F495600

General Info

Members Datasets Scaffolds Average Seq Length
1758 805 1524 308

Family's Representative Sequence

Representative Sequence 3300053105|Ga0500557_000029|Ga0500557_000029_8993_10054
Length 353
Sequence MACFETIFLSAIAAGQGHSYLRAPLTRPRQVPAFPPQHQPLRLAAIMSSIISVANLSKTYGSGFKALNNVNLDIMSGEIFALLGPNGAGKTTLISIICGIANPSEGKVLVGGENIQTSYRKARSLIGLVPQELHTDAFESVWATVSFSRGLFGKPKNPAHIEKVLKDLSLWDKKDSKIITLSGGMKRRVMIAKALSHEPQILFLDEPTAGVDVELRKGMWEVVRTLQQSGVTIILTTHYIEEAEEMADRIGVINKGEIVLVEDKATLMQKLGKKRLTLHLQGKLDKLPESLGHYELDLCDGGATLVYDYDTKGERTGITSLLGDLRTAGIRFNDLDTTQSSLEDIFVDLVRAS

Samples

Sample ID Description Type Environment
1 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
2 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
3 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
4 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
5 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
6 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
7 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
8 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
9 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
10 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
11 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
12 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
13 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
14 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
15 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
16 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
17 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
18 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
19 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
20 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
21 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
22 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
23 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
24 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
25 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
26 2582581280 Caulobacter henricii CF287 Isolate Rhizosphere
27 2582581293 Caulobacter henricii YR570 Isolate Rhizosphere
28 2585428106 Caulobacter sp. OV484 Isolate Rhizosphere
29 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
30 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
31 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
32 2643221552 Caulobacter sp. Root1472 Isolate Unclassified
33 2643221560 Sphingopyxis sp. Root1497 Isolate Unclassified
34 2643221584 Caulobacter sp. Root656 Isolate Unclassified
35 2643221640 Caulobacter sp. Root342 Isolate Unclassified
36 2643221642 Caulobacter sp. Root343 Isolate Unclassified
37 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
38 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
39 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
40 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
41 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
42 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
43 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
44 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
45 2818991435 Caulobacter henricii 536 Isolate Unclassified
46 2818991454 Caulobacter rhizosphaerae 3260 Isolate Rhizosphere
47 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
48 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
49 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
50 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
51 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
52 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
53 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
54 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
55 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
56 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
57 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
58 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
59 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
60 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
61 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
62 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
63 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
64 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
65 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
66 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
67 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
68 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
69 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
70 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
71 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
72 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
73 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
74 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
75 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
76 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
77 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
78 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
79 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
80 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
81 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
82 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
83 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
84 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
85 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
86 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
87 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
88 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
89 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
90 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
91 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
92 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
93 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
94 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
95 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
96 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
97 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
98 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
99 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
100 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
101 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
102 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
103 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
104 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
105 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
106 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
107 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
108 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
109 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
110 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
111 2904699407
112 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
113 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
114 2906610324
115 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
116 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
117 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
118 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
119 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
120 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
121 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
122 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
123 2922368715
124 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
125 2922425934
126 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere
127 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
128 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
129 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
130 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
131 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
132 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
133 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
134 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
135 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
136 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
137 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
138 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
139 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
140 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
141 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
142 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
143 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
144 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
145 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
146 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
147 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
148 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
149 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
150 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
151 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
152 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
153 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
154 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
155 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
156 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
157 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
158 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
159 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
160 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
161 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
162 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
163 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
164 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
165 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
166 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
167 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
168 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
169 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
170 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
171 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
172 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
173 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
174 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
175 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
176 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
177 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
178 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
179 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
180 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
181 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
182 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
183 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
184 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
185 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
186 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
187 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
188 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
189 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
190 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
191 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
192 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
193 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
194 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
195 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
196 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
197 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
198 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
199 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
200 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
201 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
202 3300000045 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere Metagenome Rhizosphere
203 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
204 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
205 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
206 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
207 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
208 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
209 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
210 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
211 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
212 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
213 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
214 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
215 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
216 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
217 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
218 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
219 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
220 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
221 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
222 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
223 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
224 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
225 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
226 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
227 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
228 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
229 3300005276 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1 Metagenome Rhizosphere
230 3300005277 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) Metagenome Rhizosphere
231 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
232 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
233 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
234 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
235 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
236 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
237 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
238 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
239 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
240 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
241 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
242 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
243 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
244 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
245 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
246 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
247 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
248 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
249 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
250 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
251 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
252 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
253 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
254 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
255 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
256 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
257 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
258 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
259 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
260 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
261 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
262 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
263 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
264 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
265 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
266 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
267 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
268 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
269 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
270 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
271 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
272 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
273 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
274 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
275 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
276 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
277 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
278 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
279 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
280 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
281 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
282 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
283 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
284 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
285 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
286 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
287 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
288 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
289 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
290 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
291 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
292 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
293 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
294 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
295 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
296 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
297 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
298 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
299 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
300 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
301 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
302 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
303 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
304 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
305 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
306 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
307 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
308 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
309 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
310 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
311 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
312 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
313 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
314 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
315 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
316 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
317 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
318 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
319 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
320 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
321 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
322 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
323 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
324 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
325 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
326 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
327 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
328 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
329 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
330 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
331 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
332 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
333 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
334 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
335 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
336 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
337 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
338 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
339 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
340 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
341 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
342 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
343 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
344 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
345 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
346 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
347 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
348 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
349 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
350 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
351 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
352 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
353 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
354 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
355 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
356 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
357 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
358 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
359 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
360 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
361 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
362 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
363 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
364 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
365 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
366 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
367 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
368 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
369 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
370 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
371 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
372 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
373 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
374 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
375 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
376 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
377 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
378 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
379 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
380 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
381 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
382 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
383 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
384 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
385 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
386 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
387 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
388 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
389 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
390 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
391 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
392 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
393 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
394 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
395 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
396 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
397 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
398 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
399 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
400 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
401 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
402 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
403 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
404 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
405 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
406 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
407 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
408 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
409 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
410 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
411 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
412 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
413 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
414 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
415 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
416 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
417 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
418 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
419 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
420 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
421 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
422 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
423 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
424 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
425 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
426 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
427 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
428 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
429 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
430 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
431 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
432 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
433 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
434 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
435 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
436 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
437 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
438 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
439 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
440 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
441 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
442 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
443 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
444 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
445 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
446 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
447 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
448 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
449 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
450 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
451 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
452 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
453 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
454 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
455 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
456 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
457 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
458 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
459 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
460 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
461 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
462 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
463 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
464 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
465 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
466 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
467 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
468 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
469 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
470 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
471 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
472 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
473 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
474 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
475 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
476 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
477 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
478 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
479 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
480 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
481 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
482 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
483 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
484 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
485 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
486 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
487 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
488 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
489 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
490 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
491 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
492 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
493 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
494 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
495 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
496 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
497 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
498 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
499 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
500 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
501 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
502 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
503 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
504 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
505 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
506 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
507 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
508 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
509 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
510 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
511 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
512 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
513 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
514 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
515 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
516 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
517 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
518 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
519 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
520 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
521 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
522 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
523 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
524 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
525 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
526 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
527 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
528 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
529 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
530 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
531 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
532 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
533 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
534 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
535 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
536 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
537 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
538 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
539 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
540 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
541 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
542 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
543 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
544 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
545 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
546 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
547 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
548 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
549 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
550 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
551 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
552 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
553 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
554 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
555 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
556 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
557 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
558 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
559 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
560 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
561 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
562 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
563 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
564 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
565 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
566 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
567 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
568 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
569 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
570 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
571 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
572 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
573 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
574 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
575 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
576 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
577 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
578 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
579 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
580 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
581 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
582 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
583 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
584 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
585 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
586 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
587 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
588 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
589 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
590 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
591 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
592 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
593 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
594 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
595 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
596 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
597 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
598 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
599 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
600 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
601 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
602 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
603 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
604 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
605 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
606 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
607 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
608 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
609 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
610 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
611 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
612 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
613 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
614 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
615 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
616 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
617 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
618 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
619 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
620 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
621 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
622 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
623 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
624 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
625 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
626 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
627 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
628 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
629 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
630 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
631 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
632 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
633 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
634 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
635 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
636 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
637 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
638 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
639 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
640 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
641 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
642 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
643 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
644 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
645 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
646 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
647 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
648 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
649 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
650 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
651 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
652 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
653 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
654 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
655 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
656 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
657 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
658 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
659 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
660 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
661 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
662 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
663 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
664 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
665 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
666 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
667 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
668 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
669 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
670 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
671 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
672 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
673 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
674 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
675 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
676 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
677 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
678 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
679 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
680 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
681 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
682 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
683 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
684 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
685 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
686 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
687 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
688 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
689 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
690 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
691 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
692 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
693 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
694 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
695 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
696 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
697 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
698 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
699 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
700 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
701 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
702 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
703 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
704 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
705 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
706 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
707 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
708 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
709 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
710 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
711 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
712 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
713 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
714 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
715 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
716 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
717 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
718 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
719 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
720 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
721 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
722 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
723 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
724 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
725 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
726 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
727 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
728 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
729 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
730 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
731 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
732 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
733 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
734 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
735 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
736 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
737 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
738 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
739 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
740 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
741 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
742 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
743 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
744 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
745 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
746 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
747 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
748 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
749 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
750 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
751 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
752 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
753 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
754 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
755 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
756 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
757 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
758 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
759 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
760 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
761 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
762 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
763 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
764 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
765 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
766 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
767 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
768 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
769 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
770 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
771 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
772 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
773 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
774 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
775 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
776 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
777 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
778 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
779 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
780 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
781 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
782 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
783 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
784 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
785 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
786 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
787 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
788 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
789 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
790 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
791 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
792 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
793 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
794 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
795 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
796 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
797 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
798 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
799 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
800 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
801 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
802 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
803 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
804 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
805 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 86.89
Metatranscriptomes 0
Isolates 13.11

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.57
Nodule 10.13
Rhizoplane 6.48
Rhizosphere 68.94
Stem 0
Stem Tuber 0
Unclassified 6.88

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 2214600489 2209111006 Bacteria 5547
2 ARcpr5oldR_c000075 3300000041 Bacteria 18141
3 ARSoilYngRDRAFT_c00009 3300000042 Bacteria 30468
4 ARcpr5yngRDRAFT_c000006 3300000043 Bacteria 44193
5 ARSoilOldRDRAFT_c000008 3300000044 Bacteria 50600
6 ARCol0oldRDRAFT_c00242 3300000045 Bacteria 5115
7 ARCol0yngRDRAFT_1000092 3300000652 Bacteria 16856
8 JGI24741J21665_1005717 3300001915 Bacteria 2563
9 JGI24746J21847_1000654 3300001977 Bacteria 5304
10 JGI24740J21852_10001722 3300001979 Bacteria 10052
11 JGI24739J22299_10000092 3300001989 Bacteria 26283
12 JGI24739J22299_10010924 3300001989 Bacteria 3358
13 JGI24739J22299_10050347 3300001989 Bacteria 1347
14 JGI24737J22298_10000325 3300001990 Bacteria 16017
15 JGI24737J22298_10001344 3300001990 Bacteria 8708
16 JGI24737J22298_10003780 3300001990 Bacteria 5327
17 JGI24735J21928_10019123 3300002067 Bacteria 2107
18 JGI24735J21928_10055274 3300002067 Bacteria 1143
19 JGI24750J21931_1000128 3300002070 Bacteria 12041
20 JGI24745J21846_1000019 3300002073 Bacteria 10205
21 JGI24748J21848_1000158 3300002074 Bacteria 9876
22 JGI24738J21930_10000010 3300002075 Bacteria 37976
23 JGI24749J21850_1000653 3300002076 Bacteria 5028
24 JGI24744J21845_10007455 3300002077 Bacteria 2261
25 JGI24035J26624_1000002 3300002126 Bacteria 16706
26 JGI24033J26618_1004382 3300002155 Bacteria 1523
27 JGI24034J26672_10000201 3300002239 Bacteria 8012
28 JGI24742J22300_10000449 3300002244 Bacteria 6067
29 JGI25406J46586_10000417 3300003203 Bacteria 19537
30 JGI25406J46586_10029212 3300003203 Bacteria 2090
31 JGI25165J46597_1004090 3300003214 Bacteria 3270
32 JGI25153J46596_10000758 3300003215 Bacteria 19728
33 JGI25153J46596_10003729 3300003215 Bacteria 8414
34 JGI25153J46596_10014037 3300003215 Bacteria 3353
35 JGI25404J52841_10014829 3300003659 Bacteria 1692
36 Ga0055526_1022934 3300003771 Bacteria 2102
37 Ga0055531_10006207 3300003794 Bacteria 6823
38 Ga0055531_10016346 3300003794 Bacteria 3206
39 JGI25405J52794_10002686 3300003911 Bacteria 3086
40 JGI25405J52794_10019743 3300003911 Bacteria 1353
41 Ga0055543_1002634 3300004625 Bacteria 5780
42 Ga0065165_1003855 3300005262 Bacteria 9959
43 Ga0065165_1003912 3300005262 Bacteria 9835
44 Ga0065717_1000057 3300005276 Bacteria 6757
45 Ga0065716_1001714 3300005277 Bacteria 3918
46 Ga0065712_10000899 3300005290 Bacteria 8202
47 Ga0065712_10068648 3300005290 Bacteria 9527
48 Ga0065715_10000752 3300005293 Bacteria 15084
49 Ga0065715_10000834 3300005293 Bacteria 8809
50 Ga0065715_10099531 3300005293 Bacteria 3400
51 Ga0070658_10000029 3300005327 Bacteria 156910
52 Ga0070683_100001029 3300005329 Bacteria 20930
53 Ga0070683_100001787 3300005329 Bacteria 16752
54 Ga0070683_100014914 3300005329 Bacteria 6811
55 Ga0070683_100106508 3300005329 Bacteria 2643
56 Ga0070690_100002808 3300005330 Bacteria 9398
57 Ga0070690_100020537 3300005330 Bacteria 4024
58 Ga0070670_100017810 3300005331 Bacteria 6096
59 Ga0070677_10000045 3300005333 Bacteria 38826
60 Ga0068869_100000079 3300005334 Bacteria 44000
61 Ga0068869_100036226 3300005334 Bacteria 3502
62 Ga0068869_100042272 3300005334 Bacteria 3267
63 Ga0070666_10019934 3300005335 Bacteria 4332
64 Ga0070680_100080310 3300005336 Bacteria 2689
65 Ga0070680_100101893 3300005336 Bacteria 2384
66 Ga0070680_100205146 3300005336 Bacteria 1662
67 Ga0070682_100000641 3300005337 Bacteria 21233
68 Ga0070682_100048995 3300005337 Bacteria 2632
69 Ga0070682_100082911 3300005337 Bacteria 2079
70 Ga0068868_100002114 3300005338 Bacteria 13683
71 Ga0068868_100010593 3300005338 Bacteria 6682
72 Ga0068868_100116506 3300005338 Bacteria 2176
73 Ga0070660_100000715 3300005339 Bacteria 21980
74 Ga0070660_100004207 3300005339 Bacteria 9935
75 Ga0070660_100067446 3300005339 Bacteria 2787
76 Ga0070660_100109288 3300005339 Bacteria 2198
77 Ga0070660_100164229 3300005339 Bacteria 1791
78 Ga0070689_100003727 3300005340 Bacteria 10202
79 Ga0070689_100052174 3300005340 Bacteria 3163
80 Ga0070691_10000161 3300005341 Bacteria 21699
81 Ga0070691_10006926 3300005341 Bacteria 5189
82 Ga0070687_100000085 3300005343 Bacteria 30647
83 Ga0070661_100000307 3300005344 Bacteria 39479
84 Ga0070661_100132338 3300005344 Bacteria 1874
85 Ga0070661_100186230 3300005344 Bacteria 1582
86 Ga0070692_10007199 3300005345 Bacteria 4886
87 Ga0070692_10119582 3300005345 Bacteria 1468
88 Ga0070668_100000164 3300005347 Bacteria 42113
89 Ga0070668_100033222 3300005347 Bacteria 3927
90 Ga0070668_100051475 3300005347 Bacteria 3173
91 Ga0070668_100165747 3300005347 Bacteria 1795
92 Ga0070668_100216327 3300005347 Bacteria 1578
93 Ga0070669_100000571 3300005353 Bacteria 27367
94 Ga0070669_100107439 3300005353 Bacteria 2114
95 Ga0070675_100002792 3300005354 Bacteria 13151
96 Ga0070671_100000104 3300005355 Bacteria 53922
97 Ga0070671_100082892 3300005355 Bacteria 2682
98 Ga0070674_100000238 3300005356 Bacteria 27260
99 Ga0070674_100071785 3300005356 Bacteria 2450
100 Ga0070674_100111852 3300005356 Bacteria 2006
101 Ga0070673_100000152 3300005364 Bacteria 33183
102 Ga0070673_100119337 3300005364 Bacteria 2197
103 Ga0070673_100122975 3300005364 Bacteria 2168
104 Ga0070688_100001552 3300005365 Bacteria 11464
105 Ga0070688_100004752 3300005365 Bacteria 7097
106 Ga0070688_100140851 3300005365 Bacteria 1638
107 Ga0070688_100148754 3300005365 Bacteria 1599
108 Ga0070688_100267867 3300005365 Bacteria 1223
109 Ga0070659_100000551 3300005366 Bacteria 27372
110 Ga0070659_100021203 3300005366 Bacteria 4943
111 Ga0070659_100029695 3300005366 Bacteria 4226
112 Ga0070659_100139609 3300005366 Bacteria 1972
113 Ga0070659_100178734 3300005366 Bacteria 1741
114 Ga0070659_100290427 3300005366 Bacteria 1362
115 Ga0070667_100002365 3300005367 Bacteria 16513
116 Ga0070667_100159545 3300005367 Bacteria 1985
117 Ga0070667_100214820 3300005367 Bacteria 1710
118 Ga0070703_10002279 3300005406 Bacteria 5564
119 Ga0070709_10000690 3300005434 Bacteria 19189
120 Ga0070709_10154832 3300005434 Bacteria 1588
121 Ga0070714_100010787 3300005435 Bacteria 7233
122 Ga0070714_100075535 3300005435 Bacteria 2924
123 Ga0070714_100224086 3300005435 Bacteria 1729
124 Ga0070713_100001316 3300005436 Bacteria 15879
125 Ga0070713_100020625 3300005436 Bacteria 5056
126 Ga0070713_100046727 3300005436 Bacteria 3553
127 Ga0070710_10227873 3300005437 Bacteria 1189
128 Ga0070701_10000674 3300005438 Bacteria 12016
129 Ga0070711_100008627 3300005439 Bacteria 6251
130 Ga0070711_100031169 3300005439 Bacteria 3537
131 Ga0070711_100295171 3300005439 Bacteria 1287
132 Ga0070705_100000148 3300005440 Bacteria 41687
133 Ga0070700_100000277 3300005441 Bacteria 27391
134 Ga0070700_100025371 3300005441 Bacteria 3489
135 Ga0070700_100195613 3300005441 Bacteria 1417
136 Ga0070694_100003001 3300005444 Bacteria 10038
137 Ga0070708_100038211 3300005445 Bacteria 4194
138 Ga0070663_100001406 3300005455 Bacteria 13151
139 Ga0070663_100023864 3300005455 Bacteria 4105
140 Ga0070663_100028764 3300005455 Bacteria 3788
141 Ga0070663_100039199 3300005455 Bacteria 3310
142 Ga0070663_100045017 3300005455 Bacteria 3116
143 Ga0070663_100063781 3300005455 Bacteria 2662
144 Ga0070663_100099842 3300005455 Bacteria 2164
145 Ga0070678_100008123 3300005456 Bacteria 6270
146 Ga0070678_100033129 3300005456 Bacteria 3583
147 Ga0070678_100035825 3300005456 Bacteria 3468
148 Ga0070678_100444534 3300005456 Bacteria 1134
149 Ga0070662_100005414 3300005457 Bacteria 8152
150 Ga0070662_100007650 3300005457 Bacteria 7010
151 Ga0070662_100010491 3300005457 Bacteria 6082
152 Ga0070662_100136863 3300005457 Bacteria 1894
153 Ga0070681_10003456 3300005458 Bacteria 14797
154 Ga0070681_10037621 3300005458 Bacteria 4855
155 Ga0070681_10074831 3300005458 Bacteria 3347
156 Ga0070681_10146358 3300005458 Bacteria 2291
157 Ga0070681_10232122 3300005458 Bacteria 1759
158 Ga0068867_100004407 3300005459 Bacteria 9902
159 Ga0070685_10001961 3300005466 Bacteria 10680
160 Ga0070685_10034291 3300005466 Bacteria 2858
161 Ga0070685_10141807 3300005466 Bacteria 1514
162 Ga0070699_100147812 3300005518 Bacteria 2077
163 Ga0070679_100000394 3300005530 Bacteria 37125
164 Ga0070679_100083466 3300005530 Bacteria 3183
165 Ga0070679_100110405 3300005530 Bacteria 2736
166 Ga0070684_100001138 3300005535 Bacteria 19106
167 Ga0070684_100004074 3300005535 Bacteria 11062
168 Ga0070684_100255997 3300005535 Bacteria 1600
169 Ga0070697_100228562 3300005536 Bacteria 1586
170 Ga0068853_100002891 3300005539 Bacteria 13032
171 Ga0068853_100022528 3300005539 Bacteria 5261
172 Ga0068853_100177647 3300005539 Bacteria 1929
173 Ga0068853_100215276 3300005539 Bacteria 1752
174 Ga0068853_100265341 3300005539 Bacteria 1580
175 Ga0070672_100000088 3300005543 Bacteria 44394
176 Ga0070686_100000719 3300005544 Bacteria 19252
177 Ga0070686_100013533 3300005544 Bacteria 4676
178 Ga0070686_100380259 3300005544 Bacteria 1069
179 Ga0070695_100000586 3300005545 Bacteria 19224
180 Ga0070695_100003316 3300005545 Bacteria 9416
181 Ga0070695_100044161 3300005545 Bacteria 2835
182 Ga0070695_100191825 3300005545 Bacteria 1455
183 Ga0070696_100000921 3300005546 Bacteria 19106
184 Ga0070696_100108735 3300005546 Bacteria 1995
185 Ga0070693_100000134 3300005547 Bacteria 33408
186 Ga0070693_100061633 3300005547 Bacteria 2181
187 Ga0070693_100123521 3300005547 Bacteria 1609
188 Ga0070665_100016851 3300005548 Bacteria 7326
189 Ga0070665_100146031 3300005548 Bacteria 2368
190 Ga0070665_100169819 3300005548 Bacteria 2182
191 Ga0070704_100000026 3300005549 Bacteria 48700
192 Ga0068855_100006834 3300005563 Bacteria 13840
193 Ga0068855_100009486 3300005563 Bacteria 11753
194 Ga0068855_100328561 3300005563 Bacteria 1688
195 Ga0070664_100001420 3300005564 Bacteria 19106
196 Ga0070664_100155219 3300005564 Bacteria 2022
197 Ga0068857_100001388 3300005577 Bacteria 19106
198 Ga0068857_100039317 3300005577 Bacteria 4190
199 Ga0068857_100053613 3300005577 Bacteria 3577
200 Ga0068857_100112078 3300005577 Bacteria 2453
201 Ga0068854_100000546 3300005578 Bacteria 22673
202 Ga0068854_100027437 3300005578 Bacteria 3925
203 Ga0068854_100030387 3300005578 Bacteria 3747
204 Ga0068854_100129454 3300005578 Bacteria 1925
205 Ga0068856_100000091 3300005614 Bacteria 85048
206 Ga0068856_100002000 3300005614 Bacteria 21261
207 Ga0068856_100012506 3300005614 Bacteria 8216
208 Ga0068856_100015546 3300005614 Bacteria 7356
209 Ga0068856_100429726 3300005614 Bacteria 1341
210 Ga0070702_100000245 3300005615 Bacteria 18498
211 Ga0070702_100012324 3300005615 Bacteria 4279
212 Ga0070702_100028554 3300005615 Bacteria 3024
213 Ga0070702_100173279 3300005615 Bacteria 1405
214 Ga0068852_100002320 3300005616 Bacteria 13074
215 Ga0068859_100006734 3300005617 Bacteria 11674
216 Ga0068859_100049744 3300005617 Bacteria 4210
217 Ga0068864_100000890 3300005618 Bacteria 25145
218 Ga0068864_100124327 3300005618 Bacteria 2310
219 Ga0068864_100216993 3300005618 Bacteria 1763
220 Ga0068864_100400248 3300005618 Bacteria 1305
221 Ga0068864_100415709 3300005618 Bacteria 1280
222 Ga0068866_10000221 3300005718 Bacteria 27070
223 Ga0068866_10079022 3300005718 Bacteria 1761
224 Ga0068861_100000783 3300005719 Bacteria 19106
225 Ga0068861_100122352 3300005719 Bacteria 2101
226 Ga0068851_10008009 3300005834 Bacteria 4874
227 Ga0068851_10052554 3300005834 Bacteria 2072
228 Ga0068870_10000090 3300005840 Bacteria 29559
229 Ga0068863_100000340 3300005841 Bacteria 47641
230 Ga0068863_100061662 3300005841 Bacteria 3546
231 Ga0068858_100000295 3300005842 Bacteria 53892
232 Ga0068858_100031612 3300005842 Bacteria 4917
233 Ga0068860_100000291 3300005843 Bacteria 71296
234 Ga0068860_100001285 3300005843 Bacteria 27247
235 Ga0068860_100425096 3300005843 Bacteria 1317
236 Ga0068860_100431596 3300005843 Bacteria 1307
237 Ga0068862_100003658 3300005844 Bacteria 13151
238 Ga0068862_100043709 3300005844 Bacteria 3820
239 Ga0081455_10000007 3300005937 Bacteria 269394
240 Ga0081455_10007150 3300005937 Bacteria 11812
241 Ga0081455_10019547 3300005937 Bacteria 6405
242 Ga0081455_10089595 3300005937 Bacteria 2496
243 Ga0081538_10027322 3300005981 Bacteria 3960
244 Ga0081540_1000390 3300005983 Bacteria 43721
245 Ga0081540_1016027 3300005983 Bacteria 4717
246 Ga0081540_1018305 3300005983 Bacteria 4302
247 Ga0081540_1082057 3300005983 Bacteria 1448
248 Ga0081539_10000748 3300005985 Bacteria 64594
249 Ga0081539_10001525 3300005985 Bacteria 38837
250 Ga0081539_10036857 3300005985 Bacteria 2920
251 Ga0070717_10008927 3300006028 Bacteria 7512
252 Ga0070717_10009632 3300006028 Bacteria 7271
253 Ga0070717_10045951 3300006028 Bacteria 3572
254 Ga0075365_10028872 3300006038 Bacteria 3540
255 Ga0075365_10038398 3300006038 Bacteria 3112
256 Ga0075365_10063018 3300006038 Bacteria 2481
257 Ga0075365_10187265 3300006038 Bacteria 1448
258 Ga0075368_10037876 3300006042 Bacteria 1886
259 Ga0075363_100037328 3300006048 Bacteria 2552
260 Ga0075363_100055727 3300006048 Bacteria 2118
261 Ga0075364_10347084 3300006051 Bacteria 1011
262 Ga0075432_10005977 3300006058 Bacteria 4142
263 Ga0075432_10044381 3300006058 Bacteria 1559
264 Ga0070715_10076610 3300006163 Bacteria 1507
265 Ga0070716_100029152 3300006173 Bacteria 2981
266 Ga0070716_100067042 3300006173 Bacteria 2096
267 Ga0070712_100000719 3300006175 Bacteria 19499
268 Ga0075362_10007719 3300006177 Bacteria 4087
269 Ga0075427_10000012 3300006194 Bacteria 11956
270 Ga0075366_10004643 3300006195 Bacteria 7380
271 Ga0075366_10008677 3300006195 Bacteria 5658
272 Ga0075366_10011231 3300006195 Bacteria 5052
273 Ga0075366_10109101 3300006195 Bacteria 1664
274 Ga0097621_100000040 3300006237 Bacteria 66339
275 Ga0097621_100070634 3300006237 Bacteria 2883
276 Ga0097621_100216934 3300006237 Bacteria 1666
277 Ga0068871_100000252 3300006358 Bacteria 37355
278 Ga0068871_100012473 3300006358 Bacteria 6267
279 Ga0068871_100070601 3300006358 Bacteria 2871
280 Ga0068871_100074517 3300006358 Bacteria 2800
281 Ga0075430_100018573 3300006846 Bacteria 5917
282 Ga0075431_100181614 3300006847 Bacteria 2159
283 Ga0075433_10000007 3300006852 Bacteria 75995
284 Ga0075434_100002477 3300006871 Bacteria 16252
285 Ga0075434_100002531 3300006871 Bacteria 16122
286 Ga0075434_100157129 3300006871 Bacteria 2293
287 Ga0075434_100307519 3300006871 Bacteria 1605
288 Ga0075429_100002081 3300006880 Bacteria 16691
289 Ga0068865_100000275 3300006881 Bacteria 28270
290 Ga0075436_100090548 3300006914 Bacteria 2126
291 Ga0097620_100006734 3300006931 Bacteria 11674
292 Ga0097620_100049739 3300006931 Bacteria 4210
293 Ga0099825_1018577 3300006941 Bacteria 5382
294 Ga0099824_1003213 3300006942 Bacteria 23884
295 Ga0099824_1004100 3300006942 Bacteria 21098
296 Ga0099822_1000022 3300006943 Bacteria 64942
297 Ga0099823_1033291 3300006944 Bacteria 4146
298 Ga0075435_100001384 3300007076 Bacteria 15669
299 Ga0099794_10031966 3300007265 Bacteria 2467
300 Ga0099794_10060679 3300007265 Bacteria 1837
301 Ga0099794_10131568 3300007265 Bacteria 1264
302 Ga0099795_10000002 3300007788 Bacteria 161112
303 Ga0099795_10009035 3300007788 Bacteria 2874
304 Ga0099795_10013752 3300007788 Bacteria 2493
305 Ga0105251_10036640 3300009011 Bacteria 2412
306 Ga0105250_10025985 3300009092 Bacteria 2358
307 Ga0105240_10008489 3300009093 Bacteria 14689
308 Ga0105240_10012704 3300009093 Bacteria 11608
309 Ga0105240_10370371 3300009093 Bacteria 1620
310 Ga0105240_10458293 3300009093 Bacteria 1425
311 Ga0111539_10000394 3300009094 Bacteria 54170
312 Ga0111539_10003483 3300009094 Bacteria 20741
313 Ga0111539_10101733 3300009094 Bacteria 3373
314 Ga0105245_10000462 3300009098 Bacteria 37242
315 Ga0105245_10105110 3300009098 Bacteria 2618
316 Ga0105245_10146469 3300009098 Bacteria 2228
317 Ga0105247_10000442 3300009101 Bacteria 35071
318 Ga0105247_10007985 3300009101 Bacteria 6466
319 Ga0105247_10063961 3300009101 Bacteria 2285
320 Ga0105247_10186632 3300009101 Bacteria 1386
321 Ga0105247_10206795 3300009101 Bacteria 1322
322 Ga0114129_10001111 3300009147 Bacteria 35464
323 Ga0114129_10397585 3300009147 Bacteria 1817
324 Ga0105243_10000282 3300009148 Bacteria 56666
325 Ga0105243_10034755 3300009148 Bacteria 3906
326 Ga0105243_10050968 3300009148 Bacteria 3271
327 Ga0105241_10000652 3300009174 Bacteria 26004
328 Ga0105241_10008896 3300009174 Bacteria 7384
329 Ga0105241_10062186 3300009174 Bacteria 2877
330 Ga0105241_10065435 3300009174 Bacteria 2809
331 Ga0105241_10258825 3300009174 Bacteria 1478
332 Ga0105242_10001726 3300009176 Bacteria 17253
333 Ga0105242_10033558 3300009176 Bacteria 4110
334 Ga0105242_10076170 3300009176 Bacteria 2796
335 Ga0105248_10388333 3300009177 Bacteria 1572
336 Ga0105248_10419449 3300009177 Bacteria 1507
337 Ga0105248_10505818 3300009177 Bacteria 1362
338 Ga0105248_10508859 3300009177 Bacteria 1358
339 Ga0105237_10004071 3300009545 Bacteria 17048
340 Ga0105237_10008154 3300009545 Bacteria 11375
341 Ga0105237_10025117 3300009545 Bacteria 6095
342 Ga0105237_10042051 3300009545 Bacteria 4608
343 Ga0105237_10183408 3300009545 Bacteria 2093
344 Ga0105237_10353638 3300009545 Bacteria 1473
345 Ga0105238_10003337 3300009551 Bacteria 16021
346 Ga0105238_10014305 3300009551 Bacteria 8021
347 Ga0105238_10023755 3300009551 Bacteria 6248
348 Ga0105238_10030700 3300009551 Bacteria 5470
349 Ga0105238_10171965 3300009551 Bacteria 2143
350 Ga0105238_10386627 3300009551 Bacteria 1391
351 Ga0105249_10001210 3300009553 Bacteria 22796
352 Ga0105249_10010878 3300009553 Bacteria 7996
353 Ga0105249_10139088 3300009553 Bacteria 2326
354 Ga0105249_10293262 3300009553 Bacteria 1629
355 Ga0105249_10331615 3300009553 Bacteria 1535
356 Ga0099796_10000004 3300010159 Bacteria 77538
357 Ga0099796_10004806 3300010159 Bacteria 3308
358 Ga0105239_10006303 3300010375 Bacteria 13795
359 Ga0105239_10013274 3300010375 Bacteria 9154
360 Ga0105239_10013946 3300010375 Bacteria 8922
361 Ga0105239_10024151 3300010375 Bacteria 6695
362 Ga0105239_10084928 3300010375 Bacteria 3488
363 Ga0105239_10108631 3300010375 Bacteria 3073
364 Ga0105239_10310694 3300010375 Bacteria 1777
365 Ga0105239_10328605 3300010375 Bacteria 1725
366 Ga0105239_10358824 3300010375 Bacteria 1646
367 Ga0105246_10000312 3300011119 Bacteria 25800
368 Ga0105246_10009199 3300011119 Bacteria 6084
369 Ga0105246_10033565 3300011119 Bacteria 3412
370 Ga0105246_10140466 3300011119 Bacteria 1815
371 Ga0105246_10191470 3300011119 Bacteria 1583
372 Ga0157373_10026078 3300013100 Bacteria 4224
373 Ga0157373_10088140 3300013100 Bacteria 2186
374 Ga0157371_10011709 3300013102 Bacteria 6740
375 Ga0157371_10016826 3300013102 Bacteria 5445
376 Ga0157370_10149119 3300013104 Bacteria 2177
377 Ga0157369_10024576 3300013105 Bacteria 6698
378 Ga0157369_10103135 3300013105 Bacteria 3038
379 Ga0157374_10001123 3300013296 Bacteria 23027
380 Ga0157378_10000270 3300013297 Bacteria 50517
381 Ga0157378_10187750 3300013297 Bacteria 1947
382 Ga0157378_10494249 3300013297 Bacteria 1221
383 Ga0163162_10000145 3300013306 Bacteria 65191
384 Ga0163162_10053735 3300013306 Bacteria 4049
385 Ga0163162_10065175 3300013306 Bacteria 3689
386 Ga0163162_10442921 3300013306 Bacteria 1431
387 Ga0157372_10004025 3300013307 Bacteria 15762
388 Ga0157375_10000332 3300013308 Bacteria 42513
389 Ga0157375_10080802 3300013308 Bacteria 3290
390 Ga0157375_10427461 3300013308 Bacteria 1490
391 Ga0163163_10000865 3300014325 Bacteria 25811
392 Ga0163163_10010305 3300014325 Bacteria 8401
393 Ga0163163_10020785 3300014325 Bacteria 6189
394 Ga0163163_10083035 3300014325 Bacteria 3208
395 Ga0157380_10003074 3300014326 Bacteria 11374
396 Ga0157380_10128696 3300014326 Bacteria 2157
397 Ga0157380_10354612 3300014326 Bacteria 1374
398 Ga0182008_10070087 3300014497 Bacteria 1725
399 Ga0157377_10000137 3300014745 Bacteria 46698
400 Ga0157379_10001761 3300014968 Bacteria 17895
401 Ga0157379_10036684 3300014968 Bacteria 4371
402 Ga0157379_10058255 3300014968 Bacteria 3453
403 Ga0157379_10092162 3300014968 Bacteria 2718
404 Ga0157376_10000088 3300014969 Bacteria 70084
405 Ga0157376_10088578 3300014969 Bacteria 2674
406 Ga0157376_10190860 3300014969 Bacteria 1879
407 Ga0163161_10000144 3300017792 Bacteria 64771
408 Ga0163161_10066113 3300017792 Bacteria 2639
409 Ga0214544_1000026 3300021320 Bacteria 161530
410 Ga0214542_1000025 3300021321 Bacteria 183588
411 Ga0214545_1000014 3300021324 Bacteria 183588
412 Ga0214543_1000034 3300021327 Bacteria 183712
413 Ga0209148_1000516 3300025254 Bacteria 38539
414 Ga0209233_1010135 3300025261 Bacteria 2837
415 Ga0209233_1011860 3300025261 Bacteria 2554
416 Ga0207666_1000048 3300025271 Bacteria 23535
417 Ga0209673_1036315 3300025273 Bacteria 1463
418 Ga0209564_1000485 3300025295 Bacteria 66032
419 Ga0209564_1006386 3300025295 Bacteria 6372
420 Ga0209564_1014991 3300025295 Bacteria 3185
421 Ga0209758_1000141 3300025297 Bacteria 172481
422 Ga0209758_1001510 3300025297 Bacteria 27007
423 Ga0209758_1002417 3300025297 Bacteria 19125
424 Ga0209758_1002489 3300025297 Bacteria 18724
425 Ga0209758_1002656 3300025297 Bacteria 17698
426 Ga0209758_1002862 3300025297 Bacteria 16755
427 Ga0209256_1020989 3300025299 Bacteria 2022
428 Ga0209256_1030849 3300025299 Bacteria 1474
429 Ga0207426_1001111 3300025302 Bacteria 24708
430 Ga0209257_1000426 3300025304 Bacteria 81095
431 Ga0209257_1005168 3300025304 Bacteria 9409
432 Ga0207697_10000136 3300025315 Bacteria 35274
433 Ga0207697_10048662 3300025315 Bacteria 1749
434 Ga0207656_10122122 3300025321 Bacteria 1213
435 Ga0207696_1018901 3300025711 Bacteria 2254
436 Ga0207696_1043475 3300025711 Bacteria 1306
437 Ga0207653_10008240 3300025885 Bacteria 3249
438 Ga0207682_10000006 3300025893 Bacteria 94953
439 Ga0207642_10000628 3300025899 Bacteria 10836
440 Ga0207642_10114303 3300025899 Bacteria 1380
441 Ga0207710_10001915 3300025900 Bacteria 9975
442 Ga0207710_10004369 3300025900 Bacteria 6176
443 Ga0207710_10019353 3300025900 Bacteria 2905
444 Ga0207688_10000027 3300025901 Bacteria 48448
445 Ga0207688_10003913 3300025901 Bacteria 8119
446 Ga0207688_10017094 3300025901 Bacteria 3941
447 Ga0207688_10202008 3300025901 Bacteria 1192
448 Ga0207680_10013527 3300025903 Bacteria 4196
449 Ga0207680_10025017 3300025903 Bacteria 3287
450 Ga0207647_10005467 3300025904 Bacteria 9310
451 Ga0207647_10005974 3300025904 Bacteria 8867
452 Ga0207647_10008208 3300025904 Bacteria 7502
453 Ga0207647_10018942 3300025904 Bacteria 4638
454 Ga0207685_10069164 3300025905 Bacteria 1425
455 Ga0207699_10079489 3300025906 Bacteria 2029
456 Ga0207645_10000100 3300025907 Bacteria 64057
457 Ga0207645_10062741 3300025907 Bacteria 2374
458 Ga0207643_10000007 3300025908 Bacteria 171706
459 Ga0207705_10000002 3300025909 Bacteria 2046852
460 Ga0207684_10238209 3300025910 Bacteria 1570
461 Ga0207654_10000314 3300025911 Bacteria 29106
462 Ga0207654_10002526 3300025911 Bacteria 9289
463 Ga0207654_10004616 3300025911 Bacteria 6953
464 Ga0207654_10033564 3300025911 Bacteria 2846
465 Ga0207707_10002308 3300025912 Bacteria 17195
466 Ga0207707_10003553 3300025912 Bacteria 13808
467 Ga0207707_10012718 3300025912 Bacteria 7316
468 Ga0207695_10000062 3300025913 Bacteria 351979
469 Ga0207695_10000497 3300025913 Bacteria 83894
470 Ga0207695_10140940 3300025913 Bacteria 2359
471 Ga0207695_10199012 3300025913 Bacteria 1918
472 Ga0207671_10002658 3300025914 Bacteria 18763
473 Ga0207671_10011777 3300025914 Bacteria 7082
474 Ga0207671_10040838 3300025914 Bacteria 3433
475 Ga0207671_10278907 3300025914 Bacteria 1318
476 Ga0207693_10003057 3300025915 Bacteria 14445
477 Ga0207693_10029113 3300025915 Bacteria 4365
478 Ga0207663_10032113 3300025916 Bacteria 3114
479 Ga0207660_10000041 3300025917 Bacteria 63485
480 Ga0207660_10026737 3300025917 Bacteria 3932
481 Ga0207660_10207541 3300025917 Bacteria 1533
482 Ga0207662_10000282 3300025918 Bacteria 23540
483 Ga0207662_10025433 3300025918 Bacteria 3409
484 Ga0207662_10131399 3300025918 Bacteria 1579
485 Ga0207657_10000519 3300025919 Bacteria 40709
486 Ga0207657_10003933 3300025919 Bacteria 15773
487 Ga0207657_10018028 3300025919 Bacteria 6753
488 Ga0207657_10031886 3300025919 Bacteria 4766
489 Ga0207657_10060032 3300025919 Bacteria 3265
490 Ga0207657_10077974 3300025919 Bacteria 2791
491 Ga0207657_10108134 3300025919 Bacteria 2299
492 Ga0207657_10114073 3300025919 Bacteria 2229
493 Ga0207657_10200495 3300025919 Bacteria 1605
494 Ga0207649_10002204 3300025920 Bacteria 11011
495 Ga0207649_10120515 3300025920 Bacteria 1768
496 Ga0207652_10012613 3300025921 Bacteria 6830
497 Ga0207681_10000100 3300025923 Bacteria 72913
498 Ga0207694_10000571 3300025924 Bacteria 33435
499 Ga0207694_10037389 3300025924 Bacteria 3729
500 Ga0207694_10215738 3300025924 Bacteria 1564
501 Ga0207694_10366372 3300025924 Bacteria 1195
502 Ga0207650_10019786 3300025925 Bacteria 4736
503 Ga0207659_10000044 3300025926 Bacteria 88759
504 Ga0207687_10000072 3300025927 Bacteria 76222
505 Ga0207687_10012004 3300025927 Bacteria 5666
506 Ga0207687_10053669 3300025927 Bacteria 2817
507 Ga0207687_10176880 3300025927 Bacteria 1650
508 Ga0207687_10213845 3300025927 Bacteria 1514
509 Ga0207687_10351026 3300025927 Bacteria 1202
510 Ga0207700_10008381 3300025928 Bacteria 6400
511 Ga0207700_10017558 3300025928 Bacteria 4784
512 Ga0207700_10196813 3300025928 Bacteria 1696
513 Ga0207700_10208464 3300025928 Bacteria 1651
514 Ga0207664_10018577 3300025929 Bacteria 5122
515 Ga0207644_10001432 3300025931 Bacteria 15366
516 Ga0207644_10013238 3300025931 Bacteria 5495
517 Ga0207690_10000140 3300025932 Bacteria 58923
518 Ga0207690_10075849 3300025932 Bacteria 2333
519 Ga0207706_10001913 3300025933 Bacteria 20445
520 Ga0207706_10003180 3300025933 Bacteria 15778
521 Ga0207706_10031592 3300025933 Bacteria 4717
522 Ga0207706_10121098 3300025933 Bacteria 2301
523 Ga0207706_10126629 3300025933 Bacteria 2246
524 Ga0207706_10161971 3300025933 Bacteria 1966
525 Ga0207706_10261639 3300025933 Bacteria 1510
526 Ga0207686_10000448 3300025934 Bacteria 27388
527 Ga0207686_10115276 3300025934 Bacteria 1819
528 Ga0207709_10000154 3300025935 Bacteria 93456
529 Ga0207709_10127415 3300025935 Bacteria 1729
530 Ga0207670_10000444 3300025936 Bacteria 23206
531 Ga0207670_10156746 3300025936 Bacteria 1696
532 Ga0207670_10324460 3300025936 Bacteria 1212
533 Ga0207669_10000176 3300025937 Bacteria 29979
534 Ga0207669_10014566 3300025937 Bacteria 3945
535 Ga0207704_10000086 3300025938 Bacteria 54866
536 Ga0207704_10030558 3300025938 Bacteria 3021
537 Ga0207665_10000666 3300025939 Bacteria 23108
538 Ga0207665_10073614 3300025939 Bacteria 2337
539 Ga0207665_10362529 3300025939 Bacteria 1096
540 Ga0207691_10000214 3300025940 Bacteria 56205
541 Ga0207691_10156266 3300025940 Bacteria 2003
542 Ga0207711_10001773 3300025941 Bacteria 19760
543 Ga0207711_10012916 3300025941 Bacteria 6936
544 Ga0207711_10285779 3300025941 Bacteria 1520
545 Ga0207711_10300262 3300025941 Bacteria 1481
546 Ga0207689_10000366 3300025942 Bacteria 42711
547 Ga0207689_10018957 3300025942 Bacteria 5803
548 Ga0207689_10038482 3300025942 Bacteria 3961
549 Ga0207661_10000087 3300025944 Bacteria 63263
550 Ga0207661_10001002 3300025944 Bacteria 18644
551 Ga0207661_10107424 3300025944 Bacteria 2354
552 Ga0207661_10151138 3300025944 Bacteria 2007
553 Ga0207661_10245344 3300025944 Bacteria 1590
554 Ga0207679_10000029 3300025945 Bacteria 183002
555 Ga0207679_10149531 3300025945 Bacteria 1899
556 Ga0207667_10007625 3300025949 Bacteria 12967
557 Ga0207667_10017824 3300025949 Bacteria 7983
558 Ga0207667_10032520 3300025949 Bacteria 5619
559 Ga0207667_10034403 3300025949 Bacteria 5441
560 Ga0207667_10085886 3300025949 Bacteria 3257
561 Ga0207651_10000264 3300025960 Bacteria 22299
562 Ga0207651_10068056 3300025960 Bacteria 2509
563 Ga0207651_10149237 3300025960 Bacteria 1817
564 Ga0207712_10000129 3300025961 Bacteria 79246
565 Ga0207712_10066481 3300025961 Bacteria 2577
566 Ga0207712_10072890 3300025961 Bacteria 2475
567 Ga0207668_10000100 3300025972 Bacteria 60574
568 Ga0207668_10065341 3300025972 Bacteria 2574
569 Ga0207640_10311113 3300025981 Bacteria 1250
570 Ga0207658_10020786 3300025986 Bacteria 4547
571 Ga0207658_10039104 3300025986 Bacteria 3422
572 Ga0207658_10187780 3300025986 Bacteria 1715
573 Ga0207677_10004458 3300026023 Bacteria 7518
574 Ga0207677_10059396 3300026023 Bacteria 2637
575 Ga0207703_10127623 3300026035 Bacteria 2192
576 Ga0207703_10411496 3300026035 Bacteria 1257
577 Ga0207639_10002204 3300026041 Bacteria 13124
578 Ga0207639_10025640 3300026041 Bacteria 4276
579 Ga0207639_10329451 3300026041 Bacteria 1358
580 Ga0207678_10002814 3300026067 Bacteria 15778
581 Ga0207678_10005074 3300026067 Bacteria 11807
582 Ga0207678_10023123 3300026067 Bacteria 5439
583 Ga0207678_10024197 3300026067 Bacteria 5305
584 Ga0207708_10001802 3300026075 Bacteria 15778
585 Ga0207708_10002366 3300026075 Bacteria 13852
586 Ga0207708_10022517 3300026075 Bacteria 4759
587 Ga0207708_10054454 3300026075 Bacteria 3050
588 Ga0207702_10000003 3300026078 Bacteria 434196
589 Ga0207702_10000041 3300026078 Bacteria 150754
590 Ga0207702_10001819 3300026078 Bacteria 20980
591 Ga0207702_10042079 3300026078 Bacteria 3831
592 Ga0207702_10167231 3300026078 Bacteria 2013
593 Ga0207702_10309965 3300026078 Bacteria 1500
594 Ga0207641_10000476 3300026088 Bacteria 45413
595 Ga0207641_10068621 3300026088 Bacteria 3040
596 Ga0207641_10353218 3300026088 Bacteria 1402
597 Ga0207648_10000072 3300026089 Bacteria 94957
598 Ga0207648_10051806 3300026089 Bacteria 3588
599 Ga0207648_10087749 3300026089 Bacteria 2715
600 Ga0207676_10000512 3300026095 Bacteria 32630
601 Ga0207676_10028618 3300026095 Bacteria 4164
602 Ga0207676_10234937 3300026095 Bacteria 1641
603 Ga0207674_10000697 3300026116 Bacteria 43729
604 Ga0207674_10005049 3300026116 Bacteria 15751
605 Ga0207674_10007537 3300026116 Bacteria 12679
606 Ga0207674_10011489 3300026116 Bacteria 9946
607 Ga0207674_10049678 3300026116 Bacteria 4288
608 Ga0207674_10164655 3300026116 Bacteria 2171
609 Ga0207675_100002384 3300026118 Bacteria 18614
610 Ga0207675_100023832 3300026118 Bacteria 5692
611 Ga0207675_100241327 3300026118 Bacteria 1746
612 Ga0207683_10000029 3300026121 Bacteria 109665
613 Ga0207683_10004241 3300026121 Bacteria 12373
614 Ga0207683_10071211 3300026121 Bacteria 3073
615 Ga0207683_10283169 3300026121 Bacteria 1515
616 Ga0207698_10000523 3300026142 Bacteria 22323
617 Ga0207698_10065911 3300026142 Bacteria 2848
618 Ga0207698_10069482 3300026142 Bacteria 2785
619 Ga0209389_1000004 3300027296 Bacteria 263759
620 Ga0209389_1000023 3300027296 Bacteria 150730
621 Ga0209589_1000006 3300027357 Bacteria 436292
622 Ga0209589_1000010 3300027357 Bacteria 237657
623 Ga0209489_100007 3300027361 Bacteria 436292
624 Ga0209489_100011 3300027361 Bacteria 244710
625 Ga0209489_100295 3300027361 Bacteria 87273
626 Ga0209700_100008 3300027363 Bacteria 436292
627 Ga0209700_100013 3300027363 Bacteria 341906
628 Ga0209967_1003594 3300027364 Bacteria 2042
629 Ga0209179_1000003 3300027512 Bacteria 121837
630 Ga0209179_1006366 3300027512 Bacteria 1899
631 Ga0209588_1023972 3300027671 Bacteria 1926
632 Ga0209971_1011541 3300027682 Bacteria 2093
633 Ga0209971_1016573 3300027682 Bacteria 1747
634 Ga0209966_1003460 3300027695 Bacteria 2655
635 Ga0209998_10001339 3300027717 Bacteria 5989
636 Ga0209998_10001839 3300027717 Bacteria 5030
637 Ga0209813_10020926 3300027866 Bacteria 1835
638 Ga0209974_10002749 3300027876 Bacteria 6378
639 Ga0207428_10000100 3300027907 Bacteria 119495
640 Ga0207428_10000115 3300027907 Bacteria 109072
641 Ga0207428_10000228 3300027907 Bacteria 77812
642 Ga0207428_10099010 3300027907 Bacteria 2255
643 Ga0268266_10017979 3300028379 Bacteria 6027
644 Ga0268266_10034519 3300028379 Bacteria 4302
645 Ga0268266_10193385 3300028379 Bacteria 1858
646 Ga0268266_10334645 3300028379 Bacteria 1420
647 Ga0268266_10344906 3300028379 Bacteria 1398
648 Ga0268265_10001240 3300028380 Bacteria 22083
649 Ga0268265_10369761 3300028380 Bacteria 1315
650 Ga0268264_10000093 3300028381 Bacteria 232057
651 Ga0268264_10006796 3300028381 Bacteria 9610
652 Ga0268264_10153478 3300028381 Bacteria 2067
653 Ga0268264_10410743 3300028381 Bacteria 1303
654 Ga0265337_1000401 3300028556 Bacteria 23329
655 Ga0265326_10014656 3300028558 Bacteria 2283
656 Ga0265319_1020513 3300028563 Bacteria 2448
657 Ga0265334_10014240 3300028573 Bacteria 3315
658 Ga0265334_10025525 3300028573 Bacteria 2391
659 Ga0265323_10001197 3300028653 Bacteria 13220
660 Ga0265336_10001290 3300028666 Bacteria 11766
661 Ga0265338_10000328 3300028800 Bacteria 86546
662 Ga0265324_10012383 3300029957 Bacteria 3216
663 Ga0307511_10073605 3300030521 Bacteria 2469
664 Ga0265332_10074214 3300031238 Bacteria 1447
665 Ga0265325_10014793 3300031241 Bacteria 4403
666 Ga0265340_10033136 3300031247 Bacteria 2574
667 Ga0265340_10053977 3300031247 Bacteria 1939
668 Ga0265339_10015453 3300031249 Bacteria 4574
669 Ga0265331_10057063 3300031250 Bacteria 1853
670 Ga0265316_10041124 3300031344 Bacteria 3702
671 Ga0307509_10223657 3300031507 Bacteria 1692
672 Ga0307408_100050931 3300031548 Bacteria 2980
673 Ga0307408_100057956 3300031548 Bacteria 2814
674 Ga0307408_100111005 3300031548 Bacteria 2106
675 Ga0307408_100169313 3300031548 Bacteria 1743
676 Ga0307508_10019334 3300031616 Bacteria 6191
677 Ga0307508_10114972 3300031616 Bacteria 2291
678 Ga0265314_10098892 3300031711 Bacteria 1881
679 Ga0307516_10014917 3300031730 Bacteria 8197
680 Ga0307516_10018834 3300031730 Bacteria 7166
681 Ga0307516_10121810 3300031730 Bacteria 2397
682 Ga0307516_10136943 3300031730 Bacteria 2222
683 Ga0307405_10057297 3300031731 Bacteria 2447
684 Ga0307413_10021873 3300031824 Bacteria 3433
685 Ga0307413_10049793 3300031824 Bacteria 2513
686 Ga0307410_10051828 3300031852 Bacteria 2768
687 Ga0307406_10031430 3300031901 Bacteria 3233
688 Ga0307406_10045124 3300031901 Bacteria 2765
689 Ga0307407_10023000 3300031903 Bacteria 3245
690 Ga0307407_10304918 3300031903 Bacteria 1112
691 Ga0307412_10090894 3300031911 Bacteria 2135
692 Ga0307412_10125753 3300031911 Bacteria 1854
693 Ga0307409_100055014 3300031995 Bacteria 3069
694 Ga0307409_100065630 3300031995 Bacteria 2857
695 Ga0307409_100287308 3300031995 Bacteria 1523
696 Ga0307416_100020106 3300032002 Bacteria 4755
697 Ga0307416_100063313 3300032002 Bacteria 3028
698 Ga0307416_100502261 3300032002 Bacteria 1277
699 Ga0307414_10012904 3300032004 Bacteria 4959
700 Ga0307414_10014760 3300032004 Bacteria 4695
701 Ga0307414_10151270 3300032004 Bacteria 1831
702 Ga0307414_10309643 3300032004 Bacteria 1340
703 Ga0307411_10018956 3300032005 Bacteria 3961
704 Ga0307411_10024990 3300032005 Bacteria 3570
705 Ga0307411_10241280 3300032005 Bacteria 1415
706 Ga0307415_100048009 3300032126 Bacteria 2878
707 Ga0307415_100065146 3300032126 Bacteria 2538
708 Ga0307510_10039371 3300033180 Bacteria 5208
709 Ga0307510_10104983 3300033180 Bacteria 2596
710 Ga0307510_10190883 3300033180 Bacteria 1597
711 Ga0315911_1000010 3300033442 Bacteria 322197
712 Ga0373930_0001541 3300034816 Bacteria 3451
713 Ga0373930_0009273 3300034816 Bacteria 1739
714 Ga0373948_0000346 3300034817 Bacteria 5681
715 Ga0373950_0000453 3300034818 Bacteria 5029
716 Ga0373950_0001749 3300034818 Bacteria 2883
717 Ga0373950_0002953 3300034818 Bacteria 2396
718 Ga0373959_0001859 3300034820 Bacteria 3367
719 Ga0373938_0000565 3300034957 Bacteria 5981
720 Ga0373938_0000859 3300034957 Bacteria 4895
721 Ga0373938_0010089 3300034957 Bacteria 1726
722 Ga0373926_0014990 3300035083 Bacteria 2640
723 Ga0373928_0000893 3300035084 Bacteria 5857
724 Ga0373928_0001974 3300035084 Bacteria 3998
725 Ga0373929_0000957 3300035085 Bacteria 5608
726 Ga0373929_0004742 3300035085 Bacteria 2437
727 Ga0373944_0009683 3300035089 Bacteria 2617
728 Ga0373944_0058790 3300035089 Bacteria 1229
729 Ga0373949_0000284 3300035090 Bacteria 18664
730 Ga0373949_0001993 3300035090 Bacteria 5459
731 Ga0373951_0000560 3300035091 Bacteria 10396
732 Ga0373951_0001866 3300035091 Bacteria 5430
733 Ga0373951_0005206 3300035091 Bacteria 3035
734 Ga0373951_0012273 3300035091 Bacteria 1927
735 Ga0373952_0000135 3300035092 Bacteria 10680
736 Ga0373952_0001907 3300035092 Bacteria 3782
737 Ga0373923_0025425 3300035111 Bacteria 2346
738 Ga0373932_0000172 3300035112 Bacteria 18943
739 Ga0373936_0028869 3300035113 Bacteria 2182
740 Ga0373939_0001475 3300035114 Bacteria 5702
741 Ga0373939_0001827 3300035114 Bacteria 5121
742 Ga0373941_0000081 3300035115 Bacteria 15592
743 Ga0373941_0003306 3300035115 Bacteria 3640
744 Ga0373941_0068864 3300035115 Bacteria 1170
745 Ga0373945_0055460 3300035116 Bacteria 1467
746 Ga0373953_0010918 3300035117 Bacteria 3174
747 Ga0373954_0001018 3300035118 Bacteria 11098
748 Ga0373954_0032596 3300035118 Bacteria 2409
749 Ga0373954_0050234 3300035118 Bacteria 1957
750 Ga0373956_0006210 3300035119 Bacteria 4781
751 Ga0373956_0030833 3300035119 Bacteria 2346
752 Ga0373960_0001722 3300035121 Bacteria 4895
753 Ga0373960_0002628 3300035121 Bacteria 4063
754 Ga0373960_0061296 3300035121 Bacteria 1142
755 Ga0373943_0002389 3300035170 Bacteria 8514
756 Ga0373943_0002637 3300035170 Bacteria 8160
757 Ga0373943_0009573 3300035170 Bacteria 4344
758 Ga0373946_0001719 3300035171 Bacteria 7639
759 Ga0373946_0042235 3300035171 Bacteria 1873
760 Ga0373946_0051785 3300035171 Bacteria 1719
761 Ga0373955_0000505 3300035172 Bacteria 16570
762 Ga0373955_0008965 3300035172 Bacteria 4669
763 Ga0373955_0022067 3300035172 Bacteria 3223
764 Ga0373955_0085117 3300035172 Bacteria 1794
765 Ga0373955_0110363 3300035172 Bacteria 1590
766 Ga0373942_0000173 3300035207 Bacteria 16049
767 Ga0373942_0001874 3300035207 Bacteria 5278
768 Ga0373961_0000196 3300035241 Bacteria 28662
769 Ga0373962_0000151 3300035242 Bacteria 14355
770 Ga0373924_0002965 3300035410 Bacteria 5768
771 Ga0373924_0006538 3300035410 Bacteria 4180
772 Ga0373924_0015542 3300035410 Bacteria 2896
773 Ga0373924_0023993 3300035410 Bacteria 2399
774 Ga0373931_0001253 3300035691 Bacteria 10836
775 Ga0373931_0009230 3300035691 Bacteria 4710
776 Ga0373931_0046680 3300035691 Bacteria 2290
777 Ga0373931_0057582 3300035691 Bacteria 2084
778 Ga0373935_0000383 3300035692 Bacteria 22734
779 Ga0373935_0004350 3300035692 Bacteria 8312
780 Ga0373935_0040168 3300035692 Bacteria 2935
781 Ga0373935_0079441 3300035692 Bacteria 2129
782 Ga0373935_0093548 3300035692 Bacteria 1971
783 Ga0373935_0208501 3300035692 Bacteria 1353
784 Ga0373927_0000339 3300035695 Bacteria 36731
785 Ga0373927_0020380 3300035695 Bacteria 4348
786 Ga0373927_0027756 3300035695 Bacteria 3696
787 Ga0373927_0034997 3300035695 Bacteria 3266
788 Ga0373927_0075379 3300035695 Bacteria 2184
789 Ga0373933_0000697 3300035724 Bacteria 20663
790 Ga0373933_0004299 3300035724 Bacteria 7822
791 Ga0373933_0007968 3300035724 Bacteria 5778
792 Ga0373933_0084401 3300035724 Bacteria 1951
793 Ga0373933_0099221 3300035724 Bacteria 1805
794 Ga0373947_0000623 3300035725 Bacteria 20940
795 Ga0373947_0005753 3300035725 Bacteria 7230
796 Ga0373947_0015465 3300035725 Bacteria 4381
797 Ga0373947_0162450 3300035725 Bacteria 1445
798 Ga0373937_0023630 3300036401 Bacteria 5538
799 Ga0373937_0033607 3300036401 Bacteria 4659
800 Ga0373937_0053653 3300036401 Bacteria 3697
801 Ga0373937_0160918 3300036401 Bacteria 2104
802 Ga0373925_0025049 3300037068 Bacteria 4358
803 Ga0373925_0025122 3300037068 Bacteria 4350
804 Ga0373925_0047978 3300037068 Bacteria 3181
805 Ga0373925_0058161 3300037068 Bacteria 2898
806 Ga0373925_0099769 3300037068 Bacteria 2230
807 Ga0373925_0106024 3300037068 Bacteria 2166
808 Ga0395900_0007473 3300037418 Bacteria 11297
809 Ga0395900_0243302 3300037418 Bacteria 1804
810 Ga0395900_0339552 3300037418 Bacteria 1478
811 Ga0395898_0022639 3300037466 Bacteria 6363
812 Ga0395898_0053860 3300037466 Bacteria 3928
813 Ga0395898_0192273 3300037466 Bacteria 1950
814 Ga0395905_0001381 3300037471 Bacteria 29391
815 Ga0395905_0001880 3300037471 Bacteria 24197
816 Ga0395905_0349531 3300037471 Bacteria 1370
817 Ga0395901_0072458 3300038443 Bacteria 3591
818 Ga0395901_0250401 3300038443 Bacteria 1846
819 Ga0395901_0726349 3300038443 Bacteria 988
820 Ga0436365_0007777 3300039437 Bacteria 4023
821 Ga0436365_1219354 3300039437 Bacteria 6238
822 Ga0436365_1283193 3300039437 Bacteria 6724
823 Ga0436365_1496755 3300039437 Bacteria 1956
824 Ga0436365_1754300 3300039437 Bacteria 1729
825 Ga0436360_0598897 3300039438 Bacteria 1771
826 Ga0436360_1142640 3300039438 Bacteria 1816
827 Ga0436363_0616687 3300039450 Bacteria 4066
828 Ga0451793_0847063 3300041452 Bacteria 1576
829 Ga0439432_017279 3300042006 Bacteria 2422
830 Ga0439435_0049467 3300042436 Bacteria 1200
831 Ga0451577_0025411 3300042876 Bacteria 5374
832 Ga0466969_0058844 3300044656 Bacteria 1869
833 Ga0466969_0107205 3300044656 Bacteria 1310
834 Ga0466966_0015210 3300044684 Bacteria 5090
835 Ga0466961_0000149 3300044693 Bacteria 47561
836 Ga0466964_0175442 3300044706 Bacteria 1012
837 Ga0453684_0235668 3300044712 Bacteria 2110
838 Ga0466960_0152315 3300044901 Bacteria 1236
839 Ga0466959_0036290 3300045049 Bacteria 3642
840 Ga0451576_0184521 3300045051 Bacteria 2178
841 Ga0466958_0246474 3300045836 Bacteria 1142
842 Ga0466967_0015775 3300045976 Bacteria 5935
843 Ga0466967_0072058 3300045976 Bacteria 3095
844 Ga0466967_0224106 3300045976 Bacteria 1788
845 Ga0495617_028012 3300046452 Bacteria 1895
846 Ga0495627_053630 3300046453 Bacteria 1207
847 Ga0495592_0001464 3300046454 Bacteria 16415
848 Ga0495592_0051294 3300046454 Bacteria 3064
849 Ga0495592_0077523 3300046454 Bacteria 2409
850 Ga0495592_0120593 3300046454 Bacteria 1845
851 Ga0495603_0001921 3300046455 Bacteria 12253
852 Ga0495603_0025531 3300046455 Bacteria 3573
853 Ga0495603_0025682 3300046455 Bacteria 3561
854 Ga0495603_0077594 3300046455 Bacteria 1948
855 Ga0495603_0086816 3300046455 Bacteria 1831
856 Ga0495603_0199553 3300046455 Bacteria 1156
857 Ga0495590_0080298 3300046457 Bacteria 1148
858 Ga0495629_0000280 3300046459 Bacteria 44080
859 Ga0495629_0008419 3300046459 Bacteria 7590
860 Ga0495629_0019114 3300046459 Bacteria 4899
861 Ga0495629_0047757 3300046459 Bacteria 3002
862 Ga0495629_0107607 3300046459 Bacteria 1945
863 Ga0495629_0110151 3300046459 Bacteria 1919
864 Ga0495638_0000011 3300046460 Bacteria 442453
865 Ga0495638_0088100 3300046460 Bacteria 1874
866 Ga0495638_0107859 3300046460 Bacteria 1657
867 Ga0495638_0160267 3300046460 Bacteria 1298
868 Ga0495641_0005456 3300046461 Bacteria 8588
869 Ga0495641_0044804 3300046461 Bacteria 2039
870 Ga0495651_0001797 3300046462 Bacteria 16534
871 Ga0495651_0005170 3300046462 Bacteria 9954
872 Ga0495651_0026260 3300046462 Bacteria 4536
873 Ga0495653_0016213 3300046463 Bacteria 6070
874 Ga0495653_0047920 3300046463 Bacteria 3302
875 Ga0495653_0103650 3300046463 Bacteria 2057
876 Ga0495653_0109734 3300046463 Bacteria 1985
877 Ga0495653_0121798 3300046463 Bacteria 1858
878 Ga0495580_0002106 3300046472 Bacteria 17464
879 Ga0495580_0024266 3300046472 Bacteria 4443
880 Ga0495580_0102356 3300046472 Bacteria 1991
881 Ga0495582_0000839 3300046473 Bacteria 16987
882 Ga0495582_0005522 3300046473 Bacteria 7041
883 Ga0495582_0159580 3300046473 Bacteria 1282
884 Ga0495639_0000198 3300046475 Bacteria 31609
885 Ga0495639_0038346 3300046475 Bacteria 2152
886 Ga0495639_0053169 3300046475 Bacteria 1845
887 Ga0495662_0013305 3300046476 Bacteria 4004
888 Ga0495662_0018057 3300046476 Bacteria 3412
889 Ga0495664_0085178 3300046477 Bacteria 1897
890 Ga0495664_0133072 3300046477 Bacteria 1506
891 Ga0495584_0044126 3300046491 Bacteria 2250
892 Ga0495585_0000974 3300046492 Bacteria 24017
893 Ga0495594_0000484 3300046499 Bacteria 20276
894 Ga0495594_0021206 3300046499 Bacteria 3467
895 Ga0495594_0044111 3300046499 Bacteria 2445
896 Ga0495607_0011320 3300046501 Bacteria 5946
897 Ga0495607_0149737 3300046501 Bacteria 1195
898 Ga0495607_0156032 3300046501 Bacteria 1164
899 Ga0495583_0000242 3300046506 Bacteria 90367
900 Ga0495606_0009928 3300046507 Bacteria 7971
901 Ga0495606_0018301 3300046507 Bacteria 5260
902 Ga0495608_0014611 3300046511 Bacteria 5447
903 Ga0495608_0044163 3300046511 Bacteria 2974
904 Ga0495608_0054453 3300046511 Bacteria 2644
905 Ga0495608_0127866 3300046511 Bacteria 1627
906 Ga0495610_0037940 3300046512 Bacteria 2448
907 Ga0495610_0151874 3300046512 Bacteria 987
908 Ga0495618_0015542 3300046514 Bacteria 4646
909 Ga0495618_0058196 3300046514 Bacteria 2447
910 Ga0495618_0174098 3300046514 Bacteria 1369
911 Ga0495618_0180488 3300046514 Bacteria 1341
912 Ga0495620_0039614 3300046515 Bacteria 2081
913 Ga0495628_0003390 3300046516 Bacteria 14259
914 Ga0495628_0010246 3300046516 Bacteria 7974
915 Ga0495628_0018942 3300046516 Bacteria 5696
916 Ga0495628_0071368 3300046516 Bacteria 2707
917 Ga0495628_0085781 3300046516 Bacteria 2442
918 Ga0495630_0004090 3300046517 Bacteria 10212
919 Ga0495630_0013420 3300046517 Bacteria 5962
920 Ga0495630_0080217 3300046517 Bacteria 2461
921 Ga0495632_0000638 3300046519 Bacteria 32240
922 Ga0495632_0038280 3300046519 Bacteria 2429
923 Ga0495643_0016356 3300046522 Bacteria 4356
924 Ga0495644_0002940 3300046523 Bacteria 6769
925 Ga0495648_0000023 3300046524 Bacteria 240174
926 Ga0495648_0001628 3300046524 Bacteria 21799
927 Ga0495648_0003788 3300046524 Bacteria 13150
928 Ga0495648_0005381 3300046524 Bacteria 10643
929 Ga0495648_0024143 3300046524 Bacteria 4150
930 Ga0495663_0016868 3300046525 Bacteria 2067
931 Ga0495663_0075635 3300046525 Bacteria 1078
932 Ga0495666_0004626 3300046526 Bacteria 6956
933 Ga0495666_0023858 3300046526 Bacteria 3025
934 Ga0495666_0033603 3300046526 Bacteria 2505
935 Ga0495666_0067968 3300046526 Bacteria 1697
936 Ga0495652_0034324 3300046529 Bacteria 4421
937 Ga0495652_0037775 3300046529 Bacteria 4187
938 Ga0495652_0044572 3300046529 Bacteria 3818
939 Ga0495652_0184198 3300046529 Bacteria 1599
940 Ga0495665_0000539 3300046531 Bacteria 19201
941 Ga0495665_0024344 3300046531 Bacteria 3252
942 Ga0495665_0030354 3300046531 Bacteria 2892
943 Ga0495640_0004718 3300046533 Bacteria 10864
944 Ga0495640_0022789 3300046533 Bacteria 4573
945 Ga0495640_0027286 3300046533 Bacteria 4119
946 Ga0495640_0028769 3300046533 Bacteria 3997
947 Ga0495640_0039086 3300046533 Bacteria 3332
948 Ga0495587_0002521 3300046536 Bacteria 12231
949 Ga0495587_0118056 3300046536 Bacteria 1520
950 Ga0495587_0177845 3300046536 Bacteria 1207
951 Ga0495598_0009092 3300046537 Bacteria 2336
952 Ga0495645_0002657 3300046543 Bacteria 12151
953 Ga0495645_0015582 3300046543 Bacteria 5408
954 Ga0495645_0021112 3300046543 Bacteria 4706
955 Ga0495645_0031265 3300046543 Bacteria 3878
956 Ga0495645_0226226 3300046543 Bacteria 1255
957 Ga0495622_0005155 3300046557 Bacteria 6060
958 Ga0495622_0036333 3300046557 Bacteria 2297
959 Ga0495622_0043754 3300046557 Bacteria 2081
960 Ga0495622_0152561 3300046557 Bacteria 1045
961 Ga0495633_0002331 3300046558 Bacteria 13493
962 Ga0495633_0005929 3300046558 Bacteria 7349
963 Ga0495667_0002603 3300046559 Bacteria 12042
964 Ga0495667_0009295 3300046559 Bacteria 6666
965 Ga0495667_0090210 3300046559 Bacteria 1986
966 Ga0495656_0000276 3300046615 Bacteria 18021
967 Ga0495668_0029006 3300046616 Bacteria 3127
968 Ga0495668_0125744 3300046616 Bacteria 1403
969 Ga0495634_0000792 3300046642 Bacteria 30599
970 Ga0495634_0024899 3300046642 Bacteria 4195
971 Ga0495634_0028175 3300046642 Bacteria 3901
972 Ga0495634_0062371 3300046642 Bacteria 2475
973 Ga0495611_0004478 3300046648 Bacteria 6049
974 Ga0495611_0084899 3300046648 Bacteria 1460
975 Ga0495625_0055998 3300046660 Bacteria 2809
976 Ga0495625_0106634 3300046660 Bacteria 1918
977 Ga0495635_0000534 3300046663 Bacteria 24127
978 Ga0495635_0002309 3300046663 Bacteria 12963
979 Ga0495635_0012601 3300046663 Bacteria 5929
980 Ga0495635_0022557 3300046663 Bacteria 4386
981 Ga0495635_0080012 3300046663 Bacteria 2236
982 Ga0495635_0104329 3300046663 Bacteria 1937
983 Ga0495635_0128831 3300046663 Bacteria 1725
984 Ga0495588_0005803 3300046674 Bacteria 5522
985 Ga0495588_0012125 3300046674 Bacteria 4064
986 Ga0495588_0044972 3300046674 Bacteria 2262
987 Ga0495657_0012670 3300046675 Bacteria 6254
988 Ga0495657_0013808 3300046675 Bacteria 5945
989 Ga0495657_0037981 3300046675 Bacteria 3315
990 Ga0495599_0011975 3300046678 Bacteria 5335
991 Ga0495599_0023511 3300046678 Bacteria 3853
992 Ga0495599_0056334 3300046678 Bacteria 2460
993 Ga0495599_0098409 3300046678 Bacteria 1823
994 Ga0495599_0199214 3300046678 Bacteria 1230
995 Ga0495599_0237823 3300046678 Bacteria 1111
996 Ga0495623_0013899 3300046679 Bacteria 5218
997 Ga0495623_0061095 3300046679 Bacteria 2363
998 Ga0495623_0089766 3300046679 Bacteria 1888
999 Ga0495646_0006258 3300046680 Bacteria 7549
1000 Ga0495646_0006855 3300046680 Bacteria 7227
1001 Ga0495646_0114495 3300046680 Bacteria 1532
1002 Ga0495647_0001093 3300046681 Bacteria 8269
1003 Ga0495647_0003761 3300046681 Bacteria 4880
1004 Ga0495647_0004239 3300046681 Bacteria 4644
1005 Ga0495647_0065352 3300046681 Bacteria 1444
1006 Ga0495658_0001282 3300046683 Bacteria 13170
1007 Ga0495658_0001614 3300046683 Bacteria 11745
1008 Ga0495658_0012893 3300046683 Bacteria 4246
1009 Ga0495658_0032622 3300046683 Bacteria 2845
1010 Ga0495658_0041311 3300046683 Bacteria 2568
1011 Ga0495658_0091626 3300046683 Bacteria 1801
1012 Ga0495669_0003692 3300046684 Bacteria 6299
1013 Ga0495613_0018666 3300046689 Bacteria 5171
1014 Ga0495613_0044715 3300046689 Bacteria 3275
1015 Ga0495613_0062257 3300046689 Bacteria 2731
1016 Ga0495613_0244584 3300046689 Bacteria 1253
1017 Ga0495624_0002224 3300046690 Bacteria 14785
1018 Ga0495624_0006348 3300046690 Bacteria 8396
1019 Ga0495624_0031131 3300046690 Bacteria 3472
1020 Ga0495624_0037078 3300046690 Bacteria 3139
1021 Ga0495670_0135398 3300046691 Bacteria 1286
1022 Ga0495671_0000012 3300046692 Bacteria 358632
1023 Ga0495671_0006594 3300046692 Bacteria 6695
1024 Ga0495649_0102017 3300046694 Bacteria 1524
1025 Ga0495600_0001341 3300046809 Bacteria 13567
1026 Ga0495600_0013087 3300046809 Bacteria 5206
1027 Ga0495600_0024809 3300046809 Bacteria 3860
1028 Ga0495660_0078731 3300046810 Bacteria 1732
1029 Ga0495581_0000015 3300047315 Bacteria 59214
1030 Ga0495581_0052097 3300047315 Bacteria 2364
1031 Ga0495581_0061591 3300047315 Bacteria 2168
1032 Ga0495581_0089091 3300047315 Bacteria 1789
1033 Ga0495581_0102352 3300047315 Bacteria 1664
1034 Ga0495604_0002055 3300047317 Bacteria 16241
1035 Ga0495604_0007158 3300047317 Bacteria 8835
1036 Ga0495604_0011991 3300047317 Bacteria 6890
1037 Ga0495604_0040475 3300047317 Bacteria 3659
1038 Ga0495604_0049006 3300047317 Bacteria 3284
1039 Ga0495604_0260303 3300047317 Bacteria 1179
1040 Ga0495674_0008391 3300047319 Bacteria 9846
1041 Ga0495674_0011609 3300047319 Bacteria 8308
1042 Ga0495674_0046688 3300047319 Bacteria 3844
1043 Ga0495674_0049830 3300047319 Bacteria 3697
1044 Ga0495674_0058711 3300047319 Bacteria 3362
1045 Ga0495672_0004036 3300047320 Bacteria 12270
1046 Ga0495672_0119074 3300047320 Bacteria 1406
1047 Ga0495676_0025908 3300047321 Bacteria 5054
1048 Ga0495676_0088017 3300047321 Bacteria 2331
1049 Ga0495676_0094959 3300047321 Bacteria 2220
1050 Ga0495680_0004358 3300047322 Bacteria 13558
1051 Ga0495680_0006209 3300047322 Bacteria 11135
1052 Ga0495680_0008847 3300047322 Bacteria 9107
1053 Ga0495680_0016086 3300047322 Bacteria 6432
1054 Ga0495680_0023741 3300047322 Bacteria 5096
1055 Ga0495680_0144672 3300047322 Bacteria 1737
1056 Ga0495687_007506 3300047443 Bacteria 6409
1057 Ga0495675_0013658 3300047444 Bacteria 5130
1058 Ga0495675_0120725 3300047444 Bacteria 1632
1059 Ga0495679_049399 3300047446 Bacteria 1269
1060 Ga0495673_0000029 3300047469 Bacteria 471019
1061 Ga0495684_0001012 3300047471 Bacteria 22906
1062 Ga0495684_0024587 3300047471 Bacteria 4636
1063 Ga0495684_0041830 3300047471 Bacteria 3511
1064 Ga0495684_0041933 3300047471 Bacteria 3507
1065 Ga0495684_0045322 3300047471 Bacteria 3366
1066 Ga0495686_0095766 3300047472 Bacteria 1797
1067 Ga0495686_0141420 3300047472 Bacteria 1420
1068 Ga0495593_0000384 3300047673 Bacteria 24498
1069 Ga0495593_0008133 3300047673 Bacteria 6104
1070 Ga0495593_0010683 3300047673 Bacteria 5293
1071 Ga0495593_0053787 3300047673 Bacteria 2124
1072 Ga0495602_0004518 3300048088 Bacteria 14518
1073 Ga0495602_0007000 3300048088 Bacteria 11841
1074 Ga0495602_0037211 3300048088 Bacteria 4520
1075 Ga0495602_0039351 3300048088 Bacteria 4355
1076 Ga0495602_0115137 3300048088 Bacteria 2175
1077 Ga0495602_0325781 3300048088 Bacteria 1116
1078 Ga0495614_0011280 3300048089 Bacteria 3932
1079 Ga0495614_0048183 3300048089 Bacteria 1827
1080 Ga0495626_0065051 3300048091 Bacteria 1651
1081 Ga0496100_0000530 3300048903 Bacteria 18154
1082 Ga0496100_0010450 3300048903 Bacteria 5254
1083 Ga0496100_0114028 3300048903 Bacteria 1882
1084 Ga0496101_0000189 3300048904 Bacteria 48416
1085 Ga0496101_0006701 3300048904 Bacteria 7428
1086 Ga0496101_0008079 3300048904 Bacteria 6862
1087 Ga0496101_0033067 3300048904 Bacteria 3645
1088 Ga0496101_0068182 3300048904 Bacteria 2600
1089 Ga0496101_0122894 3300048904 Bacteria 1964
1090 Ga0496102_0011342 3300048905 Bacteria 7677
1091 Ga0496102_0012470 3300048905 Bacteria 7356
1092 Ga0496102_0023434 3300048905 Bacteria 5483
1093 Ga0496102_0024990 3300048905 Bacteria 5314
1094 Ga0496102_0041225 3300048905 Bacteria 4178
1095 Ga0496102_0275381 3300048905 Bacteria 1586
1096 Ga0496103_0007850 3300048906 Bacteria 6343
1097 Ga0496103_0045148 3300048906 Bacteria 2718
1098 Ga0496104_0000508 3300048907 Bacteria 33336
1099 Ga0496104_0001997 3300048907 Bacteria 17701
1100 Ga0496104_0006052 3300048907 Bacteria 10613
1101 Ga0496104_0012119 3300048907 Bacteria 7741
1102 Ga0496104_0037267 3300048907 Bacteria 4548
1103 Ga0496104_0059191 3300048907 Bacteria 3626
1104 Ga0496104_0063090 3300048907 Bacteria 3514
1105 Ga0496104_0163695 3300048907 Bacteria 2133
1106 Ga0496104_0197002 3300048907 Bacteria 1926
1107 Ga0496104_0206836 3300048907 Bacteria 1874
1108 Ga0496104_0228172 3300048907 Bacteria 1774
1109 Ga0496104_0321350 3300048907 Bacteria 1460
1110 Ga0496105_0006301 3300048908 Bacteria 9113
1111 Ga0496105_0016135 3300048908 Bacteria 5958
1112 Ga0496105_0040901 3300048908 Bacteria 3821
1113 Ga0496105_0044252 3300048908 Bacteria 3671
1114 Ga0496105_0103867 3300048908 Bacteria 2347
1115 Ga0496105_0122035 3300048908 Bacteria 2148
1116 Ga0496105_0135232 3300048908 Bacteria 2031
1117 Ga0496105_0135683 3300048908 Bacteria 2027
1118 Ga0496105_0144903 3300048908 Bacteria 1953
1119 Ga0496105_0254213 3300048908 Bacteria 1423
1120 Ga0496106_0001465 3300048909 Bacteria 17755
1121 Ga0496106_0012760 3300048909 Bacteria 6204
1122 Ga0496106_0013066 3300048909 Bacteria 6128
1123 Ga0496106_0016847 3300048909 Bacteria 5407
1124 Ga0496106_0017851 3300048909 Bacteria 5246
1125 Ga0496106_0103526 3300048909 Bacteria 2209
1126 Ga0496106_0308532 3300048909 Bacteria 1269
1127 Ga0496106_0438482 3300048909 Bacteria 1050
1128 Ga0496107_0003085 3300048910 Bacteria 11063
1129 Ga0496107_0005112 3300048910 Bacteria 8947
1130 Ga0496107_0005951 3300048910 Bacteria 8356
1131 Ga0496107_0011126 3300048910 Bacteria 6259
1132 Ga0496107_0018052 3300048910 Bacteria 4963
1133 Ga0496107_0079230 3300048910 Bacteria 2394
1134 Ga0496107_0321451 3300048910 Bacteria 1151
1135 Ga0496108_0002465 3300048911 Bacteria 14815
1136 Ga0496108_0003684 3300048911 Bacteria 12291
1137 Ga0496108_0004455 3300048911 Bacteria 11275
1138 Ga0496108_0004887 3300048911 Bacteria 10820
1139 Ga0496108_0018809 3300048911 Bacteria 5663
1140 Ga0496108_0052725 3300048911 Bacteria 3410
1141 Ga0496108_0131162 3300048911 Bacteria 2154
1142 Ga0496108_0138139 3300048911 Bacteria 2098
1143 Ga0496108_0176533 3300048911 Bacteria 1849
1144 Ga0496108_0265285 3300048911 Bacteria 1494
1145 Ga0496109_0000361 3300048912 Bacteria 42221
1146 Ga0496109_0000488 3300048912 Bacteria 33914
1147 Ga0496109_0005024 3300048912 Bacteria 11051
1148 Ga0496109_0006884 3300048912 Bacteria 9588
1149 Ga0496109_0009996 3300048912 Bacteria 8100
1150 Ga0496109_0043459 3300048912 Bacteria 4073
1151 Ga0496109_0064561 3300048912 Bacteria 3350
1152 Ga0496110_0006318 3300048913 Bacteria 9358
1153 Ga0496110_0031059 3300048913 Bacteria 4607
1154 Ga0496110_0039424 3300048913 Bacteria 4113
1155 Ga0496110_0074590 3300048913 Bacteria 3013
1156 Ga0496110_0192564 3300048913 Bacteria 1852
1157 Ga0496110_0308133 3300048913 Bacteria 1442
1158 Ga0496111_0008713 3300048914 Bacteria 6731
1159 Ga0496111_0013217 3300048914 Bacteria 5612
1160 Ga0496111_0020669 3300048914 Bacteria 4587
1161 Ga0496111_0040286 3300048914 Bacteria 3351
1162 Ga0496111_0079806 3300048914 Bacteria 2387
1163 Ga0496111_0083151 3300048914 Bacteria 2339
1164 Ga0496111_0142483 3300048914 Bacteria 1776
1165 Ga0496112_0000008 3300048915 Bacteria 310323
1166 Ga0496112_0002869 3300048915 Bacteria 14010
1167 Ga0496112_0006900 3300048915 Bacteria 10018
1168 Ga0496112_0007908 3300048915 Bacteria 9472
1169 Ga0496112_0018028 3300048915 Bacteria 6643
1170 Ga0496112_0053933 3300048915 Bacteria 3949
1171 Ga0496112_0087946 3300048915 Bacteria 3074
1172 Ga0496112_0135217 3300048915 Bacteria 2436
1173 Ga0496112_0139424 3300048915 Bacteria 2394
1174 Ga0496113_0002209 3300048916 Bacteria 11223
1175 Ga0496113_0002579 3300048916 Bacteria 10584
1176 Ga0496113_0003109 3300048916 Bacteria 9866
1177 Ga0496113_0024919 3300048916 Bacteria 4259
1178 Ga0496113_0043915 3300048916 Bacteria 3309
1179 Ga0496113_0075116 3300048916 Bacteria 2579
1180 Ga0496113_0106377 3300048916 Bacteria 2179
1181 Ga0496113_0309434 3300048916 Bacteria 1265
1182 Ga0496114_0001960 3300048917 Bacteria 15650
1183 Ga0496114_0002928 3300048917 Bacteria 13087
1184 Ga0496114_0006147 3300048917 Bacteria 9448
1185 Ga0496114_0008185 3300048917 Bacteria 8290
1186 Ga0496114_0307180 3300048917 Bacteria 1401
1187 Ga0496115_0002442 3300048918 Bacteria 13349
1188 Ga0496115_0014481 3300048918 Bacteria 5971
1189 Ga0496115_0047309 3300048918 Bacteria 3439
1190 Ga0496115_0076158 3300048918 Bacteria 2726
1191 Ga0496115_0342826 3300048918 Bacteria 1219
1192 Ga0496116_0003172 3300048919 Bacteria 16473
1193 Ga0496117_0008447 3300048920 Bacteria 9776
1194 Ga0496117_0021988 3300048920 Bacteria 5132
1195 Ga0496117_0129765 3300048920 Bacteria 1530
1196 Ga0496117_0175249 3300048920 Bacteria 1240
1197 Ga0496118_0012830 3300048921 Bacteria 7997
1198 Ga0496118_0054949 3300048921 Bacteria 3010
1199 Ga0496118_0091406 3300048921 Bacteria 2093
1200 Ga0496118_0109763 3300048921 Bacteria 1835
1201 Ga0496119_0019927 3300048922 Bacteria 4914
1202 Ga0496119_0067340 3300048922 Bacteria 2112
1203 Ga0496120_0005798 3300048923 Bacteria 9681
1204 Ga0496120_0066833 3300048923 Bacteria 1987
1205 Ga0496121_0000381 3300048924 Bacteria 90593
1206 Ga0496121_0005990 3300048924 Bacteria 15358
1207 Ga0496121_0012055 3300048924 Bacteria 9497
1208 Ga0496121_0020194 3300048924 Bacteria 6610
1209 Ga0496121_0025417 3300048924 Bacteria 5617
1210 Ga0496121_0055052 3300048924 Bacteria 3318
1211 Ga0496123_0101798 3300048926 Bacteria 1669
1212 Ga0496124_0007279 3300048927 Bacteria 11803
1213 Ga0496124_0381178 3300048927 Bacteria 986
1214 Ga0496125_0000654 3300048928 Bacteria 57851
1215 Ga0496125_0001646 3300048928 Bacteria 31476
1216 Ga0496125_0027660 3300048928 Bacteria 5136
1217 Ga0496125_0037567 3300048928 Bacteria 4208
1218 Ga0496125_0093021 3300048928 Bacteria 2252
1219 Ga0496125_0099925 3300048928 Bacteria 2140
1220 Ga0496125_0144663 3300048928 Bacteria 1646
1221 Ga0496125_0146452 3300048928 Bacteria 1631
1222 Ga0496126_0005477 3300048929 Bacteria 14469
1223 Ga0496126_0014823 3300048929 Bacteria 7863
1224 Ga0496126_0021093 3300048929 Bacteria 6371
1225 Ga0496126_0022427 3300048929 Bacteria 6145
1226 Ga0496126_0364499 3300048929 Bacteria 1179
1227 Ga0496126_0424416 3300048929 Bacteria 1074
1228 Ga0496126_0435441 3300048929 Bacteria 1058
1229 Ga0501290_000772 3300049513 Bacteria 4739
1230 Ga0501292_000014 3300049515 Bacteria 64546
1231 Ga0501294_000889 3300049517 Bacteria 3218
1232 Ga0501300_000229 3300049523 Bacteria 8470
1233 Ga0501031_0012923 3300049568 Bacteria 5452
1234 Ga0501031_0017863 3300049568 Bacteria 4613
1235 Ga0501031_0074919 3300049568 Bacteria 2203
1236 Ga0501032_0000269 3300049569 Bacteria 43721
1237 Ga0501032_0011788 3300049569 Bacteria 6265
1238 Ga0501032_0092312 3300049569 Bacteria 2008
1239 Ga0501033_0000249 3300049570 Bacteria 52045
1240 Ga0501033_0007545 3300049570 Bacteria 8465
1241 Ga0501033_0022581 3300049570 Bacteria 4746
1242 Ga0501033_0040028 3300049570 Bacteria 3499
1243 Ga0501033_0085408 3300049570 Bacteria 2311
1244 Ga0501033_0127630 3300049570 Bacteria 1844
1245 Ga0501034_0000039 3300049571 Bacteria 237357
1246 Ga0501034_0000850 3300049571 Bacteria 45243
1247 Ga0501034_0016544 3300049571 Bacteria 7562
1248 Ga0501034_0042660 3300049571 Bacteria 4592
1249 Ga0501034_0058977 3300049571 Bacteria 3856
1250 Ga0501034_0099018 3300049571 Bacteria 2910
1251 Ga0501034_0192062 3300049571 Bacteria 2004
1252 Ga0501034_0205154 3300049571 Bacteria 1928
1253 Ga0501034_0406821 3300049571 Bacteria 1283
1254 Ga0501034_0450712 3300049571 Bacteria 1204
1255 Ga0501036_0000899 3300049572 Bacteria 22269
1256 Ga0501036_0004935 3300049572 Bacteria 10781
1257 Ga0501036_0007504 3300049572 Bacteria 8897
1258 Ga0501036_0046557 3300049572 Bacteria 3673
1259 Ga0501036_0077541 3300049572 Bacteria 2812
1260 Ga0501036_0143194 3300049572 Bacteria 2016
1261 Ga0501036_0179267 3300049572 Bacteria 1784
1262 Ga0501037_0000112 3300049573 Bacteria 75698
1263 Ga0501037_0001864 3300049573 Bacteria 15310
1264 Ga0501037_0015791 3300049573 Bacteria 5557
1265 Ga0501037_0021022 3300049573 Bacteria 4821
1266 Ga0501037_0027622 3300049573 Bacteria 4193
1267 Ga0501037_0033704 3300049573 Bacteria 3781
1268 Ga0501037_0053072 3300049573 Bacteria 2964
1269 Ga0501037_0138099 3300049573 Bacteria 1745
1270 Ga0501038_0000727 3300049574 Bacteria 29411
1271 Ga0501038_0009937 3300049574 Bacteria 8713
1272 Ga0501038_0013255 3300049574 Bacteria 7517
1273 Ga0501038_0017301 3300049574 Bacteria 6516
1274 Ga0501038_0028682 3300049574 Bacteria 4943
1275 Ga0501038_0035710 3300049574 Bacteria 4364
1276 Ga0501038_0044912 3300049574 Bacteria 3836
1277 Ga0501038_0066126 3300049574 Bacteria 3079
1278 Ga0501038_0220246 3300049574 Bacteria 1514
1279 Ga0501038_0323811 3300049574 Bacteria 1205
1280 Ga0501039_0024000 3300049575 Bacteria 4683
1281 Ga0501039_0040832 3300049575 Bacteria 3581
1282 Ga0501039_0049595 3300049575 Bacteria 3245
1283 Ga0501039_0087269 3300049575 Bacteria 2430
1284 Ga0501040_0008040 3300049576 Bacteria 6850
1285 Ga0501040_0146866 3300049576 Bacteria 1662
1286 Ga0501042_0030617 3300049578 Bacteria 3802
1287 Ga0501042_0051603 3300049578 Bacteria 2933
1288 Ga0501042_0097714 3300049578 Bacteria 2111
1289 Ga0501043_0004641 3300049579 Bacteria 11138
1290 Ga0501043_0015869 3300049579 Bacteria 5904
1291 Ga0501043_0018381 3300049579 Bacteria 5481
1292 Ga0501043_0063213 3300049579 Bacteria 2906
1293 Ga0501043_0076108 3300049579 Bacteria 2636
1294 Ga0501043_0124807 3300049579 Bacteria 2018
1295 Ga0501043_0141018 3300049579 Bacteria 1887
1296 Ga0501043_0266974 3300049579 Bacteria 1314
1297 Ga0501046_0006020 3300049580 Bacteria 10788
1298 Ga0501046_0013310 3300049580 Bacteria 6968
1299 Ga0501046_0018899 3300049580 Bacteria 5723
1300 Ga0501046_0037594 3300049580 Bacteria 3889
1301 Ga0501047_0000455 3300049581 Bacteria 45200
1302 Ga0501047_0002128 3300049581 Bacteria 18968
1303 Ga0501047_0025946 3300049581 Bacteria 5635
1304 Ga0501047_0043146 3300049581 Bacteria 4356
1305 Ga0501047_0049002 3300049581 Bacteria 4079
1306 Ga0501047_0054513 3300049581 Bacteria 3867
1307 Ga0501047_0079140 3300049581 Bacteria 3161
1308 Ga0501047_0114372 3300049581 Bacteria 2580
1309 Ga0501047_0133657 3300049581 Bacteria 2361
1310 Ga0501047_0161880 3300049581 Bacteria 2109
1311 Ga0501048_0000677 3300049582 Bacteria 24715
1312 Ga0501048_0001113 3300049582 Bacteria 20168
1313 Ga0501048_0024279 3300049582 Bacteria 4425
1314 Ga0501048_0164118 3300049582 Bacteria 1572
1315 Ga0501067_0003780 3300049583 Bacteria 8347
1316 Ga0501067_0005792 3300049583 Bacteria 6859
1317 Ga0501068_0021310 3300049584 Bacteria 3784
1318 Ga0501068_0041830 3300049584 Bacteria 2754
1319 Ga0501069_0005343 3300049585 Bacteria 6680
1320 Ga0501069_0018370 3300049585 Bacteria 3773
1321 Ga0501070_0005835 3300049586 Bacteria 10502
1322 Ga0501070_0028051 3300049586 Bacteria 4721
1323 Ga0501070_0043105 3300049586 Bacteria 3756
1324 Ga0501070_0071480 3300049586 Bacteria 2873
1325 Ga0501070_0087502 3300049586 Bacteria 2578
1326 Ga0501070_0186535 3300049586 Bacteria 1706
1327 Ga0501071_0044143 3300049587 Bacteria 3197
1328 Ga0501071_0085263 3300049587 Bacteria 2316
1329 Ga0501072_0078654 3300049588 Bacteria 2611
1330 Ga0501073_0000103 3300049589 Bacteria 53962
1331 Ga0501073_0011859 3300049589 Bacteria 6363
1332 Ga0501073_0029119 3300049589 Bacteria 3946
1333 Ga0501073_0052331 3300049589 Bacteria 2859
1334 Ga0501073_0083610 3300049589 Bacteria 2221
1335 Ga0501073_0127602 3300049589 Bacteria 1763
1336 Ga0501073_0129940 3300049589 Bacteria 1746
1337 Ga0501074_0000203 3300049590 Bacteria 32417
1338 Ga0501074_0015716 3300049590 Bacteria 5503
1339 Ga0501074_0031406 3300049590 Bacteria 3847
1340 Ga0501074_0053579 3300049590 Bacteria 2910
1341 Ga0501206_000816 3300049653 Bacteria 3811
1342 Ga0501223_000250 3300049663 Bacteria 13783
1343 Ga0501224_000750 3300049664 Bacteria 4089
1344 Ga0501227_009571 3300049665 Bacteria 2090
1345 Ga0501235_001772 3300049669 Bacteria 4623
1346 Ga0501261_000003 3300049690 Bacteria 106942
1347 Ga0501225_0000710 3300049705 Bacteria 10467
1348 Ga0501245_001564 3300049708 Bacteria 2979
1349 Ga0501079_0009511 3300049741 Bacteria 7370
1350 Ga0501079_0021435 3300049741 Bacteria 4943
1351 Ga0501079_0099424 3300049741 Bacteria 2254
1352 Ga0501080_0002271 3300049742 Bacteria 16721
1353 Ga0501080_0005235 3300049742 Bacteria 11555
1354 Ga0501080_0009477 3300049742 Bacteria 8881
1355 Ga0501080_0034637 3300049742 Bacteria 4715
1356 Ga0501080_0102862 3300049742 Bacteria 2649
1357 Ga0501080_0361282 3300049742 Bacteria 1310
1358 Ga0501083_0000437 3300049744 Bacteria 26753
1359 Ga0501083_0001959 3300049744 Bacteria 14144
1360 Ga0501083_0027454 3300049744 Bacteria 3928
1361 Ga0501279_000007 3300049775 Bacteria 141756
1362 Ga0501280_000284 3300049776 Bacteria 12940
1363 Ga0501281_00155 3300049777 Bacteria 7997
1364 Ga0501035_0000523 3300049822 Bacteria 43259
1365 Ga0501035_0006586 3300049822 Bacteria 10875
1366 Ga0501035_0010086 3300049822 Bacteria 8769
1367 Ga0501035_0011909 3300049822 Bacteria 8049
1368 Ga0501035_0056260 3300049822 Bacteria 3510
1369 Ga0501035_0107764 3300049822 Bacteria 2442
1370 Ga0501044_0000435 3300049823 Bacteria 51516
1371 Ga0501044_0012897 3300049823 Bacteria 9046
1372 Ga0501044_0015397 3300049823 Bacteria 8236
1373 Ga0501044_0074906 3300049823 Bacteria 3437
1374 Ga0501044_0076157 3300049823 Bacteria 3406
1375 Ga0501044_0081364 3300049823 Bacteria 3278
1376 Ga0501044_0083035 3300049823 Bacteria 3240
1377 Ga0501044_0110579 3300049823 Bacteria 2756
1378 Ga0501044_0204578 3300049823 Bacteria 1931
1379 Ga0501044_0206168 3300049823 Bacteria 1922
1380 Ga0501045_0027706 3300049824 Bacteria 4085
1381 nmdc:mga03683_81463_c1 3300050489 Bacteria 1398
1382 nmdc:mga0yw44_33309_c1 3300050492 Bacteria 3009
1383 nmdc:mga0yw44_91919_c1 3300050492 Bacteria 1919
1384 nmdc:mga0k408_14562_c1 3300050493 Bacteria 4337
1385 nmdc:mga0k408_69038_c1 3300050493 Bacteria 1601
1386 nmdc:mga06z11_60341_c1 3300050494 Bacteria 1974
1387 nmdc:mga06z11_85576_c1 3300050494 Bacteria 1701
1388 nmdc:mga07m45_94390_c1 3300050496 Bacteria 1715
1389 nmdc:mga05p37_11853_c1 3300050507 Bacteria 10392
1390 nmdc:mga05p37_347562_c1 3300050507 Bacteria 1747
1391 nmdc:mga05p37_505_c1 3300050507 Bacteria 42970
1392 nmdc:mga0qj67_859_c1 3300050509 Bacteria 20877
1393 nmdc:mga06r32_10551_c1 3300050510 Bacteria 8331
1394 nmdc:mga06r32_225713_c1 3300050510 Bacteria 1861
1395 nmdc:mga06r32_414258_c1 3300050510 Bacteria 1329
1396 nmdc:mga08y16_11105_c1 3300050511 Bacteria 9458
1397 nmdc:mga08y16_66746_c1 3300050511 Bacteria 3755
1398 nmdc:mga08y16_78683_c1 3300050511 Bacteria 3437
1399 nmdc:mga08y16_82852_c1 3300050511 Bacteria 3344
1400 nmdc:mga0n895_13449_c1 3300050512 Bacteria 7384
1401 nmdc:mga0n895_189973_c1 3300050512 Bacteria 2085
1402 nmdc:mga0n895_2584_c1 3300050512 Bacteria 14215
1403 nmdc:mga0n895_3537_c1 3300050512 Bacteria 12632
1404 nmdc:mga0n895_74991_c1 3300050512 Bacteria 1706
1405 nmdc:mga0rr50_1087_c1 3300050513 Bacteria 14763
1406 nmdc:mga0rr50_125753_c1 3300050513 Bacteria 2047
1407 nmdc:mga0rr50_50121_c1 3300050513 Bacteria 3093
1408 nmdc:mga08x19_171419_c1 3300050514 Bacteria 1478
1409 nmdc:mga0a205_1492_c1 3300050515 Bacteria 19963
1410 nmdc:mga0a205_55693_c1 3300050515 Bacteria 3819
1411 nmdc:mga0a205_9612_c1 3300050515 Bacteria 1817
1412 nmdc:mga0sz30_14198_c1 3300050516 Bacteria 3131
1413 nmdc:mga0sz30_16624_c1 3300050516 Bacteria 2924
1414 nmdc:mga0sz30_63339_c2 3300050516 Bacteria 1166
1415 Ga0495601_0000958 3300053077 Bacteria 15765
1416 Ga0495601_0002291 3300053077 Bacteria 10796
1417 Ga0495601_0004285 3300053077 Bacteria 8240
1418 Ga0495601_0004332 3300053077 Bacteria 8198
1419 Ga0495601_0020306 3300053077 Bacteria 4057
1420 Ga0495601_0131025 3300053077 Bacteria 1633
1421 Ga0495601_0217393 3300053077 Bacteria 1248
1422 Ga0495612_0000276 3300053078 Bacteria 21133
1423 Ga0495612_0003620 3300053078 Bacteria 6406
1424 Ga0495612_0006758 3300053078 Bacteria 4698
1425 Ga0495612_0021497 3300053078 Bacteria 2589
1426 Ga0495612_0040437 3300053078 Bacteria 1899
1427 Ga0500635_0009681 3300053080 Bacteria 2681
1428 Ga0495595_0000596 3300053084 Bacteria 13772
1429 Ga0495595_0003189 3300053084 Bacteria 6502
1430 Ga0495619_0000108 3300053085 Bacteria 62197
1431 Ga0495619_0000211 3300053085 Bacteria 42390
1432 Ga0495619_0000763 3300053085 Bacteria 21009
1433 Ga0495619_0005840 3300053085 Bacteria 7799
1434 Ga0495619_0010930 3300053085 Bacteria 5712
1435 Ga0495619_0017139 3300053085 Bacteria 4589
1436 Ga0495619_0020471 3300053085 Bacteria 4213
1437 Ga0495619_0035198 3300053085 Bacteria 3257
1438 Ga0500643_000435 3300053087 Bacteria 31475
1439 Ga0500643_017565 3300053087 Bacteria 2393
1440 Ga0500644_0000896 3300053088 Bacteria 9597
1441 Ga0500644_0020013 3300053088 Bacteria 1983
1442 Ga0500581_163710 3300053089 Bacteria 1029
1443 Ga0500646_0055049 3300053090 Bacteria 1157
1444 Ga0500651_0002754 3300053093 Bacteria 9399
1445 Ga0500651_0006575 3300053093 Bacteria 6713
1446 Ga0500651_0064251 3300053093 Bacteria 2289
1447 Ga0500651_0199738 3300053093 Bacteria 1180
1448 Ga0500566_0000008 3300053094 Bacteria 143641
1449 Ga0500566_0002013 3300053094 Bacteria 11994
1450 Ga0500566_0003961 3300053094 Bacteria 8834
1451 Ga0500566_0019250 3300053094 Bacteria 4008
1452 Ga0500566_0064905 3300053094 Bacteria 2060
1453 Ga0500640_000516 3300053095 Bacteria 9691
1454 Ga0500641_0009748 3300053096 Bacteria 3456
1455 Ga0500641_0087286 3300053096 Bacteria 1329
1456 Ga0500641_0124741 3300053096 Bacteria 1110
1457 Ga0500650_0042653 3300053098 Bacteria 2096
1458 Ga0500650_0048886 3300053098 Bacteria 1962
1459 Ga0500556_0000202 3300053104 Bacteria 48694
1460 Ga0500557_000029 3300053105 Bacteria 77152
1461 Ga0500562_005821 3300053108 Bacteria 3102
1462 Ga0500562_040435 3300053108 Bacteria 1239
1463 Ga0500572_000056 3300053111 Bacteria 34105
1464 Ga0500572_020679 3300053111 Bacteria 1734
1465 Ga0500592_001569 3300053116 Bacteria 3695
1466 Ga0500594_0007592 3300053118 Bacteria 2456
1467 Ga0500595_000002 3300053119 Bacteria 1074388
1468 Ga0500595_000726 3300053119 Bacteria 19589
1469 Ga0500595_010613 3300053119 Bacteria 3651
1470 Ga0500595_020648 3300053119 Bacteria 2366
1471 Ga0500597_149433 3300053120 Bacteria 1003
1472 Ga0500607_121585 3300053121 Bacteria 1261
1473 Ga0500608_003325 3300053122 Bacteria 6009
1474 Ga0500608_037225 3300053122 Bacteria 2324
1475 Ga0500614_003782 3300053123 Bacteria 3242
1476 Ga0500621_069030 3300053126 Bacteria 1426
1477 Ga0500642_0000005 3300053130 Bacteria 422725
1478 Ga0500642_0000333 3300053130 Bacteria 16200
1479 Ga0500652_001078 3300053131 Bacteria 8837
1480 Ga0500559_0000423 3300053136 Bacteria 30084
1481 Ga0500559_0000533 3300053136 Bacteria 26526
1482 Ga0500559_0002351 3300053136 Bacteria 9883
1483 Ga0500564_076426 3300053138 Bacteria 1505
1484 Ga0500568_0000865 3300053139 Bacteria 21243
1485 Ga0500568_0004261 3300053139 Bacteria 7685
1486 Ga0500568_0073081 3300053139 Bacteria 1310
1487 Ga0500577_0000330 3300053142 Bacteria 12272
1488 Ga0500590_063262 3300053148 Bacteria 1855
1489 Ga0500590_111389 3300053148 Bacteria 1298
1490 Ga0500603_000104 3300053150 Bacteria 19878
1491 Ga0500603_001908 3300053150 Bacteria 4646
1492 Ga0500604_0024547 3300053151 Bacteria 1726
1493 Ga0500616_0000002 3300053153 Bacteria 1611257
1494 Ga0500616_0000166 3300053153 Bacteria 110141
1495 Ga0500616_0000180 3300053153 Bacteria 106053
1496 Ga0500616_0006540 3300053153 Bacteria 7614
1497 Ga0500616_0046615 3300053153 Bacteria 2304
1498 Ga0500622_0001180 3300053156 Bacteria 21555
1499 Ga0500622_0016125 3300053156 Bacteria 3996
1500 Ga0500630_013996 3300053159 Bacteria 3949
1501 Ga0500638_001215 3300053162 Bacteria 7810
1502 Ga0500639_000010 3300053163 Bacteria 136747
1503 Ga0500639_016510 3300053163 Bacteria 3894
1504 Ga0500636_0000112 3300053177 Bacteria 42041
1505 Ga0500636_0000753 3300053177 Bacteria 17452
1506 Ga0500636_0094752 3300053177 Bacteria 1705
1507 Ga0500637_0016014 3300053178 Bacteria 3989
1508 Ga0500611_003002 3300053727 Bacteria 2105
1509 Ga0500645_000012 3300053730 Bacteria 168579
1510 Ga0500645_013885 3300053730 Bacteria 2576
1511 Ga0500645_016971 3300053730 Bacteria 2287
1512 Ga0500645_020131 3300053730 Bacteria 2069
1513 Ga0500609_001787 3300053731 Bacteria 3118
1514 Ga0500596_001607 3300053735 Bacteria 4581
1515 Ga0500596_008194 3300053735 Bacteria 1674
1516 Ga0500601_001269 3300053737 Bacteria 2799
1517 Ga0501084_0003243 3300054114 Bacteria 13169
1518 Ga0501084_0057636 3300054114 Bacteria 3250
1519 Ga0501082_0000008 3300060353 Bacteria 125977
1520 Ga0501082_0008505 3300060353 Bacteria 8847
1521 Ga0501082_0017509 3300060353 Bacteria 6174
1522 Ga0501082_0093156 3300060353 Bacteria 2603
1523 Ga0501082_0111143 3300060353 Bacteria 2372
1524 Ga0530510_0381959 3300061734 Bacteria 1060

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035172 Ga0373955_0085117 Ga0373955_0085117_498_1421 277
2 3300005436 Ga0070713_100020625 Ga0070713_1000206255 281
3 3300005466 Ga0070685_10141807 Ga0070685_101418072 281
4 3300006358 Ga0068871_100074517 Ga0068871_1000745172 281
5 3300025915 Ga0207693_10029113 Ga0207693_100291134 281
6 3300025928 Ga0207700_10196813 Ga0207700_101968132 281
7 3300035117 Ga0373953_0010918 Ga0373953_0010918_2151_3110 281
8 3300035118 Ga0373954_0032596 Ga0373954_0032596_175_1134 281
9 3300035172 Ga0373955_0022067 Ga0373955_0022067_2011_2970 281
10 3300035410 Ga0373924_0002965 Ga0373924_0002965_895_1854 281
11 3300035724 Ga0373933_0004299 Ga0373933_0004299_485_1444 281
12 3300046462 Ga0495651_0026260 Ga0495651_0026260_1415_2374 281
13 3300046463 Ga0495653_0016213 Ga0495653_0016213_2956_3915 281
14 3300046511 Ga0495608_0054453 Ga0495608_0054453_1110_2069 281
15 3300046514 Ga0495618_0015542 Ga0495618_0015542_316_1275 281
16 3300046516 Ga0495628_0010246 Ga0495628_0010246_4769_5728 281
17 3300046533 Ga0495640_0039086 Ga0495640_0039086_2130_3089 281
18 3300046536 Ga0495587_0002521 Ga0495587_0002521_139_1098 281
19 3300046543 Ga0495645_0002657 Ga0495645_0002657_6295_7254 281
20 3300046559 Ga0495667_0002603 Ga0495667_0002603_6148_7107 281
21 3300046663 Ga0495635_0012601 Ga0495635_0012601_2128_3087 281
22 3300046675 Ga0495657_0012670 Ga0495657_0012670_3985_4944 281
23 3300046679 Ga0495623_0061095 Ga0495623_0061095_949_1908 281
24 3300046680 Ga0495646_0006855 Ga0495646_0006855_5819_6778 281
25 3300047317 Ga0495604_0011991 Ga0495604_0011991_113_1072 281
26 3300047319 Ga0495674_0049830 Ga0495674_0049830_2036_2995 281
27 3300047322 Ga0495680_0006209 Ga0495680_0006209_2762_3721 281
28 3300047471 Ga0495684_0041830 Ga0495684_0041830_492_1451 281
29 3300048088 Ga0495602_0007000 Ga0495602_0007000_5660_6619 281
30 3300048910 Ga0496107_0079230 Ga0496107_0079230_1121_2080 281
31 3300048911 Ga0496108_0018809 Ga0496108_0018809_1070_2029 281
32 3300053077 Ga0495601_0004285 Ga0495601_0004285_6707_7666 281
33 3300053078 Ga0495612_0003620 Ga0495612_0003620_4745_5704 281
34 3300053085 Ga0495619_0005840 Ga0495619_0005840_634_1593 281
35 3300028556 Ga0265337_1000401 Ga0265337_100040117 284
36 3300005434 Ga0070709_10154832 Ga0070709_101548321 285
37 3300026088 Ga0207641_10353218 Ga0207641_103532181 285
38 3300005436 Ga0070713_100046727 Ga0070713_1000467272 288
39 3300006028 Ga0070717_10045951 Ga0070717_100459512 288
40 3300046463 Ga0495653_0121798 Ga0495653_0121798_456_1415 288
41 3300046663 Ga0495635_0128831 Ga0495635_0128831_385_1344 288
42 3300047317 Ga0495604_0260303 Ga0495604_0260303_69_1028 288
43 3300048088 Ga0495602_0115137 Ga0495602_0115137_57_1016 288
44 3300050515 nmdc:mga0a205_9612_c1 nmdc:mga0a205_9612_c1_934_1800 288
45 3300053077 Ga0495601_0004332 Ga0495601_0004332_4801_5760 288
46 3300053085 Ga0495619_0000108 Ga0495619_0000108_8703_9662 288
47 3300005337 Ga0070682_100082911 Ga0070682_1000829112 289
48 3300005339 Ga0070660_100109288 Ga0070660_1001092882 289
49 3300005366 Ga0070659_100139609 Ga0070659_1001396092 289
50 3300005457 Ga0070662_100007650 Ga0070662_1000076502 289
51 3300005458 Ga0070681_10146358 Ga0070681_101463582 289
52 3300005545 Ga0070695_100044161 Ga0070695_1000441612 289
53 3300005547 Ga0070693_100061633 Ga0070693_1000616332 289
54 3300005615 Ga0070702_100173279 Ga0070702_1001732791 289
55 3300006173 Ga0070716_100067042 Ga0070716_1000670422 289
56 3300014968 Ga0157379_10092162 Ga0157379_100921622 289
57 3300025912 Ga0207707_10012718 Ga0207707_100127184 289
58 3300025919 Ga0207657_10060032 Ga0207657_100600323 289
59 3300025933 Ga0207706_10001913 Ga0207706_1000191317 289
60 3300025939 Ga0207665_10073614 Ga0207665_100736143 289
61 3300026067 Ga0207678_10024197 Ga0207678_100241976 289
62 3300035091 Ga0373951_0012273 Ga0373951_0012273_112_1038 289
63 3300035115 Ga0373941_0068864 Ga0373941_0068864_44_970 289
64 3300035118 Ga0373954_0050234 Ga0373954_0050234_767_1693 289
65 3300048905 Ga0496102_0275381 Ga0496102_0275381_333_1259 289
66 3300048909 Ga0496106_0308532 Ga0496106_0308532_279_1205 289
67 3300053085 Ga0495619_0035198 Ga0495619_0035198_1884_2810 289
68 iso_pu_bacteria 2879127579 2879130532 300
69 3300035118 Ga0373954_0001018 Ga0373954_0001018_2634_3539 301
70 3300035119 Ga0373956_0006210 Ga0373956_0006210_1392_2297 301
71 3300035410 Ga0373924_0015542 Ga0373924_0015542_1248_2153 301
72 3300035724 Ga0373933_0007968 Ga0373933_0007968_3710_4615 301
73 3300036401 Ga0373937_0053653 Ga0373937_0053653_1432_2337 301
74 3300046454 Ga0495592_0001464 Ga0495592_0001464_2723_3628 301
75 3300046463 Ga0495653_0047920 Ga0495653_0047920_1133_2038 301
76 3300046511 Ga0495608_0044163 Ga0495608_0044163_1336_2241 301
77 3300046533 Ga0495640_0028769 Ga0495640_0028769_720_1625 301
78 3300046642 Ga0495634_0028175 Ga0495634_0028175_161_1066 301
79 3300046663 Ga0495635_0000534 Ga0495635_0000534_20932_21837 301
80 3300046675 Ga0495657_0013808 Ga0495657_0013808_3833_4738 301
81 3300046679 Ga0495623_0013899 Ga0495623_0013899_3466_4371 301
82 3300047317 Ga0495604_0007158 Ga0495604_0007158_6045_6950 301
83 3300047322 Ga0495680_0008847 Ga0495680_0008847_4219_5124 301
84 3300047444 Ga0495675_0013658 Ga0495675_0013658_1426_2331 301
85 3300047471 Ga0495684_0001012 Ga0495684_0001012_1133_2038 301
86 3300053085 Ga0495619_0010930 Ga0495619_0010930_1721_2626 301
87 3300032005 Ga0307411_10241280 Ga0307411_102412802 302
88 3300060353 Ga0501082_0093156 Ga0501082_0093156_78_986 302
89 iso_pu_bacteria 2602042107 2603862639 302
90 iso_pu_bacteria 2857524615 2857529988 302
91 iso_pu_bacteria 2893066018 2893071088 302
92 iso_pu_bacteria 2919073203 2919077159 302
93 3300005718 Ga0068866_10079022 Ga0068866_100790222 303
94 iso_pu_bacteria 2507262055 2507510984 303
95 iso_pu_bacteria 2508501009 2508544804 303
96 iso_pu_bacteria 2508501042 2508696970 303
97 iso_pu_bacteria 2508501128 2509148853 303
98 iso_pu_bacteria 2511231028 2511394106 303
99 iso_pu_bacteria 2513237092 2513623461 303
100 iso_pu_bacteria 2513237094 2513637499 303
101 iso_pu_bacteria 2513237095 2513649659 303
102 iso_pu_bacteria 2513237096 2513654995 303
103 iso_pu_bacteria 2513237098 2513679532 303
104 iso_pu_bacteria 2513237102 2513701429 303
105 iso_pu_bacteria 2513237104 2513716893 303
106 iso_pu_bacteria 2513237137 2513861015 303
107 iso_pu_bacteria 2513237139 2513874629 303
108 iso_pu_bacteria 2513237141 2513892060 303
109 iso_pu_bacteria 2513237145 2513915982 303
110 iso_pu_bacteria 2513237161 2514017569 303
111 iso_pu_bacteria 2515154112 2515625464 303
112 iso_pu_bacteria 2517093001 2517100567 303
113 iso_pu_bacteria 2517572143 2517894717 303
114 iso_pu_bacteria 2524023205 2524438211 303
115 iso_pu_bacteria 2524023210 2524464047 303
116 iso_pu_bacteria 2524023228 2524534466 303
117 iso_pu_bacteria 2528768022 2528849843 303
118 iso_pu_bacteria 2582581280 2585153989 303
119 iso_pu_bacteria 2582581293 2585194982 303
120 iso_pu_bacteria 2617270735 2617350753 303
121 iso_pu_bacteria 2643221552 2643780728 303
122 iso_pu_bacteria 2643221584 2643930018 303
123 iso_pu_bacteria 2667528175 2671119130 303
124 iso_pu_bacteria 2728368998 2728747628 303
125 iso_pu_bacteria 2744054633 2745076906 303
126 iso_pu_bacteria 2791355196 2793064637 303
127 iso_pu_bacteria 2791355197 2793071193 303
128 iso_pu_bacteria 2802429603 2805916626 303
129 iso_pu_bacteria 2816332527 2818238130 303
130 iso_pu_bacteria 2818991435 2819536098 303
131 iso_pu_bacteria 2818991454 2819644491 303
132 iso_pu_bacteria 2824600985 2824607984 303
133 iso_pu_bacteria 2824609381 2824616521 303
134 iso_pu_bacteria 2824617872 2824624677 303
135 iso_pu_bacteria 2824626560 2824633288 303
136 iso_pu_bacteria 2824635225 2824640640 303
137 iso_pu_bacteria 2824644064 2824649832 303
138 iso_pu_bacteria 2824653114 2824657823 303
139 iso_pu_bacteria 2824661429 2824670061 303
140 iso_pu_bacteria 2824671348 2824677254 303
141 iso_pu_bacteria 2824679649 2824683863 303
142 iso_pu_bacteria 2824687955 2824693688 303
143 iso_pu_bacteria 2824696289 2824702240 303
144 iso_pu_bacteria 2824704595 2824714338 303
145 iso_pu_bacteria 2824714736 2824720090 303
146 iso_pu_bacteria 2824723954 2824728492 303
147 iso_pu_bacteria 2824732956 2824737054 303
148 iso_pu_bacteria 2824753945 2824761837 303
149 iso_pu_bacteria 2824763712 2824772281 303
150 iso_pu_bacteria 2824773399 2824780829 303
151 iso_pu_bacteria 2838122688 2838127873 303
152 iso_pu_bacteria 2841941048 2841943166 303
153 iso_pu_bacteria 2841949485 2841956187 303
154 iso_pu_bacteria 2841957949 2841960244 303
155 iso_pu_bacteria 2841966195 2841968193 303
156 iso_pu_bacteria 2841974524 2841976596 303
157 iso_pu_bacteria 2841983080 2841987970 303
158 iso_pu_bacteria 2842038055 2842042727 303
159 iso_pu_bacteria 2842045827 2842050770 303
160 iso_pu_bacteria 2844315083 2844316940 303
161 iso_pu_bacteria 2847930680 2847938541 303
162 iso_pu_bacteria 2847939898 2847944260 303
163 iso_pu_bacteria 2849076700 2849081506 303
164 iso_pu_bacteria 2857509624 2857512167 303
165 iso_pu_bacteria 2874590934 2874597721 303
166 iso_pu_bacteria 2874612657 2874615793 303
167 iso_pu_bacteria 2874620515 2874623459 303
168 iso_pu_bacteria 2874628541 2874630631 303
169 iso_pu_bacteria 2874645413 2874651251 303
170 iso_pu_bacteria 2876761206 2876762430 303
171 iso_pu_bacteria 2876771140 2876776321 303
172 iso_pu_bacteria 2876818435 2876820889 303
173 iso_pu_bacteria 2879074833 2879081816 303
174 iso_pu_bacteria 2879083081 2879086215 303
175 iso_pu_bacteria 2879099564 2879101680 303
176 iso_pu_bacteria 2879142872 2879146418 303
177 iso_pu_bacteria 2881364244 2881370657 303
178 iso_pu_bacteria 2881665667 2881672708 303
179 iso_pu_bacteria 2885366525 2885366958 303
180 iso_pu_bacteria 2885374607 2885383332 303
181 iso_pu_bacteria 2885409591 2885413455 303
182 iso_pu_bacteria 2888378607 2888381551 303
183 iso_pu_bacteria 2888388044 2888389090 303
184 iso_pu_bacteria 2888419890 2888421950 303
185 iso_pu_bacteria 2903727486 2903733990 303
186 iso_pu_bacteria 2903748898 2903751401 303
187 iso_pu_bacteria 2903768456 2903777036 303
188 iso_pu_bacteria 2904666416 2904667310 303
189 iso_pu_bacteria 2904690495 2904696950 303
190 iso_pu_bacteria 2904699407 2904705761 303
191 iso_pu_bacteria 2904711408 2904719197 303
192 iso_pu_bacteria 2906602504 2906604606 303
193 iso_pu_bacteria 2906610324 2906611440 303
194 iso_pu_bacteria 2906626472 2906629300 303
195 iso_pu_bacteria 2906635258 2906640994 303
196 iso_pu_bacteria 2906643746 2906651546 303
197 iso_pu_bacteria 2906660503 2906660827 303
198 iso_pu_bacteria 2908739725 2908745028 303
199 iso_pu_bacteria 2908756301 2908757203 303
200 iso_pu_bacteria 2908775508 2908782088 303
201 iso_pu_bacteria 2922368715 2922371216 303
202 iso_pu_bacteria 2922393267 2922393847 303
203 iso_pu_bacteria 2922425934 2922427917 303
204 iso_pu_bacteria 2929615660 2929619601 303
205 iso_pu_bacteria 2929624759 2929627929 303
206 iso_pu_bacteria 2932784394 2932785930 303
207 iso_pu_bacteria 2932794094 2932798286 303
208 iso_pu_bacteria 2932801729 2932804082 303
209 iso_pu_bacteria 2932809354 2932817302 303
210 iso_pu_bacteria 2932818245 2932826899 303
211 iso_pu_bacteria 2932828146 2932830974 303
212 iso_pu_bacteria 2933577622 2933581521 303
213 iso_pu_bacteria 2935608549 2935612779 303
214 iso_pu_bacteria 2935616580 2935621039 303
215 iso_pu_bacteria 2935630451 2935632151 303
216 iso_pu_bacteria 2935638405 2935640115 303
217 iso_pu_bacteria 2935648319 2935655426 303
218 iso_pu_bacteria 2935656913 2935664273 303
219 iso_pu_bacteria 2935665750 2935667046 303
220 iso_pu_bacteria 2935675223 2935680310 303
221 iso_pu_bacteria 2935684952 2935690178 303
222 iso_pu_bacteria 2935694250 2935699736 303
223 iso_pu_bacteria 2935703347 2935704802 303
224 iso_pu_bacteria 2935713505 2935718126 303
225 iso_pu_bacteria 2935722832 2935726724 303
226 iso_pu_bacteria 2935732158 2935735493 303
227 iso_pu_bacteria 2935741537 2935745236 303
228 iso_pu_bacteria 2935750917 2935755189 303
229 iso_pu_bacteria 2935760218 2935762295 303
230 iso_pu_bacteria 2935769743 2935773689 303
231 iso_pu_bacteria 2935777560 2935780241 303
232 iso_pu_bacteria 2935785616 2935788406 303
233 iso_pu_bacteria 2935793552 2935796563 303
234 iso_pu_bacteria 2935801545 2935803796 303
235 iso_pu_bacteria 2935810662 2935811713 303
236 iso_pu_bacteria 2935819856 2935824269 303
237 iso_pu_bacteria 2935827899 2935829598 303
238 iso_pu_bacteria 2935837841 2935843068 303
239 iso_pu_bacteria 2935847175 2935852585 303
240 iso_pu_bacteria 2935855204 2935858846 303
241 iso_pu_bacteria 2935864058 2935866756 303
242 iso_pu_bacteria 2935873716 2935876887 303
243 iso_pu_bacteria 2935883170 2935884112 303
244 iso_pu_bacteria 2935908558 2935912268 303
245 iso_pu_bacteria 2935916978 2935924058 303
246 iso_pu_bacteria 2935926038 2935929297 303
247 iso_pu_bacteria 2935934488 2935935928 303
248 iso_pu_bacteria 2935942939 2935950436 303
249 iso_pu_bacteria 2935951376 2935957406 303
250 iso_pu_bacteria 2935959822 2935962066 303
251 iso_pu_bacteria 2935967501 2935968437 303
252 iso_pu_bacteria 2935975950 2935976625 303
253 iso_pu_bacteria 2935984226 2935987931 303
254 iso_pu_bacteria 2935992306 2935993476 303
255 iso_pu_bacteria 2936002035 2936004371 303
256 iso_pu_bacteria 2936011229 2936018343 303
257 iso_pu_bacteria 2936019824 2936026894 303
258 iso_pu_bacteria 2936028420 2936035742 303
259 iso_pu_bacteria 2936037263 2936038295 303
260 iso_pu_bacteria 2936046547 2936053821 303
261 iso_pu_bacteria 2936055302 2936058635 303
262 iso_pu_bacteria 2940556831 2940561531 303
263 iso_pu_bacteria 2941507105 2941508099 303
264 iso_pu_bacteria 2941515067 2941515396 303
265 iso_pu_bacteria 2941523033 2941524029 303
266 iso_pu_bacteria 2941531003 2941533725 303
267 iso_pu_bacteria 2941538514 2941544292 303
268 iso_pu_bacteria 3005474847 3005477631 303
269 iso_pu_bacteria 3005506211 3005507147 303
270 iso_pu_bacteria 3005587118 3005594514 303
271 iso_pu_bacteria 3005594810 3005596573 303
272 iso_pu_bacteria 3005710791 3005712650 303
273 iso_pu_bacteria 3005718088 3005719701 303
274 iso_pu_bacteria 8006926726 8006931833 303
275 iso_pu_bacteria 8006933436 8006933585 303
276 iso_pu_bacteria 8006973647 8006983258 303
277 iso_pu_bacteria 8016511872 8016516412 303
278 iso_pu_bacteria 8016522445 8016523796 303
279 iso_pu_bacteria 8016530956 8016537328 303
280 iso_pu_bacteria 8016548790 8016551670 303
281 iso_pu_bacteria 8016557553 8016560058 303
282 iso_pu_bacteria 8016566248 8016566981 303
283 iso_pu_bacteria 8016575299 8016579704 303
284 iso_pu_bacteria 8016595262 8016597981 303
285 iso_pu_bacteria 8016603502 8016604112 303
286 iso_pu_bacteria 8016613128 8016620695 303
287 iso_pu_bacteria 8016622563 8016629298 303
288 iso_pu_bacteria 8016630954 8016633819 303
289 iso_pu_bacteria 8017057580 8017060126 303
290 iso_pu_bacteria 8019530166 8019537011 303
291 iso_pu_bacteria 8019538911 8019542520 303
292 iso_pu_bacteria 8019547302 8019548228 303
293 iso_pu_bacteria 8019555841 8019559523 303
294 iso_pu_bacteria 8019565922 8019569625 303
295 iso_pu_bacteria 8019576017 8019579638 303
296 iso_pu_bacteria 8019586578 8019587347 303
297 iso_pu_bacteria 8019597564 8019603994 303
298 iso_pu_bacteria 8019619141 8019625169 303
299 iso_pu_bacteria 8019629233 8019637011 303
300 iso_pu_bacteria 8019648815 8019649994 303
301 iso_pu_bacteria 8019659431 8019664851 303
302 iso_pu_bacteria 8019668869 8019674414 303
303 iso_pu_bacteria 8019678201 8019681692 303
304 iso_pu_bacteria 8019687851 8019694085 303
305 iso_pu_bacteria 8055742211 8055749142 303
306 iso_pu_bacteria 8056681323 8056682408 303
307 iso_pu_bacteria 8056689827 8056695142 303
308 iso_pu_bacteria 8056967851 8056969990 303
309 3300049573 Ga0501037_0015791 Ga0501037_0015791_3670_4584 304
310 iso_pu_bacteria 2585428106 2587919016 304
311 iso_pu_bacteria 2643221560 2643822842 304
312 iso_pu_bacteria 2643221640 2644227572 304
313 iso_pu_bacteria 2643221642 2644236910 304
314 iso_pu_bacteria 2928531327 2928531712 304
315 3300001979 JGI24740J21852_10001722 JGI24740J21852_100017223 305
316 3300001989 JGI24739J22299_10010924 JGI24739J22299_100109242 305
317 3300001989 JGI24739J22299_10050347 JGI24739J22299_100503472 305
318 3300001990 JGI24737J22298_10003780 JGI24737J22298_100037806 305
319 3300002067 JGI24735J21928_10019123 JGI24735J21928_100191232 305
320 3300005439 Ga0070711_100295171 Ga0070711_1002951711 305
321 3300005455 Ga0070663_100045017 Ga0070663_1000450174 305
322 3300005539 Ga0068853_100022528 Ga0068853_1000225285 305
323 3300005577 Ga0068857_100053613 Ga0068857_1000536134 305
324 3300005578 Ga0068854_100027437 Ga0068854_1000274374 305
325 3300005578 Ga0068854_100030387 Ga0068854_1000303873 305
326 3300005614 Ga0068856_100012506 Ga0068856_1000125065 305
327 3300005614 Ga0068856_100015546 Ga0068856_1000155465 305
328 3300005834 Ga0068851_10008009 Ga0068851_100080095 305
329 3300005843 Ga0068860_100000291 Ga0068860_10000029163 305
330 3300009093 Ga0105240_10008489 Ga0105240_100084899 305
331 3300009174 Ga0105241_10008896 Ga0105241_100088965 305
332 3300009545 Ga0105237_10025117 Ga0105237_100251176 305
333 3300009545 Ga0105237_10042051 Ga0105237_100420513 305
334 3300009551 Ga0105238_10003337 Ga0105238_1000333711 305
335 3300009551 Ga0105238_10030700 Ga0105238_100307003 305
336 3300010375 Ga0105239_10024151 Ga0105239_100241514 305
337 3300025904 Ga0207647_10008208 Ga0207647_100082087 305
338 3300025911 Ga0207654_10004616 Ga0207654_100046166 305
339 3300025913 Ga0207695_10000497 Ga0207695_1000049746 305
340 3300025924 Ga0207694_10000571 Ga0207694_100005716 305
341 3300025949 Ga0207667_10007625 Ga0207667_100076257 305
342 3300025949 Ga0207667_10017824 Ga0207667_100178249 305
343 3300025981 Ga0207640_10311113 Ga0207640_103111132 305
344 3300026041 Ga0207639_10025640 Ga0207639_100256403 305
345 3300026078 Ga0207702_10000003 Ga0207702_10000003421 305
346 3300026078 Ga0207702_10042079 Ga0207702_100420792 305
347 3300026116 Ga0207674_10005049 Ga0207674_1000504910 305
348 3300026116 Ga0207674_10007537 Ga0207674_100075377 305
349 3300026142 Ga0207698_10065911 Ga0207698_100659112 305
350 3300028381 Ga0268264_10000093 Ga0268264_1000009391 305
351 3300030521 Ga0307511_10073605 Ga0307511_100736053 305
352 3300031616 Ga0307508_10114972 Ga0307508_101149722 305
353 3300031730 Ga0307516_10018834 Ga0307516_100188345 305
354 3300031730 Ga0307516_10136943 Ga0307516_101369432 305
355 3300033180 Ga0307510_10190883 Ga0307510_101908832 305
356 3300035692 Ga0373935_0093548 Ga0373935_0093548_775_1692 305
357 3300037068 Ga0373925_0106024 Ga0373925_0106024_372_1289 305
358 3300048909 Ga0496106_0001465 Ga0496106_0001465_16157_17074 305
359 3300048909 Ga0496106_0013066 Ga0496106_0013066_347_1264 305
360 3300048910 Ga0496107_0005951 Ga0496107_0005951_6977_7894 305
361 3300048911 Ga0496108_0003684 Ga0496108_0003684_729_1646 305
362 3300048911 Ga0496108_0138139 Ga0496108_0138139_962_1879 305
363 3300048912 Ga0496109_0000361 Ga0496109_0000361_20071_20988 305
364 3300048913 Ga0496110_0039424 Ga0496110_0039424_106_1023 305
365 3300048917 Ga0496114_0307180 Ga0496114_0307180_75_992 305
366 3300048920 Ga0496117_0008447 Ga0496117_0008447_3846_4763 305
367 3300048924 Ga0496121_0000381 Ga0496121_0000381_72357_73274 305
368 3300048927 Ga0496124_0007279 Ga0496124_0007279_5895_6812 305
369 3300048929 Ga0496126_0021093 Ga0496126_0021093_5012_5929 305
370 3300053094 Ga0500566_0064905 Ga0500566_0064905_1005_1922 305
371 3300053153 Ga0500616_0046615 Ga0500616_0046615_451_1368 305
372 3300053735 Ga0500596_008194 Ga0500596_008194_49_966 305
373 3300003771 Ga0055526_1022934 Ga0055526_10229342 306
374 3300005983 Ga0081540_1000390 Ga0081540_100039023 306
375 3300006038 Ga0075365_10028872 Ga0075365_100288722 306
376 3300006038 Ga0075365_10038398 Ga0075365_100383983 306
377 3300006177 Ga0075362_10007719 Ga0075362_100077195 306
378 3300006195 Ga0075366_10004643 Ga0075366_100046435 306
379 3300009101 Ga0105247_10063961 Ga0105247_100639612 306
380 3300009101 Ga0105247_10206795 Ga0105247_102067952 306
381 3300009177 Ga0105248_10388333 Ga0105248_103883332 306
382 3300009551 Ga0105238_10014305 Ga0105238_100143056 306
383 3300013102 Ga0157371_10016826 Ga0157371_100168262 306
384 3300025295 Ga0209564_1000485 Ga0209564_10004855 306
385 3300025297 Ga0209758_1001510 Ga0209758_10015103 306
386 3300025900 Ga0207710_10019353 Ga0207710_100193532 306
387 3300025940 Ga0207691_10156266 Ga0207691_101562662 306
388 3300025941 Ga0207711_10285779 Ga0207711_102857792 306
389 3300025986 Ga0207658_10039104 Ga0207658_100391044 306
390 3300026035 Ga0207703_10127623 Ga0207703_101276232 306
391 3300026035 Ga0207703_10411496 Ga0207703_104114961 306
392 3300028379 Ga0268266_10334645 Ga0268266_103346452 306
393 3300028558 Ga0265326_10014656 Ga0265326_100146562 306
394 3300028563 Ga0265319_1020513 Ga0265319_10205133 306
395 3300028573 Ga0265334_10014240 Ga0265334_100142404 306
396 3300028653 Ga0265323_10001197 Ga0265323_100011975 306
397 3300028666 Ga0265336_10001290 Ga0265336_100012908 306
398 3300028800 Ga0265338_10000328 Ga0265338_1000032848 306
399 3300029957 Ga0265324_10012383 Ga0265324_100123832 306
400 3300034818 Ga0373950_0002953 Ga0373950_0002953_53_1003 306
401 3300038443 Ga0395901_0250401 Ga0395901_0250401_569_1489 306
402 3300039437 Ga0436365_1496755 Ga0436365_1496755_360_1349 306
403 3300046460 Ga0495638_0000011 Ga0495638_0000011_329290_330228 306
404 3300046460 Ga0495638_0107859 Ga0495638_0107859_118_1038 306
405 3300046501 Ga0495607_0149737 Ga0495607_0149737_177_1097 306
406 3300046506 Ga0495583_0000242 Ga0495583_0000242_81604_82542 306
407 3300046512 Ga0495610_0037940 Ga0495610_0037940_1074_1994 306
408 3300046515 Ga0495620_0039614 Ga0495620_0039614_516_1436 306
409 3300046519 Ga0495632_0000638 Ga0495632_0000638_24130_25068 306
410 3300046524 Ga0495648_0000023 Ga0495648_0000023_127010_127948 306
411 3300046524 Ga0495648_0001628 Ga0495648_0001628_10063_10983 306
412 3300046557 Ga0495622_0043754 Ga0495622_0043754_395_1315 306
413 3300046558 Ga0495633_0005929 Ga0495633_0005929_1565_2503 306
414 3300046692 Ga0495671_0000012 Ga0495671_0000012_104252_105190 306
415 3300046810 Ga0495660_0078731 Ga0495660_0078731_779_1699 306
416 3300047320 Ga0495672_0004036 Ga0495672_0004036_754_1674 306
417 3300047320 Ga0495672_0119074 Ga0495672_0119074_217_1137 306
418 3300047469 Ga0495673_0000029 Ga0495673_0000029_253443_254381 306
419 3300047472 Ga0495686_0095766 Ga0495686_0095766_865_1785 306
420 3300048091 Ga0495626_0065051 Ga0495626_0065051_350_1270 306
421 3300048904 Ga0496101_0122894 Ga0496101_0122894_1021_1941 306
422 3300048907 Ga0496104_0163695 Ga0496104_0163695_843_1796 306
423 3300048908 Ga0496105_0135683 Ga0496105_0135683_33_986 306
424 3300048919 Ga0496116_0003172 Ga0496116_0003172_2584_3504 306
425 3300048920 Ga0496117_0021988 Ga0496117_0021988_1441_2361 306
426 3300048920 Ga0496117_0129765 Ga0496117_0129765_461_1381 306
427 3300048921 Ga0496118_0054949 Ga0496118_0054949_509_1429 306
428 3300048922 Ga0496119_0067340 Ga0496119_0067340_267_1187 306
429 3300048923 Ga0496120_0066833 Ga0496120_0066833_955_1875 306
430 3300048924 Ga0496121_0012055 Ga0496121_0012055_368_1288 306
431 3300048924 Ga0496121_0025417 Ga0496121_0025417_3994_4914 306
432 3300048926 Ga0496123_0101798 Ga0496123_0101798_589_1509 306
433 3300048927 Ga0496124_0381178 Ga0496124_0381178_19_939 306
434 3300048928 Ga0496125_0000654 Ga0496125_0000654_54674_55594 306
435 3300048928 Ga0496125_0001646 Ga0496125_0001646_12767_13687 306
436 3300048928 Ga0496125_0037567 Ga0496125_0037567_2972_3892 306
437 3300048928 Ga0496125_0099925 Ga0496125_0099925_100_1020 306
438 3300048929 Ga0496126_0005477 Ga0496126_0005477_8810_9730 306
439 3300048929 Ga0496126_0014823 Ga0496126_0014823_1684_2604 306
440 3300049568 Ga0501031_0017863 Ga0501031_0017863_1349_2269 306
441 3300049568 Ga0501031_0074919 Ga0501031_0074919_400_1320 306
442 3300049569 Ga0501032_0000269 Ga0501032_0000269_34913_35833 306
443 3300049569 Ga0501032_0011788 Ga0501032_0011788_3433_4353 306
444 3300049569 Ga0501032_0092312 Ga0501032_0092312_334_1254 306
445 3300049570 Ga0501033_0000249 Ga0501033_0000249_341_1261 306
446 3300049570 Ga0501033_0007545 Ga0501033_0007545_3388_4308 306
447 3300049570 Ga0501033_0022581 Ga0501033_0022581_1578_2498 306
448 3300049571 Ga0501034_0000039 Ga0501034_0000039_3911_4831 306
449 3300049571 Ga0501034_0042660 Ga0501034_0042660_1304_2224 306
450 3300049571 Ga0501034_0058977 Ga0501034_0058977_1047_1967 306
451 3300049571 Ga0501034_0205154 Ga0501034_0205154_760_1680 306
452 3300049571 Ga0501034_0450712 Ga0501034_0450712_255_1175 306
453 3300049572 Ga0501036_0000899 Ga0501036_0000899_1363_2283 306
454 3300049572 Ga0501036_0046557 Ga0501036_0046557_1228_2148 306
455 3300049572 Ga0501036_0179267 Ga0501036_0179267_494_1414 306
456 3300049573 Ga0501037_0000112 Ga0501037_0000112_1804_2724 306
457 3300049573 Ga0501037_0021022 Ga0501037_0021022_1519_2439 306
458 3300049573 Ga0501037_0053072 Ga0501037_0053072_818_1738 306
459 3300049574 Ga0501038_0000727 Ga0501038_0000727_21553_22473 306
460 3300049574 Ga0501038_0013255 Ga0501038_0013255_3684_4604 306
461 3300049574 Ga0501038_0017301 Ga0501038_0017301_5263_6183 306
462 3300049574 Ga0501038_0028682 Ga0501038_0028682_2948_3868 306
463 3300049574 Ga0501038_0220246 Ga0501038_0220246_372_1292 306
464 3300049574 Ga0501038_0323811 Ga0501038_0323811_49_969 306
465 3300049575 Ga0501039_0024000 Ga0501039_0024000_3468_4388 306
466 3300049576 Ga0501040_0008040 Ga0501040_0008040_4225_5145 306
467 3300049578 Ga0501042_0030617 Ga0501042_0030617_69_989 306
468 3300049578 Ga0501042_0051603 Ga0501042_0051603_840_1760 306
469 3300049579 Ga0501043_0004641 Ga0501043_0004641_8410_9330 306
470 3300049579 Ga0501043_0018381 Ga0501043_0018381_698_1618 306
471 3300049579 Ga0501043_0124807 Ga0501043_0124807_41_961 306
472 3300049579 Ga0501043_0141018 Ga0501043_0141018_516_1436 306
473 3300049580 Ga0501046_0006020 Ga0501046_0006020_8633_9553 306
474 3300049580 Ga0501046_0037594 Ga0501046_0037594_884_1804 306
475 3300049581 Ga0501047_0002128 Ga0501047_0002128_16472_17392 306
476 3300049581 Ga0501047_0114372 Ga0501047_0114372_695_1615 306
477 3300049581 Ga0501047_0133657 Ga0501047_0133657_555_1475 306
478 3300049582 Ga0501048_0000677 Ga0501048_0000677_18413_19333 306
479 3300049582 Ga0501048_0024279 Ga0501048_0024279_2128_3048 306
480 3300049583 Ga0501067_0003780 Ga0501067_0003780_1754_2674 306
481 3300049583 Ga0501067_0005792 Ga0501067_0005792_1656_2576 306
482 3300049584 Ga0501068_0021310 Ga0501068_0021310_859_1779 306
483 3300049584 Ga0501068_0041830 Ga0501068_0041830_46_966 306
484 3300049585 Ga0501069_0005343 Ga0501069_0005343_421_1341 306
485 3300049585 Ga0501069_0018370 Ga0501069_0018370_1972_2892 306
486 3300049586 Ga0501070_0071480 Ga0501070_0071480_75_995 306
487 3300049586 Ga0501070_0087502 Ga0501070_0087502_1577_2497 306
488 3300049587 Ga0501071_0044143 Ga0501071_0044143_555_1475 306
489 3300049587 Ga0501071_0085263 Ga0501071_0085263_28_948 306
490 3300049588 Ga0501072_0078654 Ga0501072_0078654_906_1826 306
491 3300049589 Ga0501073_0000103 Ga0501073_0000103_45206_46126 306
492 3300049589 Ga0501073_0011859 Ga0501073_0011859_2007_2927 306
493 3300049589 Ga0501073_0129940 Ga0501073_0129940_369_1289 306
494 3300049590 Ga0501074_0000203 Ga0501074_0000203_7965_8885 306
495 3300049590 Ga0501074_0015716 Ga0501074_0015716_1720_2640 306
496 3300049741 Ga0501079_0009511 Ga0501079_0009511_1686_2606 306
497 3300049741 Ga0501079_0099424 Ga0501079_0099424_1174_2094 306
498 3300049742 Ga0501080_0002271 Ga0501080_0002271_7785_8705 306
499 3300049742 Ga0501080_0102862 Ga0501080_0102862_912_1832 306
500 3300049742 Ga0501080_0361282 Ga0501080_0361282_244_1164 306
501 3300049744 Ga0501083_0001959 Ga0501083_0001959_11445_12365 306
502 3300049744 Ga0501083_0027454 Ga0501083_0027454_1304_2224 306
503 3300049822 Ga0501035_0000523 Ga0501035_0000523_10653_11573 306
504 3300049822 Ga0501035_0056260 Ga0501035_0056260_1130_2050 306
505 3300049822 Ga0501035_0107764 Ga0501035_0107764_1227_2147 306
506 3300049823 Ga0501044_0000435 Ga0501044_0000435_18783_19703 306
507 3300049823 Ga0501044_0012897 Ga0501044_0012897_3914_4834 306
508 3300049823 Ga0501044_0081364 Ga0501044_0081364_781_1701 306
509 3300049823 Ga0501044_0083035 Ga0501044_0083035_381_1301 306
510 3300049823 Ga0501044_0204578 Ga0501044_0204578_798_1718 306
511 3300049824 Ga0501045_0027706 Ga0501045_0027706_1175_2095 306
512 3300050492 nmdc:mga0yw44_33309_c1 nmdc:mga0yw44_33309_c1_957_1877 306
513 3300050493 nmdc:mga0k408_14562_c1 nmdc:mga0k408_14562_c1_1026_1946 306
514 3300050496 nmdc:mga07m45_94390_c1 nmdc:mga07m45_94390_c1_682_1602 306
515 3300050516 nmdc:mga0sz30_14198_c1 nmdc:mga0sz30_14198_c1_223_1143 306
516 3300053088 Ga0500644_0020013 Ga0500644_0020013_317_1237 306
517 3300053089 Ga0500581_163710 Ga0500581_163710_64_984 306
518 3300053090 Ga0500646_0055049 Ga0500646_0055049_124_1044 306
519 3300053093 Ga0500651_0002754 Ga0500651_0002754_6106_7026 306
520 3300053093 Ga0500651_0064251 Ga0500651_0064251_1158_2078 306
521 3300053093 Ga0500651_0199738 Ga0500651_0199738_161_1081 306
522 3300053094 Ga0500566_0019250 Ga0500566_0019250_2965_3885 306
523 3300053096 Ga0500641_0124741 Ga0500641_0124741_145_1065 306
524 3300053098 Ga0500650_0042653 Ga0500650_0042653_794_1714 306
525 3300053104 Ga0500556_0000202 Ga0500556_0000202_23274_24194 306
526 3300053108 Ga0500562_040435 Ga0500562_040435_69_989 306
527 3300053116 Ga0500592_001569 Ga0500592_001569_1638_2558 306
528 3300053119 Ga0500595_010613 Ga0500595_010613_425_1345 306
529 3300053122 Ga0500608_003325 Ga0500608_003325_1319_2239 306
530 3300053130 Ga0500642_0000005 Ga0500642_0000005_57410_58330 306
531 3300053131 Ga0500652_001078 Ga0500652_001078_1790_2710 306
532 3300053136 Ga0500559_0000533 Ga0500559_0000533_19686_20606 306
533 3300053139 Ga0500568_0000865 Ga0500568_0000865_10472_11392 306
534 3300053142 Ga0500577_0000330 Ga0500577_0000330_2301_3221 306
535 3300053148 Ga0500590_063262 Ga0500590_063262_571_1491 306
536 3300053151 Ga0500604_0024547 Ga0500604_0024547_197_1117 306
537 3300053153 Ga0500616_0000166 Ga0500616_0000166_55017_55994 306
538 3300053153 Ga0500616_0000180 Ga0500616_0000180_47967_48887 306
539 3300053156 Ga0500622_0001180 Ga0500622_0001180_9110_10030 306
540 3300053177 Ga0500636_0000753 Ga0500636_0000753_13692_14612 306
541 3300053727 Ga0500611_003002 Ga0500611_003002_725_1645 306
542 3300053730 Ga0500645_016971 Ga0500645_016971_55_975 306
543 3300054114 Ga0501084_0003243 Ga0501084_0003243_1794_2714 306
544 3300054114 Ga0501084_0057636 Ga0501084_0057636_1110_2030 306
545 3300060353 Ga0501082_0008505 Ga0501082_0008505_1758_2678 306
546 3300060353 Ga0501082_0017509 Ga0501082_0017509_3340_4260 306
547 iso_pu_bacteria 2721755755 2723843099 306
548 iso_pu_bacteria 2876808645 2876813739 306
549 iso_pu_bacteria 2879110137 2879118011 306
550 iso_pu_bacteria 8006964411 8006966505 306
551 iso_pu_bacteria 8006984368 8006989333 306
552 3300002067 JGI24735J21928_10055274 JGI24735J21928_100552741 307
553 3300003203 JGI25406J46586_10000417 JGI25406J46586_1000041716 307
554 3300003214 JGI25165J46597_1004090 JGI25165J46597_10040903 307
555 3300003215 JGI25153J46596_10000758 JGI25153J46596_1000075820 307
556 3300003215 JGI25153J46596_10003729 JGI25153J46596_100037299 307
557 3300003215 JGI25153J46596_10014037 JGI25153J46596_100140374 307
558 3300003794 Ga0055531_10006207 Ga0055531_100062072 307
559 3300004625 Ga0055543_1002634 Ga0055543_10026342 307
560 3300005262 Ga0065165_1003855 Ga0065165_10038552 307
561 3300005262 Ga0065165_1003912 Ga0065165_10039127 307
562 3300005329 Ga0070683_100001787 Ga0070683_1000017878 307
563 3300005329 Ga0070683_100106508 Ga0070683_1001065081 307
564 3300005334 Ga0068869_100042272 Ga0068869_1000422722 307
565 3300005336 Ga0070680_100101893 Ga0070680_1001018932 307
566 3300005336 Ga0070680_100205146 Ga0070680_1002051462 307
567 3300005338 Ga0068868_100010593 Ga0068868_1000105937 307
568 3300005339 Ga0070660_100164229 Ga0070660_1001642291 307
569 3300005344 Ga0070661_100132338 Ga0070661_1001323382 307
570 3300005345 Ga0070692_10119582 Ga0070692_101195821 307
571 3300005347 Ga0070668_100051475 Ga0070668_1000514752 307
572 3300005347 Ga0070668_100165747 Ga0070668_1001657472 307
573 3300005347 Ga0070668_100216327 Ga0070668_1002163272 307
574 3300005353 Ga0070669_100107439 Ga0070669_1001074392 307
575 3300005356 Ga0070674_100111852 Ga0070674_1001118522 307
576 3300005364 Ga0070673_100122975 Ga0070673_1001229752 307
577 3300005365 Ga0070688_100148754 Ga0070688_1001487542 307
578 3300005366 Ga0070659_100178734 Ga0070659_1001787342 307
579 3300005366 Ga0070659_100290427 Ga0070659_1002904272 307
580 3300005367 Ga0070667_100159545 Ga0070667_1001595452 307
581 3300005367 Ga0070667_100214820 Ga0070667_1002148202 307
582 3300005435 Ga0070714_100075535 Ga0070714_1000755354 307
583 3300005435 Ga0070714_100224086 Ga0070714_1002240862 307
584 3300005437 Ga0070710_10227873 Ga0070710_102278731 307
585 3300005441 Ga0070700_100025371 Ga0070700_1000253712 307
586 3300005445 Ga0070708_100038211 Ga0070708_1000382113 307
587 3300005455 Ga0070663_100023864 Ga0070663_1000238643 307
588 3300005455 Ga0070663_100028764 Ga0070663_1000287642 307
589 3300005455 Ga0070663_100063781 Ga0070663_1000637815 307
590 3300005455 Ga0070663_100099842 Ga0070663_1000998422 307
591 3300005456 Ga0070678_100035825 Ga0070678_1000358253 307
592 3300005456 Ga0070678_100444534 Ga0070678_1004445341 307
593 3300005457 Ga0070662_100136863 Ga0070662_1001368632 307
594 3300005458 Ga0070681_10037621 Ga0070681_100376212 307
595 3300005458 Ga0070681_10074831 Ga0070681_100748314 307
596 3300005530 Ga0070679_100110405 Ga0070679_1001104052 307
597 3300005535 Ga0070684_100004074 Ga0070684_1000040744 307
598 3300005536 Ga0070697_100228562 Ga0070697_1002285622 307
599 3300005539 Ga0068853_100177647 Ga0068853_1001776472 307
600 3300005539 Ga0068853_100215276 Ga0068853_1002152761 307
601 3300005544 Ga0070686_100380259 Ga0070686_1003802591 307
602 3300005547 Ga0070693_100123521 Ga0070693_1001235212 307
603 3300005548 Ga0070665_100016851 Ga0070665_1000168513 307
604 3300005548 Ga0070665_100146031 Ga0070665_1001460312 307
605 3300005548 Ga0070665_100169819 Ga0070665_1001698193 307
606 3300005563 Ga0068855_100009486 Ga0068855_1000094863 307
607 3300005563 Ga0068855_100328561 Ga0068855_1003285612 307
608 3300005577 Ga0068857_100112078 Ga0068857_1001120781 307
609 3300005578 Ga0068854_100129454 Ga0068854_1001294543 307
610 3300005614 Ga0068856_100000091 Ga0068856_10000009134 307
611 3300005614 Ga0068856_100429726 Ga0068856_1004297262 307
612 3300005615 Ga0070702_100028554 Ga0070702_1000285543 307
613 3300005618 Ga0068864_100216993 Ga0068864_1002169932 307
614 3300005618 Ga0068864_100400248 Ga0068864_1004002481 307
615 3300005719 Ga0068861_100122352 Ga0068861_1001223522 307
616 3300005834 Ga0068851_10052554 Ga0068851_100525542 307
617 3300005843 Ga0068860_100425096 Ga0068860_1004250962 307
618 3300005981 Ga0081538_10027322 Ga0081538_100273222 307
619 3300005983 Ga0081540_1016027 Ga0081540_10160273 307
620 3300005983 Ga0081540_1082057 Ga0081540_10820572 307
621 3300005985 Ga0081539_10000748 Ga0081539_1000074817 307
622 3300005985 Ga0081539_10036857 Ga0081539_100368572 307
623 3300006038 Ga0075365_10063018 Ga0075365_100630183 307
624 3300006042 Ga0075368_10037876 Ga0075368_100378762 307
625 3300006048 Ga0075363_100055727 Ga0075363_1000557272 307
626 3300006051 Ga0075364_10347084 Ga0075364_103470841 307
627 3300006175 Ga0070712_100000719 Ga0070712_10000071921 307
628 3300006195 Ga0075366_10109101 Ga0075366_101091012 307
629 3300006237 Ga0097621_100216934 Ga0097621_1002169342 307
630 3300006358 Ga0068871_100070601 Ga0068871_1000706012 307
631 3300006941 Ga0099825_1018577 Ga0099825_10185775 307
632 3300006942 Ga0099824_1003213 Ga0099824_100321311 307
633 3300006942 Ga0099824_1004100 Ga0099824_10041009 307
634 3300006943 Ga0099822_1000022 Ga0099822_100002238 307
635 3300006944 Ga0099823_1033291 Ga0099823_10332912 307
636 3300007265 Ga0099794_10060679 Ga0099794_100606792 307
637 3300007265 Ga0099794_10131568 Ga0099794_101315682 307
638 3300007788 Ga0099795_10009035 Ga0099795_100090352 307
639 3300007788 Ga0099795_10013752 Ga0099795_100137523 307
640 3300009093 Ga0105240_10012704 Ga0105240_100127044 307
641 3300009093 Ga0105240_10458293 Ga0105240_104582932 307
642 3300009094 Ga0111539_10101733 Ga0111539_101017333 307
643 3300009098 Ga0105245_10146469 Ga0105245_101464692 307
644 3300009101 Ga0105247_10186632 Ga0105247_101866322 307
645 3300009148 Ga0105243_10050968 Ga0105243_100509683 307
646 3300009174 Ga0105241_10062186 Ga0105241_100621862 307
647 3300009174 Ga0105241_10065435 Ga0105241_100654354 307
648 3300009176 Ga0105242_10076170 Ga0105242_100761703 307
649 3300009177 Ga0105248_10419449 Ga0105248_104194492 307
650 3300009177 Ga0105248_10505818 Ga0105248_105058181 307
651 3300009177 Ga0105248_10508859 Ga0105248_105088592 307
652 3300009545 Ga0105237_10004071 Ga0105237_1000407119 307
653 3300009545 Ga0105237_10183408 Ga0105237_101834082 307
654 3300009551 Ga0105238_10171965 Ga0105238_101719652 307
655 3300009551 Ga0105238_10386627 Ga0105238_103866271 307
656 3300009553 Ga0105249_10139088 Ga0105249_101390882 307
657 3300009553 Ga0105249_10331615 Ga0105249_103316152 307
658 3300010159 Ga0099796_10004806 Ga0099796_100048062 307
659 3300010375 Ga0105239_10013946 Ga0105239_100139466 307
660 3300010375 Ga0105239_10084928 Ga0105239_100849282 307
661 3300010375 Ga0105239_10108631 Ga0105239_101086312 307
662 3300010375 Ga0105239_10310694 Ga0105239_103106942 307
663 3300011119 Ga0105246_10009199 Ga0105246_100091996 307
664 3300011119 Ga0105246_10033565 Ga0105246_100335652 307
665 3300011119 Ga0105246_10191470 Ga0105246_101914702 307
666 3300013104 Ga0157370_10149119 Ga0157370_101491192 307
667 3300013105 Ga0157369_10024576 Ga0157369_100245764 307
668 3300013105 Ga0157369_10103135 Ga0157369_101031351 307
669 3300013308 Ga0157375_10080802 Ga0157375_100808022 307
670 3300013308 Ga0157375_10427461 Ga0157375_104274612 307
671 3300014325 Ga0163163_10020785 Ga0163163_100207852 307
672 3300014325 Ga0163163_10083035 Ga0163163_100830353 307
673 3300014326 Ga0157380_10128696 Ga0157380_101286961 307
674 3300014326 Ga0157380_10354612 Ga0157380_103546122 307
675 3300014968 Ga0157379_10058255 Ga0157379_100582552 307
676 3300014969 Ga0157376_10190860 Ga0157376_101908602 307
677 3300017792 Ga0163161_10066113 Ga0163161_100661133 307
678 3300021320 Ga0214544_1000026 Ga0214544_1000026121 307
679 3300021321 Ga0214542_1000025 Ga0214542_100002540 307
680 3300021324 Ga0214545_1000014 Ga0214545_1000014138 307
681 3300021327 Ga0214543_1000034 Ga0214543_100003439 307
682 3300025254 Ga0209148_1000516 Ga0209148_100051613 307
683 3300025261 Ga0209233_1010135 Ga0209233_10101353 307
684 3300025261 Ga0209233_1011860 Ga0209233_10118602 307
685 3300025273 Ga0209673_1036315 Ga0209673_10363151 307
686 3300025295 Ga0209564_1006386 Ga0209564_10063862 307
687 3300025295 Ga0209564_1014991 Ga0209564_10149912 307
688 3300025297 Ga0209758_1000141 Ga0209758_1000141134 307
689 3300025297 Ga0209758_1002489 Ga0209758_10024895 307
690 3300025297 Ga0209758_1002656 Ga0209758_10026564 307
691 3300025297 Ga0209758_1002862 Ga0209758_100286212 307
692 3300025299 Ga0209256_1020989 Ga0209256_10209892 307
693 3300025299 Ga0209256_1030849 Ga0209256_10308492 307
694 3300025302 Ga0207426_1001111 Ga0207426_10011114 307
695 3300025304 Ga0209257_1000426 Ga0209257_100042612 307
696 3300025315 Ga0207697_10048662 Ga0207697_100486622 307
697 3300025711 Ga0207696_1043475 Ga0207696_10434752 307
698 3300025899 Ga0207642_10114303 Ga0207642_101143032 307
699 3300025901 Ga0207688_10017094 Ga0207688_100170944 307
700 3300025901 Ga0207688_10202008 Ga0207688_102020082 307
701 3300025904 Ga0207647_10018942 Ga0207647_100189425 307
702 3300025906 Ga0207699_10079489 Ga0207699_100794893 307
703 3300025911 Ga0207654_10002526 Ga0207654_100025266 307
704 3300025912 Ga0207707_10002308 Ga0207707_1000230816 307
705 3300025913 Ga0207695_10000062 Ga0207695_10000062244 307
706 3300025913 Ga0207695_10199012 Ga0207695_101990122 307
707 3300025914 Ga0207671_10002658 Ga0207671_100026588 307
708 3300025914 Ga0207671_10040838 Ga0207671_100408384 307
709 3300025915 Ga0207693_10003057 Ga0207693_100030579 307
710 3300025917 Ga0207660_10207541 Ga0207660_102075412 307
711 3300025919 Ga0207657_10031886 Ga0207657_100318862 307
712 3300025919 Ga0207657_10108134 Ga0207657_101081343 307
713 3300025919 Ga0207657_10200495 Ga0207657_102004952 307
714 3300025921 Ga0207652_10012613 Ga0207652_100126139 307
715 3300025924 Ga0207694_10215738 Ga0207694_102157382 307
716 3300025924 Ga0207694_10366372 Ga0207694_103663722 307
717 3300025927 Ga0207687_10012004 Ga0207687_100120041 307
718 3300025927 Ga0207687_10176880 Ga0207687_101768802 307
719 3300025927 Ga0207687_10351026 Ga0207687_103510261 307
720 3300025928 Ga0207700_10208464 Ga0207700_102084642 307
721 3300025933 Ga0207706_10031592 Ga0207706_100315923 307
722 3300025933 Ga0207706_10121098 Ga0207706_101210982 307
723 3300025933 Ga0207706_10261639 Ga0207706_102616392 307
724 3300025935 Ga0207709_10127415 Ga0207709_101274153 307
725 3300025937 Ga0207669_10014566 Ga0207669_100145663 307
726 3300025939 Ga0207665_10362529 Ga0207665_103625291 307
727 3300025941 Ga0207711_10300262 Ga0207711_103002622 307
728 3300025942 Ga0207689_10018957 Ga0207689_100189575 307
729 3300025944 Ga0207661_10001002 Ga0207661_1000100211 307
730 3300025944 Ga0207661_10245344 Ga0207661_102453442 307
731 3300025949 Ga0207667_10032520 Ga0207667_100325203 307
732 3300025949 Ga0207667_10085886 Ga0207667_100858862 307
733 3300025960 Ga0207651_10068056 Ga0207651_100680562 307
734 3300025961 Ga0207712_10072890 Ga0207712_100728901 307
735 3300025972 Ga0207668_10065341 Ga0207668_100653412 307
736 3300026023 Ga0207677_10004458 Ga0207677_100044587 307
737 3300026041 Ga0207639_10329451 Ga0207639_103294512 307
738 3300026067 Ga0207678_10023123 Ga0207678_100231236 307
739 3300026075 Ga0207708_10022517 Ga0207708_100225174 307
740 3300026075 Ga0207708_10054454 Ga0207708_100544542 307
741 3300026078 Ga0207702_10000041 Ga0207702_1000004148 307
742 3300026078 Ga0207702_10167231 Ga0207702_101672312 307
743 3300026078 Ga0207702_10309965 Ga0207702_103099652 307
744 3300026095 Ga0207676_10028618 Ga0207676_100286182 307
745 3300026095 Ga0207676_10234937 Ga0207676_102349372 307
746 3300026116 Ga0207674_10049678 Ga0207674_100496784 307
747 3300026118 Ga0207675_100241327 Ga0207675_1002413272 307
748 3300026121 Ga0207683_10071211 Ga0207683_100712112 307
749 3300026121 Ga0207683_10283169 Ga0207683_102831692 307
750 3300026142 Ga0207698_10069482 Ga0207698_100694822 307
751 3300027296 Ga0209389_1000004 Ga0209389_100000425 307
752 3300027296 Ga0209389_1000023 Ga0209389_100002332 307
753 3300027357 Ga0209589_1000006 Ga0209589_1000006347 307
754 3300027357 Ga0209589_1000010 Ga0209589_1000010127 307
755 3300027361 Ga0209489_100007 Ga0209489_100007347 307
756 3300027361 Ga0209489_100011 Ga0209489_100011109 307
757 3300027361 Ga0209489_100295 Ga0209489_10029524 307
758 3300027363 Ga0209700_100008 Ga0209700_100008347 307
759 3300027363 Ga0209700_100013 Ga0209700_100013112 307
760 3300027512 Ga0209179_1006366 Ga0209179_10063661 307
761 3300027671 Ga0209588_1023972 Ga0209588_10239722 307
762 3300027866 Ga0209813_10020926 Ga0209813_100209262 307
763 3300027907 Ga0207428_10099010 Ga0207428_100990102 307
764 3300028379 Ga0268266_10034519 Ga0268266_100345193 307
765 3300028379 Ga0268266_10193385 Ga0268266_101933851 307
766 3300028379 Ga0268266_10344906 Ga0268266_103449062 307
767 3300028380 Ga0268265_10369761 Ga0268265_103697611 307
768 3300028381 Ga0268264_10410743 Ga0268264_104107432 307
769 3300028573 Ga0265334_10025525 Ga0265334_100255252 307
770 3300031247 Ga0265340_10053977 Ga0265340_100539773 307
771 3300031249 Ga0265339_10015453 Ga0265339_100154534 307
772 3300031250 Ga0265331_10057063 Ga0265331_100570632 307
773 3300031507 Ga0307509_10223657 Ga0307509_102236572 307
774 3300031616 Ga0307508_10019334 Ga0307508_100193342 307
775 3300031711 Ga0265314_10098892 Ga0265314_100988922 307
776 3300031730 Ga0307516_10121810 Ga0307516_101218102 307
777 3300032126 Ga0307415_100048009 Ga0307415_1000480094 307
778 3300033180 Ga0307510_10039371 Ga0307510_100393715 307
779 3300033180 Ga0307510_10104983 Ga0307510_101049832 307
780 3300033442 Ga0315911_1000010 Ga0315911_1000010189 307
781 3300035085 Ga0373929_0004742 Ga0373929_0004742_126_1058 307
782 3300035089 Ga0373944_0058790 Ga0373944_0058790_191_1123 307
783 3300035111 Ga0373923_0025425 Ga0373923_0025425_1356_2279 307
784 3300035115 Ga0373941_0003306 Ga0373941_0003306_692_1624 307
785 3300035116 Ga0373945_0055460 Ga0373945_0055460_234_1157 307
786 3300035119 Ga0373956_0030833 Ga0373956_0030833_1337_2260 307
787 3300035170 Ga0373943_0002389 Ga0373943_0002389_7128_8051 307
788 3300035170 Ga0373943_0009573 Ga0373943_0009573_2170_3093 307
789 3300035171 Ga0373946_0051785 Ga0373946_0051785_126_1049 307
790 3300035172 Ga0373955_0000505 Ga0373955_0000505_826_1749 307
791 3300035410 Ga0373924_0023993 Ga0373924_0023993_1301_2224 307
792 3300035691 Ga0373931_0057582 Ga0373931_0057582_540_1472 307
793 3300035692 Ga0373935_0000383 Ga0373935_0000383_18427_19350 307
794 3300035692 Ga0373935_0079441 Ga0373935_0079441_959_1882 307
795 3300035692 Ga0373935_0208501 Ga0373935_0208501_147_1070 307
796 3300035695 Ga0373927_0000339 Ga0373927_0000339_2516_3439 307
797 3300035695 Ga0373927_0020380 Ga0373927_0020380_1356_2279 307
798 3300035695 Ga0373927_0034997 Ga0373927_0034997_1602_2534 307
799 3300035724 Ga0373933_0084401 Ga0373933_0084401_633_1556 307
800 3300035724 Ga0373933_0099221 Ga0373933_0099221_292_1215 307
801 3300035725 Ga0373947_0000623 Ga0373947_0000623_4860_5783 307
802 3300035725 Ga0373947_0005753 Ga0373947_0005753_2261_3184 307
803 3300035725 Ga0373947_0162450 Ga0373947_0162450_163_1089 307
804 3300036401 Ga0373937_0160918 Ga0373937_0160918_781_1704 307
805 3300037068 Ga0373925_0025049 Ga0373925_0025049_290_1216 307
806 3300037068 Ga0373925_0047978 Ga0373925_0047978_825_1748 307
807 3300037418 Ga0395900_0007473 Ga0395900_0007473_4287_5210 307
808 3300037418 Ga0395900_0243302 Ga0395900_0243302_811_1734 307
809 3300037466 Ga0395898_0022639 Ga0395898_0022639_3238_4161 307
810 3300037466 Ga0395898_0053860 Ga0395898_0053860_777_1700 307
811 3300037466 Ga0395898_0192273 Ga0395898_0192273_928_1851 307
812 3300037471 Ga0395905_0001880 Ga0395905_0001880_19072_19995 307
813 3300037471 Ga0395905_0349531 Ga0395905_0349531_347_1270 307
814 3300038443 Ga0395901_0072458 Ga0395901_0072458_2615_3538 307
815 3300038443 Ga0395901_0726349 Ga0395901_0726349_35_958 307
816 3300039437 Ga0436365_1219354 Ga0436365_1219354_4918_5841 307
817 3300039437 Ga0436365_1283193 Ga0436365_1283193_104_1027 307
818 3300039437 Ga0436365_1754300 Ga0436365_1754300_487_1410 307
819 3300039438 Ga0436360_0598897 Ga0436360_0598897_493_1416 307
820 3300039438 Ga0436360_1142640 Ga0436360_1142640_249_1172 307
821 3300039450 Ga0436363_0616687 Ga0436363_0616687_1930_2853 307
822 3300041452 Ga0451793_0847063 Ga0451793_0847063_615_1538 307
823 3300044656 Ga0466969_0107205 Ga0466969_0107205_293_1216 307
824 3300044684 Ga0466966_0015210 Ga0466966_0015210_2648_3571 307
825 3300044693 Ga0466961_0000149 Ga0466961_0000149_17016_17939 307
826 3300044706 Ga0466964_0175442 Ga0466964_0175442_74_997 307
827 3300044901 Ga0466960_0152315 Ga0466960_0152315_189_1112 307
828 3300045049 Ga0466959_0036290 Ga0466959_0036290_333_1256 307
829 3300045836 Ga0466958_0246474 Ga0466958_0246474_79_1008 307
830 3300045976 Ga0466967_0015775 Ga0466967_0015775_4140_5063 307
831 3300045976 Ga0466967_0072058 Ga0466967_0072058_463_1386 307
832 3300045976 Ga0466967_0224106 Ga0466967_0224106_535_1458 307
833 3300046453 Ga0495627_053630 Ga0495627_053630_187_1119 307
834 3300046454 Ga0495592_0051294 Ga0495592_0051294_310_1233 307
835 3300046454 Ga0495592_0077523 Ga0495592_0077523_1340_2263 307
836 3300046454 Ga0495592_0120593 Ga0495592_0120593_696_1661 307
837 3300046455 Ga0495603_0001921 Ga0495603_0001921_8525_9448 307
838 3300046455 Ga0495603_0025531 Ga0495603_0025531_810_1733 307
839 3300046455 Ga0495603_0025682 Ga0495603_0025682_2599_3531 307
840 3300046455 Ga0495603_0077594 Ga0495603_0077594_91_1023 307
841 3300046455 Ga0495603_0086816 Ga0495603_0086816_628_1560 307
842 3300046455 Ga0495603_0199553 Ga0495603_0199553_197_1120 307
843 3300046457 Ga0495590_0080298 Ga0495590_0080298_126_1058 307
844 3300046459 Ga0495629_0008419 Ga0495629_0008419_3457_4380 307
845 3300046459 Ga0495629_0019114 Ga0495629_0019114_3859_4782 307
846 3300046459 Ga0495629_0047757 Ga0495629_0047757_1022_1945 307
847 3300046459 Ga0495629_0107607 Ga0495629_0107607_503_1426 307
848 3300046460 Ga0495638_0160267 Ga0495638_0160267_108_1040 307
849 3300046461 Ga0495641_0005456 Ga0495641_0005456_5450_6373 307
850 3300046462 Ga0495651_0005170 Ga0495651_0005170_5841_6806 307
851 3300046472 Ga0495580_0002106 Ga0495580_0002106_6786_7709 307
852 3300046472 Ga0495580_0102356 Ga0495580_0102356_703_1626 307
853 3300046473 Ga0495582_0000839 Ga0495582_0000839_9471_10394 307
854 3300046473 Ga0495582_0159580 Ga0495582_0159580_56_988 307
855 3300046475 Ga0495639_0000198 Ga0495639_0000198_28295_29218 307
856 3300046475 Ga0495639_0053169 Ga0495639_0053169_295_1221 307
857 3300046476 Ga0495662_0013305 Ga0495662_0013305_462_1385 307
858 3300046477 Ga0495664_0085178 Ga0495664_0085178_756_1721 307
859 3300046477 Ga0495664_0133072 Ga0495664_0133072_517_1440 307
860 3300046499 Ga0495594_0000484 Ga0495594_0000484_15052_15975 307
861 3300046499 Ga0495594_0021206 Ga0495594_0021206_1175_2107 307
862 3300046501 Ga0495607_0156032 Ga0495607_0156032_171_1094 307
863 3300046507 Ga0495606_0009928 Ga0495606_0009928_4866_5789 307
864 3300046507 Ga0495606_0018301 Ga0495606_0018301_2829_3752 307
865 3300046511 Ga0495608_0127866 Ga0495608_0127866_432_1355 307
866 3300046512 Ga0495610_0151874 Ga0495610_0151874_33_956 307
867 3300046514 Ga0495618_0058196 Ga0495618_0058196_185_1108 307
868 3300046514 Ga0495618_0174098 Ga0495618_0174098_315_1238 307
869 3300046516 Ga0495628_0071368 Ga0495628_0071368_1609_2574 307
870 3300046516 Ga0495628_0085781 Ga0495628_0085781_1171_2094 307
871 3300046517 Ga0495630_0004090 Ga0495630_0004090_7093_8016 307
872 3300046517 Ga0495630_0013420 Ga0495630_0013420_4694_5617 307
873 3300046519 Ga0495632_0038280 Ga0495632_0038280_258_1190 307
874 3300046522 Ga0495643_0016356 Ga0495643_0016356_1360_2283 307
875 3300046524 Ga0495648_0003788 Ga0495648_0003788_11165_12088 307
876 3300046524 Ga0495648_0005381 Ga0495648_0005381_2061_2984 307
877 3300046524 Ga0495648_0024143 Ga0495648_0024143_2380_3303 307
878 3300046525 Ga0495663_0075635 Ga0495663_0075635_27_959 307
879 3300046526 Ga0495666_0033603 Ga0495666_0033603_1193_2116 307
880 3300046526 Ga0495666_0067968 Ga0495666_0067968_707_1630 307
881 3300046529 Ga0495652_0037775 Ga0495652_0037775_3069_3992 307
882 3300046529 Ga0495652_0044572 Ga0495652_0044572_1869_2792 307
883 3300046529 Ga0495652_0184198 Ga0495652_0184198_292_1215 307
884 3300046531 Ga0495665_0000539 Ga0495665_0000539_6801_7724 307
885 3300046531 Ga0495665_0024344 Ga0495665_0024344_2217_3140 307
886 3300046533 Ga0495640_0004718 Ga0495640_0004718_6170_7093 307
887 3300046533 Ga0495640_0022789 Ga0495640_0022789_2808_3731 307
888 3300046536 Ga0495587_0118056 Ga0495587_0118056_259_1224 307
889 3300046536 Ga0495587_0177845 Ga0495587_0177845_58_981 307
890 3300046543 Ga0495645_0015582 Ga0495645_0015582_1244_2167 307
891 3300046543 Ga0495645_0021112 Ga0495645_0021112_3612_4535 307
892 3300046543 Ga0495645_0226226 Ga0495645_0226226_68_991 307
893 3300046557 Ga0495622_0036333 Ga0495622_0036333_850_1773 307
894 3300046559 Ga0495667_0090210 Ga0495667_0090210_347_1312 307
895 3300046616 Ga0495668_0029006 Ga0495668_0029006_1146_2078 307
896 3300046616 Ga0495668_0125744 Ga0495668_0125744_223_1146 307
897 3300046642 Ga0495634_0000792 Ga0495634_0000792_6975_7898 307
898 3300046642 Ga0495634_0024899 Ga0495634_0024899_3055_3978 307
899 3300046648 Ga0495611_0084899 Ga0495611_0084899_115_1047 307
900 3300046660 Ga0495625_0055998 Ga0495625_0055998_1756_2679 307
901 3300046660 Ga0495625_0106634 Ga0495625_0106634_439_1371 307
902 3300046663 Ga0495635_0002309 Ga0495635_0002309_2307_3230 307
903 3300046663 Ga0495635_0022557 Ga0495635_0022557_748_1671 307
904 3300046663 Ga0495635_0080012 Ga0495635_0080012_900_1823 307
905 3300046663 Ga0495635_0104329 Ga0495635_0104329_319_1242 307
906 3300046674 Ga0495588_0005803 Ga0495588_0005803_3559_4482 307
907 3300046674 Ga0495588_0044972 Ga0495588_0044972_538_1470 307
908 3300046675 Ga0495657_0037981 Ga0495657_0037981_2175_3098 307
909 3300046678 Ga0495599_0023511 Ga0495599_0023511_1834_2757 307
910 3300046678 Ga0495599_0056334 Ga0495599_0056334_352_1275 307
911 3300046678 Ga0495599_0098409 Ga0495599_0098409_637_1602 307
912 3300046678 Ga0495599_0199214 Ga0495599_0199214_241_1164 307
913 3300046678 Ga0495599_0237823 Ga0495599_0237823_33_956 307
914 3300046679 Ga0495623_0089766 Ga0495623_0089766_291_1256 307
915 3300046680 Ga0495646_0006258 Ga0495646_0006258_1024_1947 307
916 3300046681 Ga0495647_0001093 Ga0495647_0001093_2915_3838 307
917 3300046681 Ga0495647_0065352 Ga0495647_0065352_389_1312 307
918 3300046683 Ga0495658_0001614 Ga0495658_0001614_6575_7498 307
919 3300046683 Ga0495658_0032622 Ga0495658_0032622_1191_2114 307
920 3300046683 Ga0495658_0091626 Ga0495658_0091626_60_983 307
921 3300046684 Ga0495669_0003692 Ga0495669_0003692_2173_3096 307
922 3300046689 Ga0495613_0018666 Ga0495613_0018666_376_1299 307
923 3300046689 Ga0495613_0044715 Ga0495613_0044715_1137_2060 307
924 3300046690 Ga0495624_0002224 Ga0495624_0002224_7093_8016 307
925 3300046690 Ga0495624_0031131 Ga0495624_0031131_1024_1947 307
926 3300046691 Ga0495670_0135398 Ga0495670_0135398_306_1238 307
927 3300046694 Ga0495649_0102017 Ga0495649_0102017_461_1393 307
928 3300046809 Ga0495600_0001341 Ga0495600_0001341_259_1224 307
929 3300046809 Ga0495600_0013087 Ga0495600_0013087_3127_4050 307
930 3300047315 Ga0495581_0000015 Ga0495581_0000015_11135_12058 307
931 3300047315 Ga0495581_0052097 Ga0495581_0052097_1180_2103 307
932 3300047315 Ga0495581_0089091 Ga0495581_0089091_229_1161 307
933 3300047315 Ga0495581_0102352 Ga0495581_0102352_20_952 307
934 3300047317 Ga0495604_0002055 Ga0495604_0002055_3446_4369 307
935 3300047317 Ga0495604_0040475 Ga0495604_0040475_201_1124 307
936 3300047319 Ga0495674_0008391 Ga0495674_0008391_2923_3846 307
937 3300047319 Ga0495674_0046688 Ga0495674_0046688_304_1227 307
938 3300047319 Ga0495674_0058711 Ga0495674_0058711_599_1564 307
939 3300047321 Ga0495676_0088017 Ga0495676_0088017_988_1911 307
940 3300047321 Ga0495676_0094959 Ga0495676_0094959_379_1302 307
941 3300047322 Ga0495680_0016086 Ga0495680_0016086_2138_3103 307
942 3300047322 Ga0495680_0144672 Ga0495680_0144672_740_1663 307
943 3300047443 Ga0495687_007506 Ga0495687_007506_968_1891 307
944 3300047444 Ga0495675_0120725 Ga0495675_0120725_178_1143 307
945 3300047471 Ga0495684_0024587 Ga0495684_0024587_1383_2306 307
946 3300047471 Ga0495684_0045322 Ga0495684_0045322_1071_1994 307
947 3300047673 Ga0495593_0000384 Ga0495593_0000384_18871_19794 307
948 3300047673 Ga0495593_0010683 Ga0495593_0010683_3214_4137 307
949 3300047673 Ga0495593_0053787 Ga0495593_0053787_486_1409 307
950 3300048088 Ga0495602_0037211 Ga0495602_0037211_2696_3619 307
951 3300048088 Ga0495602_0039351 Ga0495602_0039351_3250_4215 307
952 3300048089 Ga0495614_0048183 Ga0495614_0048183_526_1449 307
953 3300048903 Ga0496100_0114028 Ga0496100_0114028_254_1177 307
954 3300048904 Ga0496101_0008079 Ga0496101_0008079_4746_5669 307
955 3300048904 Ga0496101_0033067 Ga0496101_0033067_127_1050 307
956 3300048904 Ga0496101_0068182 Ga0496101_0068182_1158_2090 307
957 3300048905 Ga0496102_0011342 Ga0496102_0011342_3763_4686 307
958 3300048905 Ga0496102_0012470 Ga0496102_0012470_1362_2294 307
959 3300048905 Ga0496102_0023434 Ga0496102_0023434_816_1739 307
960 3300048906 Ga0496103_0045148 Ga0496103_0045148_121_1044 307
961 3300048907 Ga0496104_0012119 Ga0496104_0012119_5357_6289 307
962 3300048907 Ga0496104_0037267 Ga0496104_0037267_3076_3999 307
963 3300048907 Ga0496104_0197002 Ga0496104_0197002_300_1223 307
964 3300048907 Ga0496104_0206836 Ga0496104_0206836_751_1674 307
965 3300048907 Ga0496104_0321350 Ga0496104_0321350_157_1080 307
966 3300048908 Ga0496105_0040901 Ga0496105_0040901_1986_2909 307
967 3300048908 Ga0496105_0044252 Ga0496105_0044252_1448_2380 307
968 3300048908 Ga0496105_0103867 Ga0496105_0103867_674_1597 307
969 3300048908 Ga0496105_0144903 Ga0496105_0144903_487_1410 307
970 3300048909 Ga0496106_0012760 Ga0496106_0012760_1828_2751 307
971 3300048909 Ga0496106_0103526 Ga0496106_0103526_432_1355 307
972 3300048910 Ga0496107_0005112 Ga0496107_0005112_4171_5094 307
973 3300048910 Ga0496107_0321451 Ga0496107_0321451_24_956 307
974 3300048911 Ga0496108_0052725 Ga0496108_0052725_1070_1993 307
975 3300048911 Ga0496108_0131162 Ga0496108_0131162_450_1382 307
976 3300048911 Ga0496108_0176533 Ga0496108_0176533_73_1005 307
977 3300048912 Ga0496109_0043459 Ga0496109_0043459_558_1490 307
978 3300048912 Ga0496109_0064561 Ga0496109_0064561_1518_2441 307
979 3300048913 Ga0496110_0006318 Ga0496110_0006318_3113_4045 307
980 3300048913 Ga0496110_0192564 Ga0496110_0192564_291_1214 307
981 3300048913 Ga0496110_0308133 Ga0496110_0308133_186_1109 307
982 3300048914 Ga0496111_0013217 Ga0496111_0013217_1015_1947 307
983 3300048914 Ga0496111_0040286 Ga0496111_0040286_1910_2833 307
984 3300048914 Ga0496111_0142483 Ga0496111_0142483_804_1727 307
985 3300048915 Ga0496112_0000008 Ga0496112_0000008_36603_37526 307
986 3300048915 Ga0496112_0007908 Ga0496112_0007908_1572_2504 307
987 3300048915 Ga0496112_0087946 Ga0496112_0087946_2074_2997 307
988 3300048915 Ga0496112_0135217 Ga0496112_0135217_867_1865 307
989 3300048915 Ga0496112_0139424 Ga0496112_0139424_886_1809 307
990 3300048916 Ga0496113_0003109 Ga0496113_0003109_5773_6705 307
991 3300048916 Ga0496113_0024919 Ga0496113_0024919_2992_3915 307
992 3300048916 Ga0496113_0043915 Ga0496113_0043915_409_1332 307
993 3300048916 Ga0496113_0309434 Ga0496113_0309434_85_1008 307
994 3300048917 Ga0496114_0002928 Ga0496114_0002928_80_1003 307
995 3300048917 Ga0496114_0008185 Ga0496114_0008185_1031_1963 307
996 3300048918 Ga0496115_0047309 Ga0496115_0047309_1458_2381 307
997 3300048920 Ga0496117_0175249 Ga0496117_0175249_118_1050 307
998 3300048921 Ga0496118_0012830 Ga0496118_0012830_869_1792 307
999 3300048921 Ga0496118_0091406 Ga0496118_0091406_526_1449 307
1000 3300048921 Ga0496118_0109763 Ga0496118_0109763_162_1085 307
1001 3300048922 Ga0496119_0019927 Ga0496119_0019927_2933_3856 307
1002 3300048923 Ga0496120_0005798 Ga0496120_0005798_2290_3213 307
1003 3300048924 Ga0496121_0005990 Ga0496121_0005990_13802_14725 307
1004 3300048924 Ga0496121_0020194 Ga0496121_0020194_5550_6473 307
1005 3300048924 Ga0496121_0055052 Ga0496121_0055052_1479_2411 307
1006 3300048928 Ga0496125_0027660 Ga0496125_0027660_3919_4842 307
1007 3300048928 Ga0496125_0093021 Ga0496125_0093021_1291_2214 307
1008 3300048928 Ga0496125_0144663 Ga0496125_0144663_530_1453 307
1009 3300048928 Ga0496125_0146452 Ga0496125_0146452_360_1292 307
1010 3300048929 Ga0496126_0022427 Ga0496126_0022427_2218_3141 307
1011 3300048929 Ga0496126_0364499 Ga0496126_0364499_186_1118 307
1012 3300048929 Ga0496126_0424416 Ga0496126_0424416_62_994 307
1013 3300049571 Ga0501034_0016544 Ga0501034_0016544_6608_7531 307
1014 3300049573 Ga0501037_0138099 Ga0501037_0138099_268_1191 307
1015 3300049574 Ga0501038_0035710 Ga0501038_0035710_1067_1990 307
1016 3300049579 Ga0501043_0266974 Ga0501043_0266974_360_1283 307
1017 3300049580 Ga0501046_0018899 Ga0501046_0018899_1377_2300 307
1018 3300049581 Ga0501047_0043146 Ga0501047_0043146_2231_3154 307
1019 3300049581 Ga0501047_0049002 Ga0501047_0049002_810_1733 307
1020 3300049586 Ga0501070_0005835 Ga0501070_0005835_2995_3918 307
1021 3300049589 Ga0501073_0029119 Ga0501073_0029119_735_1658 307
1022 3300049589 Ga0501073_0083610 Ga0501073_0083610_188_1111 307
1023 3300049590 Ga0501074_0031406 Ga0501074_0031406_2538_3461 307
1024 3300049742 Ga0501080_0034637 Ga0501080_0034637_3593_4516 307
1025 3300049822 Ga0501035_0011909 Ga0501035_0011909_4302_5225 307
1026 3300049823 Ga0501044_0076157 Ga0501044_0076157_1696_2619 307
1027 3300050493 nmdc:mga0k408_69038_c1 nmdc:mga0k408_69038_c1_60_983 307
1028 3300050494 nmdc:mga06z11_60341_c1 nmdc:mga06z11_60341_c1_562_1494 307
1029 3300050507 nmdc:mga05p37_347562_c1 nmdc:mga05p37_347562_c1_172_1104 307
1030 3300050514 nmdc:mga08x19_171419_c1 nmdc:mga08x19_171419_c1_350_1273 307
1031 3300050516 nmdc:mga0sz30_16624_c1 nmdc:mga0sz30_16624_c1_271_1194 307
1032 3300050516 nmdc:mga0sz30_63339_c2 nmdc:mga0sz30_63339_c2_213_1136 307
1033 3300053077 Ga0495601_0020306 Ga0495601_0020306_3074_3997 307
1034 3300053077 Ga0495601_0131025 Ga0495601_0131025_189_1112 307
1035 3300053077 Ga0495601_0217393 Ga0495601_0217393_225_1148 307
1036 3300053078 Ga0495612_0021497 Ga0495612_0021497_837_1760 307
1037 3300053078 Ga0495612_0040437 Ga0495612_0040437_837_1760 307
1038 3300053080 Ga0500635_0009681 Ga0500635_0009681_427_1359 307
1039 3300053085 Ga0495619_0017139 Ga0495619_0017139_3219_4151 307
1040 3300053087 Ga0500643_000435 Ga0500643_000435_8389_9312 307
1041 3300053094 Ga0500566_0000008 Ga0500566_0000008_250_1233 307
1042 3300053094 Ga0500566_0002013 Ga0500566_0002013_8857_9789 307
1043 3300053094 Ga0500566_0003961 Ga0500566_0003961_7614_8537 307
1044 3300053095 Ga0500640_000516 Ga0500640_000516_317_1300 307
1045 3300053096 Ga0500641_0009748 Ga0500641_0009748_1288_2220 307
1046 3300053096 Ga0500641_0087286 Ga0500641_0087286_200_1123 307
1047 3300053098 Ga0500650_0048886 Ga0500650_0048886_728_1651 307
1048 3300053105 Ga0500557_000029 Ga0500557_000029_8993_10054 307
1049 3300053108 Ga0500562_005821 Ga0500562_005821_1659_2582 307
1050 3300053111 Ga0500572_000056 Ga0500572_000056_11348_12271 307
1051 3300053111 Ga0500572_020679 Ga0500572_020679_169_1092 307
1052 3300053119 Ga0500595_000726 Ga0500595_000726_12968_13900 307
1053 3300053119 Ga0500595_020648 Ga0500595_020648_1417_2340 307
1054 3300053120 Ga0500597_149433 Ga0500597_149433_32_955 307
1055 3300053121 Ga0500607_121585 Ga0500607_121585_126_1049 307
1056 3300053122 Ga0500608_037225 Ga0500608_037225_1208_2191 307
1057 3300053123 Ga0500614_003782 Ga0500614_003782_336_1319 307
1058 3300053126 Ga0500621_069030 Ga0500621_069030_188_1120 307
1059 3300053130 Ga0500642_0000333 Ga0500642_0000333_7313_8374 307
1060 3300053136 Ga0500559_0000423 Ga0500559_0000423_17599_18522 307
1061 3300053136 Ga0500559_0002351 Ga0500559_0002351_8297_9280 307
1062 3300053138 Ga0500564_076426 Ga0500564_076426_435_1358 307
1063 3300053139 Ga0500568_0073081 Ga0500568_0073081_199_1122 307
1064 3300053148 Ga0500590_111389 Ga0500590_111389_287_1270 307
1065 3300053150 Ga0500603_000104 Ga0500603_000104_7216_8199 307
1066 3300053150 Ga0500603_001908 Ga0500603_001908_3280_4212 307
1067 3300053156 Ga0500622_0016125 Ga0500622_0016125_224_1147 307
1068 3300053159 Ga0500630_013996 Ga0500630_013996_3010_3933 307
1069 3300053162 Ga0500638_001215 Ga0500638_001215_2306_3238 307
1070 3300053163 Ga0500639_000010 Ga0500639_000010_26962_27945 307
1071 3300053163 Ga0500639_016510 Ga0500639_016510_2170_3093 307
1072 3300053177 Ga0500636_0000112 Ga0500636_0000112_23303_24226 307
1073 3300053177 Ga0500636_0094752 Ga0500636_0094752_46_978 307
1074 3300053178 Ga0500637_0016014 Ga0500637_0016014_2859_3782 307
1075 3300053730 Ga0500645_000012 Ga0500645_000012_128884_129807 307
1076 3300053730 Ga0500645_013885 Ga0500645_013885_865_1797 307
1077 3300053730 Ga0500645_020131 Ga0500645_020131_240_1163 307
1078 3300053731 Ga0500609_001787 Ga0500609_001787_1754_2677 307
1079 3300053735 Ga0500596_001607 Ga0500596_001607_2612_3535 307
1080 3300053737 Ga0500601_001269 Ga0500601_001269_802_1725 307
1081 iso_pu_bacteria 2617270741 2617377857 307
1082 iso_pu_bacteria 2824746037 2824750518 307
1083 iso_pu_bacteria 3005483717 3005485692 307
1084 iso_pu_bacteria 8016583857 8016589161 307
1085 2209111006 2214600489 2213637875 308
1086 3300000041 ARcpr5oldR_c000075 ARcpr5oldR_00007521 308
1087 3300000042 ARSoilYngRDRAFT_c00009 ARSoilYngRDRAFT_0000921 308
1088 3300000043 ARcpr5yngRDRAFT_c000006 ARcpr5yngRDRAFT_00000621 308
1089 3300000044 ARSoilOldRDRAFT_c000008 ARSoilOldRDRAFT_00000853 308
1090 3300000045 ARCol0oldRDRAFT_c00242 ARCol0oldRDRAFT_002424 308
1091 3300000652 ARCol0yngRDRAFT_1000092 ARCol0yngRDRAFT_10000927 308
1092 3300001915 JGI24741J21665_1005717 JGI24741J21665_10057172 308
1093 3300001977 JGI24746J21847_1000654 JGI24746J21847_10006542 308
1094 3300001989 JGI24739J22299_10000092 JGI24739J22299_1000009223 308
1095 3300001990 JGI24737J22298_10000325 JGI24737J22298_100003257 308
1096 3300001990 JGI24737J22298_10001344 JGI24737J22298_100013444 308
1097 3300002070 JGI24750J21931_1000128 JGI24750J21931_100012811 308
1098 3300002073 JGI24745J21846_1000019 JGI24745J21846_10000192 308
1099 3300002074 JGI24748J21848_1000158 JGI24748J21848_100015811 308
1100 3300002075 JGI24738J21930_10000010 JGI24738J21930_1000001018 308
1101 3300002076 JGI24749J21850_1000653 JGI24749J21850_10006536 308
1102 3300002077 JGI24744J21845_10007455 JGI24744J21845_100074553 308
1103 3300002126 JGI24035J26624_1000002 JGI24035J26624_100000211 308
1104 3300002155 JGI24033J26618_1004382 JGI24033J26618_10043822 308
1105 3300002239 JGI24034J26672_10000201 JGI24034J26672_1000020110 308
1106 3300002244 JGI24742J22300_10000449 JGI24742J22300_100004496 308
1107 3300003203 JGI25406J46586_10029212 JGI25406J46586_100292123 308
1108 3300003659 JGI25404J52841_10014829 JGI25404J52841_100148292 308
1109 3300003794 Ga0055531_10016346 Ga0055531_100163464 308
1110 3300003911 JGI25405J52794_10002686 JGI25405J52794_100026863 308
1111 3300003911 JGI25405J52794_10019743 JGI25405J52794_100197431 308
1112 3300005276 Ga0065717_1000057 Ga0065717_10000575 308
1113 3300005277 Ga0065716_1001714 Ga0065716_10017145 308
1114 3300005290 Ga0065712_10000899 Ga0065712_100008992 308
1115 3300005290 Ga0065712_10068648 Ga0065712_100686484 308
1116 3300005293 Ga0065715_10000752 Ga0065715_1000075211 308
1117 3300005293 Ga0065715_10000834 Ga0065715_100008344 308
1118 3300005293 Ga0065715_10099531 Ga0065715_100995313 308
1119 3300005327 Ga0070658_10000029 Ga0070658_10000029157 308
1120 3300005329 Ga0070683_100001029 Ga0070683_10000102911 308
1121 3300005329 Ga0070683_100014914 Ga0070683_1000149143 308
1122 3300005330 Ga0070690_100002808 Ga0070690_1000028087 308
1123 3300005330 Ga0070690_100020537 Ga0070690_1000205374 308
1124 3300005331 Ga0070670_100017810 Ga0070670_1000178107 308
1125 3300005333 Ga0070677_10000045 Ga0070677_100000454 308
1126 3300005334 Ga0068869_100000079 Ga0068869_10000007911 308
1127 3300005334 Ga0068869_100036226 Ga0068869_1000362264 308
1128 3300005335 Ga0070666_10019934 Ga0070666_100199344 308
1129 3300005336 Ga0070680_100080310 Ga0070680_1000803102 308
1130 3300005337 Ga0070682_100000641 Ga0070682_1000006417 308
1131 3300005337 Ga0070682_100048995 Ga0070682_1000489951 308
1132 3300005338 Ga0068868_100002114 Ga0068868_10000211414 308
1133 3300005338 Ga0068868_100116506 Ga0068868_1001165062 308
1134 3300005339 Ga0070660_100000715 Ga0070660_1000007156 308
1135 3300005339 Ga0070660_100004207 Ga0070660_1000042074 308
1136 3300005339 Ga0070660_100067446 Ga0070660_1000674462 308
1137 3300005340 Ga0070689_100003727 Ga0070689_10000372711 308
1138 3300005340 Ga0070689_100052174 Ga0070689_1000521742 308
1139 3300005341 Ga0070691_10000161 Ga0070691_1000016112 308
1140 3300005341 Ga0070691_10006926 Ga0070691_100069264 308
1141 3300005343 Ga0070687_100000085 Ga0070687_10000008526 308
1142 3300005344 Ga0070661_100000307 Ga0070661_10000030722 308
1143 3300005344 Ga0070661_100186230 Ga0070661_1001862302 308
1144 3300005345 Ga0070692_10007199 Ga0070692_100071993 308
1145 3300005347 Ga0070668_100000164 Ga0070668_1000001644 308
1146 3300005347 Ga0070668_100033222 Ga0070668_1000332222 308
1147 3300005353 Ga0070669_100000571 Ga0070669_10000057118 308
1148 3300005354 Ga0070675_100002792 Ga0070675_1000027924 308
1149 3300005355 Ga0070671_100000104 Ga0070671_10000010444 308
1150 3300005355 Ga0070671_100082892 Ga0070671_1000828924 308
1151 3300005356 Ga0070674_100000238 Ga0070674_10000023818 308
1152 3300005356 Ga0070674_100071785 Ga0070674_1000717853 308
1153 3300005364 Ga0070673_100000152 Ga0070673_10000015228 308
1154 3300005364 Ga0070673_100119337 Ga0070673_1001193372 308
1155 3300005365 Ga0070688_100001552 Ga0070688_10000155211 308
1156 3300005365 Ga0070688_100004752 Ga0070688_1000047525 308
1157 3300005365 Ga0070688_100140851 Ga0070688_1001408512 308
1158 3300005365 Ga0070688_100267867 Ga0070688_1002678672 308
1159 3300005366 Ga0070659_100000551 Ga0070659_10000055118 308
1160 3300005366 Ga0070659_100021203 Ga0070659_1000212034 308
1161 3300005366 Ga0070659_100029695 Ga0070659_1000296953 308
1162 3300005367 Ga0070667_100002365 Ga0070667_10000236510 308
1163 3300005406 Ga0070703_10002279 Ga0070703_100022794 308
1164 3300005434 Ga0070709_10000690 Ga0070709_1000069016 308
1165 3300005435 Ga0070714_100010787 Ga0070714_1000107873 308
1166 3300005436 Ga0070713_100001316 Ga0070713_10000131612 308
1167 3300005438 Ga0070701_10000674 Ga0070701_100006743 308
1168 3300005439 Ga0070711_100008627 Ga0070711_1000086273 308
1169 3300005439 Ga0070711_100031169 Ga0070711_1000311693 308
1170 3300005440 Ga0070705_100000148 Ga0070705_10000014817 308
1171 3300005441 Ga0070700_100000277 Ga0070700_10000027715 308
1172 3300005441 Ga0070700_100195613 Ga0070700_1001956132 308
1173 3300005444 Ga0070694_100003001 Ga0070694_1000030018 308
1174 3300005455 Ga0070663_100001406 Ga0070663_10000140614 308
1175 3300005455 Ga0070663_100039199 Ga0070663_1000391992 308
1176 3300005456 Ga0070678_100008123 Ga0070678_1000081235 308
1177 3300005456 Ga0070678_100033129 Ga0070678_1000331293 308
1178 3300005457 Ga0070662_100005414 Ga0070662_1000054145 308
1179 3300005457 Ga0070662_100010491 Ga0070662_1000104912 308
1180 3300005458 Ga0070681_10003456 Ga0070681_1000345611 308
1181 3300005458 Ga0070681_10232122 Ga0070681_102321222 308
1182 3300005459 Ga0068867_100004407 Ga0068867_1000044073 308
1183 3300005466 Ga0070685_10001961 Ga0070685_1000196111 308
1184 3300005466 Ga0070685_10034291 Ga0070685_100342912 308
1185 3300005518 Ga0070699_100147812 Ga0070699_1001478122 308
1186 3300005530 Ga0070679_100000394 Ga0070679_10000039444 308
1187 3300005530 Ga0070679_100083466 Ga0070679_1000834664 308
1188 3300005535 Ga0070684_100001138 Ga0070684_1000011384 308
1189 3300005535 Ga0070684_100255997 Ga0070684_1002559972 308
1190 3300005539 Ga0068853_100002891 Ga0068853_1000028915 308
1191 3300005539 Ga0068853_100265341 Ga0068853_1002653412 308
1192 3300005543 Ga0070672_100000088 Ga0070672_10000008836 308
1193 3300005544 Ga0070686_100000719 Ga0070686_1000007193 308
1194 3300005544 Ga0070686_100013533 Ga0070686_1000135332 308
1195 3300005545 Ga0070695_100000586 Ga0070695_1000005864 308
1196 3300005545 Ga0070695_100003316 Ga0070695_10000331612 308
1197 3300005545 Ga0070695_100191825 Ga0070695_1001918252 308
1198 3300005546 Ga0070696_100000921 Ga0070696_1000009214 308
1199 3300005546 Ga0070696_100108735 Ga0070696_1001087352 308
1200 3300005547 Ga0070693_100000134 Ga0070693_10000013425 308
1201 3300005549 Ga0070704_100000026 Ga0070704_10000002611 308
1202 3300005563 Ga0068855_100006834 Ga0068855_1000068344 308
1203 3300005564 Ga0070664_100001420 Ga0070664_10000142022 308
1204 3300005564 Ga0070664_100155219 Ga0070664_1001552192 308
1205 3300005577 Ga0068857_100001388 Ga0068857_1000013884 308
1206 3300005577 Ga0068857_100039317 Ga0068857_1000393173 308
1207 3300005578 Ga0068854_100000546 Ga0068854_10000054613 308
1208 3300005614 Ga0068856_100002000 Ga0068856_1000020005 308
1209 3300005615 Ga0070702_100000245 Ga0070702_10000024515 308
1210 3300005615 Ga0070702_100012324 Ga0070702_1000123244 308
1211 3300005616 Ga0068852_100002320 Ga0068852_1000023204 308
1212 3300005617 Ga0068859_100006734 Ga0068859_1000067344 308
1213 3300005617 Ga0068859_100049744 Ga0068859_1000497444 308
1214 3300005618 Ga0068864_100000890 Ga0068864_10000089011 308
1215 3300005618 Ga0068864_100124327 Ga0068864_1001243272 308
1216 3300005618 Ga0068864_100415709 Ga0068864_1004157092 308
1217 3300005718 Ga0068866_10000221 Ga0068866_1000022111 308
1218 3300005719 Ga0068861_100000783 Ga0068861_1000007834 308
1219 3300005840 Ga0068870_10000090 Ga0068870_1000009035 308
1220 3300005841 Ga0068863_100000340 Ga0068863_1000003403 308
1221 3300005841 Ga0068863_100061662 Ga0068863_1000616622 308
1222 3300005842 Ga0068858_100000295 Ga0068858_10000029546 308
1223 3300005842 Ga0068858_100031612 Ga0068858_1000316126 308
1224 3300005843 Ga0068860_100001285 Ga0068860_10000128514 308
1225 3300005843 Ga0068860_100431596 Ga0068860_1004315962 308
1226 3300005844 Ga0068862_100003658 Ga0068862_1000036584 308
1227 3300005844 Ga0068862_100043709 Ga0068862_1000437094 308
1228 3300005937 Ga0081455_10000007 Ga0081455_10000007229 308
1229 3300005937 Ga0081455_10007150 Ga0081455_1000715012 308
1230 3300005937 Ga0081455_10019547 Ga0081455_100195474 308
1231 3300005937 Ga0081455_10089595 Ga0081455_100895952 308
1232 3300005983 Ga0081540_1018305 Ga0081540_10183053 308
1233 3300005985 Ga0081539_10001525 Ga0081539_1000152535 308
1234 3300006028 Ga0070717_10008927 Ga0070717_100089277 308
1235 3300006028 Ga0070717_10009632 Ga0070717_100096328 308
1236 3300006038 Ga0075365_10187265 Ga0075365_101872652 308
1237 3300006048 Ga0075363_100037328 Ga0075363_1000373284 308
1238 3300006058 Ga0075432_10005977 Ga0075432_100059773 308
1239 3300006058 Ga0075432_10044381 Ga0075432_100443811 308
1240 3300006163 Ga0070715_10076610 Ga0070715_100766102 308
1241 3300006173 Ga0070716_100029152 Ga0070716_1000291522 308
1242 3300006194 Ga0075427_10000012 Ga0075427_1000001214 308
1243 3300006195 Ga0075366_10008677 Ga0075366_100086772 308
1244 3300006195 Ga0075366_10011231 Ga0075366_100112312 308
1245 3300006237 Ga0097621_100000040 Ga0097621_10000004051 308
1246 3300006237 Ga0097621_100070634 Ga0097621_1000706344 308
1247 3300006358 Ga0068871_100000252 Ga0068871_10000025244 308
1248 3300006358 Ga0068871_100012473 Ga0068871_1000124731 308
1249 3300006846 Ga0075430_100018573 Ga0075430_1000185733 308
1250 3300006847 Ga0075431_100181614 Ga0075431_1001816142 308
1251 3300006852 Ga0075433_10000007 Ga0075433_1000000719 308
1252 3300006871 Ga0075434_100002477 Ga0075434_10000247714 308
1253 3300006871 Ga0075434_100002531 Ga0075434_1000025313 308
1254 3300006871 Ga0075434_100157129 Ga0075434_1001571292 308
1255 3300006871 Ga0075434_100307519 Ga0075434_1003075192 308
1256 3300006880 Ga0075429_100002081 Ga0075429_1000020815 308
1257 3300006881 Ga0068865_100000275 Ga0068865_10000027525 308
1258 3300006914 Ga0075436_100090548 Ga0075436_1000905482 308
1259 3300006931 Ga0097620_100006734 Ga0097620_1000067344 308
1260 3300006931 Ga0097620_100049739 Ga0097620_1000497394 308
1261 3300007076 Ga0075435_100001384 Ga0075435_1000013848 308
1262 3300007265 Ga0099794_10031966 Ga0099794_100319663 308
1263 3300007788 Ga0099795_10000002 Ga0099795_10000002119 308
1264 3300009011 Ga0105251_10036640 Ga0105251_100366401 308
1265 3300009092 Ga0105250_10025985 Ga0105250_100259852 308
1266 3300009093 Ga0105240_10370371 Ga0105240_103703712 308
1267 3300009094 Ga0111539_10000394 Ga0111539_1000039441 308
1268 3300009094 Ga0111539_10003483 Ga0111539_1000348315 308
1269 3300009098 Ga0105245_10000462 Ga0105245_1000046222 308
1270 3300009098 Ga0105245_10105110 Ga0105245_101051103 308
1271 3300009101 Ga0105247_10000442 Ga0105247_1000044213 308
1272 3300009101 Ga0105247_10007985 Ga0105247_100079854 308
1273 3300009147 Ga0114129_10001111 Ga0114129_1000111124 308
1274 3300009147 Ga0114129_10397585 Ga0114129_103975852 308
1275 3300009148 Ga0105243_10000282 Ga0105243_1000028245 308
1276 3300009148 Ga0105243_10034755 Ga0105243_100347552 308
1277 3300009174 Ga0105241_10000652 Ga0105241_1000065221 308
1278 3300009174 Ga0105241_10258825 Ga0105241_102588252 308
1279 3300009176 Ga0105242_10001726 Ga0105242_1000172614 308
1280 3300009176 Ga0105242_10033558 Ga0105242_100335585 308
1281 3300009545 Ga0105237_10008154 Ga0105237_1000815411 308
1282 3300009545 Ga0105237_10353638 Ga0105237_103536382 308
1283 3300009551 Ga0105238_10023755 Ga0105238_100237555 308
1284 3300009553 Ga0105249_10001210 Ga0105249_100012108 308
1285 3300009553 Ga0105249_10010878 Ga0105249_1001087810 308
1286 3300009553 Ga0105249_10293262 Ga0105249_102932622 308
1287 3300010159 Ga0099796_10000004 Ga0099796_1000000415 308
1288 3300010375 Ga0105239_10006303 Ga0105239_1000630311 308
1289 3300010375 Ga0105239_10013274 Ga0105239_100132748 308
1290 3300010375 Ga0105239_10328605 Ga0105239_103286052 308
1291 3300010375 Ga0105239_10358824 Ga0105239_103588242 308
1292 3300011119 Ga0105246_10000312 Ga0105246_1000031211 308
1293 3300011119 Ga0105246_10140466 Ga0105246_101404662 308
1294 3300013100 Ga0157373_10026078 Ga0157373_100260783 308
1295 3300013100 Ga0157373_10088140 Ga0157373_100881402 308
1296 3300013102 Ga0157371_10011709 Ga0157371_100117096 308
1297 3300013296 Ga0157374_10001123 Ga0157374_100011239 308
1298 3300013297 Ga0157378_10000270 Ga0157378_1000027018 308
1299 3300013297 Ga0157378_10187750 Ga0157378_101877501 308
1300 3300013297 Ga0157378_10494249 Ga0157378_104942492 308
1301 3300013306 Ga0163162_10000145 Ga0163162_1000014520 308
1302 3300013306 Ga0163162_10053735 Ga0163162_100537352 308
1303 3300013306 Ga0163162_10065175 Ga0163162_100651754 308
1304 3300013306 Ga0163162_10442921 Ga0163162_104429212 308
1305 3300013307 Ga0157372_10004025 Ga0157372_1000402511 308
1306 3300013308 Ga0157375_10000332 Ga0157375_1000033217 308
1307 3300014325 Ga0163163_10000865 Ga0163163_1000086523 308
1308 3300014325 Ga0163163_10010305 Ga0163163_100103054 308
1309 3300014326 Ga0157380_10003074 Ga0157380_100030743 308
1310 3300014497 Ga0182008_10070087 Ga0182008_100700871 308
1311 3300014745 Ga0157377_10000137 Ga0157377_1000013721 308
1312 3300014968 Ga0157379_10001761 Ga0157379_100017613 308
1313 3300014968 Ga0157379_10036684 Ga0157379_100366843 308
1314 3300014969 Ga0157376_10000088 Ga0157376_1000008845 308
1315 3300014969 Ga0157376_10088578 Ga0157376_100885782 308
1316 3300017792 Ga0163161_10000144 Ga0163161_1000014426 308
1317 3300025271 Ga0207666_1000048 Ga0207666_100004810 308
1318 3300025297 Ga0209758_1002417 Ga0209758_10024177 308
1319 3300025304 Ga0209257_1005168 Ga0209257_10051684 308
1320 3300025315 Ga0207697_10000136 Ga0207697_1000013611 308
1321 3300025321 Ga0207656_10122122 Ga0207656_101221221 308
1322 3300025711 Ga0207696_1018901 Ga0207696_10189012 308
1323 3300025885 Ga0207653_10008240 Ga0207653_100082402 308
1324 3300025893 Ga0207682_10000006 Ga0207682_1000000610 308
1325 3300025899 Ga0207642_10000628 Ga0207642_100006288 308
1326 3300025900 Ga0207710_10001915 Ga0207710_100019152 308
1327 3300025900 Ga0207710_10004369 Ga0207710_100043692 308
1328 3300025901 Ga0207688_10000027 Ga0207688_1000002745 308
1329 3300025901 Ga0207688_10003913 Ga0207688_100039134 308
1330 3300025903 Ga0207680_10013527 Ga0207680_100135274 308
1331 3300025903 Ga0207680_10025017 Ga0207680_100250173 308
1332 3300025904 Ga0207647_10005467 Ga0207647_100054672 308
1333 3300025904 Ga0207647_10005974 Ga0207647_100059747 308
1334 3300025905 Ga0207685_10069164 Ga0207685_100691642 308
1335 3300025907 Ga0207645_10000100 Ga0207645_1000010045 308
1336 3300025907 Ga0207645_10062741 Ga0207645_100627413 308
1337 3300025908 Ga0207643_10000007 Ga0207643_10000007156 308
1338 3300025909 Ga0207705_10000002 Ga0207705_10000002891 308
1339 3300025910 Ga0207684_10238209 Ga0207684_102382092 308
1340 3300025911 Ga0207654_10000314 Ga0207654_1000031424 308
1341 3300025911 Ga0207654_10033564 Ga0207654_100335643 308
1342 3300025912 Ga0207707_10003553 Ga0207707_100035536 308
1343 3300025913 Ga0207695_10140940 Ga0207695_101409401 308
1344 3300025914 Ga0207671_10011777 Ga0207671_100117774 308
1345 3300025914 Ga0207671_10278907 Ga0207671_102789072 308
1346 3300025916 Ga0207663_10032113 Ga0207663_100321133 308
1347 3300025917 Ga0207660_10000041 Ga0207660_1000004127 308
1348 3300025917 Ga0207660_10026737 Ga0207660_100267374 308
1349 3300025918 Ga0207662_10000282 Ga0207662_1000028210 308
1350 3300025918 Ga0207662_10025433 Ga0207662_100254333 308
1351 3300025918 Ga0207662_10131399 Ga0207662_101313992 308
1352 3300025919 Ga0207657_10000519 Ga0207657_1000051947 308
1353 3300025919 Ga0207657_10003933 Ga0207657_1000393310 308
1354 3300025919 Ga0207657_10018028 Ga0207657_100180285 308
1355 3300025919 Ga0207657_10077974 Ga0207657_100779742 308
1356 3300025919 Ga0207657_10114073 Ga0207657_101140732 308
1357 3300025920 Ga0207649_10002204 Ga0207649_1000220411 308
1358 3300025920 Ga0207649_10120515 Ga0207649_101205152 308
1359 3300025923 Ga0207681_10000100 Ga0207681_1000010076 308
1360 3300025924 Ga0207694_10037389 Ga0207694_100373894 308
1361 3300025925 Ga0207650_10019786 Ga0207650_100197862 308
1362 3300025926 Ga0207659_10000044 Ga0207659_1000004491 308
1363 3300025927 Ga0207687_10000072 Ga0207687_1000007247 308
1364 3300025927 Ga0207687_10053669 Ga0207687_100536694 308
1365 3300025927 Ga0207687_10213845 Ga0207687_102138452 308
1366 3300025928 Ga0207700_10008381 Ga0207700_100083812 308
1367 3300025928 Ga0207700_10017558 Ga0207700_100175582 308
1368 3300025929 Ga0207664_10018577 Ga0207664_100185775 308
1369 3300025931 Ga0207644_10001432 Ga0207644_1000143210 308
1370 3300025931 Ga0207644_10013238 Ga0207644_100132384 308
1371 3300025932 Ga0207690_10000140 Ga0207690_1000014050 308
1372 3300025932 Ga0207690_10075849 Ga0207690_100758493 308
1373 3300025933 Ga0207706_10003180 Ga0207706_1000318011 308
1374 3300025933 Ga0207706_10126629 Ga0207706_101266291 308
1375 3300025933 Ga0207706_10161971 Ga0207706_101619712 308
1376 3300025934 Ga0207686_10000448 Ga0207686_1000044829 308
1377 3300025934 Ga0207686_10115276 Ga0207686_101152761 308
1378 3300025935 Ga0207709_10000154 Ga0207709_1000015494 308
1379 3300025936 Ga0207670_10000444 Ga0207670_1000044419 308
1380 3300025936 Ga0207670_10156746 Ga0207670_101567462 308
1381 3300025936 Ga0207670_10324460 Ga0207670_103244601 308
1382 3300025937 Ga0207669_10000176 Ga0207669_100001765 308
1383 3300025938 Ga0207704_10000086 Ga0207704_1000008618 308
1384 3300025938 Ga0207704_10030558 Ga0207704_100305584 308
1385 3300025939 Ga0207665_10000666 Ga0207665_1000066611 308
1386 3300025940 Ga0207691_10000214 Ga0207691_1000021445 308
1387 3300025941 Ga0207711_10001773 Ga0207711_1000177311 308
1388 3300025941 Ga0207711_10012916 Ga0207711_100129162 308
1389 3300025942 Ga0207689_10000366 Ga0207689_1000036641 308
1390 3300025942 Ga0207689_10038482 Ga0207689_100384822 308
1391 3300025944 Ga0207661_10000087 Ga0207661_1000008726 308
1392 3300025944 Ga0207661_10107424 Ga0207661_101074243 308
1393 3300025944 Ga0207661_10151138 Ga0207661_101511382 308
1394 3300025945 Ga0207679_10000029 Ga0207679_1000002941 308
1395 3300025945 Ga0207679_10149531 Ga0207679_101495311 308
1396 3300025949 Ga0207667_10034403 Ga0207667_100344034 308
1397 3300025960 Ga0207651_10000264 Ga0207651_100002648 308
1398 3300025960 Ga0207651_10149237 Ga0207651_101492372 308
1399 3300025961 Ga0207712_10000129 Ga0207712_1000012982 308
1400 3300025961 Ga0207712_10066481 Ga0207712_100664812 308
1401 3300025972 Ga0207668_10000100 Ga0207668_1000010060 308
1402 3300025986 Ga0207658_10020786 Ga0207658_100207863 308
1403 3300025986 Ga0207658_10187780 Ga0207658_101877802 308
1404 3300026023 Ga0207677_10059396 Ga0207677_100593963 308
1405 3300026041 Ga0207639_10002204 Ga0207639_1000220411 308
1406 3300026067 Ga0207678_10002814 Ga0207678_1000281411 308
1407 3300026067 Ga0207678_10005074 Ga0207678_100050746 308
1408 3300026075 Ga0207708_10001802 Ga0207708_1000180210 308
1409 3300026075 Ga0207708_10002366 Ga0207708_100023667 308
1410 3300026078 Ga0207702_10001819 Ga0207702_1000181914 308
1411 3300026088 Ga0207641_10000476 Ga0207641_1000047618 308
1412 3300026088 Ga0207641_10068621 Ga0207641_100686212 308
1413 3300026089 Ga0207648_10000072 Ga0207648_1000007218 308
1414 3300026089 Ga0207648_10051806 Ga0207648_100518063 308
1415 3300026089 Ga0207648_10087749 Ga0207648_100877492 308
1416 3300026095 Ga0207676_10000512 Ga0207676_1000051221 308
1417 3300026116 Ga0207674_10000697 Ga0207674_1000069725 308
1418 3300026116 Ga0207674_10011489 Ga0207674_100114895 308
1419 3300026116 Ga0207674_10164655 Ga0207674_101646552 308
1420 3300026118 Ga0207675_100002384 Ga0207675_10000238413 308
1421 3300026118 Ga0207675_100023832 Ga0207675_1000238324 308
1422 3300026121 Ga0207683_10000029 Ga0207683_1000002928 308
1423 3300026121 Ga0207683_10004241 Ga0207683_100042413 308
1424 3300026142 Ga0207698_10000523 Ga0207698_1000052321 308
1425 3300027364 Ga0209967_1003594 Ga0209967_10035942 308
1426 3300027512 Ga0209179_1000003 Ga0209179_100000375 308
1427 3300027682 Ga0209971_1011541 Ga0209971_10115413 308
1428 3300027682 Ga0209971_1016573 Ga0209971_10165732 308
1429 3300027695 Ga0209966_1003460 Ga0209966_10034603 308
1430 3300027717 Ga0209998_10001339 Ga0209998_100013395 308
1431 3300027717 Ga0209998_10001839 Ga0209998_100018392 308
1432 3300027876 Ga0209974_10002749 Ga0209974_100027492 308
1433 3300027907 Ga0207428_10000100 Ga0207428_10000100108 308
1434 3300027907 Ga0207428_10000115 Ga0207428_1000011563 308
1435 3300027907 Ga0207428_10000228 Ga0207428_1000022840 308
1436 3300028379 Ga0268266_10017979 Ga0268266_100179794 308
1437 3300028380 Ga0268265_10001240 Ga0268265_100012403 308
1438 3300028381 Ga0268264_10006796 Ga0268264_1000679611 308
1439 3300028381 Ga0268264_10153478 Ga0268264_101534782 308
1440 3300031238 Ga0265332_10074214 Ga0265332_100742142 308
1441 3300031241 Ga0265325_10014793 Ga0265325_100147934 308
1442 3300031247 Ga0265340_10033136 Ga0265340_100331363 308
1443 3300031344 Ga0265316_10041124 Ga0265316_100411245 308
1444 3300031548 Ga0307408_100050931 Ga0307408_1000509313 308
1445 3300031548 Ga0307408_100057956 Ga0307408_1000579562 308
1446 3300031548 Ga0307408_100111005 Ga0307408_1001110053 308
1447 3300031548 Ga0307408_100169313 Ga0307408_1001693132 308
1448 3300031730 Ga0307516_10014917 Ga0307516_100149172 308
1449 3300031731 Ga0307405_10057297 Ga0307405_100572972 308
1450 3300031824 Ga0307413_10021873 Ga0307413_100218733 308
1451 3300031824 Ga0307413_10049793 Ga0307413_100497933 308
1452 3300031852 Ga0307410_10051828 Ga0307410_100518282 308
1453 3300031901 Ga0307406_10031430 Ga0307406_100314304 308
1454 3300031901 Ga0307406_10045124 Ga0307406_100451244 308
1455 3300031903 Ga0307407_10023000 Ga0307407_100230003 308
1456 3300031903 Ga0307407_10304918 Ga0307407_103049181 308
1457 3300031911 Ga0307412_10090894 Ga0307412_100908943 308
1458 3300031911 Ga0307412_10125753 Ga0307412_101257533 308
1459 3300031995 Ga0307409_100055014 Ga0307409_1000550143 308
1460 3300031995 Ga0307409_100065630 Ga0307409_1000656302 308
1461 3300031995 Ga0307409_100287308 Ga0307409_1002873082 308
1462 3300032002 Ga0307416_100020106 Ga0307416_1000201065 308
1463 3300032002 Ga0307416_100063313 Ga0307416_1000633132 308
1464 3300032002 Ga0307416_100502261 Ga0307416_1005022612 308
1465 3300032004 Ga0307414_10012904 Ga0307414_100129046 308
1466 3300032004 Ga0307414_10014760 Ga0307414_100147602 308
1467 3300032004 Ga0307414_10151270 Ga0307414_101512702 308
1468 3300032004 Ga0307414_10309643 Ga0307414_103096432 308
1469 3300032005 Ga0307411_10018956 Ga0307411_100189564 308
1470 3300032005 Ga0307411_10024990 Ga0307411_100249903 308
1471 3300032126 Ga0307415_100065146 Ga0307415_1000651462 308
1472 3300034816 Ga0373930_0001541 Ga0373930_0001541_2499_3425 308
1473 3300034816 Ga0373930_0009273 Ga0373930_0009273_130_1056 308
1474 3300034817 Ga0373948_0000346 Ga0373948_0000346_1937_2863 308
1475 3300034818 Ga0373950_0000453 Ga0373950_0000453_476_1402 308
1476 3300034818 Ga0373950_0001749 Ga0373950_0001749_1859_2785 308
1477 3300034820 Ga0373959_0001859 Ga0373959_0001859_1645_2571 308
1478 3300034957 Ga0373938_0000565 Ga0373938_0000565_4798_5724 308
1479 3300034957 Ga0373938_0000859 Ga0373938_0000859_2985_3911 308
1480 3300034957 Ga0373938_0010089 Ga0373938_0010089_80_1006 308
1481 3300035083 Ga0373926_0014990 Ga0373926_0014990_288_1214 308
1482 3300035084 Ga0373928_0000893 Ga0373928_0000893_1107_2033 308
1483 3300035084 Ga0373928_0001974 Ga0373928_0001974_1821_2747 308
1484 3300035085 Ga0373929_0000957 Ga0373929_0000957_3915_4841 308
1485 3300035089 Ga0373944_0009683 Ga0373944_0009683_1035_1961 308
1486 3300035090 Ga0373949_0000284 Ga0373949_0000284_11309_12235 308
1487 3300035090 Ga0373949_0001993 Ga0373949_0001993_88_1014 308
1488 3300035091 Ga0373951_0000560 Ga0373951_0000560_985_1911 308
1489 3300035091 Ga0373951_0001866 Ga0373951_0001866_112_1038 308
1490 3300035091 Ga0373951_0005206 Ga0373951_0005206_547_1473 308
1491 3300035092 Ga0373952_0000135 Ga0373952_0000135_1007_1933 308
1492 3300035092 Ga0373952_0001907 Ga0373952_0001907_2837_3763 308
1493 3300035112 Ga0373932_0000172 Ga0373932_0000172_16150_17076 308
1494 3300035113 Ga0373936_0028869 Ga0373936_0028869_847_1806 308
1495 3300035114 Ga0373939_0001475 Ga0373939_0001475_3792_4718 308
1496 3300035114 Ga0373939_0001827 Ga0373939_0001827_1280_2206 308
1497 3300035115 Ga0373941_0000081 Ga0373941_0000081_13682_14608 308
1498 3300035121 Ga0373960_0001722 Ga0373960_0001722_985_1911 308
1499 3300035121 Ga0373960_0002628 Ga0373960_0002628_2469_3395 308
1500 3300035121 Ga0373960_0061296 Ga0373960_0061296_60_986 308
1501 3300035170 Ga0373943_0002637 Ga0373943_0002637_6044_6970 308
1502 3300035171 Ga0373946_0001719 Ga0373946_0001719_5408_6367 308
1503 3300035171 Ga0373946_0042235 Ga0373946_0042235_810_1736 308
1504 3300035172 Ga0373955_0008965 Ga0373955_0008965_2863_3822 308
1505 3300035172 Ga0373955_0110363 Ga0373955_0110363_21_959 308
1506 3300035207 Ga0373942_0000173 Ga0373942_0000173_14267_15193 308
1507 3300035207 Ga0373942_0001874 Ga0373942_0001874_2319_3245 308
1508 3300035241 Ga0373961_0000196 Ga0373961_0000196_25829_26755 308
1509 3300035242 Ga0373962_0000151 Ga0373962_0000151_5002_5928 308
1510 3300035410 Ga0373924_0006538 Ga0373924_0006538_2426_3385 308
1511 3300035691 Ga0373931_0001253 Ga0373931_0001253_8559_9485 308
1512 3300035691 Ga0373931_0009230 Ga0373931_0009230_1389_2315 308
1513 3300035691 Ga0373931_0046680 Ga0373931_0046680_220_1146 308
1514 3300035692 Ga0373935_0004350 Ga0373935_0004350_5009_5935 308
1515 3300035692 Ga0373935_0040168 Ga0373935_0040168_152_1111 308
1516 3300035695 Ga0373927_0027756 Ga0373927_0027756_2741_3667 308
1517 3300035695 Ga0373927_0075379 Ga0373927_0075379_326_1252 308
1518 3300035724 Ga0373933_0000697 Ga0373933_0000697_14391_15341 308
1519 3300035725 Ga0373947_0015465 Ga0373947_0015465_2953_3879 308
1520 3300036401 Ga0373937_0023630 Ga0373937_0023630_4344_5303 308
1521 3300036401 Ga0373937_0033607 Ga0373937_0033607_1330_2289 308
1522 3300037068 Ga0373925_0025122 Ga0373925_0025122_3386_4312 308
1523 3300037068 Ga0373925_0058161 Ga0373925_0058161_1117_2076 308
1524 3300037068 Ga0373925_0099769 Ga0373925_0099769_1084_2010 308
1525 3300037418 Ga0395900_0339552 Ga0395900_0339552_482_1408 308
1526 3300037471 Ga0395905_0001381 Ga0395905_0001381_22273_23199 308
1527 3300039437 Ga0436365_0007777 Ga0436365_0007777_1024_1950 308
1528 3300042006 Ga0439432_017279 Ga0439432_017279_510_1448 308
1529 3300042436 Ga0439435_0049467 Ga0439435_0049467_53_979 308
1530 3300042876 Ga0451577_0025411 Ga0451577_0025411_4004_4930 308
1531 3300044656 Ga0466969_0058844 Ga0466969_0058844_48_995 308
1532 3300044712 Ga0453684_0235668 Ga0453684_0235668_381_1307 308
1533 3300045051 Ga0451576_0184521 Ga0451576_0184521_95_1021 308
1534 3300046452 Ga0495617_028012 Ga0495617_028012_18_977 308
1535 3300046459 Ga0495629_0000280 Ga0495629_0000280_6748_7674 308
1536 3300046459 Ga0495629_0110151 Ga0495629_0110151_417_1376 308
1537 3300046460 Ga0495638_0088100 Ga0495638_0088100_97_1023 308
1538 3300046461 Ga0495641_0044804 Ga0495641_0044804_804_1763 308
1539 3300046462 Ga0495651_0001797 Ga0495651_0001797_6533_7492 308
1540 3300046463 Ga0495653_0103650 Ga0495653_0103650_706_1632 308
1541 3300046463 Ga0495653_0109734 Ga0495653_0109734_777_1736 308
1542 3300046472 Ga0495580_0024266 Ga0495580_0024266_1651_2610 308
1543 3300046473 Ga0495582_0005522 Ga0495582_0005522_3082_4008 308
1544 3300046475 Ga0495639_0038346 Ga0495639_0038346_246_1172 308
1545 3300046476 Ga0495662_0018057 Ga0495662_0018057_804_1763 308
1546 3300046491 Ga0495584_0044126 Ga0495584_0044126_68_1027 308
1547 3300046492 Ga0495585_0000974 Ga0495585_0000974_15972_16931 308
1548 3300046499 Ga0495594_0044111 Ga0495594_0044111_541_1467 308
1549 3300046501 Ga0495607_0011320 Ga0495607_0011320_3963_4922 308
1550 3300046511 Ga0495608_0014611 Ga0495608_0014611_576_1535 308
1551 3300046514 Ga0495618_0180488 Ga0495618_0180488_30_956 308
1552 3300046516 Ga0495628_0003390 Ga0495628_0003390_12801_13760 308
1553 3300046516 Ga0495628_0018942 Ga0495628_0018942_2021_2980 308
1554 3300046517 Ga0495630_0080217 Ga0495630_0080217_544_1503 308
1555 3300046523 Ga0495644_0002940 Ga0495644_0002940_2770_3729 308
1556 3300046525 Ga0495663_0016868 Ga0495663_0016868_215_1174 308
1557 3300046526 Ga0495666_0004626 Ga0495666_0004626_590_1549 308
1558 3300046526 Ga0495666_0023858 Ga0495666_0023858_1794_2720 308
1559 3300046529 Ga0495652_0034324 Ga0495652_0034324_817_1776 308
1560 3300046531 Ga0495665_0030354 Ga0495665_0030354_1005_1964 308
1561 3300046533 Ga0495640_0027286 Ga0495640_0027286_786_1712 308
1562 3300046537 Ga0495598_0009092 Ga0495598_0009092_418_1377 308
1563 3300046543 Ga0495645_0031265 Ga0495645_0031265_2736_3695 308
1564 3300046557 Ga0495622_0005155 Ga0495622_0005155_3645_4604 308
1565 3300046557 Ga0495622_0152561 Ga0495622_0152561_65_991 308
1566 3300046558 Ga0495633_0002331 Ga0495633_0002331_2601_3560 308
1567 3300046559 Ga0495667_0009295 Ga0495667_0009295_5015_5974 308
1568 3300046615 Ga0495656_0000276 Ga0495656_0000276_10312_11271 308
1569 3300046642 Ga0495634_0062371 Ga0495634_0062371_1140_2066 308
1570 3300046648 Ga0495611_0004478 Ga0495611_0004478_312_1271 308
1571 3300046674 Ga0495588_0012125 Ga0495588_0012125_2101_3060 308
1572 3300046678 Ga0495599_0011975 Ga0495599_0011975_2049_3008 308
1573 3300046680 Ga0495646_0114495 Ga0495646_0114495_457_1416 308
1574 3300046681 Ga0495647_0003761 Ga0495647_0003761_3278_4237 308
1575 3300046681 Ga0495647_0004239 Ga0495647_0004239_3623_4549 308
1576 3300046683 Ga0495658_0001282 Ga0495658_0001282_3251_4177 308
1577 3300046683 Ga0495658_0012893 Ga0495658_0012893_2787_3713 308
1578 3300046683 Ga0495658_0041311 Ga0495658_0041311_1333_2292 308
1579 3300046689 Ga0495613_0062257 Ga0495613_0062257_1518_2444 308
1580 3300046689 Ga0495613_0244584 Ga0495613_0244584_90_1016 308
1581 3300046690 Ga0495624_0006348 Ga0495624_0006348_685_1644 308
1582 3300046690 Ga0495624_0037078 Ga0495624_0037078_164_1126 308
1583 3300046692 Ga0495671_0006594 Ga0495671_0006594_4864_5805 308
1584 3300046809 Ga0495600_0024809 Ga0495600_0024809_1437_2396 308
1585 3300047315 Ga0495581_0061591 Ga0495581_0061591_794_1753 308
1586 3300047317 Ga0495604_0049006 Ga0495604_0049006_1313_2272 308
1587 3300047319 Ga0495674_0011609 Ga0495674_0011609_2102_3028 308
1588 3300047321 Ga0495676_0025908 Ga0495676_0025908_2445_3404 308
1589 3300047322 Ga0495680_0004358 Ga0495680_0004358_9413_10372 308
1590 3300047322 Ga0495680_0023741 Ga0495680_0023741_3495_4454 308
1591 3300047446 Ga0495679_049399 Ga0495679_049399_90_1049 308
1592 3300047471 Ga0495684_0041933 Ga0495684_0041933_2132_3091 308
1593 3300047472 Ga0495686_0141420 Ga0495686_0141420_272_1246 308
1594 3300047673 Ga0495593_0008133 Ga0495593_0008133_4602_5561 308
1595 3300048088 Ga0495602_0004518 Ga0495602_0004518_3108_4067 308
1596 3300048088 Ga0495602_0325781 Ga0495602_0325781_38_997 308
1597 3300048089 Ga0495614_0011280 Ga0495614_0011280_1409_2368 308
1598 3300048903 Ga0496100_0000530 Ga0496100_0000530_14387_15313 308
1599 3300048903 Ga0496100_0010450 Ga0496100_0010450_881_1807 308
1600 3300048904 Ga0496101_0000189 Ga0496101_0000189_28699_29625 308
1601 3300048904 Ga0496101_0006701 Ga0496101_0006701_1227_2153 308
1602 3300048905 Ga0496102_0024990 Ga0496102_0024990_3037_3963 308
1603 3300048905 Ga0496102_0041225 Ga0496102_0041225_781_1707 308
1604 3300048906 Ga0496103_0007850 Ga0496103_0007850_4308_5234 308
1605 3300048907 Ga0496104_0000508 Ga0496104_0000508_14910_15848 308
1606 3300048907 Ga0496104_0001997 Ga0496104_0001997_10062_10988 308
1607 3300048907 Ga0496104_0006052 Ga0496104_0006052_90_1028 308
1608 3300048907 Ga0496104_0059191 Ga0496104_0059191_2416_3342 308
1609 3300048907 Ga0496104_0063090 Ga0496104_0063090_649_1575 308
1610 3300048907 Ga0496104_0228172 Ga0496104_0228172_677_1645 308
1611 3300048908 Ga0496105_0006301 Ga0496105_0006301_1864_2790 308
1612 3300048908 Ga0496105_0016135 Ga0496105_0016135_2508_3446 308
1613 3300048908 Ga0496105_0122035 Ga0496105_0122035_546_1472 308
1614 3300048908 Ga0496105_0135232 Ga0496105_0135232_168_1136 308
1615 3300048908 Ga0496105_0254213 Ga0496105_0254213_109_1035 308
1616 3300048909 Ga0496106_0016847 Ga0496106_0016847_3583_4509 308
1617 3300048909 Ga0496106_0017851 Ga0496106_0017851_141_1067 308
1618 3300048909 Ga0496106_0438482 Ga0496106_0438482_14_940 308
1619 3300048910 Ga0496107_0003085 Ga0496107_0003085_803_1729 308
1620 3300048910 Ga0496107_0011126 Ga0496107_0011126_3979_4905 308
1621 3300048910 Ga0496107_0018052 Ga0496107_0018052_3261_4187 308
1622 3300048911 Ga0496108_0002465 Ga0496108_0002465_13299_14225 308
1623 3300048911 Ga0496108_0004455 Ga0496108_0004455_9151_10077 308
1624 3300048911 Ga0496108_0004887 Ga0496108_0004887_6319_7245 308
1625 3300048911 Ga0496108_0265285 Ga0496108_0265285_304_1230 308
1626 3300048912 Ga0496109_0000488 Ga0496109_0000488_10090_11016 308
1627 3300048912 Ga0496109_0005024 Ga0496109_0005024_9395_10363 308
1628 3300048912 Ga0496109_0006884 Ga0496109_0006884_47_973 308
1629 3300048912 Ga0496109_0009996 Ga0496109_0009996_3739_4665 308
1630 3300048913 Ga0496110_0031059 Ga0496110_0031059_3030_3956 308
1631 3300048913 Ga0496110_0074590 Ga0496110_0074590_1784_2752 308
1632 3300048914 Ga0496111_0008713 Ga0496111_0008713_1437_2363 308
1633 3300048914 Ga0496111_0020669 Ga0496111_0020669_2812_3738 308
1634 3300048914 Ga0496111_0079806 Ga0496111_0079806_1419_2345 308
1635 3300048914 Ga0496111_0083151 Ga0496111_0083151_1176_2102 308
1636 3300048915 Ga0496112_0002869 Ga0496112_0002869_1822_2781 308
1637 3300048915 Ga0496112_0006900 Ga0496112_0006900_3096_4064 308
1638 3300048915 Ga0496112_0018028 Ga0496112_0018028_4244_5170 308
1639 3300048915 Ga0496112_0053933 Ga0496112_0053933_2284_3210 308
1640 3300048916 Ga0496113_0002209 Ga0496113_0002209_4200_5126 308
1641 3300048916 Ga0496113_0002579 Ga0496113_0002579_5920_6846 308
1642 3300048916 Ga0496113_0075116 Ga0496113_0075116_261_1229 308
1643 3300048916 Ga0496113_0106377 Ga0496113_0106377_140_1066 308
1644 3300048917 Ga0496114_0001960 Ga0496114_0001960_8747_9673 308
1645 3300048917 Ga0496114_0006147 Ga0496114_0006147_5864_6790 308
1646 3300048918 Ga0496115_0002442 Ga0496115_0002442_5748_6674 308
1647 3300048918 Ga0496115_0014481 Ga0496115_0014481_279_1217 308
1648 3300048918 Ga0496115_0076158 Ga0496115_0076158_920_1846 308
1649 3300048918 Ga0496115_0342826 Ga0496115_0342826_51_977 308
1650 3300048929 Ga0496126_0435441 Ga0496126_0435441_110_1048 308
1651 3300049513 Ga0501290_000772 Ga0501290_000772_1202_2134 308
1652 3300049515 Ga0501292_000014 Ga0501292_000014_24050_24982 308
1653 3300049517 Ga0501294_000889 Ga0501294_000889_1131_2063 308
1654 3300049523 Ga0501300_000229 Ga0501300_000229_5572_6504 308
1655 3300049568 Ga0501031_0012923 Ga0501031_0012923_2669_3595 308
1656 3300049570 Ga0501033_0040028 Ga0501033_0040028_1733_2659 308
1657 3300049570 Ga0501033_0085408 Ga0501033_0085408_453_1379 308
1658 3300049570 Ga0501033_0127630 Ga0501033_0127630_59_985 308
1659 3300049571 Ga0501034_0000850 Ga0501034_0000850_7695_8621 308
1660 3300049571 Ga0501034_0099018 Ga0501034_0099018_61_987 308
1661 3300049571 Ga0501034_0192062 Ga0501034_0192062_855_1781 308
1662 3300049571 Ga0501034_0406821 Ga0501034_0406821_283_1209 308
1663 3300049572 Ga0501036_0004935 Ga0501036_0004935_7695_8621 308
1664 3300049572 Ga0501036_0007504 Ga0501036_0007504_6003_6929 308
1665 3300049572 Ga0501036_0077541 Ga0501036_0077541_1551_2477 308
1666 3300049572 Ga0501036_0143194 Ga0501036_0143194_74_1000 308
1667 3300049573 Ga0501037_0001864 Ga0501037_0001864_6453_7379 308
1668 3300049573 Ga0501037_0027622 Ga0501037_0027622_2885_3826 308
1669 3300049573 Ga0501037_0033704 Ga0501037_0033704_1042_1968 308
1670 3300049574 Ga0501038_0009937 Ga0501038_0009937_7028_7954 308
1671 3300049574 Ga0501038_0044912 Ga0501038_0044912_1072_1998 308
1672 3300049574 Ga0501038_0066126 Ga0501038_0066126_1987_2928 308
1673 3300049575 Ga0501039_0040832 Ga0501039_0040832_681_1607 308
1674 3300049575 Ga0501039_0049595 Ga0501039_0049595_1397_2323 308
1675 3300049575 Ga0501039_0087269 Ga0501039_0087269_132_1058 308
1676 3300049576 Ga0501040_0146866 Ga0501040_0146866_651_1577 308
1677 3300049578 Ga0501042_0097714 Ga0501042_0097714_695_1621 308
1678 3300049579 Ga0501043_0015869 Ga0501043_0015869_3890_4816 308
1679 3300049579 Ga0501043_0063213 Ga0501043_0063213_190_1116 308
1680 3300049579 Ga0501043_0076108 Ga0501043_0076108_845_1771 308
1681 3300049580 Ga0501046_0013310 Ga0501046_0013310_545_1471 308
1682 3300049581 Ga0501047_0000455 Ga0501047_0000455_36603_37529 308
1683 3300049581 Ga0501047_0025946 Ga0501047_0025946_3193_4119 308
1684 3300049581 Ga0501047_0054513 Ga0501047_0054513_540_1466 308
1685 3300049581 Ga0501047_0079140 Ga0501047_0079140_1384_2310 308
1686 3300049581 Ga0501047_0161880 Ga0501047_0161880_447_1388 308
1687 3300049582 Ga0501048_0001113 Ga0501048_0001113_7645_8571 308
1688 3300049582 Ga0501048_0164118 Ga0501048_0164118_567_1493 308
1689 3300049586 Ga0501070_0028051 Ga0501070_0028051_1057_1983 308
1690 3300049586 Ga0501070_0043105 Ga0501070_0043105_2435_3361 308
1691 3300049586 Ga0501070_0186535 Ga0501070_0186535_65_991 308
1692 3300049589 Ga0501073_0052331 Ga0501073_0052331_1174_2100 308
1693 3300049589 Ga0501073_0127602 Ga0501073_0127602_581_1507 308
1694 3300049590 Ga0501074_0053579 Ga0501074_0053579_570_1496 308
1695 3300049653 Ga0501206_000816 Ga0501206_000816_1695_2627 308
1696 3300049663 Ga0501223_000250 Ga0501223_000250_4744_5676 308
1697 3300049664 Ga0501224_000750 Ga0501224_000750_1595_2527 308
1698 3300049665 Ga0501227_009571 Ga0501227_009571_466_1398 308
1699 3300049669 Ga0501235_001772 Ga0501235_001772_848_1780 308
1700 3300049690 Ga0501261_000003 Ga0501261_000003_8879_9811 308
1701 3300049705 Ga0501225_0000710 Ga0501225_0000710_4409_5341 308
1702 3300049708 Ga0501245_001564 Ga0501245_001564_1202_2134 308
1703 3300049741 Ga0501079_0021435 Ga0501079_0021435_2682_3608 308
1704 3300049742 Ga0501080_0005235 Ga0501080_0005235_9830_10756 308
1705 3300049742 Ga0501080_0009477 Ga0501080_0009477_5522_6448 308
1706 3300049744 Ga0501083_0000437 Ga0501083_0000437_18106_19032 308
1707 3300049775 Ga0501279_000007 Ga0501279_000007_35204_36136 308
1708 3300049776 Ga0501280_000284 Ga0501280_000284_4888_5820 308
1709 3300049777 Ga0501281_00155 Ga0501281_00155_4005_4937 308
1710 3300049822 Ga0501035_0006586 Ga0501035_0006586_4433_5359 308
1711 3300049822 Ga0501035_0010086 Ga0501035_0010086_2285_3211 308
1712 3300049823 Ga0501044_0015397 Ga0501044_0015397_2112_3038 308
1713 3300049823 Ga0501044_0074906 Ga0501044_0074906_796_1737 308
1714 3300049823 Ga0501044_0110579 Ga0501044_0110579_1623_2549 308
1715 3300049823 Ga0501044_0206168 Ga0501044_0206168_298_1224 308
1716 3300050489 nmdc:mga03683_81463_c1 nmdc:mga03683_81463_c1_346_1383 308
1717 3300050492 nmdc:mga0yw44_91919_c1 nmdc:mga0yw44_91919_c1_597_1523 308
1718 3300050494 nmdc:mga06z11_85576_c1 nmdc:mga06z11_85576_c1_757_1683 308
1719 3300050507 nmdc:mga05p37_11853_c1 nmdc:mga05p37_11853_c1_5411_6337 308
1720 3300050507 nmdc:mga05p37_505_c1 nmdc:mga05p37_505_c1_15937_16863 308
1721 3300050509 nmdc:mga0qj67_859_c1 nmdc:mga0qj67_859_c1_17965_18891 308
1722 3300050510 nmdc:mga06r32_10551_c1 nmdc:mga06r32_10551_c1_7314_8240 308
1723 3300050510 nmdc:mga06r32_225713_c1 nmdc:mga06r32_225713_c1_795_1721 308
1724 3300050510 nmdc:mga06r32_414258_c1 nmdc:mga06r32_414258_c1_183_1109 308
1725 3300050511 nmdc:mga08y16_11105_c1 nmdc:mga08y16_11105_c1_2842_3768 308
1726 3300050511 nmdc:mga08y16_66746_c1 nmdc:mga08y16_66746_c1_1519_2445 308
1727 3300050511 nmdc:mga08y16_78683_c1 nmdc:mga08y16_78683_c1_2261_3187 308
1728 3300050511 nmdc:mga08y16_82852_c1 nmdc:mga08y16_82852_c1_2199_3125 308
1729 3300050512 nmdc:mga0n895_13449_c1 nmdc:mga0n895_13449_c1_2654_3580 308
1730 3300050512 nmdc:mga0n895_189973_c1 nmdc:mga0n895_189973_c1_372_1367 308
1731 3300050512 nmdc:mga0n895_2584_c1 nmdc:mga0n895_2584_c1_10612_11538 308
1732 3300050512 nmdc:mga0n895_3537_c1 nmdc:mga0n895_3537_c1_3009_3935 308
1733 3300050512 nmdc:mga0n895_74991_c1 nmdc:mga0n895_74991_c1_562_1488 308
1734 3300050513 nmdc:mga0rr50_1087_c1 nmdc:mga0rr50_1087_c1_8190_9116 308
1735 3300050513 nmdc:mga0rr50_125753_c1 nmdc:mga0rr50_125753_c1_959_1954 308
1736 3300050513 nmdc:mga0rr50_50121_c1 nmdc:mga0rr50_50121_c1_952_1878 308
1737 3300050515 nmdc:mga0a205_1492_c1 nmdc:mga0a205_1492_c1_6092_7018 308
1738 3300050515 nmdc:mga0a205_55693_c1 nmdc:mga0a205_55693_c1_1232_2158 308
1739 3300053077 Ga0495601_0000958 Ga0495601_0000958_11923_12882 308
1740 3300053077 Ga0495601_0002291 Ga0495601_0002291_6577_7503 308
1741 3300053078 Ga0495612_0000276 Ga0495612_0000276_14760_15719 308
1742 3300053078 Ga0495612_0006758 Ga0495612_0006758_944_1903 308
1743 3300053084 Ga0495595_0000596 Ga0495595_0000596_7360_8319 308
1744 3300053084 Ga0495595_0003189 Ga0495595_0003189_787_1746 308
1745 3300053085 Ga0495619_0000211 Ga0495619_0000211_21203_22129 308
1746 3300053085 Ga0495619_0000763 Ga0495619_0000763_8863_9822 308
1747 3300053085 Ga0495619_0020471 Ga0495619_0020471_1535_2461 308
1748 3300053087 Ga0500643_017565 Ga0500643_017565_899_1837 308
1749 3300053088 Ga0500644_0000896 Ga0500644_0000896_153_1079 308
1750 3300053093 Ga0500651_0006575 Ga0500651_0006575_662_1588 308
1751 3300053118 Ga0500594_0007592 Ga0500594_0007592_591_1532 308
1752 3300053119 Ga0500595_000002 Ga0500595_000002_688148_689086 308
1753 3300053139 Ga0500568_0004261 Ga0500568_0004261_5118_6065 308
1754 3300053153 Ga0500616_0000002 Ga0500616_0000002_736445_737371 308
1755 3300053153 Ga0500616_0006540 Ga0500616_0006540_3105_4031 308
1756 3300060353 Ga0501082_0000008 Ga0501082_0000008_42235_43161 308
1757 3300060353 Ga0501082_0111143 Ga0501082_0111143_974_1900 308
1758 3300061734 Ga0530510_0381959 Ga0530510_0381959_108_1034 308

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

67

209

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
6z4w-assembly1.cif.gz_A ftse structure from streptococcus pneumoniae in complex with adp (space group p 1) 0.946 2 218
3c41-assembly1.cif.gz_K abc protein artp in complex with amp-pnp/mg2+ 0.9396 3 213
4u00-assembly1.cif.gz_A crystal structure of ttha1159 in complex with adp 0.9364 3 222
7ahc-assembly1.cif.gz_C opua apo inward-facing 0.9337 5 222
7nnu-assembly1.cif.gz_A cryo-em structure of the folate-specific ecf transporter complex in msp2n2 lipid nanodiscs 0.9335 3 211
ID Description Score Start End Superfamily
af_A1ZBS3_1241_1472_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9478 5 213 3.40.50.300
af_O05779_1_226_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9478 4 218 3.40.50.300
af_P0A9R7_1_220_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9438 5 213 3.40.50.300
af_Q2G1L8_1_252_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9435 2 220 3.40.50.300
af_Q1RS86_918_1157_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9434 1 208 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A7Y4ZA76-F1-model_v4 ABC transporter ATP-binding protein 0.9798 2 213 GO:0005524
GO:0016887
AF-A0A5E6MKN0-F1-model_v4 Daunorubicin/doxorubicin resistance ATP-binding protein DrrA (EC 3.6.3.-) 0.9616 2 213 GO:0005524
GO:0016887
AF-A0A0U3H3Q4-F1-model_v4 ABC transporter ATP-binding protein 0.9582 2 222 GO:0005524
GO:0016887
AF-A0A348B4H2-F1-model_v4 ABC transporter domain-containing protein 0.9581 34 222 GO:0005524
GO:0016887
AF-A0A2W7B2T3-F1-model_v4 Multidrug ABC transporter ATP-binding protein 0.9567 2 207 GO:0005524
GO:0016887

Feature Viewer

pLDDT pTM Quality
89.7 0.8 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map