria | 1505 |
| 1484 | Ga0500568_0000865 | 3300053139 | Bacteria | 21243 |
| 1485 | Ga0500568_0004261 | 3300053139 | Bacteria | 7685 |
| 1486 | Ga0500568_0073081 | 3300053139 | Bacteria | 1310 |
| 1487 | Ga0500577_0000330 | 3300053142 | Bacteria | 12272 |
| 1488 | Ga0500590_063262 | 3300053148 | Bacteria | 1855 |
| 1489 | Ga0500590_111389 | 3300053148 | Bacteria | 1298 |
| 1490 | Ga0500603_000104 | 3300053150 | Bacteria | 19878 |
| 1491 | Ga0500603_001908 | 3300053150 | Bacteria | 4646 |
| 1492 | Ga0500604_0024547 | 3300053151 | Bacteria | 1726 |
| 1493 | Ga0500616_0000002 | 3300053153 | Bacteria | 1611257 |
| 1494 | Ga0500616_0000166 | 3300053153 | Bacteria | 110141 |
| 1495 | Ga0500616_0000180 | 3300053153 | Bacteria | 106053 |
| 1496 | Ga0500616_0006540 | 3300053153 | Bacteria | 7614 |
| 1497 | Ga0500616_0046615 | 3300053153 | Bacteria | 2304 |
| 1498 | Ga0500622_0001180 | 3300053156 | Bacteria | 21555 |
| 1499 | Ga0500622_0016125 | 3300053156 | Bacteria | 3996 |
| 1500 | Ga0500630_013996 | 3300053159 | Bacteria | 3949 |
| 1501 | Ga0500638_001215 | 3300053162 | Bacteria | 7810 |
| 1502 | Ga0500639_000010 | 3300053163 | Bacteria | 136747 |
| 1503 | Ga0500639_016510 | 3300053163 | Bacteria | 3894 |
| 1504 | Ga0500636_0000112 | 3300053177 | Bacteria | 42041 |
| 1505 | Ga0500636_0000753 | 3300053177 | Bacteria | 17452 |
| 1506 | Ga0500636_0094752 | 3300053177 | Bacteria | 1705 |
| 1507 | Ga0500637_0016014 | 3300053178 | Bacteria | 3989 |
| 1508 | Ga0500611_003002 | 3300053727 | Bacteria | 2105 |
| 1509 | Ga0500645_000012 | 3300053730 | Bacteria | 168579 |
| 1510 | Ga0500645_013885 | 3300053730 | Bacteria | 2576 |
| 1511 | Ga0500645_016971 | 3300053730 | Bacteria | 2287 |
| 1512 | Ga0500645_020131 | 3300053730 | Bacteria | 2069 |
| 1513 | Ga0500609_001787 | 3300053731 | Bacteria | 3118 |
| 1514 | Ga0500596_001607 | 3300053735 | Bacteria | 4581 |
| 1515 | Ga0500596_008194 | 3300053735 | Bacteria | 1674 |
| 1516 | Ga0500601_001269 | 3300053737 | Bacteria | 2799 |
| 1517 | Ga0501084_0003243 | 3300054114 | Bacteria | 13169 |
| 1518 | Ga0501084_0057636 | 3300054114 | Bacteria | 3250 |
| 1519 | Ga0501082_0000008 | 3300060353 | Bacteria | 125977 |
| 1520 | Ga0501082_0008505 | 3300060353 | Bacteria | 8847 |
| 1521 | Ga0501082_0017509 | 3300060353 | Bacteria | 6174 |
| 1522 | Ga0501082_0093156 | 3300060353 | Bacteria | 2603 |
| 1523 | Ga0501082_0111143 | 3300060353 | Bacteria | 2372 |
| 1524 | Ga0530510_0381959 | 3300061734 | Bacteria | 1060 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300035172 | Ga0373955_0085117 | Ga0373955_0085117_498_1421 | 277 |
| 2 | 3300005436 | Ga0070713_100020625 | Ga0070713_1000206255 | 281 |
| 3 | 3300005466 | Ga0070685_10141807 | Ga0070685_101418072 | 281 |
| 4 | 3300006358 | Ga0068871_100074517 | Ga0068871_1000745172 | 281 |
| 5 | 3300025915 | Ga0207693_10029113 | Ga0207693_100291134 | 281 |
| 6 | 3300025928 | Ga0207700_10196813 | Ga0207700_101968132 | 281 |
| 7 | 3300035117 | Ga0373953_0010918 | Ga0373953_0010918_2151_3110 | 281 |
| 8 | 3300035118 | Ga0373954_0032596 | Ga0373954_0032596_175_1134 | 281 |
| 9 | 3300035172 | Ga0373955_0022067 | Ga0373955_0022067_2011_2970 | 281 |
| 10 | 3300035410 | Ga0373924_0002965 | Ga0373924_0002965_895_1854 | 281 |
| 11 | 3300035724 | Ga0373933_0004299 | Ga0373933_0004299_485_1444 | 281 |
| 12 | 3300046462 | Ga0495651_0026260 | Ga0495651_0026260_1415_2374 | 281 |
| 13 | 3300046463 | Ga0495653_0016213 | Ga0495653_0016213_2956_3915 | 281 |
| 14 | 3300046511 | Ga0495608_0054453 | Ga0495608_0054453_1110_2069 | 281 |
| 15 | 3300046514 | Ga0495618_0015542 | Ga0495618_0015542_316_1275 | 281 |
| 16 | 3300046516 | Ga0495628_0010246 | Ga0495628_0010246_4769_5728 | 281 |
| 17 | 3300046533 | Ga0495640_0039086 | Ga0495640_0039086_2130_3089 | 281 |
| 18 | 3300046536 | Ga0495587_0002521 | Ga0495587_0002521_139_1098 | 281 |
| 19 | 3300046543 | Ga0495645_0002657 | Ga0495645_0002657_6295_7254 | 281 |
| 20 | 3300046559 | Ga0495667_0002603 | Ga0495667_0002603_6148_7107 | 281 |
| 21 | 3300046663 | Ga0495635_0012601 | Ga0495635_0012601_2128_3087 | 281 |
| 22 | 3300046675 | Ga0495657_0012670 | Ga0495657_0012670_3985_4944 | 281 |
| 23 | 3300046679 | Ga0495623_0061095 | Ga0495623_0061095_949_1908 | 281 |
| 24 | 3300046680 | Ga0495646_0006855 | Ga0495646_0006855_5819_6778 | 281 |
| 25 | 3300047317 | Ga0495604_0011991 | Ga0495604_0011991_113_1072 | 281 |
| 26 | 3300047319 | Ga0495674_0049830 | Ga0495674_0049830_2036_2995 | 281 |
| 27 | 3300047322 | Ga0495680_0006209 | Ga0495680_0006209_2762_3721 | 281 |
| 28 | 3300047471 | Ga0495684_0041830 | Ga0495684_0041830_492_1451 | 281 |
| 29 | 3300048088 | Ga0495602_0007000 | Ga0495602_0007000_5660_6619 | 281 |
| 30 | 3300048910 | Ga0496107_0079230 | Ga0496107_0079230_1121_2080 | 281 |
| 31 | 3300048911 | Ga0496108_0018809 | Ga0496108_0018809_1070_2029 | 281 |
| 32 | 3300053077 | Ga0495601_0004285 | Ga0495601_0004285_6707_7666 | 281 |
| 33 | 3300053078 | Ga0495612_0003620 | Ga0495612_0003620_4745_5704 | 281 |
| 34 | 3300053085 | Ga0495619_0005840 | Ga0495619_0005840_634_1593 | 281 |
| 35 | 3300028556 | Ga0265337_1000401 | Ga0265337_100040117 | 284 |
| 36 | 3300005434 | Ga0070709_10154832 | Ga0070709_101548321 | 285 |
| 37 | 3300026088 | Ga0207641_10353218 | Ga0207641_103532181 | 285 |
| 38 | 3300005436 | Ga0070713_100046727 | Ga0070713_1000467272 | 288 |
| 39 | 3300006028 | Ga0070717_10045951 | Ga0070717_100459512 | 288 |
| 40 | 3300046463 | Ga0495653_0121798 | Ga0495653_0121798_456_1415 | 288 |
| 41 | 3300046663 | Ga0495635_0128831 | Ga0495635_0128831_385_1344 | 288 |
| 42 | 3300047317 | Ga0495604_0260303 | Ga0495604_0260303_69_1028 | 288 |
| 43 | 3300048088 | Ga0495602_0115137 | Ga0495602_0115137_57_1016 | 288 |
| 44 | 3300050515 | nmdc:mga0a205_9612_c1 | nmdc:mga0a205_9612_c1_934_1800 | 288 |
| 45 | 3300053077 | Ga0495601_0004332 | Ga0495601_0004332_4801_5760 | 288 |
| 46 | 3300053085 | Ga0495619_0000108 | Ga0495619_0000108_8703_9662 | 288 |
| 47 | 3300005337 | Ga0070682_100082911 | Ga0070682_1000829112 | 289 |
| 48 | 3300005339 | Ga0070660_100109288 | Ga0070660_1001092882 | 289 |
| 49 | 3300005366 | Ga0070659_100139609 | Ga0070659_1001396092 | 289 |
| 50 | 3300005457 | Ga0070662_100007650 | Ga0070662_1000076502 | 289 |
| 51 | 3300005458 | Ga0070681_10146358 | Ga0070681_101463582 | 289 |
| 52 | 3300005545 | Ga0070695_100044161 | Ga0070695_1000441612 | 289 |
| 53 | 3300005547 | Ga0070693_100061633 | Ga0070693_1000616332 | 289 |
| 54 | 3300005615 | Ga0070702_100173279 | Ga0070702_1001732791 | 289 |
| 55 | 3300006173 | Ga0070716_100067042 | Ga0070716_1000670422 | 289 |
| 56 | 3300014968 | Ga0157379_10092162 | Ga0157379_100921622 | 289 |
| 57 | 3300025912 | Ga0207707_10012718 | Ga0207707_100127184 | 289 |
| 58 | 3300025919 | Ga0207657_10060032 | Ga0207657_100600323 | 289 |
| 59 | 3300025933 | Ga0207706_10001913 | Ga0207706_1000191317 | 289 |
| 60 | 3300025939 | Ga0207665_10073614 | Ga0207665_100736143 | 289 |
| 61 | 3300026067 | Ga0207678_10024197 | Ga0207678_100241976 | 289 |
| 62 | 3300035091 | Ga0373951_0012273 | Ga0373951_0012273_112_1038 | 289 |
| 63 | 3300035115 | Ga0373941_0068864 | Ga0373941_0068864_44_970 | 289 |
| 64 | 3300035118 | Ga0373954_0050234 | Ga0373954_0050234_767_1693 | 289 |
| 65 | 3300048905 | Ga0496102_0275381 | Ga0496102_0275381_333_1259 | 289 |
| 66 | 3300048909 | Ga0496106_0308532 | Ga0496106_0308532_279_1205 | 289 |
| 67 | 3300053085 | Ga0495619_0035198 | Ga0495619_0035198_1884_2810 | 289 |
| 68 | iso_pu_bacteria | 2879127579 | 2879130532 | 300 |
| 69 | 3300035118 | Ga0373954_0001018 | Ga0373954_0001018_2634_3539 | 301 |
| 70 | 3300035119 | Ga0373956_0006210 | Ga0373956_0006210_1392_2297 | 301 |
| 71 | 3300035410 | Ga0373924_0015542 | Ga0373924_0015542_1248_2153 | 301 |
| 72 | 3300035724 | Ga0373933_0007968 | Ga0373933_0007968_3710_4615 | 301 |
| 73 | 3300036401 | Ga0373937_0053653 | Ga0373937_0053653_1432_2337 | 301 |
| 74 | 3300046454 | Ga0495592_0001464 | Ga0495592_0001464_2723_3628 | 301 |
| 75 | 3300046463 | Ga0495653_0047920 | Ga0495653_0047920_1133_2038 | 301 |
| 76 | 3300046511 | Ga0495608_0044163 | Ga0495608_0044163_1336_2241 | 301 |
| 77 | 3300046533 | Ga0495640_0028769 | Ga0495640_0028769_720_1625 | 301 |
| 78 | 3300046642 | Ga0495634_0028175 | Ga0495634_0028175_161_1066 | 301 |
| 79 | 3300046663 | Ga0495635_0000534 | Ga0495635_0000534_20932_21837 | 301 |
| 80 | 3300046675 | Ga0495657_0013808 | Ga0495657_0013808_3833_4738 | 301 |
| 81 | 3300046679 | Ga0495623_0013899 | Ga0495623_0013899_3466_4371 | 301 |
| 82 | 3300047317 | Ga0495604_0007158 | Ga0495604_0007158_6045_6950 | 301 |
| 83 | 3300047322 | Ga0495680_0008847 | Ga0495680_0008847_4219_5124 | 301 |
| 84 | 3300047444 | Ga0495675_0013658 | Ga0495675_0013658_1426_2331 | 301 |
| 85 | 3300047471 | Ga0495684_0001012 | Ga0495684_0001012_1133_2038 | 301 |
| 86 | 3300053085 | Ga0495619_0010930 | Ga0495619_0010930_1721_2626 | 301 |
| 87 | 3300032005 | Ga0307411_10241280 | Ga0307411_102412802 | 302 |
| 88 | 3300060353 | Ga0501082_0093156 | Ga0501082_0093156_78_986 | 302 |
| 89 | iso_pu_bacteria | 2602042107 | 2603862639 | 302 |
| 90 | iso_pu_bacteria | 2857524615 | 2857529988 | 302 |
| 91 | iso_pu_bacteria | 2893066018 | 2893071088 | 302 |
| 92 | iso_pu_bacteria | 2919073203 | 2919077159 | 302 |
| 93 | 3300005718 | Ga0068866_10079022 | Ga0068866_100790222 | 303 |
| 94 | iso_pu_bacteria | 2507262055 | 2507510984 | 303 |
| 95 | iso_pu_bacteria | 2508501009 | 2508544804 | 303 |
| 96 | iso_pu_bacteria | 2508501042 | 2508696970 | 303 |
| 97 | iso_pu_bacteria | 2508501128 | 2509148853 | 303 |
| 98 | iso_pu_bacteria | 2511231028 | 2511394106 | 303 |
| 99 | iso_pu_bacteria | 2513237092 | 2513623461 | 303 |
| 100 | iso_pu_bacteria | 2513237094 | 2513637499 | 303 |
| 101 | iso_pu_bacteria | 2513237095 | 2513649659 | 303 |
| 102 | iso_pu_bacteria | 2513237096 | 2513654995 | 303 |
| 103 | iso_pu_bacteria | 2513237098 | 2513679532 | 303 |
| 104 | iso_pu_bacteria | 2513237102 | 2513701429 | 303 |
| 105 | iso_pu_bacteria | 2513237104 | 2513716893 | 303 |
| 106 | iso_pu_bacteria | 2513237137 | 2513861015 | 303 |
| 107 | iso_pu_bacteria | 2513237139 | 2513874629 | 303 |
| 108 | iso_pu_bacteria | 2513237141 | 2513892060 | 303 |
| 109 | iso_pu_bacteria | 2513237145 | 2513915982 | 303 |
| 110 | iso_pu_bacteria | 2513237161 | 2514017569 | 303 |
| 111 | iso_pu_bacteria | 2515154112 | 2515625464 | 303 |
| 112 | iso_pu_bacteria | 2517093001 | 2517100567 | 303 |
| 113 | iso_pu_bacteria | 2517572143 | 2517894717 | 303 |
| 114 | iso_pu_bacteria | 2524023205 | 2524438211 | 303 |
| 115 | iso_pu_bacteria | 2524023210 | 2524464047 | 303 |
| 116 | iso_pu_bacteria | 2524023228 | 2524534466 | 303 |
| 117 | iso_pu_bacteria | 2528768022 | 2528849843 | 303 |
| 118 | iso_pu_bacteria | 2582581280 | 2585153989 | 303 |
| 119 | iso_pu_bacteria | 2582581293 | 2585194982 | 303 |
| 120 | iso_pu_bacteria | 2617270735 | 2617350753 | 303 |
| 121 | iso_pu_bacteria | 2643221552 | 2643780728 | 303 |
| 122 | iso_pu_bacteria | 2643221584 | 2643930018 | 303 |
| 123 | iso_pu_bacteria | 2667528175 | 2671119130 | 303 |
| 124 | iso_pu_bacteria | 2728368998 | 2728747628 | 303 |
| 125 | iso_pu_bacteria | 2744054633 | 2745076906 | 303 |
| 126 | iso_pu_bacteria | 2791355196 | 2793064637 | 303 |
| 127 | iso_pu_bacteria | 2791355197 | 2793071193 | 303 |
| 128 | iso_pu_bacteria | 2802429603 | 2805916626 | 303 |
| 129 | iso_pu_bacteria | 2816332527 | 2818238130 | 303 |
| 130 | iso_pu_bacteria | 2818991435 | 2819536098 | 303 |
| 131 | iso_pu_bacteria | 2818991454 | 2819644491 | 303 |
| 132 | iso_pu_bacteria | 2824600985 | 2824607984 | 303 |
| 133 | iso_pu_bacteria | 2824609381 | 2824616521 | 303 |
| 134 | iso_pu_bacteria | 2824617872 | 2824624677 | 303 |
| 135 | iso_pu_bacteria | 2824626560 | 2824633288 | 303 |
| 136 | iso_pu_bacteria | 2824635225 | 2824640640 | 303 |
| 137 | iso_pu_bacteria | 2824644064 | 2824649832 | 303 |
| 138 | iso_pu_bacteria | 2824653114 | 2824657823 | 303 |
| 139 | iso_pu_bacteria | 2824661429 | 2824670061 | 303 |
| 140 | iso_pu_bacteria | 2824671348 | 2824677254 | 303 |
| 141 | iso_pu_bacteria | 2824679649 | 2824683863 | 303 |
| 142 | iso_pu_bacteria | 2824687955 | 2824693688 | 303 |
| 143 | iso_pu_bacteria | 2824696289 | 2824702240 | 303 |
| 144 | iso_pu_bacteria | 2824704595 | 2824714338 | 303 |
| 145 | iso_pu_bacteria | 2824714736 | 2824720090 | 303 |
| 146 | iso_pu_bacteria | 2824723954 | 2824728492 | 303 |
| 147 | iso_pu_bacteria | 2824732956 | 2824737054 | 303 |
| 148 | iso_pu_bacteria | 2824753945 | 2824761837 | 303 |
| 149 | iso_pu_bacteria | 2824763712 | 2824772281 | 303 |
| 150 | iso_pu_bacteria | 2824773399 | 2824780829 | 303 |
| 151 | iso_pu_bacteria | 2838122688 | 2838127873 | 303 |
| 152 | iso_pu_bacteria | 2841941048 | 2841943166 | 303 |
| 153 | iso_pu_bacteria | 2841949485 | 2841956187 | 303 |
| 154 | iso_pu_bacteria | 2841957949 | 2841960244 | 303 |
| 155 | iso_pu_bacteria | 2841966195 | 2841968193 | 303 |
| 156 | iso_pu_bacteria | 2841974524 | 2841976596 | 303 |
| 157 | iso_pu_bacteria | 2841983080 | 2841987970 | 303 |
| 158 | iso_pu_bacteria | 2842038055 | 2842042727 | 303 |
| 159 | iso_pu_bacteria | 2842045827 | 2842050770 | 303 |
| 160 | iso_pu_bacteria | 2844315083 | 2844316940 | 303 |
| 161 | iso_pu_bacteria | 2847930680 | 2847938541 | 303 |
| 162 | iso_pu_bacteria | 2847939898 | 2847944260 | 303 |
| 163 | iso_pu_bacteria | 2849076700 | 2849081506 | 303 |
| 164 | iso_pu_bacteria | 2857509624 | 2857512167 | 303 |
| 165 | iso_pu_bacteria | 2874590934 | 2874597721 | 303 |
| 166 | iso_pu_bacteria | 2874612657 | 2874615793 | 303 |
| 167 | iso_pu_bacteria | 2874620515 | 2874623459 | 303 |
| 168 | iso_pu_bacteria | 2874628541 | 2874630631 | 303 |
| 169 | iso_pu_bacteria | 2874645413 | 2874651251 | 303 |
| 170 | iso_pu_bacteria | 2876761206 | 2876762430 | 303 |
| 171 | iso_pu_bacteria | 2876771140 | 2876776321 | 303 |
| 172 | iso_pu_bacteria | 2876818435 | 2876820889 | 303 |
| 173 | iso_pu_bacteria | 2879074833 | 2879081816 | 303 |
| 174 | iso_pu_bacteria | 2879083081 | 2879086215 | 303 |
| 175 | iso_pu_bacteria | 2879099564 | 2879101680 | 303 |
| 176 | iso_pu_bacteria | 2879142872 | 2879146418 | 303 |
| 177 | iso_pu_bacteria | 2881364244 | 2881370657 | 303 |
| 178 | iso_pu_bacteria | 2881665667 | 2881672708 | 303 |
| 179 | iso_pu_bacteria | 2885366525 | 2885366958 | 303 |
| 180 | iso_pu_bacteria | 2885374607 | 2885383332 | 303 |
| 181 | iso_pu_bacteria | 2885409591 | 2885413455 | 303 |
| 182 | iso_pu_bacteria | 2888378607 | 2888381551 | 303 |
| 183 | iso_pu_bacteria | 2888388044 | 2888389090 | 303 |
| 184 | iso_pu_bacteria | 2888419890 | 2888421950 | 303 |
| 185 | iso_pu_bacteria | 2903727486 | 2903733990 | 303 |
| 186 | iso_pu_bacteria | 2903748898 | 2903751401 | 303 |
| 187 | iso_pu_bacteria | 2903768456 | 2903777036 | 303 |
| 188 | iso_pu_bacteria | 2904666416 | 2904667310 | 303 |
| 189 | iso_pu_bacteria | 2904690495 | 2904696950 | 303 |
| 190 | iso_pu_bacteria | 2904699407 | 2904705761 | 303 |
| 191 | iso_pu_bacteria | 2904711408 | 2904719197 | 303 |
| 192 | iso_pu_bacteria | 2906602504 | 2906604606 | 303 |
| 193 | iso_pu_bacteria | 2906610324 | 2906611440 | 303 |
| 194 | iso_pu_bacteria | 2906626472 | 2906629300 | 303 |
| 195 | iso_pu_bacteria | 2906635258 | 2906640994 | 303 |
| 196 | iso_pu_bacteria | 2906643746 | 2906651546 | 303 |
| 197 | iso_pu_bacteria | 2906660503 | 2906660827 | 303 |
| 198 | iso_pu_bacteria | 2908739725 | 2908745028 | 303 |
| 199 | iso_pu_bacteria | 2908756301 | 2908757203 | 303 |
| 200 | iso_pu_bacteria | 2908775508 | 2908782088 | 303 |
| 201 | iso_pu_bacteria | 2922368715 | 2922371216 | 303 |
| 202 | iso_pu_bacteria | 2922393267 | 2922393847 | 303 |
| 203 | iso_pu_bacteria | 2922425934 | 2922427917 | 303 |
| 204 | iso_pu_bacteria | 2929615660 | 2929619601 | 303 |
| 205 | iso_pu_bacteria | 2929624759 | 2929627929 | 303 |
| 206 | iso_pu_bacteria | 2932784394 | 2932785930 | 303 |
| 207 | iso_pu_bacteria | 2932794094 | 2932798286 | 303 |
| 208 | iso_pu_bacteria | 2932801729 | 2932804082 | 303 |
| 209 | iso_pu_bacteria | 2932809354 | 2932817302 | 303 |
| 210 | iso_pu_bacteria | 2932818245 | 2932826899 | 303 |
| 211 | iso_pu_bacteria | 2932828146 | 2932830974 | 303 |
| 212 | iso_pu_bacteria | 2933577622 | 2933581521 | 303 |
| 213 | iso_pu_bacteria | 2935608549 | 2935612779 | 303 |
| 214 | iso_pu_bacteria | 2935616580 | 2935621039 | 303 |
| 215 | iso_pu_bacteria | 2935630451 | 2935632151 | 303 |
| 216 | iso_pu_bacteria | 2935638405 | 2935640115 | 303 |
| 217 | iso_pu_bacteria | 2935648319 | 2935655426 | 303 |
| 218 | iso_pu_bacteria | 2935656913 | 2935664273 | 303 |
| 219 | iso_pu_bacteria | 2935665750 | 2935667046 | 303 |
| 220 | iso_pu_bacteria | 2935675223 | 2935680310 | 303 |
| 221 | iso_pu_bacteria | 2935684952 | 2935690178 | 303 |
| 222 | iso_pu_bacteria | 2935694250 | 2935699736 | 303 |
| 223 | iso_pu_bacteria | 2935703347 | 2935704802 | 303 |
| 224 | iso_pu_bacteria | 2935713505 | 2935718126 | 303 |
| 225 | iso_pu_bacteria | 2935722832 | 2935726724 | 303 |
| 226 | iso_pu_bacteria | 2935732158 | 2935735493 | 303 |
| 227 | iso_pu_bacteria | 2935741537 | 2935745236 | 303 |
| 228 | iso_pu_bacteria | 2935750917 | 2935755189 | 303 |
| 229 | iso_pu_bacteria | 2935760218 | 2935762295 | 303 |
| 230 | iso_pu_bacteria | 2935769743 | 2935773689 | 303 |
| 231 | iso_pu_bacteria | 2935777560 | 2935780241 | 303 |
| 232 | iso_pu_bacteria | 2935785616 | 2935788406 | 303 |
| 233 | iso_pu_bacteria | 2935793552 | 2935796563 | 303 |
| 234 | iso_pu_bacteria | 2935801545 | 2935803796 | 303 |
| 235 | iso_pu_bacteria | 2935810662 | 2935811713 | 303 |
| 236 | iso_pu_bacteria | 2935819856 | 2935824269 | 303 |
| 237 | iso_pu_bacteria | 2935827899 | 2935829598 | 303 |
| 238 | iso_pu_bacteria | 2935837841 | 2935843068 | 303 |
| 239 | iso_pu_bacteria | 2935847175 | 2935852585 | 303 |
| 240 | iso_pu_bacteria | 2935855204 | 2935858846 | 303 |
| 241 | iso_pu_bacteria | 2935864058 | 2935866756 | 303 |
| 242 | iso_pu_bacteria | 2935873716 | 2935876887 | 303 |
| 243 | iso_pu_bacteria | 2935883170 | 2935884112 | 303 |
| 244 | iso_pu_bacteria | 2935908558 | 2935912268 | 303 |
| 245 | iso_pu_bacteria | 2935916978 | 2935924058 | 303 |
| 246 | iso_pu_bacteria | 2935926038 | 2935929297 | 303 |
| 247 | iso_pu_bacteria | 2935934488 | 2935935928 | 303 |
| 248 | iso_pu_bacteria | 2935942939 | 2935950436 | 303 |
| 249 | iso_pu_bacteria | 2935951376 | 2935957406 | 303 |
| 250 | iso_pu_bacteria | 2935959822 | 2935962066 | 303 |
| 251 | iso_pu_bacteria | 2935967501 | 2935968437 | 303 |
| 252 | iso_pu_bacteria | 2935975950 | 2935976625 | 303 |
| 253 | iso_pu_bacteria | 2935984226 | 2935987931 | 303 |
| 254 | iso_pu_bacteria | 2935992306 | 2935993476 | 303 |
| 255 | iso_pu_bacteria | 2936002035 | 2936004371 | 303 |
| 256 | iso_pu_bacteria | 2936011229 | 2936018343 | 303 |
| 257 | iso_pu_bacteria | 2936019824 | 2936026894 | 303 |
| 258 | iso_pu_bacteria | 2936028420 | 2936035742 | 303 |
| 259 | iso_pu_bacteria | 2936037263 | 2936038295 | 303 |
| 260 | iso_pu_bacteria | 2936046547 | 2936053821 | 303 |
| 261 | iso_pu_bacteria | 2936055302 | 2936058635 | 303 |
| 262 | iso_pu_bacteria | 2940556831 | 2940561531 | 303 |
| 263 | iso_pu_bacteria | 2941507105 | 2941508099 | 303 |
| 264 | iso_pu_bacteria | 2941515067 | 2941515396 | 303 |
| 265 | iso_pu_bacteria | 2941523033 | 2941524029 | 303 |
| 266 | iso_pu_bacteria | 2941531003 | 2941533725 | 303 |
| 267 | iso_pu_bacteria | 2941538514 | 2941544292 | 303 |
| 268 | iso_pu_bacteria | 3005474847 | 3005477631 | 303 |
| 269 | iso_pu_bacteria | 3005506211 | 3005507147 | 303 |
| 270 | iso_pu_bacteria | 3005587118 | 3005594514 | 303 |
| 271 | iso_pu_bacteria | 3005594810 | 3005596573 | 303 |
| 272 | iso_pu_bacteria | 3005710791 | 3005712650 | 303 |
| 273 | iso_pu_bacteria | 3005718088 | 3005719701 | 303 |
| 274 | iso_pu_bacteria | 8006926726 | 8006931833 | 303 |
| 275 | iso_pu_bacteria | 8006933436 | 8006933585 | 303 |
| 276 | iso_pu_bacteria | 8006973647 | 8006983258 | 303 |
| 277 | iso_pu_bacteria | 8016511872 | 8016516412 | 303 |
| 278 | iso_pu_bacteria | 8016522445 | 8016523796 | 303 |
| 279 | iso_pu_bacteria | 8016530956 | 8016537328 | 303 |
| 280 | iso_pu_bacteria | 8016548790 | 8016551670 | 303 |
| 281 | iso_pu_bacteria | 8016557553 | 8016560058 | 303 |
| 282 | iso_pu_bacteria | 8016566248 | 8016566981 | 303 |
| 283 | iso_pu_bacteria | 8016575299 | 8016579704 | 303 |
| 284 | iso_pu_bacteria | 8016595262 | 8016597981 | 303 |
| 285 | iso_pu_bacteria | 8016603502 | 8016604112 | 303 |
| 286 | iso_pu_bacteria | 8016613128 | 8016620695 | 303 |
| 287 | iso_pu_bacteria | 8016622563 | 8016629298 | 303 |
| 288 | iso_pu_bacteria | 8016630954 | 8016633819 | 303 |
| 289 | iso_pu_bacteria | 8017057580 | 8017060126 | 303 |
| 290 | iso_pu_bacteria | 8019530166 | 8019537011 | 303 |
| 291 | iso_pu_bacteria | 8019538911 | 8019542520 | 303 |
| 292 | iso_pu_bacteria | 8019547302 | 8019548228 | 303 |
| 293 | iso_pu_bacteria | 8019555841 | 8019559523 | 303 |
| 294 | iso_pu_bacteria | 8019565922 | 8019569625 | 303 |
| 295 | iso_pu_bacteria | 8019576017 | 8019579638 | 303 |
| 296 | iso_pu_bacteria | 8019586578 | 8019587347 | 303 |
| 297 | iso_pu_bacteria | 8019597564 | 8019603994 | 303 |
| 298 | iso_pu_bacteria | 8019619141 | 8019625169 | 303 |
| 299 | iso_pu_bacteria | 8019629233 | 8019637011 | 303 |
| 300 | iso_pu_bacteria | 8019648815 | 8019649994 | 303 |
| 301 | iso_pu_bacteria | 8019659431 | 8019664851 | 303 |
| 302 | iso_pu_bacteria | 8019668869 | 8019674414 | 303 |
| 303 | iso_pu_bacteria | 8019678201 | 8019681692 | 303 |
| 304 | iso_pu_bacteria | 8019687851 | 8019694085 | 303 |
| 305 | iso_pu_bacteria | 8055742211 | 8055749142 | 303 |
| 306 | iso_pu_bacteria | 8056681323 | 8056682408 | 303 |
| 307 | iso_pu_bacteria | 8056689827 | 8056695142 | 303 |
| 308 | iso_pu_bacteria | 8056967851 | 8056969990 | 303 |
| 309 | 3300049573 | Ga0501037_0015791 | Ga0501037_0015791_3670_4584 | 304 |
| 310 | iso_pu_bacteria | 2585428106 | 2587919016 | 304 |
| 311 | iso_pu_bacteria | 2643221560 | 2643822842 | 304 |
| 312 | iso_pu_bacteria | 2643221640 | 2644227572 | 304 |
| 313 | iso_pu_bacteria | 2643221642 | 2644236910 | 304 |
| 314 | iso_pu_bacteria | 2928531327 | 2928531712 | 304 |
| 315 | 3300001979 | JGI24740J21852_10001722 | JGI24740J21852_100017223 | 305 |
| 316 | 3300001989 | JGI24739J22299_10010924 | JGI24739J22299_100109242 | 305 |
| 317 | 3300001989 | JGI24739J22299_10050347 | JGI24739J22299_100503472 | 305 |
| 318 | 3300001990 | JGI24737J22298_10003780 | JGI24737J22298_100037806 | 305 |
| 319 | 3300002067 | JGI24735J21928_10019123 | JGI24735J21928_100191232 | 305 |
| 320 | 3300005439 | Ga0070711_100295171 | Ga0070711_1002951711 | 305 |
| 321 | 3300005455 | Ga0070663_100045017 | Ga0070663_1000450174 | 305 |
| 322 | 3300005539 | Ga0068853_100022528 | Ga0068853_1000225285 | 305 |
| 323 | 3300005577 | Ga0068857_100053613 | Ga0068857_1000536134 | 305 |
| 324 | 3300005578 | Ga0068854_100027437 | Ga0068854_1000274374 | 305 |
| 325 | 3300005578 | Ga0068854_100030387 | Ga0068854_1000303873 | 305 |
| 326 | 3300005614 | Ga0068856_100012506 | Ga0068856_1000125065 | 305 |
| 327 | 3300005614 | Ga0068856_100015546 | Ga0068856_1000155465 | 305 |
| 328 | 3300005834 | Ga0068851_10008009 | Ga0068851_100080095 | 305 |
| 329 | 3300005843 | Ga0068860_100000291 | Ga0068860_10000029163 | 305 |
| 330 | 3300009093 | Ga0105240_10008489 | Ga0105240_100084899 | 305 |
| 331 | 3300009174 | Ga0105241_10008896 | Ga0105241_100088965 | 305 |
| 332 | 3300009545 | Ga0105237_10025117 | Ga0105237_100251176 | 305 |
| 333 | 3300009545 | Ga0105237_10042051 | Ga0105237_100420513 | 305 |
| 334 | 3300009551 | Ga0105238_10003337 | Ga0105238_1000333711 | 305 |
| 335 | 3300009551 | Ga0105238_10030700 | Ga0105238_100307003 | 305 |
| 336 | 3300010375 | Ga0105239_10024151 | Ga0105239_100241514 | 305 |
| 337 | 3300025904 | Ga0207647_10008208 | Ga0207647_100082087 | 305 |
| 338 | 3300025911 | Ga0207654_10004616 | Ga0207654_100046166 | 305 |
| 339 | 3300025913 | Ga0207695_10000497 | Ga0207695_1000049746 | 305 |
| 340 | 3300025924 | Ga0207694_10000571 | Ga0207694_100005716 | 305 |
| 341 | 3300025949 | Ga0207667_10007625 | Ga0207667_100076257 | 305 |
| 342 | 3300025949 | Ga0207667_10017824 | Ga0207667_100178249 | 305 |
| 343 | 3300025981 | Ga0207640_10311113 | Ga0207640_103111132 | 305 |
| 344 | 3300026041 | Ga0207639_10025640 | Ga0207639_100256403 | 305 |
| 345 | 3300026078 | Ga0207702_10000003 | Ga0207702_10000003421 | 305 |
| 346 | 3300026078 | Ga0207702_10042079 | Ga0207702_100420792 | 305 |
| 347 | 3300026116 | Ga0207674_10005049 | Ga0207674_1000504910 | 305 |
| 348 | 3300026116 | Ga0207674_10007537 | Ga0207674_100075377 | 305 |
| 349 | 3300026142 | Ga0207698_10065911 | Ga0207698_100659112 | 305 |
| 350 | 3300028381 | Ga0268264_10000093 | Ga0268264_1000009391 | 305 |
| 351 | 3300030521 | Ga0307511_10073605 | Ga0307511_100736053 | 305 |
| 352 | 3300031616 | Ga0307508_10114972 | Ga0307508_101149722 | 305 |
| 353 | 3300031730 | Ga0307516_10018834 | Ga0307516_100188345 | 305 |
| 354 | 3300031730 | Ga0307516_10136943 | Ga0307516_101369432 | 305 |
| 355 | 3300033180 | Ga0307510_10190883 | Ga0307510_101908832 | 305 |
| 356 | 3300035692 | Ga0373935_0093548 | Ga0373935_0093548_775_1692 | 305 |
| 357 | 3300037068 | Ga0373925_0106024 | Ga0373925_0106024_372_1289 | 305 |
| 358 | 3300048909 | Ga0496106_0001465 | Ga0496106_0001465_16157_17074 | 305 |
| 359 | 3300048909 | Ga0496106_0013066 | Ga0496106_0013066_347_1264 | 305 |
| 360 | 3300048910 | Ga0496107_0005951 | Ga0496107_0005951_6977_7894 | 305 |
| 361 | 3300048911 | Ga0496108_0003684 | Ga0496108_0003684_729_1646 | 305 |
| 362 | 3300048911 | Ga0496108_0138139 | Ga0496108_0138139_962_1879 | 305 |
| 363 | 3300048912 | Ga0496109_0000361 | Ga0496109_0000361_20071_20988 | 305 |
| 364 | 3300048913 | Ga0496110_0039424 | Ga0496110_0039424_106_1023 | 305 |
| 365 | 3300048917 | Ga0496114_0307180 | Ga0496114_0307180_75_992 | 305 |
| 366 | 3300048920 | Ga0496117_0008447 | Ga0496117_0008447_3846_4763 | 305 |
| 367 | 3300048924 | Ga0496121_0000381 | Ga0496121_0000381_72357_73274 | 305 |
| 368 | 3300048927 | Ga0496124_0007279 | Ga0496124_0007279_5895_6812 | 305 |
| 369 | 3300048929 | Ga0496126_0021093 | Ga0496126_0021093_5012_5929 | 305 |
| 370 | 3300053094 | Ga0500566_0064905 | Ga0500566_0064905_1005_1922 | 305 |
| 371 | 3300053153 | Ga0500616_0046615 | Ga0500616_0046615_451_1368 | 305 |
| 372 | 3300053735 | Ga0500596_008194 | Ga0500596_008194_49_966 | 305 |
| 373 | 3300003771 | Ga0055526_1022934 | Ga0055526_10229342 | 306 |
| 374 | 3300005983 | Ga0081540_1000390 | Ga0081540_100039023 | 306 |
| 375 | 3300006038 | Ga0075365_10028872 | Ga0075365_100288722 | 306 |
| 376 | 3300006038 | Ga0075365_10038398 | Ga0075365_100383983 | 306 |
| 377 | 3300006177 | Ga0075362_10007719 | Ga0075362_100077195 | 306 |
| 378 | 3300006195 | Ga0075366_10004643 | Ga0075366_100046435 | 306 |
| 379 | 3300009101 | Ga0105247_10063961 | Ga0105247_100639612 | 306 |
| 380 | 3300009101 | Ga0105247_10206795 | Ga0105247_102067952 | 306 |
| 381 | 3300009177 | Ga0105248_10388333 | Ga0105248_103883332 | 306 |
| 382 | 3300009551 | Ga0105238_10014305 | Ga0105238_100143056 | 306 |
| 383 | 3300013102 | Ga0157371_10016826 | Ga0157371_100168262 | 306 |
| 384 | 3300025295 | Ga0209564_1000485 | Ga0209564_10004855 | 306 |
| 385 | 3300025297 | Ga0209758_1001510 | Ga0209758_10015103 | 306 |
| 386 | 3300025900 | Ga0207710_10019353 | Ga0207710_100193532 | 306 |
| 387 | 3300025940 | Ga0207691_10156266 | Ga0207691_101562662 | 306 |
| 388 | 3300025941 | Ga0207711_10285779 | Ga0207711_102857792 | 306 |
| 389 | 3300025986 | Ga0207658_10039104 | Ga0207658_100391044 | 306 |
| 390 | 3300026035 | Ga0207703_10127623 | Ga0207703_101276232 | 306 |
| 391 | 3300026035 | Ga0207703_10411496 | Ga0207703_104114961 | 306 |
| 392 | 3300028379 | Ga0268266_10334645 | Ga0268266_103346452 | 306 |
| 393 | 3300028558 | Ga0265326_10014656 | Ga0265326_100146562 | 306 |
| 394 | 3300028563 | Ga0265319_1020513 | Ga0265319_10205133 | 306 |
| 395 | 3300028573 | Ga0265334_10014240 | Ga0265334_100142404 | 306 |
| 396 | 3300028653 | Ga0265323_10001197 | Ga0265323_100011975 | 306 |
| 397 | 3300028666 | Ga0265336_10001290 | Ga0265336_100012908 | 306 |
| 398 | 3300028800 | Ga0265338_10000328 | Ga0265338_1000032848 | 306 |
| 399 | 3300029957 | Ga0265324_10012383 | Ga0265324_100123832 | 306 |
| 400 | 3300034818 | Ga0373950_0002953 | Ga0373950_0002953_53_1003 | 306 |
| 401 | 3300038443 | Ga0395901_0250401 | Ga0395901_0250401_569_1489 | 306 |
| 402 | 3300039437 | Ga0436365_1496755 | Ga0436365_1496755_360_1349 | 306 |
| 403 | 3300046460 | Ga0495638_0000011 | Ga0495638_0000011_329290_330228 | 306 |
| 404 | 3300046460 | Ga0495638_0107859 | Ga0495638_0107859_118_1038 | 306 |
| 405 | 3300046501 | Ga0495607_0149737 | Ga0495607_0149737_177_1097 | 306 |
| 406 | 3300046506 | Ga0495583_0000242 | Ga0495583_0000242_81604_82542 | 306 |
| 407 | 3300046512 | Ga0495610_0037940 | Ga0495610_0037940_1074_1994 | 306 |
| 408 | 3300046515 | Ga0495620_0039614 | Ga0495620_0039614_516_1436 | 306 |
| 409 | 3300046519 | Ga0495632_0000638 | Ga0495632_0000638_24130_25068 | 306 |
| 410 | 3300046524 | Ga0495648_0000023 | Ga0495648_0000023_127010_127948 | 306 |
| 411 | 3300046524 | Ga0495648_0001628 | Ga0495648_0001628_10063_10983 | 306 |
| 412 | 3300046557 | Ga0495622_0043754 | Ga0495622_0043754_395_1315 | 306 |
| 413 | 3300046558 | Ga0495633_0005929 | Ga0495633_0005929_1565_2503 | 306 |
| 414 | 3300046692 | Ga0495671_0000012 | Ga0495671_0000012_104252_105190 | 306 |
| 415 | 3300046810 | Ga0495660_0078731 | Ga0495660_0078731_779_1699 | 306 |
| 416 | 3300047320 | Ga0495672_0004036 | Ga0495672_0004036_754_1674 | 306 |
| 417 | 3300047320 | Ga0495672_0119074 | Ga0495672_0119074_217_1137 | 306 |
| 418 | 3300047469 | Ga0495673_0000029 | Ga0495673_0000029_253443_254381 | 306 |
| 419 | 3300047472 | Ga0495686_0095766 | Ga0495686_0095766_865_1785 | 306 |
| 420 | 3300048091 | Ga0495626_0065051 | Ga0495626_0065051_350_1270 | 306 |
| 421 | 3300048904 | Ga0496101_0122894 | Ga0496101_0122894_1021_1941 | 306 |
| 422 | 3300048907 | Ga0496104_0163695 | Ga0496104_0163695_843_1796 | 306 |
| 423 | 3300048908 | Ga0496105_0135683 | Ga0496105_0135683_33_986 | 306 |
| 424 | 3300048919 | Ga0496116_0003172 | Ga0496116_0003172_2584_3504 | 306 |
| 425 | 3300048920 | Ga0496117_0021988 | Ga0496117_0021988_1441_2361 | 306 |
| 426 | 3300048920 | Ga0496117_0129765 | Ga0496117_0129765_461_1381 | 306 |
| 427 | 3300048921 | Ga0496118_0054949 | Ga0496118_0054949_509_1429 | 306 |
| 428 | 3300048922 | Ga0496119_0067340 | Ga0496119_0067340_267_1187 | 306 |
| 429 | 3300048923 | Ga0496120_0066833 | Ga0496120_0066833_955_1875 | 306 |
| 430 | 3300048924 | Ga0496121_0012055 | Ga0496121_0012055_368_1288 | 306 |
| 431 | 3300048924 | Ga0496121_0025417 | Ga0496121_0025417_3994_4914 | 306 |
| 432 | 3300048926 | Ga0496123_0101798 | Ga0496123_0101798_589_1509 | 306 |
| 433 | 3300048927 | Ga0496124_0381178 | Ga0496124_0381178_19_939 | 306 |
| 434 | 3300048928 | Ga0496125_0000654 | Ga0496125_0000654_54674_55594 | 306 |
| 435 | 3300048928 | Ga0496125_0001646 | Ga0496125_0001646_12767_13687 | 306 |
| 436 | 3300048928 | Ga0496125_0037567 | Ga0496125_0037567_2972_3892 | 306 |
| 437 | 3300048928 | Ga0496125_0099925 | Ga0496125_0099925_100_1020 | 306 |
| 438 | 3300048929 | Ga0496126_0005477 | Ga0496126_0005477_8810_9730 | 306 |
| 439 | 3300048929 | Ga0496126_0014823 | Ga0496126_0014823_1684_2604 | 306 |
| 440 | 3300049568 | Ga0501031_0017863 | Ga0501031_0017863_1349_2269 | 306 |
| 441 | 3300049568 | Ga0501031_0074919 | Ga0501031_0074919_400_1320 | 306 |
| 442 | 3300049569 | Ga0501032_0000269 | Ga0501032_0000269_34913_35833 | 306 |
| 443 | 3300049569 | Ga0501032_0011788 | Ga0501032_0011788_3433_4353 | 306 |
| 444 | 3300049569 | Ga0501032_0092312 | Ga0501032_0092312_334_1254 | 306 |
| 445 | 3300049570 | Ga0501033_0000249 | Ga0501033_0000249_341_1261 | 306 |
| 446 | 3300049570 | Ga0501033_0007545 | Ga0501033_0007545_3388_4308 | 306 |
| 447 | 3300049570 | Ga0501033_0022581 | Ga0501033_0022581_1578_2498 | 306 |
| 448 | 3300049571 | Ga0501034_0000039 | Ga0501034_0000039_3911_4831 | 306 |
| 449 | 3300049571 | Ga0501034_0042660 | Ga0501034_0042660_1304_2224 | 306 |
| 450 | 3300049571 | Ga0501034_0058977 | Ga0501034_0058977_1047_1967 | 306 |
| 451 | 3300049571 | Ga0501034_0205154 | Ga0501034_0205154_760_1680 | 306 |
| 452 | 3300049571 | Ga0501034_0450712 | Ga0501034_0450712_255_1175 | 306 |
| 453 | 3300049572 | Ga0501036_0000899 | Ga0501036_0000899_1363_2283 | 306 |
| 454 | 3300049572 | Ga0501036_0046557 | Ga0501036_0046557_1228_2148 | 306 |
| 455 | 3300049572 | Ga0501036_0179267 | Ga0501036_0179267_494_1414 | 306 |
| 456 | 3300049573 | Ga0501037_0000112 | Ga0501037_0000112_1804_2724 | 306 |
| 457 | 3300049573 | Ga0501037_0021022 | Ga0501037_0021022_1519_2439 | 306 |
| 458 | 3300049573 | Ga0501037_0053072 | Ga0501037_0053072_818_1738 | 306 |
| 459 | 3300049574 | Ga0501038_0000727 | Ga0501038_0000727_21553_22473 | 306 |
| 460 | 3300049574 | Ga0501038_0013255 | Ga0501038_0013255_3684_4604 | 306 |
| 461 | 3300049574 | Ga0501038_0017301 | Ga0501038_0017301_5263_6183 | 306 |
| 462 | 3300049574 | Ga0501038_0028682 | Ga0501038_0028682_2948_3868 | 306 |
| 463 | 3300049574 | Ga0501038_0220246 | Ga0501038_0220246_372_1292 | 306 |
| 464 | 3300049574 | Ga0501038_0323811 | Ga0501038_0323811_49_969 | 306 |
| 465 | 3300049575 | Ga0501039_0024000 | Ga0501039_0024000_3468_4388 | 306 |
| 466 | 3300049576 | Ga0501040_0008040 | Ga0501040_0008040_4225_5145 | 306 |
| 467 | 3300049578 | Ga0501042_0030617 | Ga0501042_0030617_69_989 | 306 |
| 468 | 3300049578 | Ga0501042_0051603 | Ga0501042_0051603_840_1760 | 306 |
| 469 | 3300049579 | Ga0501043_0004641 | Ga0501043_0004641_8410_9330 | 306 |
| 470 | 3300049579 | Ga0501043_0018381 | Ga0501043_0018381_698_1618 | 306 |
| 471 | 3300049579 | Ga0501043_0124807 | Ga0501043_0124807_41_961 | 306 |
| 472 | 3300049579 | Ga0501043_0141018 | Ga0501043_0141018_516_1436 | 306 |
| 473 | 3300049580 | Ga0501046_0006020 | Ga0501046_0006020_8633_9553 | 306 |
| 474 | 3300049580 | Ga0501046_0037594 | Ga0501046_0037594_884_1804 | 306 |
| 475 | 3300049581 | Ga0501047_0002128 | Ga0501047_0002128_16472_17392 | 306 |
| 476 | 3300049581 | Ga0501047_0114372 | Ga0501047_0114372_695_1615 | 306 |
| 477 | 3300049581 | Ga0501047_0133657 | Ga0501047_0133657_555_1475 | 306 |
| 478 | 3300049582 | Ga0501048_0000677 | Ga0501048_0000677_18413_19333 | 306 |
| 479 | 3300049582 | Ga0501048_0024279 | Ga0501048_0024279_2128_3048 | 306 |
| 480 | 3300049583 | Ga0501067_0003780 | Ga0501067_0003780_1754_2674 | 306 |
| 481 | 3300049583 | Ga0501067_0005792 | Ga0501067_0005792_1656_2576 | 306 |
| 482 | 3300049584 | Ga0501068_0021310 | Ga0501068_0021310_859_1779 | 306 |
| 483 | 3300049584 | Ga0501068_0041830 | Ga0501068_0041830_46_966 | 306 |
| 484 | 3300049585 | Ga0501069_0005343 | Ga0501069_0005343_421_1341 | 306 |
| 485 | 3300049585 | Ga0501069_0018370 | Ga0501069_0018370_1972_2892 | 306 |
| 486 | 3300049586 | Ga0501070_0071480 | Ga0501070_0071480_75_995 | 306 |
| 487 | 3300049586 | Ga0501070_0087502 | Ga0501070_0087502_1577_2497 | 306 |
| 488 | 3300049587 | Ga0501071_0044143 | Ga0501071_0044143_555_1475 | 306 |
| 489 | 3300049587 | Ga0501071_0085263 | Ga0501071_0085263_28_948 | 306 |
| 490 | 3300049588 | Ga0501072_0078654 | Ga0501072_0078654_906_1826 | 306 |
| 491 | 3300049589 | Ga0501073_0000103 | Ga0501073_0000103_45206_46126 | 306 |
| 492 | 3300049589 | Ga0501073_0011859 | Ga0501073_0011859_2007_2927 | 306 |
| 493 | 3300049589 | Ga0501073_0129940 | Ga0501073_0129940_369_1289 | 306 |
| 494 | 3300049590 | Ga0501074_0000203 | Ga0501074_0000203_7965_8885 | 306 |
| 495 | 3300049590 | Ga0501074_0015716 | Ga0501074_0015716_1720_2640 | 306 |
| 496 | 3300049741 | Ga0501079_0009511 | Ga0501079_0009511_1686_2606 | 306 |
| 497 | 3300049741 | Ga0501079_0099424 | Ga0501079_0099424_1174_2094 | 306 |
| 498 | 3300049742 | Ga0501080_0002271 | Ga0501080_0002271_7785_8705 | 306 |
| 499 | 3300049742 | Ga0501080_0102862 | Ga0501080_0102862_912_1832 | 306 |
| 500 | 3300049742 | Ga0501080_0361282 | Ga0501080_0361282_244_1164 | 306 |
| 501 | 3300049744 | Ga0501083_0001959 | Ga0501083_0001959_11445_12365 | 306 |
| 502 | 3300049744 | Ga0501083_0027454 | Ga0501083_0027454_1304_2224 | 306 |
| 503 | 3300049822 | Ga0501035_0000523 | Ga0501035_0000523_10653_11573 | 306 |
| 504 | 3300049822 | Ga0501035_0056260 | Ga0501035_0056260_1130_2050 | 306 |
| 505 | 3300049822 | Ga0501035_0107764 | Ga0501035_0107764_1227_2147 | 306 |
| 506 | 3300049823 | Ga0501044_0000435 | Ga0501044_0000435_18783_19703 | 306 |
| 507 | 3300049823 | Ga0501044_0012897 | Ga0501044_0012897_3914_4834 | 306 |
| 508 | 3300049823 | Ga0501044_0081364 | Ga0501044_0081364_781_1701 | 306 |
| 509 | 3300049823 | Ga0501044_0083035 | Ga0501044_0083035_381_1301 | 306 |
| 510 | 3300049823 | Ga0501044_0204578 | Ga0501044_0204578_798_1718 | 306 |
| 511 | 3300049824 | Ga0501045_0027706 | Ga0501045_0027706_1175_2095 | 306 |
| 512 | 3300050492 | nmdc:mga0yw44_33309_c1 | nmdc:mga0yw44_33309_c1_957_1877 | 306 |
| 513 | 3300050493 | nmdc:mga0k408_14562_c1 | nmdc:mga0k408_14562_c1_1026_1946 | 306 |
| 514 | 3300050496 | nmdc:mga07m45_94390_c1 | nmdc:mga07m45_94390_c1_682_1602 | 306 |
| 515 | 3300050516 | nmdc:mga0sz30_14198_c1 | nmdc:mga0sz30_14198_c1_223_1143 | 306 |
| 516 | 3300053088 | Ga0500644_0020013 | Ga0500644_0020013_317_1237 | 306 |
| 517 | 3300053089 | Ga0500581_163710 | Ga0500581_163710_64_984 | 306 |
| 518 | 3300053090 | Ga0500646_0055049 | Ga0500646_0055049_124_1044 | 306 |
| 519 | 3300053093 | Ga0500651_0002754 | Ga0500651_0002754_6106_7026 | 306 |
| 520 | 3300053093 | Ga0500651_0064251 | Ga0500651_0064251_1158_2078 | 306 |
| 521 | 3300053093 | Ga0500651_0199738 | Ga0500651_0199738_161_1081 | 306 |
| 522 | 3300053094 | Ga0500566_0019250 | Ga0500566_0019250_2965_3885 | 306 |
| 523 | 3300053096 | Ga0500641_0124741 | Ga0500641_0124741_145_1065 | 306 |
| 524 | 3300053098 | Ga0500650_0042653 | Ga0500650_0042653_794_1714 | 306 |
| 525 | 3300053104 | Ga0500556_0000202 | Ga0500556_0000202_23274_24194 | 306 |
| 526 | 3300053108 | Ga0500562_040435 | Ga0500562_040435_69_989 | 306 |
| 527 | 3300053116 | Ga0500592_001569 | Ga0500592_001569_1638_2558 | 306 |
| 528 | 3300053119 | Ga0500595_010613 | Ga0500595_010613_425_1345 | 306 |
| 529 | 3300053122 | Ga0500608_003325 | Ga0500608_003325_1319_2239 | 306 |
| 530 | 3300053130 | Ga0500642_0000005 | Ga0500642_0000005_57410_58330 | 306 |
| 531 | 3300053131 | Ga0500652_001078 | Ga0500652_001078_1790_2710 | 306 |
| 532 | 3300053136 | Ga0500559_0000533 | Ga0500559_0000533_19686_20606 | 306 |
| 533 | 3300053139 | Ga0500568_0000865 | Ga0500568_0000865_10472_11392 | 306 |
| 534 | 3300053142 | Ga0500577_0000330 | Ga0500577_0000330_2301_3221 | 306 |
| 535 | 3300053148 | Ga0500590_063262 | Ga0500590_063262_571_1491 | 306 |
| 536 | 3300053151 | Ga0500604_0024547 | Ga0500604_0024547_197_1117 | 306 |
| 537 | 3300053153 | Ga0500616_0000166 | Ga0500616_0000166_55017_55994 | 306 |
| 538 | 3300053153 | Ga0500616_0000180 | Ga0500616_0000180_47967_48887 | 306 |
| 539 | 3300053156 | Ga0500622_0001180 | Ga0500622_0001180_9110_10030 | 306 |
| 540 | 3300053177 | Ga0500636_0000753 | Ga0500636_0000753_13692_14612 | 306 |
| 541 | 3300053727 | Ga0500611_003002 | Ga0500611_003002_725_1645 | 306 |
| 542 | 3300053730 | Ga0500645_016971 | Ga0500645_016971_55_975 | 306 |
| 543 | 3300054114 | Ga0501084_0003243 | Ga0501084_0003243_1794_2714 | 306 |
| 544 | 3300054114 | Ga0501084_0057636 | Ga0501084_0057636_1110_2030 | 306 |
| 545 | 3300060353 | Ga0501082_0008505 | Ga0501082_0008505_1758_2678 | 306 |
| 546 | 3300060353 | Ga0501082_0017509 | Ga0501082_0017509_3340_4260 | 306 |
| 547 | iso_pu_bacteria | 2721755755 | 2723843099 | 306 |
| 548 | iso_pu_bacteria | 2876808645 | 2876813739 | 306 |
| 549 | iso_pu_bacteria | 2879110137 | 2879118011 | 306 |
| 550 | iso_pu_bacteria | 8006964411 | 8006966505 | 306 |
| 551 | iso_pu_bacteria | 8006984368 | 8006989333 | 306 |
| 552 | 3300002067 | JGI24735J21928_10055274 | JGI24735J21928_100552741 | 307 |
| 553 | 3300003203 | JGI25406J46586_10000417 | JGI25406J46586_1000041716 | 307 |
| 554 | 3300003214 | JGI25165J46597_1004090 | JGI25165J46597_10040903 | 307 |
| 555 | 3300003215 | JGI25153J46596_10000758 | JGI25153J46596_1000075820 | 307 |
| 556 | 3300003215 | JGI25153J46596_10003729 | JGI25153J46596_100037299 | 307 |
| 557 | 3300003215 | JGI25153J46596_10014037 | JGI25153J46596_100140374 | 307 |
| 558 | 3300003794 | Ga0055531_10006207 | Ga0055531_100062072 | 307 |
| 559 | 3300004625 | Ga0055543_1002634 | Ga0055543_10026342 | 307 |
| 560 | 3300005262 | Ga0065165_1003855 | Ga0065165_10038552 | 307 |
| 561 | 3300005262 | Ga0065165_1003912 | Ga0065165_10039127 | 307 |
| 562 | 3300005329 | Ga0070683_100001787 | Ga0070683_1000017878 | 307 |
| 563 | 3300005329 | Ga0070683_100106508 | Ga0070683_1001065081 | 307 |
| 564 | 3300005334 | Ga0068869_100042272 | Ga0068869_1000422722 | 307 |
| 565 | 3300005336 | Ga0070680_100101893 | Ga0070680_1001018932 | 307 |
| 566 | 3300005336 | Ga0070680_100205146 | Ga0070680_1002051462 | 307 |
| 567 | 3300005338 | Ga0068868_100010593 | Ga0068868_1000105937 | 307 |
| 568 | 3300005339 | Ga0070660_100164229 | Ga0070660_1001642291 | 307 |
| 569 | 3300005344 | Ga0070661_100132338 | Ga0070661_1001323382 | 307 |
| 570 | 3300005345 | Ga0070692_10119582 | Ga0070692_101195821 | 307 |
| 571 | 3300005347 | Ga0070668_100051475 | Ga0070668_1000514752 | 307 |
| 572 | 3300005347 | Ga0070668_100165747 | Ga0070668_1001657472 | 307 |
| 573 | 3300005347 | Ga0070668_100216327 | Ga0070668_1002163272 | 307 |
| 574 | 3300005353 | Ga0070669_100107439 | Ga0070669_1001074392 | 307 |
| 575 | 3300005356 | Ga0070674_100111852 | Ga0070674_1001118522 | 307 |
| 576 | 3300005364 | Ga0070673_100122975 | Ga0070673_1001229752 | 307 |
| 577 | 3300005365 | Ga0070688_100148754 | Ga0070688_1001487542 | 307 |
| 578 | 3300005366 | Ga0070659_100178734 | Ga0070659_1001787342 | 307 |
| 579 | 3300005366 | Ga0070659_100290427 | Ga0070659_1002904272 | 307 |
| 580 | 3300005367 | Ga0070667_100159545 | Ga0070667_1001595452 | 307 |
| 581 | 3300005367 | Ga0070667_100214820 | Ga0070667_1002148202 | 307 |
| 582 | 3300005435 | Ga0070714_100075535 | Ga0070714_1000755354 | 307 |
| 583 | 3300005435 | Ga0070714_100224086 | Ga0070714_1002240862 | 307 |
| 584 | 3300005437 | Ga0070710_10227873 | Ga0070710_102278731 | 307 |
| 585 | 3300005441 | Ga0070700_100025371 | Ga0070700_1000253712 | 307 |
| 586 | 3300005445 | Ga0070708_100038211 | Ga0070708_1000382113 | 307 |
| 587 | 3300005455 | Ga0070663_100023864 | Ga0070663_1000238643 | 307 |
| 588 | 3300005455 | Ga0070663_100028764 | Ga0070663_1000287642 | 307 |
| 589 | 3300005455 | Ga0070663_100063781 | Ga0070663_1000637815 | 307 |
| 590 | 3300005455 | Ga0070663_100099842 | Ga0070663_1000998422 | 307 |
| 591 | 3300005456 | Ga0070678_100035825 | Ga0070678_1000358253 | 307 |
| 592 | 3300005456 | Ga0070678_100444534 | Ga0070678_1004445341 | 307 |
| 593 | 3300005457 | Ga0070662_100136863 | Ga0070662_1001368632 | 307 |
| 594 | 3300005458 | Ga0070681_10037621 | Ga0070681_100376212 | 307 |
| 595 | 3300005458 | Ga0070681_10074831 | Ga0070681_100748314 | 307 |
| 596 | 3300005530 | Ga0070679_100110405 | Ga0070679_1001104052 | 307 |
| 597 | 3300005535 | Ga0070684_100004074 | Ga0070684_1000040744 | 307 |
| 598 | 3300005536 | Ga0070697_100228562 | Ga0070697_1002285622 | 307 |
| 599 | 3300005539 | Ga0068853_100177647 | Ga0068853_1001776472 | 307 |
| 600 | 3300005539 | Ga0068853_100215276 | Ga0068853_1002152761 | 307 |
| 601 | 3300005544 | Ga0070686_100380259 | Ga0070686_1003802591 | 307 |
| 602 | 3300005547 | Ga0070693_100123521 | Ga0070693_1001235212 | 307 |
| 603 | 3300005548 | Ga0070665_100016851 | Ga0070665_1000168513 | 307 |
| 604 | 3300005548 | Ga0070665_100146031 | Ga0070665_1001460312 | 307 |
| 605 | 3300005548 | Ga0070665_100169819 | Ga0070665_1001698193 | 307 |
| 606 | 3300005563 | Ga0068855_100009486 | Ga0068855_1000094863 | 307 |
| 607 | 3300005563 | Ga0068855_100328561 | Ga0068855_1003285612 | 307 |
| 608 | 3300005577 | Ga0068857_100112078 | Ga0068857_1001120781 | 307 |
| 609 | 3300005578 | Ga0068854_100129454 | Ga0068854_1001294543 | 307 |
| 610 | 3300005614 | Ga0068856_100000091 | Ga0068856_10000009134 | 307 |
| 611 | 3300005614 | Ga0068856_100429726 | Ga0068856_1004297262 | 307 |
| 612 | 3300005615 | Ga0070702_100028554 | Ga0070702_1000285543 | 307 |
| 613 | 3300005618 | Ga0068864_100216993 | Ga0068864_1002169932 | 307 |
| 614 | 3300005618 | Ga0068864_100400248 | Ga0068864_1004002481 | 307 |
| 615 | 3300005719 | Ga0068861_100122352 | Ga0068861_1001223522 | 307 |
| 616 | 3300005834 | Ga0068851_10052554 | Ga0068851_100525542 | 307 |
| 617 | 3300005843 | Ga0068860_100425096 | Ga0068860_1004250962 | 307 |
| 618 | 3300005981 | Ga0081538_10027322 | Ga0081538_100273222 | 307 |
| 619 | 3300005983 | Ga0081540_1016027 | Ga0081540_10160273 | 307 |
| 620 | 3300005983 | Ga0081540_1082057 | Ga0081540_10820572 | 307 |
| 621 | 3300005985 | Ga0081539_10000748 | Ga0081539_1000074817 | 307 |
| 622 | 3300005985 | Ga0081539_10036857 | Ga0081539_100368572 | 307 |
| 623 | 3300006038 | Ga0075365_10063018 | Ga0075365_100630183 | 307 |
| 624 | 3300006042 | Ga0075368_10037876 | Ga0075368_100378762 | 307 |
| 625 | 3300006048 | Ga0075363_100055727 | Ga0075363_1000557272 | 307 |
| 626 | 3300006051 | Ga0075364_10347084 | Ga0075364_103470841 | 307 |
| 627 | 3300006175 | Ga0070712_100000719 | Ga0070712_10000071921 | 307 |
| 628 | 3300006195 | Ga0075366_10109101 | Ga0075366_101091012 | 307 |
| 629 | 3300006237 | Ga0097621_100216934 | Ga0097621_1002169342 | 307 |
| 630 | 3300006358 | Ga0068871_100070601 | Ga0068871_1000706012 | 307 |
| 631 | 3300006941 | Ga0099825_1018577 | Ga0099825_10185775 | 307 |
| 632 | 3300006942 | Ga0099824_1003213 | Ga0099824_100321311 | 307 |
| 633 | 3300006942 | Ga0099824_1004100 | Ga0099824_10041009 | 307 |
| 634 | 3300006943 | Ga0099822_1000022 | Ga0099822_100002238 | 307 |
| 635 | 3300006944 | Ga0099823_1033291 | Ga0099823_10332912 | 307 |
| 636 | 3300007265 | Ga0099794_10060679 | Ga0099794_100606792 | 307 |
| 637 | 3300007265 | Ga0099794_10131568 | Ga0099794_101315682 | 307 |
| 638 | 3300007788 | Ga0099795_10009035 | Ga0099795_100090352 | 307 |
| 639 | 3300007788 | Ga0099795_10013752 | Ga0099795_100137523 | 307 |
| 640 | 3300009093 | Ga0105240_10012704 | Ga0105240_100127044 | 307 |
| 641 | 3300009093 | Ga0105240_10458293 | Ga0105240_104582932 | 307 |
| 642 | 3300009094 | Ga0111539_10101733 | Ga0111539_101017333 | 307 |
| 643 | 3300009098 | Ga0105245_10146469 | Ga0105245_101464692 | 307 |
| 644 | 3300009101 | Ga0105247_10186632 | Ga0105247_101866322 | 307 |
| 645 | 3300009148 | Ga0105243_10050968 | Ga0105243_100509683 | 307 |
| 646 | 3300009174 | Ga0105241_10062186 | Ga0105241_100621862 | 307 |
| 647 | 3300009174 | Ga0105241_10065435 | Ga0105241_100654354 | 307 |
| 648 | 3300009176 | Ga0105242_10076170 | Ga0105242_100761703 | 307 |
| 649 | 3300009177 | Ga0105248_10419449 | Ga0105248_104194492 | 307 |
| 650 | 3300009177 | Ga0105248_10505818 | Ga0105248_105058181 | 307 |
| 651 | 3300009177 | Ga0105248_10508859 | Ga0105248_105088592 | 307 |
| 652 | 3300009545 | Ga0105237_10004071 | Ga0105237_1000407119 | 307 |
| 653 | 3300009545 | Ga0105237_10183408 | Ga0105237_101834082 | 307 |
| 654 | 3300009551 | Ga0105238_10171965 | Ga0105238_101719652 | 307 |
| 655 | 3300009551 | Ga0105238_10386627 | Ga0105238_103866271 | 307 |
| 656 | 3300009553 | Ga0105249_10139088 | Ga0105249_101390882 | 307 |
| 657 | 3300009553 | Ga0105249_10331615 | Ga0105249_103316152 | 307 |
| 658 | 3300010159 | Ga0099796_10004806 | Ga0099796_100048062 | 307 |
| 659 | 3300010375 | Ga0105239_10013946 | Ga0105239_100139466 | 307 |
| 660 | 3300010375 | Ga0105239_10084928 | Ga0105239_100849282 | 307 |
| 661 | 3300010375 | Ga0105239_10108631 | Ga0105239_101086312 | 307 |
| 662 | 3300010375 | Ga0105239_10310694 | Ga0105239_103106942 | 307 |
| 663 | 3300011119 | Ga0105246_10009199 | Ga0105246_100091996 | 307 |
| 664 | 3300011119 | Ga0105246_10033565 | Ga0105246_100335652 | 307 |
| 665 | 3300011119 | Ga0105246_10191470 | Ga0105246_101914702 | 307 |
| 666 | 3300013104 | Ga0157370_10149119 | Ga0157370_101491192 | 307 |
| 667 | 3300013105 | Ga0157369_10024576 | Ga0157369_100245764 | 307 |
| 668 | 3300013105 | Ga0157369_10103135 | Ga0157369_101031351 | 307 |
| 669 | 3300013308 | Ga0157375_10080802 | Ga0157375_100808022 | 307 |
| 670 | 3300013308 | Ga0157375_10427461 | Ga0157375_104274612 | 307 |
| 671 | 3300014325 | Ga0163163_10020785 | Ga0163163_100207852 | 307 |
| 672 | 3300014325 | Ga0163163_10083035 | Ga0163163_100830353 | 307 |
| 673 | 3300014326 | Ga0157380_10128696 | Ga0157380_101286961 | 307 |
| 674 | 3300014326 | Ga0157380_10354612 | Ga0157380_103546122 | 307 |
| 675 | 3300014968 | Ga0157379_10058255 | Ga0157379_100582552 | 307 |
| 676 | 3300014969 | Ga0157376_10190860 | Ga0157376_101908602 | 307 |
| 677 | 3300017792 | Ga0163161_10066113 | Ga0163161_100661133 | 307 |
| 678 | 3300021320 | Ga0214544_1000026 | Ga0214544_1000026121 | 307 |
| 679 | 3300021321 | Ga0214542_1000025 | Ga0214542_100002540 | 307 |
| 680 | 3300021324 | Ga0214545_1000014 | Ga0214545_1000014138 | 307 |
| 681 | 3300021327 | Ga0214543_1000034 | Ga0214543_100003439 | 307 |
| 682 | 3300025254 | Ga0209148_1000516 | Ga0209148_100051613 | 307 |
| 683 | 3300025261 | Ga0209233_1010135 | Ga0209233_10101353 | 307 |
| 684 | 3300025261 | Ga0209233_1011860 | Ga0209233_10118602 | 307 |
| 685 | 3300025273 | Ga0209673_1036315 | Ga0209673_10363151 | 307 |
| 686 | 3300025295 | Ga0209564_1006386 | Ga0209564_10063862 | 307 |
| 687 | 3300025295 | Ga0209564_1014991 | Ga0209564_10149912 | 307 |
| 688 | 3300025297 | Ga0209758_1000141 | Ga0209758_1000141134 | 307 |
| 689 | 3300025297 | Ga0209758_1002489 | Ga0209758_10024895 | 307 |
| 690 | 3300025297 | Ga0209758_1002656 | Ga0209758_10026564 | 307 |
| 691 | 3300025297 | Ga0209758_1002862 | Ga0209758_100286212 | 307 |
| 692 | 3300025299 | Ga0209256_1020989 | Ga0209256_10209892 | 307 |
| 693 | 3300025299 | Ga0209256_1030849 | Ga0209256_10308492 | 307 |
| 694 | 3300025302 | Ga0207426_1001111 | Ga0207426_10011114 | 307 |
| 695 | 3300025304 | Ga0209257_1000426 | Ga0209257_100042612 | 307 |
| 696 | 3300025315 | Ga0207697_10048662 | Ga0207697_100486622 | 307 |
| 697 | 3300025711 | Ga0207696_1043475 | Ga0207696_10434752 | 307 |
| 698 | 3300025899 | Ga0207642_10114303 | Ga0207642_101143032 | 307 |
| 699 | 3300025901 | Ga0207688_10017094 | Ga0207688_100170944 | 307 |
| 700 | 3300025901 | Ga0207688_10202008 | Ga0207688_102020082 | 307 |
| 701 | 3300025904 | Ga0207647_10018942 | Ga0207647_100189425 | 307 |
| 702 | 3300025906 | Ga0207699_10079489 | Ga0207699_100794893 | 307 |
| 703 | 3300025911 | Ga0207654_10002526 | Ga0207654_100025266 | 307 |
| 704 | 3300025912 | Ga0207707_10002308 | Ga0207707_1000230816 | 307 |
| 705 | 3300025913 | Ga0207695_10000062 | Ga0207695_10000062244 | 307 |
| 706 | 3300025913 | Ga0207695_10199012 | Ga0207695_101990122 | 307 |
| 707 | 3300025914 | Ga0207671_10002658 | Ga0207671_100026588 | 307 |
| 708 | 3300025914 | Ga0207671_10040838 | Ga0207671_100408384 | 307 |
| 709 | 3300025915 | Ga0207693_10003057 | Ga0207693_100030579 | 307 |
| 710 | 3300025917 | Ga0207660_10207541 | Ga0207660_102075412 | 307 |
| 711 | 3300025919 | Ga0207657_10031886 | Ga0207657_100318862 | 307 |
| 712 | 3300025919 | Ga0207657_10108134 | Ga0207657_101081343 | 307 |
| 713 | 3300025919 | Ga0207657_10200495 | Ga0207657_102004952 | 307 |
| 714 | 3300025921 | Ga0207652_10012613 | Ga0207652_100126139 | 307 |
| 715 | 3300025924 | Ga0207694_10215738 | Ga0207694_102157382 | 307 |
| 716 | 3300025924 | Ga0207694_10366372 | Ga0207694_103663722 | 307 |
| 717 | 3300025927 | Ga0207687_10012004 | Ga0207687_100120041 | 307 |
| 718 | 3300025927 | Ga0207687_10176880 | Ga0207687_101768802 | 307 |
| 719 | 3300025927 | Ga0207687_10351026 | Ga0207687_103510261 | 307 |
| 720 | 3300025928 | Ga0207700_10208464 | Ga0207700_102084642 | 307 |
| 721 | 3300025933 | Ga0207706_10031592 | Ga0207706_100315923 | 307 |
| 722 | 3300025933 | Ga0207706_10121098 | Ga0207706_101210982 | 307 |
| 723 | 3300025933 | Ga0207706_10261639 | Ga0207706_102616392 | 307 |
| 724 | 3300025935 | Ga0207709_10127415 | Ga0207709_101274153 | 307 |
| 725 | 3300025937 | Ga0207669_10014566 | Ga0207669_100145663 | 307 |
| 726 | 3300025939 | Ga0207665_10362529 | Ga0207665_103625291 | 307 |
| 727 | 3300025941 | Ga0207711_10300262 | Ga0207711_103002622 | 307 |
| 728 | 3300025942 | Ga0207689_10018957 | Ga0207689_100189575 | 307 |
| 729 | 3300025944 | Ga0207661_10001002 | Ga0207661_1000100211 | 307 |
| 730 | 3300025944 | Ga0207661_10245344 | Ga0207661_102453442 | 307 |
| 731 | 3300025949 | Ga0207667_10032520 | Ga0207667_100325203 | 307 |
| 732 | 3300025949 | Ga0207667_10085886 | Ga0207667_100858862 | 307 |
| 733 | 3300025960 | Ga0207651_10068056 | Ga0207651_100680562 | 307 |
| 734 | 3300025961 | Ga0207712_10072890 | Ga0207712_100728901 | 307 |
| 735 | 3300025972 | Ga0207668_10065341 | Ga0207668_100653412 | 307 |
| 736 | 3300026023 | Ga0207677_10004458 | Ga0207677_100044587 | 307 |
| 737 | 3300026041 | Ga0207639_10329451 | Ga0207639_103294512 | 307 |
| 738 | 3300026067 | Ga0207678_10023123 | Ga0207678_100231236 | 307 |
| 739 | 3300026075 | Ga0207708_10022517 | Ga0207708_100225174 | 307 |
| 740 | 3300026075 | Ga0207708_10054454 | Ga0207708_100544542 | 307 |
| 741 | 3300026078 | Ga0207702_10000041 | Ga0207702_1000004148 | 307 |
| 742 | 3300026078 | Ga0207702_10167231 | Ga0207702_101672312 | 307 |
| 743 | 3300026078 | Ga0207702_10309965 | Ga0207702_103099652 | 307 |
| 744 | 3300026095 | Ga0207676_10028618 | Ga0207676_100286182 | 307 |
| 745 | 3300026095 | Ga0207676_10234937 | Ga0207676_102349372 | 307 |
| 746 | 3300026116 | Ga0207674_10049678 | Ga0207674_100496784 | 307 |
| 747 | 3300026118 | Ga0207675_100241327 | Ga0207675_1002413272 | 307 |
| 748 | 3300026121 | Ga0207683_10071211 | Ga0207683_100712112 | 307 |
| 749 | 3300026121 | Ga0207683_10283169 | Ga0207683_102831692 | 307 |
| 750 | 3300026142 | Ga0207698_10069482 | Ga0207698_100694822 | 307 |
| 751 | 3300027296 | Ga0209389_1000004 | Ga0209389_100000425 | 307 |
| 752 | 3300027296 | Ga0209389_1000023 | Ga0209389_100002332 | 307 |
| 753 | 3300027357 | Ga0209589_1000006 | Ga0209589_1000006347 | 307 |
| 754 | 3300027357 | Ga0209589_1000010 | Ga0209589_1000010127 | 307 |
| 755 | 3300027361 | Ga0209489_100007 | Ga0209489_100007347 | 307 |
| 756 | 3300027361 | Ga0209489_100011 | Ga0209489_100011109 | 307 |
| 757 | 3300027361 | Ga0209489_100295 | Ga0209489_10029524 | 307 |
| 758 | 3300027363 | Ga0209700_100008 | Ga0209700_100008347 | 307 |
| 759 | 3300027363 | Ga0209700_100013 | Ga0209700_100013112 | 307 |
| 760 | 3300027512 | Ga0209179_1006366 | Ga0209179_10063661 | 307 |
| 761 | 3300027671 | Ga0209588_1023972 | Ga0209588_10239722 | 307 |
| 762 | 3300027866 | Ga0209813_10020926 | Ga0209813_100209262 | 307 |
| 763 | 3300027907 | Ga0207428_10099010 | Ga0207428_100990102 | 307 |
| 764 | 3300028379 | Ga0268266_10034519 | Ga0268266_100345193 | 307 |
| 765 | 3300028379 | Ga0268266_10193385 | Ga0268266_101933851 | 307 |
| 766 | 3300028379 | Ga0268266_10344906 | Ga0268266_103449062 | 307 |
| 767 | 3300028380 | Ga0268265_10369761 | Ga0268265_103697611 | 307 |
| 768 | 3300028381 | Ga0268264_10410743 | Ga0268264_104107432 | 307 |
| 769 | 3300028573 | Ga0265334_10025525 | Ga0265334_100255252 | 307 |
| 770 | 3300031247 | Ga0265340_10053977 | Ga0265340_100539773 | 307 |
| 771 | 3300031249 | Ga0265339_10015453 | Ga0265339_100154534 | 307 |
| 772 | 3300031250 | Ga0265331_10057063 | Ga0265331_100570632 | 307 |
| 773 | 3300031507 | Ga0307509_10223657 | Ga0307509_102236572 | 307 |
| 774 | 3300031616 | Ga0307508_10019334 | Ga0307508_100193342 | 307 |
| 775 | 3300031711 | Ga0265314_10098892 | Ga0265314_100988922 | 307 |
| 776 | 3300031730 | Ga0307516_10121810 | Ga0307516_101218102 | 307 |
| 777 | 3300032126 | Ga0307415_100048009 | Ga0307415_1000480094 | 307 |
| 778 | 3300033180 | Ga0307510_10039371 | Ga0307510_100393715 | 307 |
| 779 | 3300033180 | Ga0307510_10104983 | Ga0307510_101049832 | 307 |
| 780 | 3300033442 | Ga0315911_1000010 | Ga0315911_1000010189 | 307 |
| 781 | 3300035085 | Ga0373929_0004742 | Ga0373929_0004742_126_1058 | 307 |
| 782 | 3300035089 | Ga0373944_0058790 | Ga0373944_0058790_191_1123 | 307 |
| 783 | 3300035111 | Ga0373923_0025425 | Ga0373923_0025425_1356_2279 | 307 |
| 784 | 3300035115 | Ga0373941_0003306 | Ga0373941_0003306_692_1624 | 307 |
| 785 | 3300035116 | Ga0373945_0055460 | Ga0373945_0055460_234_1157 | 307 |
| 786 | 3300035119 | Ga0373956_0030833 | Ga0373956_0030833_1337_2260 | 307 |
| 787 | 3300035170 | Ga0373943_0002389 | Ga0373943_0002389_7128_8051 | 307 |
| 788 | 3300035170 | Ga0373943_0009573 | Ga0373943_0009573_2170_3093 | 307 |
| 789 | 3300035171 | Ga0373946_0051785 | Ga0373946_0051785_126_1049 | 307 |
| 790 | 3300035172 | Ga0373955_0000505 | Ga0373955_0000505_826_1749 | 307 |
| 791 | 3300035410 | Ga0373924_0023993 | Ga0373924_0023993_1301_2224 | 307 |
| 792 | 3300035691 | Ga0373931_0057582 | Ga0373931_0057582_540_1472 | 307 |
| 793 | 3300035692 | Ga0373935_0000383 | Ga0373935_0000383_18427_19350 | 307 |
| 794 | 3300035692 | Ga0373935_0079441 | Ga0373935_0079441_959_1882 | 307 |
| 795 | 3300035692 | Ga0373935_0208501 | Ga0373935_0208501_147_1070 | 307 |
| 796 | 3300035695 | Ga0373927_0000339 | Ga0373927_0000339_2516_3439 | 307 |
| 797 | 3300035695 | Ga0373927_0020380 | Ga0373927_0020380_1356_2279 | 307 |
| 798 | 3300035695 | Ga0373927_0034997 | Ga0373927_0034997_1602_2534 | 307 |
| 799 | 3300035724 | Ga0373933_0084401 | Ga0373933_0084401_633_1556 | 307 |
| 800 | 3300035724 | Ga0373933_0099221 | Ga0373933_0099221_292_1215 | 307 |
| 801 | 3300035725 | Ga0373947_0000623 | Ga0373947_0000623_4860_5783 | 307 |
| 802 | 3300035725 | Ga0373947_0005753 | Ga0373947_0005753_2261_3184 | 307 |
| 803 | 3300035725 | Ga0373947_0162450 | Ga0373947_0162450_163_1089 | 307 |
| 804 | 3300036401 | Ga0373937_0160918 | Ga0373937_0160918_781_1704 | 307 |
| 805 | 3300037068 | Ga0373925_0025049 | Ga0373925_0025049_290_1216 | 307 |
| 806 | 3300037068 | Ga0373925_0047978 | Ga0373925_0047978_825_1748 | 307 |
| 807 | 3300037418 | Ga0395900_0007473 | Ga0395900_0007473_4287_5210 | 307 |
| 808 | 3300037418 | Ga0395900_0243302 | Ga0395900_0243302_811_1734 | 307 |
| 809 | 3300037466 | Ga0395898_0022639 | Ga0395898_0022639_3238_4161 | 307 |
| 810 | 3300037466 | Ga0395898_0053860 | Ga0395898_0053860_777_1700 | 307 |
| 811 | 3300037466 | Ga0395898_0192273 | Ga0395898_0192273_928_1851 | 307 |
| 812 | 3300037471 | Ga0395905_0001880 | Ga0395905_0001880_19072_19995 | 307 |
| 813 | 3300037471 | Ga0395905_0349531 | Ga0395905_0349531_347_1270 | 307 |
| 814 | 3300038443 | Ga0395901_0072458 | Ga0395901_0072458_2615_3538 | 307 |
| 815 | 3300038443 | Ga0395901_0726349 | Ga0395901_0726349_35_958 | 307 |
| 816 | 3300039437 | Ga0436365_1219354 | Ga0436365_1219354_4918_5841 | 307 |
| 817 | 3300039437 | Ga0436365_1283193 | Ga0436365_1283193_104_1027 | 307 |
| 818 | 3300039437 | Ga0436365_1754300 | Ga0436365_1754300_487_1410 | 307 |
| 819 | 3300039438 | Ga0436360_0598897 | Ga0436360_0598897_493_1416 | 307 |
| 820 | 3300039438 | Ga0436360_1142640 | Ga0436360_1142640_249_1172 | 307 |
| 821 | 3300039450 | Ga0436363_0616687 | Ga0436363_0616687_1930_2853 | 307 |
| 822 | 3300041452 | Ga0451793_0847063 | Ga0451793_0847063_615_1538 | 307 |
| 823 | 3300044656 | Ga0466969_0107205 | Ga0466969_0107205_293_1216 | 307 |
| 824 | 3300044684 | Ga0466966_0015210 | Ga0466966_0015210_2648_3571 | 307 |
| 825 | 3300044693 | Ga0466961_0000149 | Ga0466961_0000149_17016_17939 | 307 |
| 826 | 3300044706 | Ga0466964_0175442 | Ga0466964_0175442_74_997 | 307 |
| 827 | 3300044901 | Ga0466960_0152315 | Ga0466960_0152315_189_1112 | 307 |
| 828 | 3300045049 | Ga0466959_0036290 | Ga0466959_0036290_333_1256 | 307 |
| 829 | 3300045836 | Ga0466958_0246474 | Ga0466958_0246474_79_1008 | 307 |
| 830 | 3300045976 | Ga0466967_0015775 | Ga0466967_0015775_4140_5063 | 307 |
| 831 | 3300045976 | Ga0466967_0072058 | Ga0466967_0072058_463_1386 | 307 |
| 832 | 3300045976 | Ga0466967_0224106 | Ga0466967_0224106_535_1458 | 307 |
| 833 | 3300046453 | Ga0495627_053630 | Ga0495627_053630_187_1119 | 307 |
| 834 | 3300046454 | Ga0495592_0051294 | Ga0495592_0051294_310_1233 | 307 |
| 835 | 3300046454 | Ga0495592_0077523 | Ga0495592_0077523_1340_2263 | 307 |
| 836 | 3300046454 | Ga0495592_0120593 | Ga0495592_0120593_696_1661 | 307 |
| 837 | 3300046455 | Ga0495603_0001921 | Ga0495603_0001921_8525_9448 | 307 |
| 838 | 3300046455 | Ga0495603_0025531 | Ga0495603_0025531_810_1733 | 307 |
| 839 | 3300046455 | Ga0495603_0025682 | Ga0495603_0025682_2599_3531 | 307 |
| 840 | 3300046455 | Ga0495603_0077594 | Ga0495603_0077594_91_1023 | 307 |
| 841 | 3300046455 | Ga0495603_0086816 | Ga0495603_0086816_628_1560 | 307 |
| 842 | 3300046455 | Ga0495603_0199553 | Ga0495603_0199553_197_1120 | 307 |
| 843 | 3300046457 | Ga0495590_0080298 | Ga0495590_0080298_126_1058 | 307 |
| 844 | 3300046459 | Ga0495629_0008419 | Ga0495629_0008419_3457_4380 | 307 |
| 845 | 3300046459 | Ga0495629_0019114 | Ga0495629_0019114_3859_4782 | 307 |
| 846 | 3300046459 | Ga0495629_0047757 | Ga0495629_0047757_1022_1945 | 307 |
| 847 | 3300046459 | Ga0495629_0107607 | Ga0495629_0107607_503_1426 | 307 |
| 848 | 3300046460 | Ga0495638_0160267 | Ga0495638_0160267_108_1040 | 307 |
| 849 | 3300046461 | Ga0495641_0005456 | Ga0495641_0005456_5450_6373 | 307 |
| 850 | 3300046462 | Ga0495651_0005170 | Ga0495651_0005170_5841_6806 | 307 |
| 851 | 3300046472 | Ga0495580_0002106 | Ga0495580_0002106_6786_7709 | 307 |
| 852 | 3300046472 | Ga0495580_0102356 | Ga0495580_0102356_703_1626 | 307 |
| 853 | 3300046473 | Ga0495582_0000839 | Ga0495582_0000839_9471_10394 | 307 |
| 854 | 3300046473 | Ga0495582_0159580 | Ga0495582_0159580_56_988 | 307 |
| 855 | 3300046475 | Ga0495639_0000198 | Ga0495639_0000198_28295_29218 | 307 |
| 856 | 3300046475 | Ga0495639_0053169 | Ga0495639_0053169_295_1221 | 307 |
| 857 | 3300046476 | Ga0495662_0013305 | Ga0495662_0013305_462_1385 | 307 |
| 858 | 3300046477 | Ga0495664_0085178 | Ga0495664_0085178_756_1721 | 307 |
| 859 | 3300046477 | Ga0495664_0133072 | Ga0495664_0133072_517_1440 | 307 |
| 860 | 3300046499 | Ga0495594_0000484 | Ga0495594_0000484_15052_15975 | 307 |
| 861 | 3300046499 | Ga0495594_0021206 | Ga0495594_0021206_1175_2107 | 307 |
| 862 | 3300046501 | Ga0495607_0156032 | Ga0495607_0156032_171_1094 | 307 |
| 863 | 3300046507 | Ga0495606_0009928 | Ga0495606_0009928_4866_5789 | 307 |
| 864 | 3300046507 | Ga0495606_0018301 | Ga0495606_0018301_2829_3752 | 307 |
| 865 | 3300046511 | Ga0495608_0127866 | Ga0495608_0127866_432_1355 | 307 |
| 866 | 3300046512 | Ga0495610_0151874 | Ga0495610_0151874_33_956 | 307 |
| 867 | 3300046514 | Ga0495618_0058196 | Ga0495618_0058196_185_1108 | 307 |
| 868 | 3300046514 | Ga0495618_0174098 | Ga0495618_0174098_315_1238 | 307 |
| 869 | 3300046516 | Ga0495628_0071368 | Ga0495628_0071368_1609_2574 | 307 |
| 870 | 3300046516 | Ga0495628_0085781 | Ga0495628_0085781_1171_2094 | 307 |
| 871 | 3300046517 | Ga0495630_0004090 | Ga0495630_0004090_7093_8016 | 307 |
| 872 | 3300046517 | Ga0495630_0013420 | Ga0495630_0013420_4694_5617 | 307 |
| 873 | 3300046519 | Ga0495632_0038280 | Ga0495632_0038280_258_1190 | 307 |
| 874 | 3300046522 | Ga0495643_0016356 | Ga0495643_0016356_1360_2283 | 307 |
| 875 | 3300046524 | Ga0495648_0003788 | Ga0495648_0003788_11165_12088 | 307 |
| 876 | 3300046524 | Ga0495648_0005381 | Ga0495648_0005381_2061_2984 | 307 |
| 877 | 3300046524 | Ga0495648_0024143 | Ga0495648_0024143_2380_3303 | 307 |
| 878 | 3300046525 | Ga0495663_0075635 | Ga0495663_0075635_27_959 | 307 |
| 879 | 3300046526 | Ga0495666_0033603 | Ga0495666_0033603_1193_2116 | 307 |
| 880 | 3300046526 | Ga0495666_0067968 | Ga0495666_0067968_707_1630 | 307 |
| 881 | 3300046529 | Ga0495652_0037775 | Ga0495652_0037775_3069_3992 | 307 |
| 882 | 3300046529 | Ga0495652_0044572 | Ga0495652_0044572_1869_2792 | 307 |
| 883 | 3300046529 | Ga0495652_0184198 | Ga0495652_0184198_292_1215 | 307 |
| 884 | 3300046531 | Ga0495665_0000539 | Ga0495665_0000539_6801_7724 | 307 |
| 885 | 3300046531 | Ga0495665_0024344 | Ga0495665_0024344_2217_3140 | 307 |
| 886 | 3300046533 | Ga0495640_0004718 | Ga0495640_0004718_6170_7093 | 307 |
| 887 | 3300046533 | Ga0495640_0022789 | Ga0495640_0022789_2808_3731 | 307 |
| 888 | 3300046536 | Ga0495587_0118056 | Ga0495587_0118056_259_1224 | 307 |
| 889 | 3300046536 | Ga0495587_0177845 | Ga0495587_0177845_58_981 | 307 |
| 890 | 3300046543 | Ga0495645_0015582 | Ga0495645_0015582_1244_2167 | 307 |
| 891 | 3300046543 | Ga0495645_0021112 | Ga0495645_0021112_3612_4535 | 307 |
| 892 | 3300046543 | Ga0495645_0226226 | Ga0495645_0226226_68_991 | 307 |
| 893 | 3300046557 | Ga0495622_0036333 | Ga0495622_0036333_850_1773 | 307 |
| 894 | 3300046559 | Ga0495667_0090210 | Ga0495667_0090210_347_1312 | 307 |
| 895 | 3300046616 | Ga0495668_0029006 | Ga0495668_0029006_1146_2078 | 307 |
| 896 | 3300046616 | Ga0495668_0125744 | Ga0495668_0125744_223_1146 | 307 |
| 897 | 3300046642 | Ga0495634_0000792 | Ga0495634_0000792_6975_7898 | 307 |
| 898 | 3300046642 | Ga0495634_0024899 | Ga0495634_0024899_3055_3978 | 307 |
| 899 | 3300046648 | Ga0495611_0084899 | Ga0495611_0084899_115_1047 | 307 |
| 900 | 3300046660 | Ga0495625_0055998 | Ga0495625_0055998_1756_2679 | 307 |
| 901 | 3300046660 | Ga0495625_0106634 | Ga0495625_0106634_439_1371 | 307 |
| 902 | 3300046663 | Ga0495635_0002309 | Ga0495635_0002309_2307_3230 | 307 |
| 903 | 3300046663 | Ga0495635_0022557 | Ga0495635_0022557_748_1671 | 307 |
| 904 | 3300046663 | Ga0495635_0080012 | Ga0495635_0080012_900_1823 | 307 |
| 905 | 3300046663 | Ga0495635_0104329 | Ga0495635_0104329_319_1242 | 307 |
| 906 | 3300046674 | Ga0495588_0005803 | Ga0495588_0005803_3559_4482 | 307 |
| 907 | 3300046674 | Ga0495588_0044972 | Ga0495588_0044972_538_1470 | 307 |
| 908 | 3300046675 | Ga0495657_0037981 | Ga0495657_0037981_2175_3098 | 307 |
| 909 | 3300046678 | Ga0495599_0023511 | Ga0495599_0023511_1834_2757 | 307 |
| 910 | 3300046678 | Ga0495599_0056334 | Ga0495599_0056334_352_1275 | 307 |
| 911 | 3300046678 | Ga0495599_0098409 | Ga0495599_0098409_637_1602 | 307 |
| 912 | 3300046678 | Ga0495599_0199214 | Ga0495599_0199214_241_1164 | 307 |
| 913 | 3300046678 | Ga0495599_0237823 | Ga0495599_0237823_33_956 | 307 |
| 914 | 3300046679 | Ga0495623_0089766 | Ga0495623_0089766_291_1256 | 307 |
| 915 | 3300046680 | Ga0495646_0006258 | Ga0495646_0006258_1024_1947 | 307 |
| 916 | 3300046681 | Ga0495647_0001093 | Ga0495647_0001093_2915_3838 | 307 |
| 917 | 3300046681 | Ga0495647_0065352 | Ga0495647_0065352_389_1312 | 307 |
| 918 | 3300046683 | Ga0495658_0001614 | Ga0495658_0001614_6575_7498 | 307 |
| 919 | 3300046683 | Ga0495658_0032622 | Ga0495658_0032622_1191_2114 | 307 |
| 920 | 3300046683 | Ga0495658_0091626 | Ga0495658_0091626_60_983 | 307 |
| 921 | 3300046684 | Ga0495669_0003692 | Ga0495669_0003692_2173_3096 | 307 |
| 922 | 3300046689 | Ga0495613_0018666 | Ga0495613_0018666_376_1299 | 307 |
| 923 | 3300046689 | Ga0495613_0044715 | Ga0495613_0044715_1137_2060 | 307 |
| 924 | 3300046690 | Ga0495624_0002224 | Ga0495624_0002224_7093_8016 | 307 |
| 925 | 3300046690 | Ga0495624_0031131 | Ga0495624_0031131_1024_1947 | 307 |
| 926 | 3300046691 | Ga0495670_0135398 | Ga0495670_0135398_306_1238 | 307 |
| 927 | 3300046694 | Ga0495649_0102017 | Ga0495649_0102017_461_1393 | 307 |
| 928 | 3300046809 | Ga0495600_0001341 | Ga0495600_0001341_259_1224 | 307 |
| 929 | 3300046809 | Ga0495600_0013087 | Ga0495600_0013087_3127_4050 | 307 |
| 930 | 3300047315 | Ga0495581_0000015 | Ga0495581_0000015_11135_12058 | 307 |
| 931 | 3300047315 | Ga0495581_0052097 | Ga0495581_0052097_1180_2103 | 307 |
| 932 | 3300047315 | Ga0495581_0089091 | Ga0495581_0089091_229_1161 | 307 |
| 933 | 3300047315 | Ga0495581_0102352 | Ga0495581_0102352_20_952 | 307 |
| 934 | 3300047317 | Ga0495604_0002055 | Ga0495604_0002055_3446_4369 | 307 |
| 935 | 3300047317 | Ga0495604_0040475 | Ga0495604_0040475_201_1124 | 307 |
| 936 | 3300047319 | Ga0495674_0008391 | Ga0495674_0008391_2923_3846 | 307 |
| 937 | 3300047319 | Ga0495674_0046688 | Ga0495674_0046688_304_1227 | 307 |
| 938 | 3300047319 | Ga0495674_0058711 | Ga0495674_0058711_599_1564 | 307 |
| 939 | 3300047321 | Ga0495676_0088017 | Ga0495676_0088017_988_1911 | 307 |
| 940 | 3300047321 | Ga0495676_0094959 | Ga0495676_0094959_379_1302 | 307 |
| 941 | 3300047322 | Ga0495680_0016086 | Ga0495680_0016086_2138_3103 | 307 |
| 942 | 3300047322 | Ga0495680_0144672 | Ga0495680_0144672_740_1663 | 307 |
| 943 | 3300047443 | Ga0495687_007506 | Ga0495687_007506_968_1891 | 307 |
| 944 | 3300047444 | Ga0495675_0120725 | Ga0495675_0120725_178_1143 | 307 |
| 945 | 3300047471 | Ga0495684_0024587 | Ga0495684_0024587_1383_2306 | 307 |
| 946 | 3300047471 | Ga0495684_0045322 | Ga0495684_0045322_1071_1994 | 307 |
| 947 | 3300047673 | Ga0495593_0000384 | Ga0495593_0000384_18871_19794 | 307 |
| 948 | 3300047673 | Ga0495593_0010683 | Ga0495593_0010683_3214_4137 | 307 |
| 949 | 3300047673 | Ga0495593_0053787 | Ga0495593_0053787_486_1409 | 307 |
| 950 | 3300048088 | Ga0495602_0037211 | Ga0495602_0037211_2696_3619 | 307 |
| 951 | 3300048088 | Ga0495602_0039351 | Ga0495602_0039351_3250_4215 | 307 |
| 952 | 3300048089 | Ga0495614_0048183 | Ga0495614_0048183_526_1449 | 307 |
| 953 | 3300048903 | Ga0496100_0114028 | Ga0496100_0114028_254_1177 | 307 |
| 954 | 3300048904 | Ga0496101_0008079 | Ga0496101_0008079_4746_5669 | 307 |
| 955 | 3300048904 | Ga0496101_0033067 | Ga0496101_0033067_127_1050 | 307 |
| 956 | 3300048904 | Ga0496101_0068182 | Ga0496101_0068182_1158_2090 | 307 |
| 957 | 3300048905 | Ga0496102_0011342 | Ga0496102_0011342_3763_4686 | 307 |
| 958 | 3300048905 | Ga0496102_0012470 | Ga0496102_0012470_1362_2294 | 307 |
| 959 | 3300048905 | Ga0496102_0023434 | Ga0496102_0023434_816_1739 | 307 |
| 960 | 3300048906 | Ga0496103_0045148 | Ga0496103_0045148_121_1044 | 307 |
| 961 | 3300048907 | Ga0496104_0012119 | Ga0496104_0012119_5357_6289 | 307 |
| 962 | 3300048907 | Ga0496104_0037267 | Ga0496104_0037267_3076_3999 | 307 |
| 963 | 3300048907 | Ga0496104_0197002 | Ga0496104_0197002_300_1223 | 307 |
| 964 | 3300048907 | Ga0496104_0206836 | Ga0496104_0206836_751_1674 | 307 |
| 965 | 3300048907 | Ga0496104_0321350 | Ga0496104_0321350_157_1080 | 307 |
| 966 | 3300048908 | Ga0496105_0040901 | Ga0496105_0040901_1986_2909 | 307 |
| 967 | 3300048908 | Ga0496105_0044252 | Ga0496105_0044252_1448_2380 | 307 |
| 968 | 3300048908 | Ga0496105_0103867 | Ga0496105_0103867_674_1597 | 307 |
| 969 | 3300048908 | Ga0496105_0144903 | Ga0496105_0144903_487_1410 | 307 |
| 970 | 3300048909 | Ga0496106_0012760 | Ga0496106_0012760_1828_2751 | 307 |
| 971 | 3300048909 | Ga0496106_0103526 | Ga0496106_0103526_432_1355 | 307 |
| 972 | 3300048910 | Ga0496107_0005112 | Ga0496107_0005112_4171_5094 | 307 |
| 973 | 3300048910 | Ga0496107_0321451 | Ga0496107_0321451_24_956 | 307 |
| 974 | 3300048911 | Ga0496108_0052725 | Ga0496108_0052725_1070_1993 | 307 |
| 975 | 3300048911 | Ga0496108_0131162 | Ga0496108_0131162_450_1382 | 307 |
| 976 | 3300048911 | Ga0496108_0176533 | Ga0496108_0176533_73_1005 | 307 |
| 977 | 3300048912 | Ga0496109_0043459 | Ga0496109_0043459_558_1490 | 307 |
| 978 | 3300048912 | Ga0496109_0064561 | Ga0496109_0064561_1518_2441 | 307 |
| 979 | 3300048913 | Ga0496110_0006318 | Ga0496110_0006318_3113_4045 | 307 |
| 980 | 3300048913 | Ga0496110_0192564 | Ga0496110_0192564_291_1214 | 307 |
| 981 | 3300048913 | Ga0496110_0308133 | Ga0496110_0308133_186_1109 | 307 |
| 982 | 3300048914 | Ga0496111_0013217 | Ga0496111_0013217_1015_1947 | 307 |
| 983 | 3300048914 | Ga0496111_0040286 | Ga0496111_0040286_1910_2833 | 307 |
| 984 | 3300048914 | Ga0496111_0142483 | Ga0496111_0142483_804_1727 | 307 |
| 985 | 3300048915 | Ga0496112_0000008 | Ga0496112_0000008_36603_37526 | 307 |
| 986 | 3300048915 | Ga0496112_0007908 | Ga0496112_0007908_1572_2504 | 307 |
| 987 | 3300048915 | Ga0496112_0087946 | Ga0496112_0087946_2074_2997 | 307 |
| 988 | 3300048915 | Ga0496112_0135217 | Ga0496112_0135217_867_1865 | 307 |
| 989 | 3300048915 | Ga0496112_0139424 | Ga0496112_0139424_886_1809 | 307 |
| 990 | 3300048916 | Ga0496113_0003109 | Ga0496113_0003109_5773_6705 | 307 |
| 991 | 3300048916 | Ga0496113_0024919 | Ga0496113_0024919_2992_3915 | 307 |
| 992 | 3300048916 | Ga0496113_0043915 | Ga0496113_0043915_409_1332 | 307 |
| 993 | 3300048916 | Ga0496113_0309434 | Ga0496113_0309434_85_1008 | 307 |
| 994 | 3300048917 | Ga0496114_0002928 | Ga0496114_0002928_80_1003 | 307 |
| 995 | 3300048917 | Ga0496114_0008185 | Ga0496114_0008185_1031_1963 | 307 |
| 996 | 3300048918 | Ga0496115_0047309 | Ga0496115_0047309_1458_2381 | 307 |
| 997 | 3300048920 | Ga0496117_0175249 | Ga0496117_0175249_118_1050 | 307 |
| 998 | 3300048921 | Ga0496118_0012830 | Ga0496118_0012830_869_1792 | 307 |
| 999 | 3300048921 | Ga0496118_0091406 | Ga0496118_0091406_526_1449 | 307 |
| 1000 | 3300048921 | Ga0496118_0109763 | Ga0496118_0109763_162_1085 | 307 |
| 1001 | 3300048922 | Ga0496119_0019927 | Ga0496119_0019927_2933_3856 | 307 |
| 1002 | 3300048923 | Ga0496120_0005798 | Ga0496120_0005798_2290_3213 | 307 |
| 1003 | 3300048924 | Ga0496121_0005990 | Ga0496121_0005990_13802_14725 | 307 |
| 1004 | 3300048924 | Ga0496121_0020194 | Ga0496121_0020194_5550_6473 | 307 |
| 1005 | 3300048924 | Ga0496121_0055052 | Ga0496121_0055052_1479_2411 | 307 |
| 1006 | 3300048928 | Ga0496125_0027660 | Ga0496125_0027660_3919_4842 | 307 |
| 1007 | 3300048928 | Ga0496125_0093021 | Ga0496125_0093021_1291_2214 | 307 |
| 1008 | 3300048928 | Ga0496125_0144663 | Ga0496125_0144663_530_1453 | 307 |
| 1009 | 3300048928 | Ga0496125_0146452 | Ga0496125_0146452_360_1292 | 307 |
| 1010 | 3300048929 | Ga0496126_0022427 | Ga0496126_0022427_2218_3141 | 307 |
| 1011 | 3300048929 | Ga0496126_0364499 | Ga0496126_0364499_186_1118 | 307 |
| 1012 | 3300048929 | Ga0496126_0424416 | Ga0496126_0424416_62_994 | 307 |
| 1013 | 3300049571 | Ga0501034_0016544 | Ga0501034_0016544_6608_7531 | 307 |
| 1014 | 3300049573 | Ga0501037_0138099 | Ga0501037_0138099_268_1191 | 307 |
| 1015 | 3300049574 | Ga0501038_0035710 | Ga0501038_0035710_1067_1990 | 307 |
| 1016 | 3300049579 | Ga0501043_0266974 | Ga0501043_0266974_360_1283 | 307 |
| 1017 | 3300049580 | Ga0501046_0018899 | Ga0501046_0018899_1377_2300 | 307 |
| 1018 | 3300049581 | Ga0501047_0043146 | Ga0501047_0043146_2231_3154 | 307 |
| 1019 | 3300049581 | Ga0501047_0049002 | Ga0501047_0049002_810_1733 | 307 |
| 1020 | 3300049586 | Ga0501070_0005835 | Ga0501070_0005835_2995_3918 | 307 |
| 1021 | 3300049589 | Ga0501073_0029119 | Ga0501073_0029119_735_1658 | 307 |
| 1022 | 3300049589 | Ga0501073_0083610 | Ga0501073_0083610_188_1111 | 307 |
| 1023 | 3300049590 | Ga0501074_0031406 | Ga0501074_0031406_2538_3461 | 307 |
| 1024 | 3300049742 | Ga0501080_0034637 | Ga0501080_0034637_3593_4516 | 307 |
| 1025 | 3300049822 | Ga0501035_0011909 | Ga0501035_0011909_4302_5225 | 307 |
| 1026 | 3300049823 | Ga0501044_0076157 | Ga0501044_0076157_1696_2619 | 307 |
| 1027 | 3300050493 | nmdc:mga0k408_69038_c1 | nmdc:mga0k408_69038_c1_60_983 | 307 |
| 1028 | 3300050494 | nmdc:mga06z11_60341_c1 | nmdc:mga06z11_60341_c1_562_1494 | 307 |
| 1029 | 3300050507 | nmdc:mga05p37_347562_c1 | nmdc:mga05p37_347562_c1_172_1104 | 307 |
| 1030 | 3300050514 | nmdc:mga08x19_171419_c1 | nmdc:mga08x19_171419_c1_350_1273 | 307 |
| 1031 | 3300050516 | nmdc:mga0sz30_16624_c1 | nmdc:mga0sz30_16624_c1_271_1194 | 307 |
| 1032 | 3300050516 | nmdc:mga0sz30_63339_c2 | nmdc:mga0sz30_63339_c2_213_1136 | 307 |
| 1033 | 3300053077 | Ga0495601_0020306 | Ga0495601_0020306_3074_3997 | 307 |
| 1034 | 3300053077 | Ga0495601_0131025 | Ga0495601_0131025_189_1112 | 307 |
| 1035 | 3300053077 | Ga0495601_0217393 | Ga0495601_0217393_225_1148 | 307 |
| 1036 | 3300053078 | Ga0495612_0021497 | Ga0495612_0021497_837_1760 | 307 |
| 1037 | 3300053078 | Ga0495612_0040437 | Ga0495612_0040437_837_1760 | 307 |
| 1038 | 3300053080 | Ga0500635_0009681 | Ga0500635_0009681_427_1359 | 307 |
| 1039 | 3300053085 | Ga0495619_0017139 | Ga0495619_0017139_3219_4151 | 307 |
| 1040 | 3300053087 | Ga0500643_000435 | Ga0500643_000435_8389_9312 | 307 |
| 1041 | 3300053094 | Ga0500566_0000008 | Ga0500566_0000008_250_1233 | 307 |
| 1042 | 3300053094 | Ga0500566_0002013 | Ga0500566_0002013_8857_9789 | 307 |
| 1043 | 3300053094 | Ga0500566_0003961 | Ga0500566_0003961_7614_8537 | 307 |
| 1044 | 3300053095 | Ga0500640_000516 | Ga0500640_000516_317_1300 | 307 |
| 1045 | 3300053096 | Ga0500641_0009748 | Ga0500641_0009748_1288_2220 | 307 |
| 1046 | 3300053096 | Ga0500641_0087286 | Ga0500641_0087286_200_1123 | 307 |
| 1047 | 3300053098 | Ga0500650_0048886 | Ga0500650_0048886_728_1651 | 307 |
| 1048 | 3300053105 | Ga0500557_000029 | Ga0500557_000029_8993_10054 | 307 |
| 1049 | 3300053108 | Ga0500562_005821 | Ga0500562_005821_1659_2582 | 307 |
| 1050 | 3300053111 | Ga0500572_000056 | Ga0500572_000056_11348_12271 | 307 |
| 1051 | 3300053111 | Ga0500572_020679 | Ga0500572_020679_169_1092 | 307 |
| 1052 | 3300053119 | Ga0500595_000726 | Ga0500595_000726_12968_13900 | 307 |
| 1053 | 3300053119 | Ga0500595_020648 | Ga0500595_020648_1417_2340 | 307 |
| 1054 | 3300053120 | Ga0500597_149433 | Ga0500597_149433_32_955 | 307 |
| 1055 | 3300053121 | Ga0500607_121585 | Ga0500607_121585_126_1049 | 307 |
| 1056 | 3300053122 | Ga0500608_037225 | Ga0500608_037225_1208_2191 | 307 |
| 1057 | 3300053123 | Ga0500614_003782 | Ga0500614_003782_336_1319 | 307 |
| 1058 | 3300053126 | Ga0500621_069030 | Ga0500621_069030_188_1120 | 307 |
| 1059 | 3300053130 | Ga0500642_0000333 | Ga0500642_0000333_7313_8374 | 307 |
| 1060 | 3300053136 | Ga0500559_0000423 | Ga0500559_0000423_17599_18522 | 307 |
| 1061 | 3300053136 | Ga0500559_0002351 | Ga0500559_0002351_8297_9280 | 307 |
| 1062 | 3300053138 | Ga0500564_076426 | Ga0500564_076426_435_1358 | 307 |
| 1063 | 3300053139 | Ga0500568_0073081 | Ga0500568_0073081_199_1122 | 307 |
| 1064 | 3300053148 | Ga0500590_111389 | Ga0500590_111389_287_1270 | 307 |
| 1065 | 3300053150 | Ga0500603_000104 | Ga0500603_000104_7216_8199 | 307 |
| 1066 | 3300053150 | Ga0500603_001908 | Ga0500603_001908_3280_4212 | 307 |
| 1067 | 3300053156 | Ga0500622_0016125 | Ga0500622_0016125_224_1147 | 307 |
| 1068 | 3300053159 | Ga0500630_013996 | Ga0500630_013996_3010_3933 | 307 |
| 1069 | 3300053162 | Ga0500638_001215 | Ga0500638_001215_2306_3238 | 307 |
| 1070 | 3300053163 | Ga0500639_000010 | Ga0500639_000010_26962_27945 | 307 |
| 1071 | 3300053163 | Ga0500639_016510 | Ga0500639_016510_2170_3093 | 307 |
| 1072 | 3300053177 | Ga0500636_0000112 | Ga0500636_0000112_23303_24226 | 307 |
| 1073 | 3300053177 | Ga0500636_0094752 | Ga0500636_0094752_46_978 | 307 |
| 1074 | 3300053178 | Ga0500637_0016014 | Ga0500637_0016014_2859_3782 | 307 |
| 1075 | 3300053730 | Ga0500645_000012 | Ga0500645_000012_128884_129807 | 307 |
| 1076 | 3300053730 | Ga0500645_013885 | Ga0500645_013885_865_1797 | 307 |
| 1077 | 3300053730 | Ga0500645_020131 | Ga0500645_020131_240_1163 | 307 |
| 1078 | 3300053731 | Ga0500609_001787 | Ga0500609_001787_1754_2677 | 307 |
| 1079 | 3300053735 | Ga0500596_001607 | Ga0500596_001607_2612_3535 | 307 |
| 1080 | 3300053737 | Ga0500601_001269 | Ga0500601_001269_802_1725 | 307 |
| 1081 | iso_pu_bacteria | 2617270741 | 2617377857 | 307 |
| 1082 | iso_pu_bacteria | 2824746037 | 2824750518 | 307 |
| 1083 | iso_pu_bacteria | 3005483717 | 3005485692 | 307 |
| 1084 | iso_pu_bacteria | 8016583857 | 8016589161 | 307 |
| 1085 | 2209111006 | 2214600489 | 2213637875 | 308 |
| 1086 | 3300000041 | ARcpr5oldR_c000075 | ARcpr5oldR_00007521 | 308 |
| 1087 | 3300000042 | ARSoilYngRDRAFT_c00009 | ARSoilYngRDRAFT_0000921 | 308 |
| 1088 | 3300000043 | ARcpr5yngRDRAFT_c000006 | ARcpr5yngRDRAFT_00000621 | 308 |
| 1089 | 3300000044 | ARSoilOldRDRAFT_c000008 | ARSoilOldRDRAFT_00000853 | 308 |
| 1090 | 3300000045 | ARCol0oldRDRAFT_c00242 | ARCol0oldRDRAFT_002424 | 308 |
| 1091 | 3300000652 | ARCol0yngRDRAFT_1000092 | ARCol0yngRDRAFT_10000927 | 308 |
| 1092 | 3300001915 | JGI24741J21665_1005717 | JGI24741J21665_10057172 | 308 |
| 1093 | 3300001977 | JGI24746J21847_1000654 | JGI24746J21847_10006542 | 308 |
| 1094 | 3300001989 | JGI24739J22299_10000092 | JGI24739J22299_1000009223 | 308 |
| 1095 | 3300001990 | JGI24737J22298_10000325 | JGI24737J22298_100003257 | 308 |
| 1096 | 3300001990 | JGI24737J22298_10001344 | JGI24737J22298_100013444 | 308 |
| 1097 | 3300002070 | JGI24750J21931_1000128 | JGI24750J21931_100012811 | 308 |
| 1098 | 3300002073 | JGI24745J21846_1000019 | JGI24745J21846_10000192 | 308 |
| 1099 | 3300002074 | JGI24748J21848_1000158 | JGI24748J21848_100015811 | 308 |
| 1100 | 3300002075 | JGI24738J21930_10000010 | JGI24738J21930_1000001018 | 308 |
| 1101 | 3300002076 | JGI24749J21850_1000653 | JGI24749J21850_10006536 | 308 |
| 1102 | 3300002077 | JGI24744J21845_10007455 | JGI24744J21845_100074553 | 308 |
| 1103 | 3300002126 | JGI24035J26624_1000002 | JGI24035J26624_100000211 | 308 |
| 1104 | 3300002155 | JGI24033J26618_1004382 | JGI24033J26618_10043822 | 308 |
| 1105 | 3300002239 | JGI24034J26672_10000201 | JGI24034J26672_1000020110 | 308 |
| 1106 | 3300002244 | JGI24742J22300_10000449 | JGI24742J22300_100004496 | 308 |
| 1107 | 3300003203 | JGI25406J46586_10029212 | JGI25406J46586_100292123 | 308 |
| 1108 | 3300003659 | JGI25404J52841_10014829 | JGI25404J52841_100148292 | 308 |
| 1109 | 3300003794 | Ga0055531_10016346 | Ga0055531_100163464 | 308 |
| 1110 | 3300003911 | JGI25405J52794_10002686 | JGI25405J52794_100026863 | 308 |
| 1111 | 3300003911 | JGI25405J52794_10019743 | JGI25405J52794_100197431 | 308 |
| 1112 | 3300005276 | Ga0065717_1000057 | Ga0065717_10000575 | 308 |
| 1113 | 3300005277 | Ga0065716_1001714 | Ga0065716_10017145 | 308 |
| 1114 | 3300005290 | Ga0065712_10000899 | Ga0065712_100008992 | 308 |
| 1115 | 3300005290 | Ga0065712_10068648 | Ga0065712_100686484 | 308 |
| 1116 | 3300005293 | Ga0065715_10000752 | Ga0065715_1000075211 | 308 |
| 1117 | 3300005293 | Ga0065715_10000834 | Ga0065715_100008344 | 308 |
| 1118 | 3300005293 | Ga0065715_10099531 | Ga0065715_100995313 | 308 |
| 1119 | 3300005327 | Ga0070658_10000029 | Ga0070658_10000029157 | 308 |
| 1120 | 3300005329 | Ga0070683_100001029 | Ga0070683_10000102911 | 308 |
| 1121 | 3300005329 | Ga0070683_100014914 | Ga0070683_1000149143 | 308 |
| 1122 | 3300005330 | Ga0070690_100002808 | Ga0070690_1000028087 | 308 |
| 1123 | 3300005330 | Ga0070690_100020537 | Ga0070690_1000205374 | 308 |
| 1124 | 3300005331 | Ga0070670_100017810 | Ga0070670_1000178107 | 308 |
| 1125 | 3300005333 | Ga0070677_10000045 | Ga0070677_100000454 | 308 |
| 1126 | 3300005334 | Ga0068869_100000079 | Ga0068869_10000007911 | 308 |
| 1127 | 3300005334 | Ga0068869_100036226 | Ga0068869_1000362264 | 308 |
| 1128 | 3300005335 | Ga0070666_10019934 | Ga0070666_100199344 | 308 |
| 1129 | 3300005336 | Ga0070680_100080310 | Ga0070680_1000803102 | 308 |
| 1130 | 3300005337 | Ga0070682_100000641 | Ga0070682_1000006417 | 308 |
| 1131 | 3300005337 | Ga0070682_100048995 | Ga0070682_1000489951 | 308 |
| 1132 | 3300005338 | Ga0068868_100002114 | Ga0068868_10000211414 | 308 |
| 1133 | 3300005338 | Ga0068868_100116506 | Ga0068868_1001165062 | 308 |
| 1134 | 3300005339 | Ga0070660_100000715 | Ga0070660_1000007156 | 308 |
| 1135 | 3300005339 | Ga0070660_100004207 | Ga0070660_1000042074 | 308 |
| 1136 | 3300005339 | Ga0070660_100067446 | Ga0070660_1000674462 | 308 |
| 1137 | 3300005340 | Ga0070689_100003727 | Ga0070689_10000372711 | 308 |
| 1138 | 3300005340 | Ga0070689_100052174 | Ga0070689_1000521742 | 308 |
| 1139 | 3300005341 | Ga0070691_10000161 | Ga0070691_1000016112 | 308 |
| 1140 | 3300005341 | Ga0070691_10006926 | Ga0070691_100069264 | 308 |
| 1141 | 3300005343 | Ga0070687_100000085 | Ga0070687_10000008526 | 308 |
| 1142 | 3300005344 | Ga0070661_100000307 | Ga0070661_10000030722 | 308 |
| 1143 | 3300005344 | Ga0070661_100186230 | Ga0070661_1001862302 | 308 |
| 1144 | 3300005345 | Ga0070692_10007199 | Ga0070692_100071993 | 308 |
| 1145 | 3300005347 | Ga0070668_100000164 | Ga0070668_1000001644 | 308 |
| 1146 | 3300005347 | Ga0070668_100033222 | Ga0070668_1000332222 | 308 |
| 1147 | 3300005353 | Ga0070669_100000571 | Ga0070669_10000057118 | 308 |
| 1148 | 3300005354 | Ga0070675_100002792 | Ga0070675_1000027924 | 308 |
| 1149 | 3300005355 | Ga0070671_100000104 | Ga0070671_10000010444 | 308 |
| 1150 | 3300005355 | Ga0070671_100082892 | Ga0070671_1000828924 | 308 |
| 1151 | 3300005356 | Ga0070674_100000238 | Ga0070674_10000023818 | 308 |
| 1152 | 3300005356 | Ga0070674_100071785 | Ga0070674_1000717853 | 308 |
| 1153 | 3300005364 | Ga0070673_100000152 | Ga0070673_10000015228 | 308 |
| 1154 | 3300005364 | Ga0070673_100119337 | Ga0070673_1001193372 | 308 |
| 1155 | 3300005365 | Ga0070688_100001552 | Ga0070688_10000155211 | 308 |
| 1156 | 3300005365 | Ga0070688_100004752 | Ga0070688_1000047525 | 308 |
| 1157 | 3300005365 | Ga0070688_100140851 | Ga0070688_1001408512 | 308 |
| 1158 | 3300005365 | Ga0070688_100267867 | Ga0070688_1002678672 | 308 |
| 1159 | 3300005366 | Ga0070659_100000551 | Ga0070659_10000055118 | 308 |
| 1160 | 3300005366 | Ga0070659_100021203 | Ga0070659_1000212034 | 308 |
| 1161 | 3300005366 | Ga0070659_100029695 | Ga0070659_1000296953 | 308 |
| 1162 | 3300005367 | Ga0070667_100002365 | Ga0070667_10000236510 | 308 |
| 1163 | 3300005406 | Ga0070703_10002279 | Ga0070703_100022794 | 308 |
| 1164 | 3300005434 | Ga0070709_10000690 | Ga0070709_1000069016 | 308 |
| 1165 | 3300005435 | Ga0070714_100010787 | Ga0070714_1000107873 | 308 |
| 1166 | 3300005436 | Ga0070713_100001316 | Ga0070713_10000131612 | 308 |
| 1167 | 3300005438 | Ga0070701_10000674 | Ga0070701_100006743 | 308 |
| 1168 | 3300005439 | Ga0070711_100008627 | Ga0070711_1000086273 | 308 |
| 1169 | 3300005439 | Ga0070711_100031169 | Ga0070711_1000311693 | 308 |
| 1170 | 3300005440 | Ga0070705_100000148 | Ga0070705_10000014817 | 308 |
| 1171 | 3300005441 | Ga0070700_100000277 | Ga0070700_10000027715 | 308 |
| 1172 | 3300005441 | Ga0070700_100195613 | Ga0070700_1001956132 | 308 |
| 1173 | 3300005444 | Ga0070694_100003001 | Ga0070694_1000030018 | 308 |
| 1174 | 3300005455 | Ga0070663_100001406 | Ga0070663_10000140614 | 308 |
| 1175 | 3300005455 | Ga0070663_100039199 | Ga0070663_1000391992 | 308 |
| 1176 | 3300005456 | Ga0070678_100008123 | Ga0070678_1000081235 | 308 |
| 1177 | 3300005456 | Ga0070678_100033129 | Ga0070678_1000331293 | 308 |
| 1178 | 3300005457 | Ga0070662_100005414 | Ga0070662_1000054145 | 308 |
| 1179 | 3300005457 | Ga0070662_100010491 | Ga0070662_1000104912 | 308 |
| 1180 | 3300005458 | Ga0070681_10003456 | Ga0070681_1000345611 | 308 |
| 1181 | 3300005458 | Ga0070681_10232122 | Ga0070681_102321222 | 308 |
| 1182 | 3300005459 | Ga0068867_100004407 | Ga0068867_1000044073 | 308 |
| 1183 | 3300005466 | Ga0070685_10001961 | Ga0070685_1000196111 | 308 |
| 1184 | 3300005466 | Ga0070685_10034291 | Ga0070685_100342912 | 308 |
| 1185 | 3300005518 | Ga0070699_100147812 | Ga0070699_1001478122 | 308 |
| 1186 | 3300005530 | Ga0070679_100000394 | Ga0070679_10000039444 | 308 |
| 1187 | 3300005530 | Ga0070679_100083466 | Ga0070679_1000834664 | 308 |
| 1188 | 3300005535 | Ga0070684_100001138 | Ga0070684_1000011384 | 308 |
| 1189 | 3300005535 | Ga0070684_100255997 | Ga0070684_1002559972 | 308 |
| 1190 | 3300005539 | Ga0068853_100002891 | Ga0068853_1000028915 | 308 |
| 1191 | 3300005539 | Ga0068853_100265341 | Ga0068853_1002653412 | 308 |
| 1192 | 3300005543 | Ga0070672_100000088 | Ga0070672_10000008836 | 308 |
| 1193 | 3300005544 | Ga0070686_100000719 | Ga0070686_1000007193 | 308 |
| 1194 | 3300005544 | Ga0070686_100013533 | Ga0070686_1000135332 | 308 |
| 1195 | 3300005545 | Ga0070695_100000586 | Ga0070695_1000005864 | 308 |
| 1196 | 3300005545 | Ga0070695_100003316 | Ga0070695_10000331612 | 308 |
| 1197 | 3300005545 | Ga0070695_100191825 | Ga0070695_1001918252 | 308 |
| 1198 | 3300005546 | Ga0070696_100000921 | Ga0070696_1000009214 | 308 |
| 1199 | 3300005546 | Ga0070696_100108735 | Ga0070696_1001087352 | 308 |
| 1200 | 3300005547 | Ga0070693_100000134 | Ga0070693_10000013425 | 308 |
| 1201 | 3300005549 | Ga0070704_100000026 | Ga0070704_10000002611 | 308 |
| 1202 | 3300005563 | Ga0068855_100006834 | Ga0068855_1000068344 | 308 |
| 1203 | 3300005564 | Ga0070664_100001420 | Ga0070664_10000142022 | 308 |
| 1204 | 3300005564 | Ga0070664_100155219 | Ga0070664_1001552192 | 308 |
| 1205 | 3300005577 | Ga0068857_100001388 | Ga0068857_1000013884 | 308 |
| 1206 | 3300005577 | Ga0068857_100039317 | Ga0068857_1000393173 | 308 |
| 1207 | 3300005578 | Ga0068854_100000546 | Ga0068854_10000054613 | 308 |
| 1208 | 3300005614 | Ga0068856_100002000 | Ga0068856_1000020005 | 308 |
| 1209 | 3300005615 | Ga0070702_100000245 | Ga0070702_10000024515 | 308 |
| 1210 | 3300005615 | Ga0070702_100012324 | Ga0070702_1000123244 | 308 |
| 1211 | 3300005616 | Ga0068852_100002320 | Ga0068852_1000023204 | 308 |
| 1212 | 3300005617 | Ga0068859_100006734 | Ga0068859_1000067344 | 308 |
| 1213 | 3300005617 | Ga0068859_100049744 | Ga0068859_1000497444 | 308 |
| 1214 | 3300005618 | Ga0068864_100000890 | Ga0068864_10000089011 | 308 |
| 1215 | 3300005618 | Ga0068864_100124327 | Ga0068864_1001243272 | 308 |
| 1216 | 3300005618 | Ga0068864_100415709 | Ga0068864_1004157092 | 308 |
| 1217 | 3300005718 | Ga0068866_10000221 | Ga0068866_1000022111 | 308 |
| 1218 | 3300005719 | Ga0068861_100000783 | Ga0068861_1000007834 | 308 |
| 1219 | 3300005840 | Ga0068870_10000090 | Ga0068870_1000009035 | 308 |
| 1220 | 3300005841 | Ga0068863_100000340 | Ga0068863_1000003403 | 308 |
| 1221 | 3300005841 | Ga0068863_100061662 | Ga0068863_1000616622 | 308 |
| 1222 | 3300005842 | Ga0068858_100000295 | Ga0068858_10000029546 | 308 |
| 1223 | 3300005842 | Ga0068858_100031612 | Ga0068858_1000316126 | 308 |
| 1224 | 3300005843 | Ga0068860_100001285 | Ga0068860_10000128514 | 308 |
| 1225 | 3300005843 | Ga0068860_100431596 | Ga0068860_1004315962 | 308 |
| 1226 | 3300005844 | Ga0068862_100003658 | Ga0068862_1000036584 | 308 |
| 1227 | 3300005844 | Ga0068862_100043709 | Ga0068862_1000437094 | 308 |
| 1228 | 3300005937 | Ga0081455_10000007 | Ga0081455_10000007229 | 308 |
| 1229 | 3300005937 | Ga0081455_10007150 | Ga0081455_1000715012 | 308 |
| 1230 | 3300005937 | Ga0081455_10019547 | Ga0081455_100195474 | 308 |
| 1231 | 3300005937 | Ga0081455_10089595 | Ga0081455_100895952 | 308 |
| 1232 | 3300005983 | Ga0081540_1018305 | Ga0081540_10183053 | 308 |
| 1233 | 3300005985 | Ga0081539_10001525 | Ga0081539_1000152535 | 308 |
| 1234 | 3300006028 | Ga0070717_10008927 | Ga0070717_100089277 | 308 |
| 1235 | 3300006028 | Ga0070717_10009632 | Ga0070717_100096328 | 308 |
| 1236 | 3300006038 | Ga0075365_10187265 | Ga0075365_101872652 | 308 |
| 1237 | 3300006048 | Ga0075363_100037328 | Ga0075363_1000373284 | 308 |
| 1238 | 3300006058 | Ga0075432_10005977 | Ga0075432_100059773 | 308 |
| 1239 | 3300006058 | Ga0075432_10044381 | Ga0075432_100443811 | 308 |
| 1240 | 3300006163 | Ga0070715_10076610 | Ga0070715_100766102 | 308 |
| 1241 | 3300006173 | Ga0070716_100029152 | Ga0070716_1000291522 | 308 |
| 1242 | 3300006194 | Ga0075427_10000012 | Ga0075427_1000001214 | 308 |
| 1243 | 3300006195 | Ga0075366_10008677 | Ga0075366_100086772 | 308 |
| 1244 | 3300006195 | Ga0075366_10011231 | Ga0075366_100112312 | 308 |
| 1245 | 3300006237 | Ga0097621_100000040 | Ga0097621_10000004051 | 308 |
| 1246 | 3300006237 | Ga0097621_100070634 | Ga0097621_1000706344 | 308 |
| 1247 | 3300006358 | Ga0068871_100000252 | Ga0068871_10000025244 | 308 |
| 1248 | 3300006358 | Ga0068871_100012473 | Ga0068871_1000124731 | 308 |
| 1249 | 3300006846 | Ga0075430_100018573 | Ga0075430_1000185733 | 308 |
| 1250 | 3300006847 | Ga0075431_100181614 | Ga0075431_1001816142 | 308 |
| 1251 | 3300006852 | Ga0075433_10000007 | Ga0075433_1000000719 | 308 |
| 1252 | 3300006871 | Ga0075434_100002477 | Ga0075434_10000247714 | 308 |
| 1253 | 3300006871 | Ga0075434_100002531 | Ga0075434_1000025313 | 308 |
| 1254 | 3300006871 | Ga0075434_100157129 | Ga0075434_1001571292 | 308 |
| 1255 | 3300006871 | Ga0075434_100307519 | Ga0075434_1003075192 | 308 |
| 1256 | 3300006880 | Ga0075429_100002081 | Ga0075429_1000020815 | 308 |
| 1257 | 3300006881 | Ga0068865_100000275 | Ga0068865_10000027525 | 308 |
| 1258 | 3300006914 | Ga0075436_100090548 | Ga0075436_1000905482 | 308 |
| 1259 | 3300006931 | Ga0097620_100006734 | Ga0097620_1000067344 | 308 |
| 1260 | 3300006931 | Ga0097620_100049739 | Ga0097620_1000497394 | 308 |
| 1261 | 3300007076 | Ga0075435_100001384 | Ga0075435_1000013848 | 308 |
| 1262 | 3300007265 | Ga0099794_10031966 | Ga0099794_100319663 | 308 |
| 1263 | 3300007788 | Ga0099795_10000002 | Ga0099795_10000002119 | 308 |
| 1264 | 3300009011 | Ga0105251_10036640 | Ga0105251_100366401 | 308 |
| 1265 | 3300009092 | Ga0105250_10025985 | Ga0105250_100259852 | 308 |
| 1266 | 3300009093 | Ga0105240_10370371 | Ga0105240_103703712 | 308 |
| 1267 | 3300009094 | Ga0111539_10000394 | Ga0111539_1000039441 | 308 |
| 1268 | 3300009094 | Ga0111539_10003483 | Ga0111539_1000348315 | 308 |
| 1269 | 3300009098 | Ga0105245_10000462 | Ga0105245_1000046222 | 308 |
| 1270 | 3300009098 | Ga0105245_10105110 | Ga0105245_101051103 | 308 |
| 1271 | 3300009101 | Ga0105247_10000442 | Ga0105247_1000044213 | 308 |
| 1272 | 3300009101 | Ga0105247_10007985 | Ga0105247_100079854 | 308 |
| 1273 | 3300009147 | Ga0114129_10001111 | Ga0114129_1000111124 | 308 |
| 1274 | 3300009147 | Ga0114129_10397585 | Ga0114129_103975852 | 308 |
| 1275 | 3300009148 | Ga0105243_10000282 | Ga0105243_1000028245 | 308 |
| 1276 | 3300009148 | Ga0105243_10034755 | Ga0105243_100347552 | 308 |
| 1277 | 3300009174 | Ga0105241_10000652 | Ga0105241_1000065221 | 308 |
| 1278 | 3300009174 | Ga0105241_10258825 | Ga0105241_102588252 | 308 |
| 1279 | 3300009176 | Ga0105242_10001726 | Ga0105242_1000172614 | 308 |
| 1280 | 3300009176 | Ga0105242_10033558 | Ga0105242_100335585 | 308 |
| 1281 | 3300009545 | Ga0105237_10008154 | Ga0105237_1000815411 | 308 |
| 1282 | 3300009545 | Ga0105237_10353638 | Ga0105237_103536382 | 308 |
| 1283 | 3300009551 | Ga0105238_10023755 | Ga0105238_100237555 | 308 |
| 1284 | 3300009553 | Ga0105249_10001210 | Ga0105249_100012108 | 308 |
| 1285 | 3300009553 | Ga0105249_10010878 | Ga0105249_1001087810 | 308 |
| 1286 | 3300009553 | Ga0105249_10293262 | Ga0105249_102932622 | 308 |
| 1287 | 3300010159 | Ga0099796_10000004 | Ga0099796_1000000415 | 308 |
| 1288 | 3300010375 | Ga0105239_10006303 | Ga0105239_1000630311 | 308 |
| 1289 | 3300010375 | Ga0105239_10013274 | Ga0105239_100132748 | 308 |
| 1290 | 3300010375 | Ga0105239_10328605 | Ga0105239_103286052 | 308 |
| 1291 | 3300010375 | Ga0105239_10358824 | Ga0105239_103588242 | 308 |
| 1292 | 3300011119 | Ga0105246_10000312 | Ga0105246_1000031211 | 308 |
| 1293 | 3300011119 | Ga0105246_10140466 | Ga0105246_101404662 | 308 |
| 1294 | 3300013100 | Ga0157373_10026078 | Ga0157373_100260783 | 308 |
| 1295 | 3300013100 | Ga0157373_10088140 | Ga0157373_100881402 | 308 |
| 1296 | 3300013102 | Ga0157371_10011709 | Ga0157371_100117096 | 308 |
| 1297 | 3300013296 | Ga0157374_10001123 | Ga0157374_100011239 | 308 |
| 1298 | 3300013297 | Ga0157378_10000270 | Ga0157378_1000027018 | 308 |
| 1299 | 3300013297 | Ga0157378_10187750 | Ga0157378_101877501 | 308 |
| 1300 | 3300013297 | Ga0157378_10494249 | Ga0157378_104942492 | 308 |
| 1301 | 3300013306 | Ga0163162_10000145 | Ga0163162_1000014520 | 308 |
| 1302 | 3300013306 | Ga0163162_10053735 | Ga0163162_100537352 | 308 |
| 1303 | 3300013306 | Ga0163162_10065175 | Ga0163162_100651754 | 308 |
| 1304 | 3300013306 | Ga0163162_10442921 | Ga0163162_104429212 | 308 |
| 1305 | 3300013307 | Ga0157372_10004025 | Ga0157372_1000402511 | 308 |
| 1306 | 3300013308 | Ga0157375_10000332 | Ga0157375_1000033217 | 308 |
| 1307 | 3300014325 | Ga0163163_10000865 | Ga0163163_1000086523 | 308 |
| 1308 | 3300014325 | Ga0163163_10010305 | Ga0163163_100103054 | 308 |
| 1309 | 3300014326 | Ga0157380_10003074 | Ga0157380_100030743 | 308 |
| 1310 | 3300014497 | Ga0182008_10070087 | Ga0182008_100700871 | 308 |
| 1311 | 3300014745 | Ga0157377_10000137 | Ga0157377_1000013721 | 308 |
| 1312 | 3300014968 | Ga0157379_10001761 | Ga0157379_100017613 | 308 |
| 1313 | 3300014968 | Ga0157379_10036684 | Ga0157379_100366843 | 308 |
| 1314 | 3300014969 | Ga0157376_10000088 | Ga0157376_1000008845 | 308 |
| 1315 | 3300014969 | Ga0157376_10088578 | Ga0157376_100885782 | 308 |
| 1316 | 3300017792 | Ga0163161_10000144 | Ga0163161_1000014426 | 308 |
| 1317 | 3300025271 | Ga0207666_1000048 | Ga0207666_100004810 | 308 |
| 1318 | 3300025297 | Ga0209758_1002417 | Ga0209758_10024177 | 308 |
| 1319 | 3300025304 | Ga0209257_1005168 | Ga0209257_10051684 | 308 |
| 1320 | 3300025315 | Ga0207697_10000136 | Ga0207697_1000013611 | 308 |
| 1321 | 3300025321 | Ga0207656_10122122 | Ga0207656_101221221 | 308 |
| 1322 | 3300025711 | Ga0207696_1018901 | Ga0207696_10189012 | 308 |
| 1323 | 3300025885 | Ga0207653_10008240 | Ga0207653_100082402 | 308 |
| 1324 | 3300025893 | Ga0207682_10000006 | Ga0207682_1000000610 | 308 |
| 1325 | 3300025899 | Ga0207642_10000628 | Ga0207642_100006288 | 308 |
| 1326 | 3300025900 | Ga0207710_10001915 | Ga0207710_100019152 | 308 |
| 1327 | 3300025900 | Ga0207710_10004369 | Ga0207710_100043692 | 308 |
| 1328 | 3300025901 | Ga0207688_10000027 | Ga0207688_1000002745 | 308 |
| 1329 | 3300025901 | Ga0207688_10003913 | Ga0207688_100039134 | 308 |
| 1330 | 3300025903 | Ga0207680_10013527 | Ga0207680_100135274 | 308 |
| 1331 | 3300025903 | Ga0207680_10025017 | Ga0207680_100250173 | 308 |
| 1332 | 3300025904 | Ga0207647_10005467 | Ga0207647_100054672 | 308 |
| 1333 | 3300025904 | Ga0207647_10005974 | Ga0207647_100059747 | 308 |
| 1334 | 3300025905 | Ga0207685_10069164 | Ga0207685_100691642 | 308 |
| 1335 | 3300025907 | Ga0207645_10000100 | Ga0207645_1000010045 | 308 |
| 1336 | 3300025907 | Ga0207645_10062741 | Ga0207645_100627413 | 308 |
| 1337 | 3300025908 | Ga0207643_10000007 | Ga0207643_10000007156 | 308 |
| 1338 | 3300025909 | Ga0207705_10000002 | Ga0207705_10000002891 | 308 |
| 1339 | 3300025910 | Ga0207684_10238209 | Ga0207684_102382092 | 308 |
| 1340 | 3300025911 | Ga0207654_10000314 | Ga0207654_1000031424 | 308 |
| 1341 | 3300025911 | Ga0207654_10033564 | Ga0207654_100335643 | 308 |
| 1342 | 3300025912 | Ga0207707_10003553 | Ga0207707_100035536 | 308 |
| 1343 | 3300025913 | Ga0207695_10140940 | Ga0207695_101409401 | 308 |
| 1344 | 3300025914 | Ga0207671_10011777 | Ga0207671_100117774 | 308 |
| 1345 | 3300025914 | Ga0207671_10278907 | Ga0207671_102789072 | 308 |
| 1346 | 3300025916 | Ga0207663_10032113 | Ga0207663_100321133 | 308 |
| 1347 | 3300025917 | Ga0207660_10000041 | Ga0207660_1000004127 | 308 |
| 1348 | 3300025917 | Ga0207660_10026737 | Ga0207660_100267374 | 308 |
| 1349 | 3300025918 | Ga0207662_10000282 | Ga0207662_1000028210 | 308 |
| 1350 | 3300025918 | Ga0207662_10025433 | Ga0207662_100254333 | 308 |
| 1351 | 3300025918 | Ga0207662_10131399 | Ga0207662_101313992 | 308 |
| 1352 | 3300025919 | Ga0207657_10000519 | Ga0207657_1000051947 | 308 |
| 1353 | 3300025919 | Ga0207657_10003933 | Ga0207657_1000393310 | 308 |
| 1354 | 3300025919 | Ga0207657_10018028 | Ga0207657_100180285 | 308 |
| 1355 | 3300025919 | Ga0207657_10077974 | Ga0207657_100779742 | 308 |
| 1356 | 3300025919 | Ga0207657_10114073 | Ga0207657_101140732 | 308 |
| 1357 | 3300025920 | Ga0207649_10002204 | Ga0207649_1000220411 | 308 |
| 1358 | 3300025920 | Ga0207649_10120515 | Ga0207649_101205152 | 308 |
| 1359 | 3300025923 | Ga0207681_10000100 | Ga0207681_1000010076 | 308 |
| 1360 | 3300025924 | Ga0207694_10037389 | Ga0207694_100373894 | 308 |
| 1361 | 3300025925 | Ga0207650_10019786 | Ga0207650_100197862 | 308 |
| 1362 | 3300025926 | Ga0207659_10000044 | Ga0207659_1000004491 | 308 |
| 1363 | 3300025927 | Ga0207687_10000072 | Ga0207687_1000007247 | 308 |
| 1364 | 3300025927 | Ga0207687_10053669 | Ga0207687_100536694 | 308 |
| 1365 | 3300025927 | Ga0207687_10213845 | Ga0207687_102138452 | 308 |
| 1366 | 3300025928 | Ga0207700_10008381 | Ga0207700_100083812 | 308 |
| 1367 | 3300025928 | Ga0207700_10017558 | Ga0207700_100175582 | 308 |
| 1368 | 3300025929 | Ga0207664_10018577 | Ga0207664_100185775 | 308 |
| 1369 | 3300025931 | Ga0207644_10001432 | Ga0207644_1000143210 | 308 |
| 1370 | 3300025931 | Ga0207644_10013238 | Ga0207644_100132384 | 308 |
| 1371 | 3300025932 | Ga0207690_10000140 | Ga0207690_1000014050 | 308 |
| 1372 | 3300025932 | Ga0207690_10075849 | Ga0207690_100758493 | 308 |
| 1373 | 3300025933 | Ga0207706_10003180 | Ga0207706_1000318011 | 308 |
| 1374 | 3300025933 | Ga0207706_10126629 | Ga0207706_101266291 | 308 |
| 1375 | 3300025933 | Ga0207706_10161971 | Ga0207706_101619712 | 308 |
| 1376 | 3300025934 | Ga0207686_10000448 | Ga0207686_1000044829 | 308 |
| 1377 | 3300025934 | Ga0207686_10115276 | Ga0207686_101152761 | 308 |
| 1378 | 3300025935 | Ga0207709_10000154 | Ga0207709_1000015494 | 308 |
| 1379 | 3300025936 | Ga0207670_10000444 | Ga0207670_1000044419 | 308 |
| 1380 | 3300025936 | Ga0207670_10156746 | Ga0207670_101567462 | 308 |
| 1381 | 3300025936 | Ga0207670_10324460 | Ga0207670_103244601 | 308 |
| 1382 | 3300025937 | Ga0207669_10000176 | Ga0207669_100001765 | 308 |
| 1383 | 3300025938 | Ga0207704_10000086 | Ga0207704_1000008618 | 308 |
| 1384 | 3300025938 | Ga0207704_10030558 | Ga0207704_100305584 | 308 |
| 1385 | 3300025939 | Ga0207665_10000666 | Ga0207665_1000066611 | 308 |
| 1386 | 3300025940 | Ga0207691_10000214 | Ga0207691_1000021445 | 308 |
| 1387 | 3300025941 | Ga0207711_10001773 | Ga0207711_1000177311 | 308 |
| 1388 | 3300025941 | Ga0207711_10012916 | Ga0207711_100129162 | 308 |
| 1389 | 3300025942 | Ga0207689_10000366 | Ga0207689_1000036641 | 308 |
| 1390 | 3300025942 | Ga0207689_10038482 | Ga0207689_100384822 | 308 |
| 1391 | 3300025944 | Ga0207661_10000087 | Ga0207661_1000008726 | 308 |
| 1392 | 3300025944 | Ga0207661_10107424 | Ga0207661_101074243 | 308 |
| 1393 | 3300025944 | Ga0207661_10151138 | Ga0207661_101511382 | 308 |
| 1394 | 3300025945 | Ga0207679_10000029 | Ga0207679_1000002941 | 308 |
| 1395 | 3300025945 | Ga0207679_10149531 | Ga0207679_101495311 | 308 |
| 1396 | 3300025949 | Ga0207667_10034403 | Ga0207667_100344034 | 308 |
| 1397 | 3300025960 | Ga0207651_10000264 | Ga0207651_100002648 | 308 |
| 1398 | 3300025960 | Ga0207651_10149237 | Ga0207651_101492372 | 308 |
| 1399 | 3300025961 | Ga0207712_10000129 | Ga0207712_1000012982 | 308 |
| 1400 | 3300025961 | Ga0207712_10066481 | Ga0207712_100664812 | 308 |
| 1401 | 3300025972 | Ga0207668_10000100 | Ga0207668_1000010060 | 308 |
| 1402 | 3300025986 | Ga0207658_10020786 | Ga0207658_100207863 | 308 |
| 1403 | 3300025986 | Ga0207658_10187780 | Ga0207658_101877802 | 308 |
| 1404 | 3300026023 | Ga0207677_10059396 | Ga0207677_100593963 | 308 |
| 1405 | 3300026041 | Ga0207639_10002204 | Ga0207639_1000220411 | 308 |
| 1406 | 3300026067 | Ga0207678_10002814 | Ga0207678_1000281411 | 308 |
| 1407 | 3300026067 | Ga0207678_10005074 | Ga0207678_100050746 | 308 |
| 1408 | 3300026075 | Ga0207708_10001802 | Ga0207708_1000180210 | 308 |
| 1409 | 3300026075 | Ga0207708_10002366 | Ga0207708_100023667 | 308 |
| 1410 | 3300026078 | Ga0207702_10001819 | Ga0207702_1000181914 | 308 |
| 1411 | 3300026088 | Ga0207641_10000476 | Ga0207641_1000047618 | 308 |
| 1412 | 3300026088 | Ga0207641_10068621 | Ga0207641_100686212 | 308 |
| 1413 | 3300026089 | Ga0207648_10000072 | Ga0207648_1000007218 | 308 |
| 1414 | 3300026089 | Ga0207648_10051806 | Ga0207648_100518063 | 308 |
| 1415 | 3300026089 | Ga0207648_10087749 | Ga0207648_100877492 | 308 |
| 1416 | 3300026095 | Ga0207676_10000512 | Ga0207676_1000051221 | 308 |
| 1417 | 3300026116 | Ga0207674_10000697 | Ga0207674_1000069725 | 308 |
| 1418 | 3300026116 | Ga0207674_10011489 | Ga0207674_100114895 | 308 |
| 1419 | 3300026116 | Ga0207674_10164655 | Ga0207674_101646552 | 308 |
| 1420 | 3300026118 | Ga0207675_100002384 | Ga0207675_10000238413 | 308 |
| 1421 | 3300026118 | Ga0207675_100023832 | Ga0207675_1000238324 | 308 |
| 1422 | 3300026121 | Ga0207683_10000029 | Ga0207683_1000002928 | 308 |
| 1423 | 3300026121 | Ga0207683_10004241 | Ga0207683_100042413 | 308 |
| 1424 | 3300026142 | Ga0207698_10000523 | Ga0207698_1000052321 | 308 |
| 1425 | 3300027364 | Ga0209967_1003594 | Ga0209967_10035942 | 308 |
| 1426 | 3300027512 | Ga0209179_1000003 | Ga0209179_100000375 | 308 |
| 1427 | 3300027682 | Ga0209971_1011541 | Ga0209971_10115413 | 308 |
| 1428 | 3300027682 | Ga0209971_1016573 | Ga0209971_10165732 | 308 |
| 1429 | 3300027695 | Ga0209966_1003460 | Ga0209966_10034603 | 308 |
| 1430 | 3300027717 | Ga0209998_10001339 | Ga0209998_100013395 | 308 |
| 1431 | 3300027717 | Ga0209998_10001839 | Ga0209998_100018392 | 308 |
| 1432 | 3300027876 | Ga0209974_10002749 | Ga0209974_100027492 | 308 |
| 1433 | 3300027907 | Ga0207428_10000100 | Ga0207428_10000100108 | 308 |
| 1434 | 3300027907 | Ga0207428_10000115 | Ga0207428_1000011563 | 308 |
| 1435 | 3300027907 | Ga0207428_10000228 | Ga0207428_1000022840 | 308 |
| 1436 | 3300028379 | Ga0268266_10017979 | Ga0268266_100179794 | 308 |
| 1437 | 3300028380 | Ga0268265_10001240 | Ga0268265_100012403 | 308 |
| 1438 | 3300028381 | Ga0268264_10006796 | Ga0268264_1000679611 | 308 |
| 1439 | 3300028381 | Ga0268264_10153478 | Ga0268264_101534782 | 308 |
| 1440 | 3300031238 | Ga0265332_10074214 | Ga0265332_100742142 | 308 |
| 1441 | 3300031241 | Ga0265325_10014793 | Ga0265325_100147934 | 308 |
| 1442 | 3300031247 | Ga0265340_10033136 | Ga0265340_100331363 | 308 |
| 1443 | 3300031344 | Ga0265316_10041124 | Ga0265316_100411245 | 308 |
| 1444 | 3300031548 | Ga0307408_100050931 | Ga0307408_1000509313 | 308 |
| 1445 | 3300031548 | Ga0307408_100057956 | Ga0307408_1000579562 | 308 |
| 1446 | 3300031548 | Ga0307408_100111005 | Ga0307408_1001110053 | 308 |
| 1447 | 3300031548 | Ga0307408_100169313 | Ga0307408_1001693132 | 308 |
| 1448 | 3300031730 | Ga0307516_10014917 | Ga0307516_100149172 | 308 |
| 1449 | 3300031731 | Ga0307405_10057297 | Ga0307405_100572972 | 308 |
| 1450 | 3300031824 | Ga0307413_10021873 | Ga0307413_100218733 | 308 |
| 1451 | 3300031824 | Ga0307413_10049793 | Ga0307413_100497933 | 308 |
| 1452 | 3300031852 | Ga0307410_10051828 | Ga0307410_100518282 | 308 |
| 1453 | 3300031901 | Ga0307406_10031430 | Ga0307406_100314304 | 308 |
| 1454 | 3300031901 | Ga0307406_10045124 | Ga0307406_100451244 | 308 |
| 1455 | 3300031903 | Ga0307407_10023000 | Ga0307407_100230003 | 308 |
| 1456 | 3300031903 | Ga0307407_10304918 | Ga0307407_103049181 | 308 |
| 1457 | 3300031911 | Ga0307412_10090894 | Ga0307412_100908943 | 308 |
| 1458 | 3300031911 | Ga0307412_10125753 | Ga0307412_101257533 | 308 |
| 1459 | 3300031995 | Ga0307409_100055014 | Ga0307409_1000550143 | 308 |
| 1460 | 3300031995 | Ga0307409_100065630 | Ga0307409_1000656302 | 308 |
| 1461 | 3300031995 | Ga0307409_100287308 | Ga0307409_1002873082 | 308 |
| 1462 | 3300032002 | Ga0307416_100020106 | Ga0307416_1000201065 | 308 |
| 1463 | 3300032002 | Ga0307416_100063313 | Ga0307416_1000633132 | 308 |
| 1464 | 3300032002 | Ga0307416_100502261 | Ga0307416_1005022612 | 308 |
| 1465 | 3300032004 | Ga0307414_10012904 | Ga0307414_100129046 | 308 |
| 1466 | 3300032004 | Ga0307414_10014760 | Ga0307414_100147602 | 308 |
| 1467 | 3300032004 | Ga0307414_10151270 | Ga0307414_101512702 | 308 |
| 1468 | 3300032004 | Ga0307414_10309643 | Ga0307414_103096432 | 308 |
| 1469 | 3300032005 | Ga0307411_10018956 | Ga0307411_100189564 | 308 |
| 1470 | 3300032005 | Ga0307411_10024990 | Ga0307411_100249903 | 308 |
| 1471 | 3300032126 | Ga0307415_100065146 | Ga0307415_1000651462 | 308 |
| 1472 | 3300034816 | Ga0373930_0001541 | Ga0373930_0001541_2499_3425 | 308 |
| 1473 | 3300034816 | Ga0373930_0009273 | Ga0373930_0009273_130_1056 | 308 |
| 1474 | 3300034817 | Ga0373948_0000346 | Ga0373948_0000346_1937_2863 | 308 |
| 1475 | 3300034818 | Ga0373950_0000453 | Ga0373950_0000453_476_1402 | 308 |
| 1476 | 3300034818 | Ga0373950_0001749 | Ga0373950_0001749_1859_2785 | 308 |
| 1477 | 3300034820 | Ga0373959_0001859 | Ga0373959_0001859_1645_2571 | 308 |
| 1478 | 3300034957 | Ga0373938_0000565 | Ga0373938_0000565_4798_5724 | 308 |
| 1479 | 3300034957 | Ga0373938_0000859 | Ga0373938_0000859_2985_3911 | 308 |
| 1480 | 3300034957 | Ga0373938_0010089 | Ga0373938_0010089_80_1006 | 308 |
| 1481 | 3300035083 | Ga0373926_0014990 | Ga0373926_0014990_288_1214 | 308 |
| 1482 | 3300035084 | Ga0373928_0000893 | Ga0373928_0000893_1107_2033 | 308 |
| 1483 | 3300035084 | Ga0373928_0001974 | Ga0373928_0001974_1821_2747 | 308 |
| 1484 | 3300035085 | Ga0373929_0000957 | Ga0373929_0000957_3915_4841 | 308 |
| 1485 | 3300035089 | Ga0373944_0009683 | Ga0373944_0009683_1035_1961 | 308 |
| 1486 | 3300035090 | Ga0373949_0000284 | Ga0373949_0000284_11309_12235 | 308 |
| 1487 | 3300035090 | Ga0373949_0001993 | Ga0373949_0001993_88_1014 | 308 |
| 1488 | 3300035091 | Ga0373951_0000560 | Ga0373951_0000560_985_1911 | 308 |
| 1489 | 3300035091 | Ga0373951_0001866 | Ga0373951_0001866_112_1038 | 308 |
| 1490 | 3300035091 | Ga0373951_0005206 | Ga0373951_0005206_547_1473 | 308 |
| 1491 | 3300035092 | Ga0373952_0000135 | Ga0373952_0000135_1007_1933 | 308 |
| 1492 | 3300035092 | Ga0373952_0001907 | Ga0373952_0001907_2837_3763 | 308 |
| 1493 | 3300035112 | Ga0373932_0000172 | Ga0373932_0000172_16150_17076 | 308 |
| 1494 | 3300035113 | Ga0373936_0028869 | Ga0373936_0028869_847_1806 | 308 |
| 1495 | 3300035114 | Ga0373939_0001475 | Ga0373939_0001475_3792_4718 | 308 |
| 1496 | 3300035114 | Ga0373939_0001827 | Ga0373939_0001827_1280_2206 | 308 |
| 1497 | 3300035115 | Ga0373941_0000081 | Ga0373941_0000081_13682_14608 | 308 |
| 1498 | 3300035121 | Ga0373960_0001722 | Ga0373960_0001722_985_1911 | 308 |
| 1499 | 3300035121 | Ga0373960_0002628 | Ga0373960_0002628_2469_3395 | 308 |
| 1500 | 3300035121 | Ga0373960_0061296 | Ga0373960_0061296_60_986 | 308 |
| 1501 | 3300035170 | Ga0373943_0002637 | Ga0373943_0002637_6044_6970 | 308 |
| 1502 | 3300035171 | Ga0373946_0001719 | Ga0373946_0001719_5408_6367 | 308 |
| 1503 | 3300035171 | Ga0373946_0042235 | Ga0373946_0042235_810_1736 | 308 |
| 1504 | 3300035172 | Ga0373955_0008965 | Ga0373955_0008965_2863_3822 | 308 |
| 1505 | 3300035172 | Ga0373955_0110363 | Ga0373955_0110363_21_959 | 308 |
| 1506 | 3300035207 | Ga0373942_0000173 | Ga0373942_0000173_14267_15193 | 308 |
| 1507 | 3300035207 | Ga0373942_0001874 | Ga0373942_0001874_2319_3245 | 308 |
| 1508 | 3300035241 | Ga0373961_0000196 | Ga0373961_0000196_25829_26755 | 308 |
| 1509 | 3300035242 | Ga0373962_0000151 | Ga0373962_0000151_5002_5928 | 308 |
| 1510 | 3300035410 | Ga0373924_0006538 | Ga0373924_0006538_2426_3385 | 308 |
| 1511 | 3300035691 | Ga0373931_0001253 | Ga0373931_0001253_8559_9485 | 308 |
| 1512 | 3300035691 | Ga0373931_0009230 | Ga0373931_0009230_1389_2315 | 308 |
| 1513 | 3300035691 | Ga0373931_0046680 | Ga0373931_0046680_220_1146 | 308 |
| 1514 | 3300035692 | Ga0373935_0004350 | Ga0373935_0004350_5009_5935 | 308 |
| 1515 | 3300035692 | Ga0373935_0040168 | Ga0373935_0040168_152_1111 | 308 |
| 1516 | 3300035695 | Ga0373927_0027756 | Ga0373927_0027756_2741_3667 | 308 |
| 1517 | 3300035695 | Ga0373927_0075379 | Ga0373927_0075379_326_1252 | 308 |
| 1518 | 3300035724 | Ga0373933_0000697 | Ga0373933_0000697_14391_15341 | 308 |
| 1519 | 3300035725 | Ga0373947_0015465 | Ga0373947_0015465_2953_3879 | 308 |
| 1520 | 3300036401 | Ga0373937_0023630 | Ga0373937_0023630_4344_5303 | 308 |
| 1521 | 3300036401 | Ga0373937_0033607 | Ga0373937_0033607_1330_2289 | 308 |
| 1522 | 3300037068 | Ga0373925_0025122 | Ga0373925_0025122_3386_4312 | 308 |
| 1523 | 3300037068 | Ga0373925_0058161 | Ga0373925_0058161_1117_2076 | 308 |
| 1524 | 3300037068 | Ga0373925_0099769 | Ga0373925_0099769_1084_2010 | 308 |
| 1525 | 3300037418 | Ga0395900_0339552 | Ga0395900_0339552_482_1408 | 308 |
| 1526 | 3300037471 | Ga0395905_0001381 | Ga0395905_0001381_22273_23199 | 308 |
| 1527 | 3300039437 | Ga0436365_0007777 | Ga0436365_0007777_1024_1950 | 308 |
| 1528 | 3300042006 | Ga0439432_017279 | Ga0439432_017279_510_1448 | 308 |
| 1529 | 3300042436 | Ga0439435_0049467 | Ga0439435_0049467_53_979 | 308 |
| 1530 | 3300042876 | Ga0451577_0025411 | Ga0451577_0025411_4004_4930 | 308 |
| 1531 | 3300044656 | Ga0466969_0058844 | Ga0466969_0058844_48_995 | 308 |
| 1532 | 3300044712 | Ga0453684_0235668 | Ga0453684_0235668_381_1307 | 308 |
| 1533 | 3300045051 | Ga0451576_0184521 | Ga0451576_0184521_95_1021 | 308 |
| 1534 | 3300046452 | Ga0495617_028012 | Ga0495617_028012_18_977 | 308 |
| 1535 | 3300046459 | Ga0495629_0000280 | Ga0495629_0000280_6748_7674 | 308 |
| 1536 | 3300046459 | Ga0495629_0110151 | Ga0495629_0110151_417_1376 | 308 |
| 1537 | 3300046460 | Ga0495638_0088100 | Ga0495638_0088100_97_1023 | 308 |
| 1538 | 3300046461 | Ga0495641_0044804 | Ga0495641_0044804_804_1763 | 308 |
| 1539 | 3300046462 | Ga0495651_0001797 | Ga0495651_0001797_6533_7492 | 308 |
| 1540 | 3300046463 | Ga0495653_0103650 | Ga0495653_0103650_706_1632 | 308 |
| 1541 | 3300046463 | Ga0495653_0109734 | Ga0495653_0109734_777_1736 | 308 |
| 1542 | 3300046472 | Ga0495580_0024266 | Ga0495580_0024266_1651_2610 | 308 |
| 1543 | 3300046473 | Ga0495582_0005522 | Ga0495582_0005522_3082_4008 | 308 |
| 1544 | 3300046475 | Ga0495639_0038346 | Ga0495639_0038346_246_1172 | 308 |
| 1545 | 3300046476 | Ga0495662_0018057 | Ga0495662_0018057_804_1763 | 308 |
| 1546 | 3300046491 | Ga0495584_0044126 | Ga0495584_0044126_68_1027 | 308 |
| 1547 | 3300046492 | Ga0495585_0000974 | Ga0495585_0000974_15972_16931 | 308 |
| 1548 | 3300046499 | Ga0495594_0044111 | Ga0495594_0044111_541_1467 | 308 |
| 1549 | 3300046501 | Ga0495607_0011320 | Ga0495607_0011320_3963_4922 | 308 |
| 1550 | 3300046511 | Ga0495608_0014611 | Ga0495608_0014611_576_1535 | 308 |
| 1551 | 3300046514 | Ga0495618_0180488 | Ga0495618_0180488_30_956 | 308 |
| 1552 | 3300046516 | Ga0495628_0003390 | Ga0495628_0003390_12801_13760 | 308 |
| 1553 | 3300046516 | Ga0495628_0018942 | Ga0495628_0018942_2021_2980 | 308 |
| 1554 | 3300046517 | Ga0495630_0080217 | Ga0495630_0080217_544_1503 | 308 |
| 1555 | 3300046523 | Ga0495644_0002940 | Ga0495644_0002940_2770_3729 | 308 |
| 1556 | 3300046525 | Ga0495663_0016868 | Ga0495663_0016868_215_1174 | 308 |
| 1557 | 3300046526 | Ga0495666_0004626 | Ga0495666_0004626_590_1549 | 308 |
| 1558 | 3300046526 | Ga0495666_0023858 | Ga0495666_0023858_1794_2720 | 308 |
| 1559 | 3300046529 | Ga0495652_0034324 | Ga0495652_0034324_817_1776 | 308 |
| 1560 | 3300046531 | Ga0495665_0030354 | Ga0495665_0030354_1005_1964 | 308 |
| 1561 | 3300046533 | Ga0495640_0027286 | Ga0495640_0027286_786_1712 | 308 |
| 1562 | 3300046537 | Ga0495598_0009092 | Ga0495598_0009092_418_1377 | 308 |
| 1563 | 3300046543 | Ga0495645_0031265 | Ga0495645_0031265_2736_3695 | 308 |
| 1564 | 3300046557 | Ga0495622_0005155 | Ga0495622_0005155_3645_4604 | 308 |
| 1565 | 3300046557 | Ga0495622_0152561 | Ga0495622_0152561_65_991 | 308 |
| 1566 | 3300046558 | Ga0495633_0002331 | Ga0495633_0002331_2601_3560 | 308 |
| 1567 | 3300046559 | Ga0495667_0009295 | Ga0495667_0009295_5015_5974 | 308 |
| 1568 | 3300046615 | Ga0495656_0000276 | Ga0495656_0000276_10312_11271 | 308 |
| 1569 | 3300046642 | Ga0495634_0062371 | Ga0495634_0062371_1140_2066 | 308 |
| 1570 | 3300046648 | Ga0495611_0004478 | Ga0495611_0004478_312_1271 | 308 |
| 1571 | 3300046674 | Ga0495588_0012125 | Ga0495588_0012125_2101_3060 | 308 |
| 1572 | 3300046678 | Ga0495599_0011975 | Ga0495599_0011975_2049_3008 | 308 |
| 1573 | 3300046680 | Ga0495646_0114495 | Ga0495646_0114495_457_1416 | 308 |
| 1574 | 3300046681 | Ga0495647_0003761 | Ga0495647_0003761_3278_4237 | 308 |
| 1575 | 3300046681 | Ga0495647_0004239 | Ga0495647_0004239_3623_4549 | 308 |
| 1576 | 3300046683 | Ga0495658_0001282 | Ga0495658_0001282_3251_4177 | 308 |
| 1577 | 3300046683 | Ga0495658_0012893 | Ga0495658_0012893_2787_3713 | 308 |
| 1578 | 3300046683 | Ga0495658_0041311 | Ga0495658_0041311_1333_2292 | 308 |
| 1579 | 3300046689 | Ga0495613_0062257 | Ga0495613_0062257_1518_2444 | 308 |
| 1580 | 3300046689 | Ga0495613_0244584 | Ga0495613_0244584_90_1016 | 308 |
| 1581 | 3300046690 | Ga0495624_0006348 | Ga0495624_0006348_685_1644 | 308 |
| 1582 | 3300046690 | Ga0495624_0037078 | Ga0495624_0037078_164_1126 | 308 |
| 1583 | 3300046692 | Ga0495671_0006594 | Ga0495671_0006594_4864_5805 | 308 |
| 1584 | 3300046809 | Ga0495600_0024809 | Ga0495600_0024809_1437_2396 | 308 |
| 1585 | 3300047315 | Ga0495581_0061591 | Ga0495581_0061591_794_1753 | 308 |
| 1586 | 3300047317 | Ga0495604_0049006 | Ga0495604_0049006_1313_2272 | 308 |
| 1587 | 3300047319 | Ga0495674_0011609 | Ga0495674_0011609_2102_3028 | 308 |
| 1588 | 3300047321 | Ga0495676_0025908 | Ga0495676_0025908_2445_3404 | 308 |
| 1589 | 3300047322 | Ga0495680_0004358 | Ga0495680_0004358_9413_10372 | 308 |
| 1590 | 3300047322 | Ga0495680_0023741 | Ga0495680_0023741_3495_4454 | 308 |
| 1591 | 3300047446 | Ga0495679_049399 | Ga0495679_049399_90_1049 | 308 |
| 1592 | 3300047471 | Ga0495684_0041933 | Ga0495684_0041933_2132_3091 | 308 |
| 1593 | 3300047472 | Ga0495686_0141420 | Ga0495686_0141420_272_1246 | 308 |
| 1594 | 3300047673 | Ga0495593_0008133 | Ga0495593_0008133_4602_5561 | 308 |
| 1595 | 3300048088 | Ga0495602_0004518 | Ga0495602_0004518_3108_4067 | 308 |
| 1596 | 3300048088 | Ga0495602_0325781 | Ga0495602_0325781_38_997 | 308 |
| 1597 | 3300048089 | Ga0495614_0011280 | Ga0495614_0011280_1409_2368 | 308 |
| 1598 | 3300048903 | Ga0496100_0000530 | Ga0496100_0000530_14387_15313 | 308 |
| 1599 | 3300048903 | Ga0496100_0010450 | Ga0496100_0010450_881_1807 | 308 |
| 1600 | 3300048904 | Ga0496101_0000189 | Ga0496101_0000189_28699_29625 | 308 |
| 1601 | 3300048904 | Ga0496101_0006701 | Ga0496101_0006701_1227_2153 | 308 |
| 1602 | 3300048905 | Ga0496102_0024990 | Ga0496102_0024990_3037_3963 | 308 |
| 1603 | 3300048905 | Ga0496102_0041225 | Ga0496102_0041225_781_1707 | 308 |
| 1604 | 3300048906 | Ga0496103_0007850 | Ga0496103_0007850_4308_5234 | 308 |
| 1605 | 3300048907 | Ga0496104_0000508 | Ga0496104_0000508_14910_15848 | 308 |
| 1606 | 3300048907 | Ga0496104_0001997 | Ga0496104_0001997_10062_10988 | 308 |
| 1607 | 3300048907 | Ga0496104_0006052 | Ga0496104_0006052_90_1028 | 308 |
| 1608 | 3300048907 | Ga0496104_0059191 | Ga0496104_0059191_2416_3342 | 308 |
| 1609 | 3300048907 | Ga0496104_0063090 | Ga0496104_0063090_649_1575 | 308 |
| 1610 | 3300048907 | Ga0496104_0228172 | Ga0496104_0228172_677_1645 | 308 |
| 1611 | 3300048908 | Ga0496105_0006301 | Ga0496105_0006301_1864_2790 | 308 |
| 1612 | 3300048908 | Ga0496105_0016135 | Ga0496105_0016135_2508_3446 | 308 |
| 1613 | 3300048908 | Ga0496105_0122035 | Ga0496105_0122035_546_1472 | 308 |
| 1614 | 3300048908 | Ga0496105_0135232 | Ga0496105_0135232_168_1136 | 308 |
| 1615 | 3300048908 | Ga0496105_0254213 | Ga0496105_0254213_109_1035 | 308 |
| 1616 | 3300048909 | Ga0496106_0016847 | Ga0496106_0016847_3583_4509 | 308 |
| 1617 | 3300048909 | Ga0496106_0017851 | Ga0496106_0017851_141_1067 | 308 |
| 1618 | 3300048909 | Ga0496106_0438482 | Ga0496106_0438482_14_940 | 308 |
| 1619 | 3300048910 | Ga0496107_0003085 | Ga0496107_0003085_803_1729 | 308 |
| 1620 | 3300048910 | Ga0496107_0011126 | Ga0496107_0011126_3979_4905 | 308 |
| 1621 | 3300048910 | Ga0496107_0018052 | Ga0496107_0018052_3261_4187 | 308 |
| 1622 | 3300048911 | Ga0496108_0002465 | Ga0496108_0002465_13299_14225 | 308 |
| 1623 | 3300048911 | Ga0496108_0004455 | Ga0496108_0004455_9151_10077 | 308 |
| 1624 | 3300048911 | Ga0496108_0004887 | Ga0496108_0004887_6319_7245 | 308 |
| 1625 | 3300048911 | Ga0496108_0265285 | Ga0496108_0265285_304_1230 | 308 |
| 1626 | 3300048912 | Ga0496109_0000488 | Ga0496109_0000488_10090_11016 | 308 |
| 1627 | 3300048912 | Ga0496109_0005024 | Ga0496109_0005024_9395_10363 | 308 |
| 1628 | 3300048912 | Ga0496109_0006884 | Ga0496109_0006884_47_973 | 308 |
| 1629 | 3300048912 | Ga0496109_0009996 | Ga0496109_0009996_3739_4665 | 308 |
| 1630 | 3300048913 | Ga0496110_0031059 | Ga0496110_0031059_3030_3956 | 308 |
| 1631 | 3300048913 | Ga0496110_0074590 | Ga0496110_0074590_1784_2752 | 308 |
| 1632 | 3300048914 | Ga0496111_0008713 | Ga0496111_0008713_1437_2363 | 308 |
| 1633 | 3300048914 | Ga0496111_0020669 | Ga0496111_0020669_2812_3738 | 308 |
| 1634 | 3300048914 | Ga0496111_0079806 | Ga0496111_0079806_1419_2345 | 308 |
| 1635 | 3300048914 | Ga0496111_0083151 | Ga0496111_0083151_1176_2102 | 308 |
| 1636 | 3300048915 | Ga0496112_0002869 | Ga0496112_0002869_1822_2781 | 308 |
| 1637 | 3300048915 | Ga0496112_0006900 | Ga0496112_0006900_3096_4064 | 308 |
| 1638 | 3300048915 | Ga0496112_0018028 | Ga0496112_0018028_4244_5170 | 308 |
| 1639 | 3300048915 | Ga0496112_0053933 | Ga0496112_0053933_2284_3210 | 308 |
| 1640 | 3300048916 | Ga0496113_0002209 | Ga0496113_0002209_4200_5126 | 308 |
| 1641 | 3300048916 | Ga0496113_0002579 | Ga0496113_0002579_5920_6846 | 308 |
| 1642 | 3300048916 | Ga0496113_0075116 | Ga0496113_0075116_261_1229 | 308 |
| 1643 | 3300048916 | Ga0496113_0106377 | Ga0496113_0106377_140_1066 | 308 |
| 1644 | 3300048917 | Ga0496114_0001960 | Ga0496114_0001960_8747_9673 | 308 |
| 1645 | 3300048917 | Ga0496114_0006147 | Ga0496114_0006147_5864_6790 | 308 |
| 1646 | 3300048918 | Ga0496115_0002442 | Ga0496115_0002442_5748_6674 | 308 |
| 1647 | 3300048918 | Ga0496115_0014481 | Ga0496115_0014481_279_1217 | 308 |
| 1648 | 3300048918 | Ga0496115_0076158 | Ga0496115_0076158_920_1846 | 308 |
| 1649 | 3300048918 | Ga0496115_0342826 | Ga0496115_0342826_51_977 | 308 |
| 1650 | 3300048929 | Ga0496126_0435441 | Ga0496126_0435441_110_1048 | 308 |
| 1651 | 3300049513 | Ga0501290_000772 | Ga0501290_000772_1202_2134 | 308 |
| 1652 | 3300049515 | Ga0501292_000014 | Ga0501292_000014_24050_24982 | 308 |
| 1653 | 3300049517 | Ga0501294_000889 | Ga0501294_000889_1131_2063 | 308 |
| 1654 | 3300049523 | Ga0501300_000229 | Ga0501300_000229_5572_6504 | 308 |
| 1655 | 3300049568 | Ga0501031_0012923 | Ga0501031_0012923_2669_3595 | 308 |
| 1656 | 3300049570 | Ga0501033_0040028 | Ga0501033_0040028_1733_2659 | 308 |
| 1657 | 3300049570 | Ga0501033_0085408 | Ga0501033_0085408_453_1379 | 308 |
| 1658 | 3300049570 | Ga0501033_0127630 | Ga0501033_0127630_59_985 | 308 |
| 1659 | 3300049571 | Ga0501034_0000850 | Ga0501034_0000850_7695_8621 | 308 |
| 1660 | 3300049571 | Ga0501034_0099018 | Ga0501034_0099018_61_987 | 308 |
| 1661 | 3300049571 | Ga0501034_0192062 | Ga0501034_0192062_855_1781 | 308 |
| 1662 | 3300049571 | Ga0501034_0406821 | Ga0501034_0406821_283_1209 | 308 |
| 1663 | 3300049572 | Ga0501036_0004935 | Ga0501036_0004935_7695_8621 | 308 |
| 1664 | 3300049572 | Ga0501036_0007504 | Ga0501036_0007504_6003_6929 | 308 |
| 1665 | 3300049572 | Ga0501036_0077541 | Ga0501036_0077541_1551_2477 | 308 |
| 1666 | 3300049572 | Ga0501036_0143194 | Ga0501036_0143194_74_1000 | 308 |
| 1667 | 3300049573 | Ga0501037_0001864 | Ga0501037_0001864_6453_7379 | 308 |
| 1668 | 3300049573 | Ga0501037_0027622 | Ga0501037_0027622_2885_3826 | 308 |
| 1669 | 3300049573 | Ga0501037_0033704 | Ga0501037_0033704_1042_1968 | 308 |
| 1670 | 3300049574 | Ga0501038_0009937 | Ga0501038_0009937_7028_7954 | 308 |
| 1671 | 3300049574 | Ga0501038_0044912 | Ga0501038_0044912_1072_1998 | 308 |
| 1672 | 3300049574 | Ga0501038_0066126 | Ga0501038_0066126_1987_2928 | 308 |
| 1673 | 3300049575 | Ga0501039_0040832 | Ga0501039_0040832_681_1607 | 308 |
| 1674 | 3300049575 | Ga0501039_0049595 | Ga0501039_0049595_1397_2323 | 308 |
| 1675 | 3300049575 | Ga0501039_0087269 | Ga0501039_0087269_132_1058 | 308 |
| 1676 | 3300049576 | Ga0501040_0146866 | Ga0501040_0146866_651_1577 | 308 |
| 1677 | 3300049578 | Ga0501042_0097714 | Ga0501042_0097714_695_1621 | 308 |
| 1678 | 3300049579 | Ga0501043_0015869 | Ga0501043_0015869_3890_4816 | 308 |
| 1679 | 3300049579 | Ga0501043_0063213 | Ga0501043_0063213_190_1116 | 308 |
| 1680 | 3300049579 | Ga0501043_0076108 | Ga0501043_0076108_845_1771 | 308 |
| 1681 | 3300049580 | Ga0501046_0013310 | Ga0501046_0013310_545_1471 | 308 |
| 1682 | 3300049581 | Ga0501047_0000455 | Ga0501047_0000455_36603_37529 | 308 |
| 1683 | 3300049581 | Ga0501047_0025946 | Ga0501047_0025946_3193_4119 | 308 |
| 1684 | 3300049581 | Ga0501047_0054513 | Ga0501047_0054513_540_1466 | 308 |
| 1685 | 3300049581 | Ga0501047_0079140 | Ga0501047_0079140_1384_2310 | 308 |
| 1686 | 3300049581 | Ga0501047_0161880 | Ga0501047_0161880_447_1388 | 308 |
| 1687 | 3300049582 | Ga0501048_0001113 | Ga0501048_0001113_7645_8571 | 308 |
| 1688 | 3300049582 | Ga0501048_0164118 | Ga0501048_0164118_567_1493 | 308 |
| 1689 | 3300049586 | Ga0501070_0028051 | Ga0501070_0028051_1057_1983 | 308 |
| 1690 | 3300049586 | Ga0501070_0043105 | Ga0501070_0043105_2435_3361 | 308 |
| 1691 | 3300049586 | Ga0501070_0186535 | Ga0501070_0186535_65_991 | 308 |
| 1692 | 3300049589 | Ga0501073_0052331 | Ga0501073_0052331_1174_2100 | 308 |
| 1693 | 3300049589 | Ga0501073_0127602 | Ga0501073_0127602_581_1507 | 308 |
| 1694 | 3300049590 | Ga0501074_0053579 | Ga0501074_0053579_570_1496 | 308 |
| 1695 | 3300049653 | Ga0501206_000816 | Ga0501206_000816_1695_2627 | 308 |
| 1696 | 3300049663 | Ga0501223_000250 | Ga0501223_000250_4744_5676 | 308 |
| 1697 | 3300049664 | Ga0501224_000750 | Ga0501224_000750_1595_2527 | 308 |
| 1698 | 3300049665 | Ga0501227_009571 | Ga0501227_009571_466_1398 | 308 |
| 1699 | 3300049669 | Ga0501235_001772 | Ga0501235_001772_848_1780 | 308 |
| 1700 | 3300049690 | Ga0501261_000003 | Ga0501261_000003_8879_9811 | 308 |
| 1701 | 3300049705 | Ga0501225_0000710 | Ga0501225_0000710_4409_5341 | 308 |
| 1702 | 3300049708 | Ga0501245_001564 | Ga0501245_001564_1202_2134 | 308 |
| 1703 | 3300049741 | Ga0501079_0021435 | Ga0501079_0021435_2682_3608 | 308 |
| 1704 | 3300049742 | Ga0501080_0005235 | Ga0501080_0005235_9830_10756 | 308 |
| 1705 | 3300049742 | Ga0501080_0009477 | Ga0501080_0009477_5522_6448 | 308 |
| 1706 | 3300049744 | Ga0501083_0000437 | Ga0501083_0000437_18106_19032 | 308 |
| 1707 | 3300049775 | Ga0501279_000007 | Ga0501279_000007_35204_36136 | 308 |
| 1708 | 3300049776 | Ga0501280_000284 | Ga0501280_000284_4888_5820 | 308 |
| 1709 | 3300049777 | Ga0501281_00155 | Ga0501281_00155_4005_4937 | 308 |
| 1710 | 3300049822 | Ga0501035_0006586 | Ga0501035_0006586_4433_5359 | 308 |
| 1711 | 3300049822 | Ga0501035_0010086 | Ga0501035_0010086_2285_3211 | 308 |
| 1712 | 3300049823 | Ga0501044_0015397 | Ga0501044_0015397_2112_3038 | 308 |
| 1713 | 3300049823 | Ga0501044_0074906 | Ga0501044_0074906_796_1737 | 308 |
| 1714 | 3300049823 | Ga0501044_0110579 | Ga0501044_0110579_1623_2549 | 308 |
| 1715 | 3300049823 | Ga0501044_0206168 | Ga0501044_0206168_298_1224 | 308 |
| 1716 | 3300050489 | nmdc:mga03683_81463_c1 | nmdc:mga03683_81463_c1_346_1383 | 308 |
| 1717 | 3300050492 | nmdc:mga0yw44_91919_c1 | nmdc:mga0yw44_91919_c1_597_1523 | 308 |
| 1718 | 3300050494 | nmdc:mga06z11_85576_c1 | nmdc:mga06z11_85576_c1_757_1683 | 308 |
| 1719 | 3300050507 | nmdc:mga05p37_11853_c1 | nmdc:mga05p37_11853_c1_5411_6337 | 308 |
| 1720 | 3300050507 | nmdc:mga05p37_505_c1 | nmdc:mga05p37_505_c1_15937_16863 | 308 |
| 1721 | 3300050509 | nmdc:mga0qj67_859_c1 | nmdc:mga0qj67_859_c1_17965_18891 | 308 |
| 1722 | 3300050510 | nmdc:mga06r32_10551_c1 | nmdc:mga06r32_10551_c1_7314_8240 | 308 |
| 1723 | 3300050510 | nmdc:mga06r32_225713_c1 | nmdc:mga06r32_225713_c1_795_1721 | 308 |
| 1724 | 3300050510 | nmdc:mga06r32_414258_c1 | nmdc:mga06r32_414258_c1_183_1109 | 308 |
| 1725 | 3300050511 | nmdc:mga08y16_11105_c1 | nmdc:mga08y16_11105_c1_2842_3768 | 308 |
| 1726 | 3300050511 | nmdc:mga08y16_66746_c1 | nmdc:mga08y16_66746_c1_1519_2445 | 308 |
| 1727 | 3300050511 | nmdc:mga08y16_78683_c1 | nmdc:mga08y16_78683_c1_2261_3187 | 308 |
| 1728 | 3300050511 | nmdc:mga08y16_82852_c1 | nmdc:mga08y16_82852_c1_2199_3125 | 308 |
| 1729 | 3300050512 | nmdc:mga0n895_13449_c1 | nmdc:mga0n895_13449_c1_2654_3580 | 308 |
| 1730 | 3300050512 | nmdc:mga0n895_189973_c1 | nmdc:mga0n895_189973_c1_372_1367 | 308 |
| 1731 | 3300050512 | nmdc:mga0n895_2584_c1 | nmdc:mga0n895_2584_c1_10612_11538 | 308 |
| 1732 | 3300050512 | nmdc:mga0n895_3537_c1 | nmdc:mga0n895_3537_c1_3009_3935 | 308 |
| 1733 | 3300050512 | nmdc:mga0n895_74991_c1 | nmdc:mga0n895_74991_c1_562_1488 | 308 |
| 1734 | 3300050513 | nmdc:mga0rr50_1087_c1 | nmdc:mga0rr50_1087_c1_8190_9116 | 308 |
| 1735 | 3300050513 | nmdc:mga0rr50_125753_c1 | nmdc:mga0rr50_125753_c1_959_1954 | 308 |
| 1736 | 3300050513 | nmdc:mga0rr50_50121_c1 | nmdc:mga0rr50_50121_c1_952_1878 | 308 |
| 1737 | 3300050515 | nmdc:mga0a205_1492_c1 | nmdc:mga0a205_1492_c1_6092_7018 | 308 |
| 1738 | 3300050515 | nmdc:mga0a205_55693_c1 | nmdc:mga0a205_55693_c1_1232_2158 | 308 |
| 1739 | 3300053077 | Ga0495601_0000958 | Ga0495601_0000958_11923_12882 | 308 |
| 1740 | 3300053077 | Ga0495601_0002291 | Ga0495601_0002291_6577_7503 | 308 |
| 1741 | 3300053078 | Ga0495612_0000276 | Ga0495612_0000276_14760_15719 | 308 |
| 1742 | 3300053078 | Ga0495612_0006758 | Ga0495612_0006758_944_1903 | 308 |
| 1743 | 3300053084 | Ga0495595_0000596 | Ga0495595_0000596_7360_8319 | 308 |
| 1744 | 3300053084 | Ga0495595_0003189 | Ga0495595_0003189_787_1746 | 308 |
| 1745 | 3300053085 | Ga0495619_0000211 | Ga0495619_0000211_21203_22129 | 308 |
| 1746 | 3300053085 | Ga0495619_0000763 | Ga0495619_0000763_8863_9822 | 308 |
| 1747 | 3300053085 | Ga0495619_0020471 | Ga0495619_0020471_1535_2461 | 308 |
| 1748 | 3300053087 | Ga0500643_017565 | Ga0500643_017565_899_1837 | 308 |
| 1749 | 3300053088 | Ga0500644_0000896 | Ga0500644_0000896_153_1079 | 308 |
| 1750 | 3300053093 | Ga0500651_0006575 | Ga0500651_0006575_662_1588 | 308 |
| 1751 | 3300053118 | Ga0500594_0007592 | Ga0500594_0007592_591_1532 | 308 |
| 1752 | 3300053119 | Ga0500595_000002 | Ga0500595_000002_688148_689086 | 308 |
| 1753 | 3300053139 | Ga0500568_0004261 | Ga0500568_0004261_5118_6065 | 308 |
| 1754 | 3300053153 | Ga0500616_0000002 | Ga0500616_0000002_736445_737371 | 308 |
| 1755 | 3300053153 | Ga0500616_0006540 | Ga0500616_0006540_3105_4031 | 308 |
| 1756 | 3300060353 | Ga0501082_0000008 | Ga0501082_0000008_42235_43161 | 308 |
| 1757 | 3300060353 | Ga0501082_0111143 | Ga0501082_0111143_974_1900 | 308 |
| 1758 | 3300061734 | Ga0530510_0381959 | Ga0530510_0381959_108_1034 | 308 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6z4w-assembly1.cif.gz_A | ftse structure from streptococcus pneumoniae in complex with adp (space group p 1) | 0.946 | 2 | 218 |
| 3c41-assembly1.cif.gz_K | abc protein artp in complex with amp-pnp/mg2+ | 0.9396 | 3 | 213 |
| 4u00-assembly1.cif.gz_A | crystal structure of ttha1159 in complex with adp | 0.9364 | 3 | 222 |
| 7ahc-assembly1.cif.gz_C | opua apo inward-facing | 0.9337 | 5 | 222 |
| 7nnu-assembly1.cif.gz_A | cryo-em structure of the folate-specific ecf transporter complex in msp2n2 lipid nanodiscs | 0.9335 | 3 | 211 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A1ZBS3_1241_1472_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9478 | 5 | 213 | 3.40.50.300 |
| af_O05779_1_226_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9478 | 4 | 218 | 3.40.50.300 |
| af_P0A9R7_1_220_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9438 | 5 | 213 | 3.40.50.300 |
| af_Q2G1L8_1_252_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9435 | 2 | 220 | 3.40.50.300 |
| af_Q1RS86_918_1157_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9434 | 1 | 208 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7Y4ZA76-F1-model_v4 | ABC transporter ATP-binding protein | 0.9798 | 2 | 213 |
GO:0005524
GO:0016887 |
| AF-A0A5E6MKN0-F1-model_v4 | Daunorubicin/doxorubicin resistance ATP-binding protein DrrA (EC 3.6.3.-) | 0.9616 | 2 | 213 |
GO:0005524
GO:0016887 |
| AF-A0A0U3H3Q4-F1-model_v4 | ABC transporter ATP-binding protein | 0.9582 | 2 | 222 |
GO:0005524
GO:0016887 |
| AF-A0A348B4H2-F1-model_v4 | ABC transporter domain-containing protein | 0.9581 | 34 | 222 |
GO:0005524
GO:0016887 |
| AF-A0A2W7B2T3-F1-model_v4 | Multidrug ABC transporter ATP-binding protein | 0.9567 | 2 | 207 |
GO:0005524
GO:0016887 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar