F495544

General Info

Members Datasets Scaffolds Average Seq Length
1741 465 1741 180

Family's Representative Sequence

Representative Sequence 3300009545|Ga0105237_10371453|Ga0105237_103714532
Length 209
Sequence MGIQCDNFRSNIQNHFGKHCTGEKTMMPLIVIGILVVGAIFILAGMYNSLVQLRVRADSAWSDIDVQLKRRHDLIPNLVETVKGYAAHEKGTFENIAKFRSQAMQATTPADKAQAEGQLTGALKSLFAVAENYPELKASEQFTGLQSXXNXXEDNIQNARRYYNAVVRDFNTRVQSFPTNIIAGMFGFHARQFFEMETPADRENVAVKF

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
3 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
4 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
5 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
6 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
7 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
8 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
9 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
10 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
11 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
12 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
13 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
14 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
15 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
16 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
17 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
18 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
19 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
20 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
21 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
22 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
23 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
24 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
25 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
26 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
27 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
28 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
29 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
30 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
31 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
32 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
33 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
34 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
35 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
36 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
37 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
38 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
39 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
40 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
41 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
42 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
43 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
44 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
45 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
46 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
47 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
48 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
49 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
50 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
51 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
52 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
53 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
54 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
55 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
56 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
57 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
58 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
59 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
60 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
61 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
62 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
63 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
64 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
65 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
66 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
67 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
68 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
69 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
70 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
71 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
72 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
73 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
74 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
75 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
76 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
77 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
78 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
79 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
80 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
81 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
82 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
83 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
84 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
85 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
86 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
87 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
88 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
89 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
90 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
91 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
92 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
93 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
94 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
95 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
96 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
97 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
98 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
99 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
100 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
101 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
102 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
103 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
104 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
105 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
106 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
107 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
108 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
109 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
110 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
111 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
112 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
113 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
114 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
115 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
116 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
117 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
118 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
119 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
120 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
121 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
122 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
123 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
124 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
125 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
126 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
127 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
128 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
129 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
130 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
131 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
132 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
133 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
134 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
135 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
136 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
137 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
138 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
139 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
140 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
141 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
142 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
143 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
144 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
145 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
146 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
147 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
148 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
149 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
150 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
151 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
152 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
153 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
154 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
155 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
156 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
157 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
158 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
159 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
160 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
161 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
162 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
163 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
164 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
165 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
229 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
233 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
234 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
235 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
236 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
237 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
238 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
239 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
240 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
241 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
242 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
243 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
244 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
245 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
246 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
248 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
249 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
250 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
251 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
252 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
253 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
254 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
255 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
256 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
257 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
258 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
259 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
260 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
261 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
262 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
263 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
264 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
265 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
266 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
267 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
268 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
269 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
270 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
271 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
272 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
273 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
274 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
275 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
276 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
277 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
278 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
279 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
280 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
281 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
282 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
283 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
284 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
285 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
286 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
287 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
288 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
289 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
290 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
291 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
292 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
293 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
294 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
295 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
296 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
297 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
298 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
299 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
300 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
301 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
302 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
303 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
304 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
305 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
306 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
307 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
308 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
309 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
310 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
311 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
312 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
313 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
314 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
315 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
316 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
317 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
318 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
319 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
320 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
321 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
322 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
323 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
324 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
325 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
326 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
327 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
328 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
329 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
330 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
331 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
332 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
333 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
334 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
335 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
336 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
337 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
338 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
339 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
340 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
341 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
342 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
343 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
344 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
345 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
346 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
347 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
348 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
349 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
350 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
351 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
352 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
353 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
354 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
355 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
356 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
357 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
358 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
359 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
360 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
361 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
362 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
363 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
364 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
365 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
366 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
367 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
368 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
369 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
370 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
371 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
372 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
373 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
374 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
375 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
376 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
377 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
378 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
379 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
380 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
381 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
382 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
383 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
384 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
385 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
386 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
387 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
388 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
389 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
390 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
391 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
392 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
393 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
394 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
395 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
396 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
397 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
398 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
399 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
400 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
401 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
402 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
403 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
404 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
405 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
406 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
407 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
408 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
409 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
410 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
411 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
412 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
413 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
414 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
415 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
416 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
417 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
418 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
419 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
420 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
421 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
422 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
423 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
424 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
425 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
426 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
427 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
428 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
429 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
430 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
431 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
432 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
433 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
434 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
435 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
436 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
437 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
438 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
439 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
440 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
441 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
442 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
443 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
444 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
445 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
446 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
447 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
448 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
449 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
450 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
451 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
452 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
453 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
454 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
455 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
456 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
457 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
458 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
459 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
460 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
461 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
462 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
463 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
464 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
465 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.85
Metatranscriptomes 1.15
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.86
Nodule 0
Rhizoplane 7.24
Rhizosphere 90.98
Stem 0
Stem Tuber 0
Unclassified 0.92

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_10465430 2162886012 Bacteria 906
2 ARcpr5yngRDRAFT_c007790 3300000043 Bacteria 934
3 ARSoilOldRDRAFT_c005492 3300000044 Bacteria 1068
4 ARCol0yngRDRAFT_1004408 3300000652 Bacteria 1023
5 JGI24752J21851_1000481 3300001976 Bacteria 5340
6 JGI24747J21853_1003305 3300001978 Unclassified 1388
7 JGI24748J21848_1004413 3300002074 Bacteria 1615
8 JGI24738J21930_10070394 3300002075 Unclassified 724
9 JGI24749J21850_1021608 3300002076 Bacteria 911
10 JGI24034J26672_10002026 3300002239 Bacteria 2749
11 JGI24751J29686_10006924 3300002459 Bacteria 2312
12 rootH2_10000244 3300003320 Bacteria 697651
13 rootH1_10360082 3300003323 Bacteria 1920
14 Ga0006562J51391_1037240 3300003578 Bacteria 1700
15 Ga0058863_10041361 3300004799 Bacteria 889
16 Ga0058863_11504263 3300004799 Bacteria 1153
17 Ga0058860_11414818 3300004801 Unclassified 750
18 Ga0058862_12075184 3300004803 Bacteria 1382
19 Ga0065712_10076396 3300005290 Bacteria 3669
20 Ga0065712_10079424 3300005290 Unclassified 3219
21 Ga0065712_10479653 3300005290 Bacteria 664
22 Ga0065715_10000426 3300005293 Bacteria 19372
23 Ga0065715_10101767 3300005293 Unclassified 3173
24 Ga0065715_10105520 3300005293 Unclassified 2888
25 Ga0065715_10479286 3300005293 Bacteria 799
26 Ga0065707_10140158 3300005295 Bacteria 1784
27 Ga0065707_10373448 3300005295 Unclassified 887
28 Ga0065707_10442587 3300005295 Bacteria 808
29 Ga0070658_10000415 3300005327 Bacteria 36949
30 Ga0070658_10013843 3300005327 Bacteria 6474
31 Ga0070658_10063359 3300005327 Bacteria 3014
32 Ga0070676_10013881 3300005328 Unclassified 4419
33 Ga0070676_10083314 3300005328 Bacteria 1945
34 Ga0070676_10093002 3300005328 Unclassified 1851
35 Ga0070676_10323154 3300005328 Bacteria 1053
36 Ga0070683_100007493 3300005329 Bacteria 9224
37 Ga0070683_100028438 3300005329 Bacteria 5052
38 Ga0070683_100130767 3300005329 Unclassified 2376
39 Ga0070683_101094204 3300005329 Bacteria 765
40 Ga0070683_101219870 3300005329 Bacteria 723
41 Ga0070690_100033519 3300005330 Unclassified 3216
42 Ga0070690_100051706 3300005330 Bacteria 2624
43 Ga0070690_100114469 3300005330 Bacteria 1804
44 Ga0070690_100268639 3300005330 Bacteria 1212
45 Ga0070670_100033325 3300005331 Bacteria 4436
46 Ga0070670_100093976 3300005331 Bacteria 2579
47 Ga0068869_100024792 3300005334 Bacteria 4157
48 Ga0068869_100114402 3300005334 Bacteria 2056
49 Ga0068869_100184223 3300005334 Bacteria 1638
50 Ga0070666_10015277 3300005335 Bacteria 4896
51 Ga0070666_10028837 3300005335 Unclassified 3645
52 Ga0070666_10128994 3300005335 Bacteria 1756
53 Ga0070680_100001534 3300005336 Bacteria 16834
54 Ga0070680_100008338 3300005336 Bacteria 7930
55 Ga0070680_100117900 3300005336 Bacteria 2214
56 Ga0070680_100147484 3300005336 Bacteria 1974
57 Ga0070680_100156993 3300005336 Bacteria 1911
58 Ga0070680_100178114 3300005336 Bacteria 1790
59 Ga0070680_100280149 3300005336 Bacteria 1413
60 Ga0070680_100843899 3300005336 Bacteria 790
61 Ga0070680_101047478 3300005336 Bacteria 705
62 Ga0070682_100021067 3300005337 Bacteria 3842
63 Ga0070682_100116890 3300005337 Bacteria 1785
64 Ga0070682_100139439 3300005337 Bacteria 1651
65 Ga0070682_100366757 3300005337 Bacteria 1078
66 Ga0070682_100579563 3300005337 Unclassified 882
67 Ga0068868_100001807 3300005338 Bacteria 14693
68 Ga0068868_100011209 3300005338 Bacteria 6528
69 Ga0068868_100016893 3300005338 Bacteria 5429
70 Ga0068868_100031985 3300005338 Bacteria 4045
71 Ga0068868_100056205 3300005338 Unclassified 3107
72 Ga0068868_100096085 3300005338 Unclassified 2393
73 Ga0068868_100190940 3300005338 Bacteria 1703
74 Ga0068868_101417912 3300005338 Bacteria 648
75 Ga0070660_100002598 3300005339 Bacteria 12395
76 Ga0070660_100011061 3300005339 Bacteria 6398
77 Ga0070660_100033849 3300005339 Bacteria 3855
78 Ga0070660_100198155 3300005339 Bacteria 1628
79 Ga0070689_100007514 3300005340 Bacteria 7627
80 Ga0070689_100052150 3300005340 Unclassified 3164
81 Ga0070689_100124353 3300005340 Bacteria 2063
82 Ga0070689_101235810 3300005340 Bacteria 671
83 Ga0070691_10028917 3300005341 Unclassified 2592
84 Ga0070687_100082981 3300005343 Unclassified 1754
85 Ga0070687_100126158 3300005343 Bacteria 1471
86 Ga0070687_100364756 3300005343 Bacteria 936
87 Ga0070661_100004168 3300005344 Bacteria 9976
88 Ga0070661_100065186 3300005344 Unclassified 2677
89 Ga0070661_100165133 3300005344 Bacteria 1679
90 Ga0070661_100709575 3300005344 Bacteria 820
91 Ga0070668_100004857 3300005347 Bacteria 9958
92 Ga0070668_100058931 3300005347 Bacteria 2972
93 Ga0070668_100083953 3300005347 Bacteria 2501
94 Ga0070669_100002184 3300005353 Bacteria 14162
95 Ga0070669_100081119 3300005353 Unclassified 2416
96 Ga0070669_100160756 3300005353 Bacteria 1745
97 Ga0070669_100401410 3300005353 Bacteria 1121
98 Ga0070675_100006210 3300005354 Bacteria 9164
99 Ga0070675_100139800 3300005354 Unclassified 2069
100 Ga0070671_100087622 3300005355 Bacteria 2605
101 Ga0070671_100094604 3300005355 Bacteria 2504
102 Ga0070671_100313508 3300005355 Unclassified 1336
103 Ga0070671_100488681 3300005355 Bacteria 1058
104 Ga0070671_100680847 3300005355 Bacteria 891
105 Ga0070671_101094966 3300005355 Bacteria 699
106 Ga0070674_100001002 3300005356 Bacteria 14730
107 Ga0070674_100056747 3300005356 Bacteria 2716
108 Ga0070674_100234341 3300005356 Bacteria 1434
109 Ga0070673_100069635 3300005364 Bacteria 2820
110 Ga0070673_100148335 3300005364 Bacteria 1984
111 Ga0070673_100182508 3300005364 Bacteria 1797
112 Ga0070688_100000618 3300005365 Bacteria 17777
113 Ga0070688_100124820 3300005365 Bacteria 1729
114 Ga0070688_100338052 3300005365 Bacteria 1099
115 Ga0070688_100495202 3300005365 Bacteria 921
116 Ga0070659_100021268 3300005366 Bacteria 4937
117 Ga0070659_100038918 3300005366 Unclassified 3710
118 Ga0070659_100046840 3300005366 Bacteria 3390
119 Ga0070659_100059085 3300005366 Unclassified 3027
120 Ga0070659_100342279 3300005366 Unclassified 1253
121 Ga0070667_100065506 3300005367 Bacteria 3085
122 Ga0070667_100234987 3300005367 Bacteria 1635
123 Ga0070667_100899211 3300005367 Bacteria 824
124 Ga0070667_101503943 3300005367 Bacteria 632
125 Ga0070709_10013852 3300005434 Bacteria 4546
126 Ga0070709_10021996 3300005434 Bacteria 3724
127 Ga0070709_10029199 3300005434 Bacteria 3296
128 Ga0070709_10082073 3300005434 Bacteria 2106
129 Ga0070709_10085027 3300005434 Bacteria 2074
130 Ga0070709_10092593 3300005434 Bacteria 1997
131 Ga0070709_10103055 3300005434 Bacteria 1904
132 Ga0070709_10141588 3300005434 Bacteria 1653
133 Ga0070709_10248035 3300005434 Bacteria 1281
134 Ga0070709_10252448 3300005434 Bacteria 1271
135 Ga0070709_10262567 3300005434 Bacteria 1248
136 Ga0070709_10279863 3300005434 Bacteria 1212
137 Ga0070709_10630909 3300005434 Bacteria 828
138 Ga0070714_100000001 3300005435 Bacteria 469087
139 Ga0070714_100002228 3300005435 Bacteria 14285
140 Ga0070714_100055256 3300005435 Bacteria 3393
141 Ga0070714_100063336 3300005435 Bacteria 3180
142 Ga0070714_100153714 3300005435 Bacteria 2076
143 Ga0070714_100238599 3300005435 Bacteria 1677
144 Ga0070714_100302551 3300005435 Bacteria 1491
145 Ga0070714_100323511 3300005435 Bacteria 1443
146 Ga0070714_100351002 3300005435 Bacteria 1385
147 Ga0070714_100467637 3300005435 Bacteria 1199
148 Ga0070714_100584879 3300005435 Bacteria 1071
149 Ga0070713_100001895 3300005436 Bacteria 13483
150 Ga0070713_100006778 3300005436 Bacteria 7980
151 Ga0070713_100018943 3300005436 Bacteria 5241
152 Ga0070713_100081104 3300005436 Bacteria 2768
153 Ga0070713_100198128 3300005436 Bacteria 1812
154 Ga0070713_100271411 3300005436 Bacteria 1553
155 Ga0070713_100416125 3300005436 Bacteria 1257
156 Ga0070713_100457695 3300005436 Bacteria 1199
157 Ga0070713_100472479 3300005436 Bacteria 1180
158 Ga0070713_100564723 3300005436 Bacteria 1078
159 Ga0070713_100594777 3300005436 Bacteria 1050
160 Ga0070713_101601251 3300005436 Bacteria 632
161 Ga0070713_101621348 3300005436 Bacteria 628
162 Ga0070710_10004847 3300005437 Bacteria 6364
163 Ga0070710_10045654 3300005437 Bacteria 2437
164 Ga0070710_10122117 3300005437 Bacteria 1578
165 Ga0070710_10132588 3300005437 Bacteria 1520
166 Ga0070710_10306054 3300005437 Bacteria 1039
167 Ga0070701_10673404 3300005438 Bacteria 693
168 Ga0070711_100015430 3300005439 Bacteria 4836
169 Ga0070711_100102674 3300005439 Bacteria 2082
170 Ga0070711_100236503 3300005439 Bacteria 1426
171 Ga0070711_100244337 3300005439 Bacteria 1405
172 Ga0070711_100437727 3300005439 Bacteria 1068
173 Ga0070711_100457982 3300005439 Bacteria 1045
174 Ga0070705_100117258 3300005440 Bacteria 1712
175 Ga0070705_100144706 3300005440 Bacteria 1569
176 Ga0070705_100163677 3300005440 Bacteria 1490
177 Ga0070705_100651516 3300005440 Bacteria 821
178 Ga0070700_100771977 3300005441 Bacteria 771
179 Ga0070700_100800130 3300005441 Bacteria 759
180 Ga0070694_100088398 3300005444 Bacteria 2169
181 Ga0070694_100088707 3300005444 Bacteria 2166
182 Ga0070694_100368724 3300005444 Bacteria 1117
183 Ga0070708_100000372 3300005445 Bacteria 33949
184 Ga0070708_100002762 3300005445 Bacteria 13629
185 Ga0070708_100003709 3300005445 Bacteria 11974
186 Ga0070708_100017257 3300005445 Bacteria 6014
187 Ga0070708_100018103 3300005445 Bacteria 5894
188 Ga0070708_100154230 3300005445 Bacteria 2137
189 Ga0070708_100161895 3300005445 Bacteria 2085
190 Ga0070708_100228681 3300005445 Bacteria 1745
191 Ga0070708_100240708 3300005445 Bacteria 1699
192 Ga0070708_100301930 3300005445 Bacteria 1507
193 Ga0070708_100371082 3300005445 Bacteria 1349
194 Ga0070708_100576751 3300005445 Bacteria 1061
195 Ga0070708_100579954 3300005445 Bacteria 1057
196 Ga0070708_100632382 3300005445 Bacteria 1009
197 Ga0070708_100792944 3300005445 Bacteria 891
198 Ga0070708_100882211 3300005445 Bacteria 840
199 Ga0070663_100008834 3300005455 Bacteria 6219
200 Ga0070663_100015403 3300005455 Unclassified 4935
201 Ga0070663_100660043 3300005455 Bacteria 885
202 Ga0070678_100030245 3300005456 Bacteria 3721
203 Ga0070678_100042664 3300005456 Bacteria 3226
204 Ga0070678_100789425 3300005456 Unclassified 861
205 Ga0070662_100010482 3300005457 Bacteria 6084
206 Ga0070662_100060162 3300005457 Bacteria 2769
207 Ga0070662_100084544 3300005457 Bacteria 2370
208 Ga0070681_10006970 3300005458 Bacteria 10997
209 Ga0070681_10022625 3300005458 Bacteria 6312
210 Ga0070681_10041266 3300005458 Bacteria 4624
211 Ga0070681_10093083 3300005458 Bacteria 2963
212 Ga0070681_10129149 3300005458 Unclassified 2459
213 Ga0070681_10150165 3300005458 Bacteria 2257
214 Ga0070681_10258264 3300005458 Unclassified 1654
215 Ga0070681_10272375 3300005458 Bacteria 1604
216 Ga0070681_10306514 3300005458 Bacteria 1497
217 Ga0070681_10340991 3300005458 Bacteria 1408
218 Ga0070681_10456317 3300005458 Unclassified 1190
219 Ga0068867_100001118 3300005459 Bacteria 18364
220 Ga0068867_100006293 3300005459 Bacteria 8398
221 Ga0068867_100176330 3300005459 Unclassified 1696
222 Ga0070685_10004156 3300005466 Bacteria 7307
223 Ga0070685_10042193 3300005466 Bacteria 2602
224 Ga0070706_100000644 3300005467 Bacteria 39928
225 Ga0070706_100014149 3300005467 Bacteria 7373
226 Ga0070706_100021710 3300005467 Bacteria 5912
227 Ga0070706_100026447 3300005467 Bacteria 5339
228 Ga0070706_100136859 3300005467 Bacteria 2286
229 Ga0070707_100003588 3300005468 Bacteria 14633
230 Ga0070707_100004759 3300005468 Bacteria 12709
231 Ga0070707_100091156 3300005468 Unclassified 2950
232 Ga0070707_100140351 3300005468 Bacteria 2351
233 Ga0070707_100201331 3300005468 Bacteria 1941
234 Ga0070707_100298482 3300005468 Bacteria 1565
235 Ga0070707_100370465 3300005468 Unclassified 1391
236 Ga0070707_100421747 3300005468 Bacteria 1295
237 Ga0070707_100457091 3300005468 Bacteria 1238
238 Ga0070707_100656843 3300005468 Bacteria 1011
239 Ga0070698_100000345 3300005471 Bacteria 47885
240 Ga0070698_100003025 3300005471 Bacteria 18536
241 Ga0070698_100297825 3300005471 Bacteria 1544
242 Ga0070699_100001645 3300005518 Bacteria 20397
243 Ga0070699_100168716 3300005518 Bacteria 1939
244 Ga0070699_100187921 3300005518 Unclassified 1835
245 Ga0070699_100189572 3300005518 Bacteria 1826
246 Ga0070699_100405753 3300005518 Bacteria 1232
247 Ga0070699_100531153 3300005518 Bacteria 1070
248 Ga0070699_100982487 3300005518 Bacteria 774
249 Ga0070699_101204698 3300005518 Bacteria 695
250 Ga0070679_100003763 3300005530 Bacteria 13917
251 Ga0070679_100045783 3300005530 Bacteria 4359
252 Ga0070679_100047053 3300005530 Bacteria 4301
253 Ga0070679_100053750 3300005530 Bacteria 4009
254 Ga0070679_100057247 3300005530 Bacteria 3886
255 Ga0070679_100157072 3300005530 Bacteria 2249
256 Ga0070679_100175118 3300005530 Bacteria 2118
257 Ga0070679_100203956 3300005530 Bacteria 1942
258 Ga0070679_100242568 3300005530 Bacteria 1759
259 Ga0070679_100283527 3300005530 Bacteria 1609
260 Ga0070679_100407152 3300005530 Bacteria 1306
261 Ga0070679_100464006 3300005530 Bacteria 1211
262 Ga0070684_100001860 3300005535 Bacteria 15457
263 Ga0070684_100075141 3300005535 Unclassified 2980
264 Ga0070684_100094772 3300005535 Bacteria 2659
265 Ga0070684_100271516 3300005535 Bacteria 1552
266 Ga0070684_100771022 3300005535 Unclassified 898
267 Ga0070697_100000927 3300005536 Bacteria 22037
268 Ga0070697_100001970 3300005536 Bacteria 15701
269 Ga0070697_100003305 3300005536 Bacteria 12391
270 Ga0070697_100003493 3300005536 Bacteria 12076
271 Ga0070697_100013903 3300005536 Bacteria 6318
272 Ga0070697_100015972 3300005536 Bacteria 5901
273 Ga0070697_100040091 3300005536 Bacteria 3788
274 Ga0070697_100076900 3300005536 Bacteria 2745
275 Ga0070697_100108191 3300005536 Bacteria 2314
276 Ga0070697_100108193 3300005536 Bacteria 2314
277 Ga0070697_100153507 3300005536 Viruses 1942
278 Ga0070697_100540761 3300005536 Unclassified 1021
279 Ga0070697_100568564 3300005536 Bacteria 995
280 Ga0070697_100965291 3300005536 Bacteria 757
281 Ga0068853_100014807 3300005539 Bacteria 6401
282 Ga0068853_100028841 3300005539 Unclassified 4671
283 Ga0068853_100033502 3300005539 Bacteria 4359
284 Ga0068853_100091707 3300005539 Bacteria 2672
285 Ga0068853_100123884 3300005539 Bacteria 2308
286 Ga0068853_100260879 3300005539 Bacteria 1593
287 Ga0070672_100043049 3300005543 Bacteria 3479
288 Ga0070686_100003814 3300005544 Bacteria 8293
289 Ga0070686_100103538 3300005544 Bacteria 1927
290 Ga0070686_100313215 3300005544 Bacteria 1168
291 Ga0070695_100010137 3300005545 Bacteria 5619
292 Ga0070695_100064987 3300005545 Bacteria 2374
293 Ga0070695_100621149 3300005545 Bacteria 850
294 Ga0070696_100028701 3300005546 Bacteria 3797
295 Ga0070696_100141779 3300005546 Bacteria 1757
296 Ga0070696_100151388 3300005546 Bacteria 1703
297 Ga0070696_100204851 3300005546 Bacteria 1474
298 Ga0070696_100207245 3300005546 Bacteria 1466
299 Ga0070696_100297545 3300005546 Bacteria 1235
300 Ga0070696_100305943 3300005546 Bacteria 1219
301 Ga0070696_100364533 3300005546 Bacteria 1122
302 Ga0070696_100726675 3300005546 Bacteria 811
303 Ga0070696_101074793 3300005546 Bacteria 675
304 Ga0070693_100024396 3300005547 Bacteria 3243
305 Ga0070693_100055541 3300005547 Bacteria 2281
306 Ga0070693_100078923 3300005547 Bacteria 1957
307 Ga0070693_100100428 3300005547 Bacteria 1762
308 Ga0070693_100167788 3300005547 Bacteria 1403
309 Ga0070693_100296391 3300005547 Unclassified 1088
310 Ga0070693_100398810 3300005547 Bacteria 953
311 Ga0070693_100622326 3300005547 Bacteria 782
312 Ga0070665_100068270 3300005548 Bacteria 3565
313 Ga0070665_100209917 3300005548 Bacteria 1948
314 Ga0070665_101257690 3300005548 Bacteria 750
315 Ga0070665_101531013 3300005548 Bacteria 675
316 Ga0070704_100046726 3300005549 Unclassified 3022
317 Ga0070704_100288182 3300005549 Bacteria 1363
318 Ga0070704_100457776 3300005549 Bacteria 1100
319 Ga0070704_100713841 3300005549 Bacteria 890
320 Ga0068855_100018428 3300005563 Bacteria 8389
321 Ga0068855_100022413 3300005563 Bacteria 7570
322 Ga0068855_100099285 3300005563 Bacteria 3353
323 Ga0068855_100123510 3300005563 Bacteria 2962
324 Ga0068855_100133568 3300005563 Bacteria 2832
325 Ga0068855_100205910 3300005563 Bacteria 2213
326 Ga0068855_100889334 3300005563 Bacteria 941
327 Ga0068855_101186004 3300005563 Bacteria 794
328 Ga0068855_101229943 3300005563 Unclassified 778
329 Ga0070664_100002608 3300005564 Bacteria 14545
330 Ga0070664_100008488 3300005564 Bacteria 8306
331 Ga0070664_100025124 3300005564 Unclassified 4935
332 Ga0070664_100027778 3300005564 Bacteria 4704
333 Ga0070664_100050193 3300005564 Bacteria 3530
334 Ga0070664_100241514 3300005564 Unclassified 1622
335 Ga0070664_100287483 3300005564 Bacteria 1484
336 Ga0070664_100290949 3300005564 Bacteria 1475
337 Ga0070664_100560606 3300005564 Bacteria 1057
338 Ga0068857_100003629 3300005577 Bacteria 12931
339 Ga0068857_100025607 3300005577 Bacteria 5195
340 Ga0068857_100065148 3300005577 Bacteria 3239
341 Ga0068857_100083950 3300005577 Bacteria 2846
342 Ga0068857_100854571 3300005577 Bacteria 871
343 Ga0068854_100004141 3300005578 Bacteria 9116
344 Ga0068854_100031226 3300005578 Bacteria 3700
345 Ga0068854_100111034 3300005578 Bacteria 2068
346 Ga0068854_100235883 3300005578 Unclassified 1454
347 Ga0068854_100236973 3300005578 Bacteria 1451
348 Ga0068854_100264231 3300005578 Bacteria 1379
349 Ga0068854_101101216 3300005578 Bacteria 708
350 Ga0068856_100003956 3300005614 Bacteria 14838
351 Ga0068856_100006181 3300005614 Bacteria 11751
352 Ga0068856_100007666 3300005614 Bacteria 10532
353 Ga0068856_100010385 3300005614 Bacteria 9043
354 Ga0068856_100012749 3300005614 Bacteria 8138
355 Ga0068856_100039924 3300005614 Bacteria 4608
356 Ga0068856_100157011 3300005614 Bacteria 2285
357 Ga0068856_100308155 3300005614 Bacteria 1601
358 Ga0068856_100386099 3300005614 Bacteria 1420
359 Ga0068856_101017403 3300005614 Unclassified 847
360 Ga0070702_100064086 3300005615 Bacteria 2149
361 Ga0070702_100241384 3300005615 Bacteria 1220
362 Ga0068852_100000901 3300005616 Bacteria 19662
363 Ga0068852_100046782 3300005616 Unclassified 3688
364 Ga0068852_100151548 3300005616 Bacteria 2157
365 Ga0068852_100255041 3300005616 Bacteria 1682
366 Ga0068852_100326593 3300005616 Bacteria 1491
367 Ga0068852_100651192 3300005616 Bacteria 1061
368 Ga0068852_101047792 3300005616 Bacteria 835
369 Ga0068859_100022867 3300005617 Bacteria 6268
370 Ga0068859_100055800 3300005617 Bacteria 3975
371 Ga0068859_100115692 3300005617 Bacteria 2746
372 Ga0068859_100119181 3300005617 Bacteria 2705
373 Ga0068859_100229052 3300005617 Unclassified 1946
374 Ga0068859_100555714 3300005617 Bacteria 1242
375 Ga0068864_100068370 3300005618 Bacteria 3086
376 Ga0068864_100104835 3300005618 Bacteria 2512
377 Ga0068866_10005774 3300005718 Bacteria 5131
378 Ga0068866_10093485 3300005718 Bacteria 1643
379 Ga0068866_10093740 3300005718 Bacteria 1641
380 Ga0068866_10192552 3300005718 Bacteria 1213
381 Ga0068861_100082223 3300005719 Bacteria 2523
382 Ga0068861_100166005 3300005719 Bacteria 1825
383 Ga0068861_100246939 3300005719 Bacteria 1521
384 Ga0068861_101355200 3300005719 Bacteria 693
385 Ga0068851_10001293 3300005834 Bacteria 10917
386 Ga0068851_10007273 3300005834 Bacteria 5077
387 Ga0068851_10168697 3300005834 Bacteria 1207
388 Ga0068870_10001527 3300005840 Bacteria 9395
389 Ga0068870_10117731 3300005840 Bacteria 1526
390 Ga0068863_100034449 3300005841 Bacteria 4823
391 Ga0068863_100094731 3300005841 Bacteria 2834
392 Ga0068863_100112876 3300005841 Bacteria 2588
393 Ga0068863_100130082 3300005841 Bacteria 2403
394 Ga0068863_100147320 3300005841 Bacteria 2252
395 Ga0068863_100150540 3300005841 Bacteria 2226
396 Ga0068863_100267392 3300005841 Bacteria 1654
397 Ga0068858_100010129 3300005842 Bacteria 8949
398 Ga0068858_100033926 3300005842 Bacteria 4734
399 Ga0068858_100034480 3300005842 Bacteria 4695
400 Ga0068858_100409547 3300005842 Unclassified 1303
401 Ga0068858_100503165 3300005842 Bacteria 1171
402 Ga0068858_101206951 3300005842 Bacteria 744
403 Ga0068860_100015576 3300005843 Bacteria 7425
404 Ga0068860_100078197 3300005843 Bacteria 3146
405 Ga0068860_100104168 3300005843 Bacteria 2709
406 Ga0068860_100150734 3300005843 Bacteria 2239
407 Ga0068860_100163094 3300005843 Bacteria 2150
408 Ga0068860_100395150 3300005843 Bacteria 1367
409 Ga0068860_100457612 3300005843 Unclassified 1269
410 Ga0068860_100521626 3300005843 Bacteria 1188
411 Ga0068862_100003799 3300005844 Bacteria 12864
412 Ga0068862_100032388 3300005844 Bacteria 4416
413 Ga0081455_10066268 3300005937 Bacteria 3017
414 Ga0081455_10066271 3300005937 Bacteria 3017
415 Ga0081455_10339008 3300005937 Bacteria 1064
416 Ga0081455_10480170 3300005937 Bacteria 841
417 Ga0081538_10004085 3300005981 Bacteria 13568
418 Ga0081538_10011151 3300005981 Bacteria 7302
419 Ga0081538_10159909 3300005981 Bacteria 1003
420 Ga0081540_1001342 3300005983 Bacteria 21421
421 Ga0081540_1004933 3300005983 Bacteria 10038
422 Ga0070717_10000912 3300006028 Bacteria 19627
423 Ga0070717_10000971 3300006028 Bacteria 19159
424 Ga0070717_10026709 3300006028 Bacteria 4609
425 Ga0070717_10028808 3300006028 Bacteria 4449
426 Ga0070717_10032961 3300006028 Bacteria 4177
427 Ga0070717_10214387 3300006028 Bacteria 1691
428 Ga0070717_10218078 3300006028 Bacteria 1676
429 Ga0070717_10239165 3300006028 Bacteria 1600
430 Ga0070717_10258689 3300006028 Bacteria 1540
431 Ga0070717_10437517 3300006028 Bacteria 1177
432 Ga0070717_10608668 3300006028 Bacteria 991
433 Ga0070717_11054527 3300006028 Bacteria 740
434 Ga0075365_10000261 3300006038 Bacteria 18055
435 Ga0075365_10705328 3300006038 Bacteria 713
436 Ga0075363_100104048 3300006048 Bacteria 1573
437 Ga0075363_100239662 3300006048 Bacteria 1042
438 Ga0075432_10169357 3300006058 Unclassified 849
439 Ga0070715_10287272 3300006163 Bacteria 875
440 Ga0070715_10371778 3300006163 Bacteria 786
441 Ga0070716_100015394 3300006173 Bacteria 3928
442 Ga0070716_100017733 3300006173 Bacteria 3697
443 Ga0070716_100035101 3300006173 Bacteria 2755
444 Ga0070716_100056881 3300006173 Bacteria 2245
445 Ga0070716_100075275 3300006173 Bacteria 1997
446 Ga0070716_100094668 3300006173 Bacteria 1816
447 Ga0070716_100166388 3300006173 Bacteria 1434
448 Ga0070716_100432979 3300006173 Bacteria 954
449 Ga0070716_100653261 3300006173 Bacteria 798
450 Ga0070712_100000979 3300006175 Bacteria 17194
451 Ga0070712_100001023 3300006175 Bacteria 16868
452 Ga0070712_100116848 3300006175 Unclassified 2001
453 Ga0070712_100501254 3300006175 Bacteria 1018
454 Ga0070712_100874125 3300006175 Bacteria 774
455 Ga0075362_10364442 3300006177 Bacteria 725
456 Ga0075366_10012237 3300006195 Bacteria 4865
457 Ga0097621_100000275 3300006237 Bacteria 34774
458 Ga0097621_100003995 3300006237 Bacteria 10222
459 Ga0097621_100022764 3300006237 Unclassified 4868
460 Ga0097621_100083457 3300006237 Bacteria 2662
461 Ga0097621_100091661 3300006237 Bacteria 2544
462 Ga0097621_100493242 3300006237 Bacteria 1108
463 Ga0097621_100562913 3300006237 Bacteria 1038
464 Ga0097621_100627356 3300006237 Bacteria 984
465 Ga0097621_101422884 3300006237 Bacteria 657
466 Ga0068871_100000038 3300006358 Bacteria 69723
467 Ga0068871_100001288 3300006358 Bacteria 16780
468 Ga0068871_100016161 3300006358 Bacteria 5610
469 Ga0068871_100229886 3300006358 Bacteria 1609
470 Ga0068871_100315728 3300006358 Bacteria 1375
471 Ga0068871_100356860 3300006358 Bacteria 1294
472 Ga0068871_100376877 3300006358 Bacteria 1260
473 Ga0068871_100380687 3300006358 Bacteria 1253
474 Ga0068871_100814285 3300006358 Bacteria 861
475 Ga0068871_100997286 3300006358 Bacteria 780
476 Ga0075428_100058499 3300006844 Bacteria 4220
477 Ga0075428_101401296 3300006844 Bacteria 734
478 Ga0075430_100128733 3300006846 Bacteria 2110
479 Ga0075430_100243690 3300006846 Bacteria 1489
480 Ga0075430_100496611 3300006846 Bacteria 1007
481 Ga0075431_100010526 3300006847 Bacteria 9298
482 Ga0075431_100297664 3300006847 Unclassified 1630
483 Ga0075431_100340474 3300006847 Bacteria 1509
484 Ga0075431_101292601 3300006847 Bacteria 691
485 Ga0075433_10002016 3300006852 Bacteria 15317
486 Ga0075433_10002659 3300006852 Bacteria 13636
487 Ga0075433_10053918 3300006852 Unclassified 3507
488 Ga0075433_10193315 3300006852 Bacteria 1810
489 Ga0075433_10200416 3300006852 Bacteria 1774
490 Ga0075433_10721402 3300006852 Bacteria 873
491 Ga0075434_100000912 3300006871 Bacteria 23726
492 Ga0075434_100001570 3300006871 Bacteria 19359
493 Ga0075434_100010769 3300006871 Bacteria 8587
494 Ga0075434_100015123 3300006871 Bacteria 7392
495 Ga0075434_100070034 3300006871 Bacteria 3498
496 Ga0075434_100281353 3300006871 Bacteria 1683
497 Ga0075434_100302700 3300006871 Bacteria 1619
498 Ga0075434_100353601 3300006871 Bacteria 1490
499 Ga0075434_100402876 3300006871 Unclassified 1389
500 Ga0075434_100674820 3300006871 Bacteria 1051
501 Ga0075429_100039199 3300006880 Bacteria 4123
502 Ga0075429_100076639 3300006880 Bacteria 2913
503 Ga0068865_100009700 3300006881 Bacteria 5973
504 Ga0068865_100014699 3300006881 Bacteria 4980
505 Ga0068865_100135850 3300006881 Bacteria 1848
506 Ga0068865_100209418 3300006881 Bacteria 1518
507 Ga0075436_100003169 3300006914 Bacteria 11283
508 Ga0075436_100016713 3300006914 Bacteria 5022
509 Ga0075436_100018709 3300006914 Bacteria 4743
510 Ga0075436_100031006 3300006914 Bacteria 3679
511 Ga0075436_100045752 3300006914 Bacteria 3018
512 Ga0075436_100046917 3300006914 Bacteria 2980
513 Ga0075436_100144481 3300006914 Bacteria 1672
514 Ga0075436_100526665 3300006914 Bacteria 866
515 Ga0075436_100747853 3300006914 Bacteria 726
516 Ga0075436_100803209 3300006914 Bacteria 700
517 Ga0097620_100022868 3300006931 Bacteria 6268
518 Ga0097620_100055799 3300006931 Bacteria 3975
519 Ga0097620_100115698 3300006931 Bacteria 2746
520 Ga0097620_100119182 3300006931 Bacteria 2705
521 Ga0097620_100229044 3300006931 Unclassified 1946
522 Ga0097620_100555676 3300006931 Bacteria 1242
523 Ga0075435_100000025 3300007076 Bacteria 87314
524 Ga0075435_100016483 3300007076 Bacteria 5572
525 Ga0075435_100022612 3300007076 Bacteria 4851
526 Ga0075435_100033363 3300007076 Bacteria 4069
527 Ga0075435_100068268 3300007076 Bacteria 2896
528 Ga0075435_100391065 3300007076 Bacteria 1195
529 Ga0075435_100431308 3300007076 Bacteria 1136
530 Ga0075435_100492273 3300007076 Bacteria 1060
531 Ga0099794_10017550 3300007265 Bacteria 3192
532 Ga0099794_10019429 3300007265 Bacteria 3061
533 Ga0099794_10337808 3300007265 Bacteria 782
534 Ga0099795_10090210 3300007788 Bacteria 1187
535 Ga0099795_10151583 3300007788 Bacteria 950
536 Ga0105251_10214756 3300009011 Bacteria 866
537 Ga0105240_10023418 3300009093 Bacteria 8165
538 Ga0105240_10057871 3300009093 Bacteria 4840
539 Ga0105240_10088470 3300009093 Bacteria 3789
540 Ga0105240_10105976 3300009093 Bacteria 3411
541 Ga0105240_10120632 3300009093 Bacteria 3157
542 Ga0105240_10294162 3300009093 Bacteria 1860
543 Ga0105240_10432752 3300009093 Bacteria 1476
544 Ga0105240_10625556 3300009093 Bacteria 1183
545 Ga0105240_10808246 3300009093 Bacteria 1015
546 Ga0105240_10966193 3300009093 Unclassified 913
547 Ga0105240_12013736 3300009093 Bacteria 600
548 Ga0111539_10133285 3300009094 Bacteria 2909
549 Ga0111539_10237137 3300009094 Unclassified 2123
550 Ga0111539_10539472 3300009094 Bacteria 1359
551 Ga0111539_11039632 3300009094 Bacteria 952
552 Ga0105245_10000044 3300009098 Bacteria 135878
553 Ga0105245_10003953 3300009098 Bacteria 13188
554 Ga0105245_10006423 3300009098 Bacteria 10348
555 Ga0105245_10009105 3300009098 Bacteria 8654
556 Ga0105245_10011327 3300009098 Bacteria 7765
557 Ga0105245_10020569 3300009098 Bacteria 5788
558 Ga0105245_10046318 3300009098 Bacteria 3886
559 Ga0105245_10369533 3300009098 Bacteria 1425
560 Ga0105245_10676734 3300009098 Bacteria 1064
561 Ga0105247_10002094 3300009101 Bacteria 13797
562 Ga0105247_10008740 3300009101 Bacteria 6180
563 Ga0105247_10026603 3300009101 Bacteria 3495
564 Ga0105247_10035392 3300009101 Bacteria 3043
565 Ga0105247_10079904 3300009101 Bacteria 2059
566 Ga0105247_10235547 3300009101 Bacteria 1245
567 Ga0114129_10049957 3300009147 Bacteria 5875
568 Ga0114129_10050255 3300009147 Bacteria 5857
569 Ga0114129_10081420 3300009147 Bacteria 4500
570 Ga0114129_10234029 3300009147 Bacteria 2473
571 Ga0114129_10243982 3300009147 Bacteria 2414
572 Ga0114129_10659315 3300009147 Bacteria 1350
573 Ga0114129_10700674 3300009147 Bacteria 1301
574 Ga0114129_11289176 3300009147 Bacteria 906
575 Ga0105243_10017452 3300009148 Bacteria 5426
576 Ga0105243_10091139 3300009148 Bacteria 2510
577 Ga0105243_10100490 3300009148 Unclassified 2400
578 Ga0105243_10216604 3300009148 Bacteria 1690
579 Ga0105241_10017538 3300009174 Bacteria 5263
580 Ga0105241_10024484 3300009174 Unclassified 4482
581 Ga0105241_10038843 3300009174 Bacteria 3589
582 Ga0105241_10113792 3300009174 Bacteria 2169
583 Ga0105241_10122154 3300009174 Bacteria 2098
584 Ga0105241_10129586 3300009174 Bacteria 2040
585 Ga0105241_10143892 3300009174 Bacteria 1944
586 Ga0105241_10159953 3300009174 Bacteria 1850
587 Ga0105242_10017421 3300009176 Bacteria 5599
588 Ga0105242_10019694 3300009176 Bacteria 5288
589 Ga0105242_10065111 3300009176 Bacteria 3006
590 Ga0105242_10162929 3300009176 Bacteria 1954
591 Ga0105242_10358676 3300009176 Bacteria 1349
592 Ga0105242_10686412 3300009176 Bacteria 1000
593 Ga0105242_11975542 3300009176 Bacteria 625
594 Ga0105248_10008359 3300009177 Bacteria 11370
595 Ga0105248_10074037 3300009177 Bacteria 3828
596 Ga0105248_10107113 3300009177 Bacteria 3152
597 Ga0105248_10133114 3300009177 Bacteria 2805
598 Ga0105248_10170669 3300009177 Unclassified 2451
599 Ga0105248_10263330 3300009177 Bacteria 1941
600 Ga0105248_10358738 3300009177 Unclassified 1641
601 Ga0105248_10427190 3300009177 Unclassified 1492
602 Ga0105248_10616585 3300009177 Bacteria 1224
603 Ga0105248_10855629 3300009177 Bacteria 1026
604 Ga0105248_10973324 3300009177 Bacteria 958
605 Ga0105248_11087086 3300009177 Bacteria 904
606 Ga0105237_10022409 3300009545 Bacteria 6482
607 Ga0105237_10023293 3300009545 Bacteria 6346
608 Ga0105237_10024941 3300009545 Bacteria 6117
609 Ga0105237_10173261 3300009545 Bacteria 2158
610 Ga0105237_10286532 3300009545 Bacteria 1650
611 Ga0105237_10371453 3300009545 Bacteria 1435
612 Ga0105237_10836354 3300009545 Bacteria 927
613 Ga0105237_10862768 3300009545 Bacteria 912
614 Ga0105238_10010036 3300009551 Bacteria 9497
615 Ga0105238_10023637 3300009551 Bacteria 6262
616 Ga0105238_10025506 3300009551 Bacteria 6026
617 Ga0105238_10180433 3300009551 Bacteria 2088
618 Ga0105238_10329964 3300009551 Bacteria 1512
619 Ga0105238_10351322 3300009551 Bacteria 1463
620 Ga0105238_11059326 3300009551 Bacteria 833
621 Ga0105249_10009154 3300009553 Bacteria 8659
622 Ga0105249_10015097 3300009553 Bacteria 6832
623 Ga0105249_10339079 3300009553 Bacteria 1519
624 Ga0105249_10820977 3300009553 Bacteria 994
625 Ga0105249_10864635 3300009553 Bacteria 970
626 Ga0099796_10021595 3300010159 Bacteria 1985
627 Ga0105239_10004244 3300010375 Bacteria 17209
628 Ga0105239_10008739 3300010375 Bacteria 11470
629 Ga0105239_10030644 3300010375 Bacteria 5916
630 Ga0105239_10260669 3300010375 Bacteria 1948
631 Ga0105239_10527058 3300010375 Bacteria 1344
632 Ga0105239_10604113 3300010375 Bacteria 1251
633 Ga0105239_10908548 3300010375 Bacteria 1011
634 Ga0105246_10006082 3300011119 Bacteria 7364
635 Ga0105246_10032732 3300011119 Bacteria 3450
636 Ga0105246_10215110 3300011119 Bacteria 1503
637 Ga0105246_10237114 3300011119 Bacteria 1440
638 Ga0105246_10266143 3300011119 Bacteria 1368
639 Ga0105246_11017491 3300011119 Bacteria 751
640 Ga0157327_1025599 3300012512 Bacteria 700
641 Ga0157373_10008605 3300013100 Bacteria 7579
642 Ga0157373_10031435 3300013100 Unclassified 3822
643 Ga0157373_10054918 3300013100 Bacteria 2829
644 Ga0157373_10162363 3300013100 Bacteria 1572
645 Ga0157373_10321102 3300013100 Bacteria 1101
646 Ga0157371_10003594 3300013102 Bacteria 13969
647 Ga0157371_10007472 3300013102 Bacteria 8844
648 Ga0157370_10022504 3300013104 Bacteria 6271
649 Ga0157370_10142618 3300013104 Bacteria 2232
650 Ga0157370_10449490 3300013104 Bacteria 1185
651 Ga0157370_10651349 3300013104 Bacteria 963
652 Ga0157369_10000770 3300013105 Bacteria 41464
653 Ga0157369_10008874 3300013105 Bacteria 11517
654 Ga0157369_10044152 3300013105 Unclassified 4853
655 Ga0157369_10058507 3300013105 Bacteria 4158
656 Ga0157369_10332837 3300013105 Bacteria 1578
657 Ga0157369_10394244 3300013105 Bacteria 1436
658 Ga0157369_10585664 3300013105 Bacteria 1152
659 Ga0157369_11037290 3300013105 Bacteria 839
660 Ga0157374_10000058 3300013296 Bacteria 116810
661 Ga0157374_10024711 3300013296 Bacteria 5386
662 Ga0157374_10042362 3300013296 Bacteria 4200
663 Ga0157374_10051213 3300013296 Unclassified 3841
664 Ga0157374_10080656 3300013296 Bacteria 3087
665 Ga0157374_10101030 3300013296 Bacteria 2765
666 Ga0157374_10108999 3300013296 Unclassified 2662
667 Ga0157374_10259486 3300013296 Bacteria 1711
668 Ga0157374_10281762 3300013296 Unclassified 1641
669 Ga0157374_10500917 3300013296 Bacteria 1219
670 Ga0157378_10000203 3300013297 Bacteria 57992
671 Ga0157378_10018251 3300013297 Bacteria 6158
672 Ga0157378_10034794 3300013297 Bacteria 4455
673 Ga0157378_10042358 3300013297 Bacteria 4041
674 Ga0157378_10065647 3300013297 Bacteria 3248
675 Ga0157378_10236756 3300013297 Bacteria 1742
676 Ga0157378_10300693 3300013297 Bacteria 1553
677 Ga0157378_10328927 3300013297 Bacteria 1487
678 Ga0157378_10422306 3300013297 Bacteria 1318
679 Ga0157378_10431736 3300013297 Bacteria 1304
680 Ga0163162_10001530 3300013306 Bacteria 21562
681 Ga0163162_10007539 3300013306 Bacteria 10597
682 Ga0163162_10075718 3300013306 Bacteria 3426
683 Ga0163162_10216568 3300013306 Bacteria 2045
684 Ga0163162_10350898 3300013306 Bacteria 1608
685 Ga0163162_10406688 3300013306 Bacteria 1494
686 Ga0163162_10688094 3300013306 Bacteria 1145
687 Ga0163162_10896649 3300013306 Unclassified 1000
688 Ga0163162_11266242 3300013306 Bacteria 838
689 Ga0163162_11370864 3300013306 Bacteria 804
690 Ga0163162_12432425 3300013306 Unclassified 602
691 Ga0157372_10009715 3300013307 Bacteria 10231
692 Ga0157372_10046345 3300013307 Bacteria 4826
693 Ga0157372_10058516 3300013307 Unclassified 4309
694 Ga0157372_10075817 3300013307 Bacteria 3795
695 Ga0157372_10199277 3300013307 Bacteria 2319
696 Ga0157372_10203240 3300013307 Bacteria 2295
697 Ga0157372_10232396 3300013307 Bacteria 2138
698 Ga0157372_10388772 3300013307 Bacteria 1625
699 Ga0157372_10550512 3300013307 Bacteria 1345
700 Ga0157372_10652357 3300013307 Bacteria 1226
701 Ga0157372_11092229 3300013307 Unclassified 923
702 Ga0157375_10080999 3300013308 Bacteria 3286
703 Ga0157375_10122075 3300013308 Bacteria 2716
704 Ga0157375_10266886 3300013308 Bacteria 1873
705 Ga0157375_10322840 3300013308 Bacteria 1708
706 Ga0157375_12457249 3300013308 Bacteria 622
707 Ga0163163_10001263 3300014325 Bacteria 21347
708 Ga0163163_10006709 3300014325 Bacteria 10087
709 Ga0163163_10010296 3300014325 Bacteria 8404
710 Ga0163163_10022849 3300014325 Bacteria 5929
711 Ga0163163_10049606 3300014325 Bacteria 4132
712 Ga0163163_10091822 3300014325 Bacteria 3051
713 Ga0157380_10016601 3300014326 Bacteria 5434
714 Ga0157380_10344802 3300014326 Bacteria 1391
715 Ga0157380_10991591 3300014326 Bacteria 873
716 Ga0182008_10025720 3300014497 Unclassified 2989
717 Ga0182008_10258326 3300014497 Bacteria 900
718 Ga0157377_10000395 3300014745 Bacteria 18883
719 Ga0157377_10146281 3300014745 Bacteria 1457
720 Ga0157377_10493976 3300014745 Bacteria 854
721 Ga0157379_10006464 3300014968 Bacteria 10102
722 Ga0157379_10049801 3300014968 Bacteria 3740
723 Ga0157379_10147959 3300014968 Bacteria 2118
724 Ga0157379_10411730 3300014968 Bacteria 1244
725 Ga0157379_10773400 3300014968 Bacteria 905
726 Ga0157379_11174642 3300014968 Bacteria 737
727 Ga0157376_10041699 3300014969 Bacteria 3760
728 Ga0157376_10134559 3300014969 Bacteria 2210
729 Ga0157376_10253623 3300014969 Bacteria 1644
730 Ga0157376_10255663 3300014969 Bacteria 1638
731 Ga0157376_11256503 3300014969 Bacteria 770
732 Ga0182006_1019715 3300015261 Unclassified 2836
733 Ga0182007_10004292 3300015262 Bacteria 6495
734 Ga0182005_1008218 3300015265 Unclassified 3086
735 Ga0182005_1073494 3300015265 Unclassified 940
736 Ga0163161_10010982 3300017792 Bacteria 6275
737 Ga0163161_10147217 3300017792 Bacteria 1787
738 Ga0206356_10001441 3300020070 Bacteria 939
739 Ga0206356_10679129 3300020070 Bacteria 896
740 Ga0206355_1591506 3300020076 Bacteria 786
741 Ga0206352_11025838 3300020078 Bacteria 1061
742 Ga0206354_10296184 3300020081 Bacteria 585
743 Ga0154015_1331403 3300020610 Bacteria 1169
744 Ga0213873_10031710 3300021358 Bacteria 1316
745 Ga0213873_10134793 3300021358 Bacteria 734
746 Ga0213872_10091988 3300021361 Bacteria 1357
747 Ga0213876_10453699 3300021384 Bacteria 682
748 Ga0224712_10118900 3300022467 Bacteria 1142
749 Ga0228598_1029955 3300024227 Bacteria 1070
750 Ga0207697_10000518 3300025315 Bacteria 21729
751 Ga0207697_10041840 3300025315 Bacteria 1882
752 Ga0207656_10008283 3300025321 Bacteria 3819
753 Ga0207656_10015548 3300025321 Bacteria 2947
754 Ga0207656_10050952 3300025321 Bacteria 1789
755 Ga0207682_10047427 3300025893 Bacteria 1769
756 Ga0207692_10005577 3300025898 Bacteria 5051
757 Ga0207692_10089903 3300025898 Bacteria 1663
758 Ga0207692_10136710 3300025898 Bacteria 1390
759 Ga0207692_10242650 3300025898 Bacteria 1076
760 Ga0207692_10259860 3300025898 Bacteria 1043
761 Ga0207642_10029513 3300025899 Unclassified 2272
762 Ga0207642_10044725 3300025899 Bacteria 1961
763 Ga0207642_10133864 3300025899 Bacteria 1297
764 Ga0207642_10159154 3300025899 Bacteria 1211
765 Ga0207710_10015056 3300025900 Bacteria 3267
766 Ga0207688_10007908 3300025901 Bacteria 5787
767 Ga0207680_10001286 3300025903 Bacteria 11881
768 Ga0207680_10186447 3300025903 Unclassified 1406
769 Ga0207680_10483885 3300025903 Bacteria 880
770 Ga0207680_10485340 3300025903 Bacteria 879
771 Ga0207647_10004047 3300025904 Bacteria 10920
772 Ga0207647_10007521 3300025904 Bacteria 7862
773 Ga0207647_10070647 3300025904 Bacteria 2108
774 Ga0207685_10008335 3300025905 Bacteria 2947
775 Ga0207685_10282681 3300025905 Bacteria 815
776 Ga0207699_10007868 3300025906 Bacteria 5227
777 Ga0207699_10040762 3300025906 Bacteria 2678
778 Ga0207699_10051463 3300025906 Bacteria 2434
779 Ga0207699_10073947 3300025906 Bacteria 2092
780 Ga0207699_10098448 3300025906 Bacteria 1850
781 Ga0207699_10127702 3300025906 Bacteria 1653
782 Ga0207699_10174785 3300025906 Bacteria 1439
783 Ga0207699_10523103 3300025906 Bacteria 858
784 Ga0207699_10989310 3300025906 Bacteria 622
785 Ga0207645_10000351 3300025907 Bacteria 38347
786 Ga0207645_10002958 3300025907 Bacteria 13123
787 Ga0207645_10086172 3300025907 Unclassified 2018
788 Ga0207643_10001192 3300025908 Bacteria 15359
789 Ga0207705_10000914 3300025909 Bacteria 24187
790 Ga0207705_10364029 3300025909 Bacteria 1115
791 Ga0207684_10000343 3300025910 Bacteria 64775
792 Ga0207684_10006350 3300025910 Bacteria 10776
793 Ga0207684_10028989 3300025910 Bacteria 4714
794 Ga0207684_10114447 3300025910 Bacteria 2310
795 Ga0207684_10284087 3300025910 Bacteria 1427
796 Ga0207654_10035734 3300025911 Unclassified 2771
797 Ga0207654_10039066 3300025911 Bacteria 2667
798 Ga0207654_10083465 3300025911 Unclassified 1929
799 Ga0207654_10103670 3300025911 Bacteria 1757
800 Ga0207654_10137514 3300025911 Bacteria 1554
801 Ga0207707_10027170 3300025912 Bacteria 5004
802 Ga0207707_10056879 3300025912 Bacteria 3404
803 Ga0207707_10119238 3300025912 Bacteria 2306
804 Ga0207707_10123354 3300025912 Bacteria 2265
805 Ga0207707_10299705 3300025912 Bacteria 1390
806 Ga0207707_10353334 3300025912 Unclassified 1266
807 Ga0207707_10729047 3300025912 Unclassified 830
808 Ga0207695_10014655 3300025913 Bacteria 9272
809 Ga0207695_10065803 3300025913 Bacteria 3725
810 Ga0207695_10115336 3300025913 Bacteria 2661
811 Ga0207695_10225722 3300025913 Bacteria 1779
812 Ga0207695_10349128 3300025913 Bacteria 1367
813 Ga0207695_10487500 3300025913 Bacteria 1115
814 Ga0207695_10702478 3300025913 Bacteria 892
815 Ga0207695_10760367 3300025913 Bacteria 849
816 Ga0207671_10042026 3300025914 Unclassified 3384
817 Ga0207671_10083013 3300025914 Bacteria 2405
818 Ga0207671_10256906 3300025914 Bacteria 1374
819 Ga0207671_10262137 3300025914 Bacteria 1360
820 Ga0207671_10328486 3300025914 Bacteria 1211
821 Ga0207671_10417490 3300025914 Bacteria 1067
822 Ga0207693_10000235 3300025915 Bacteria 50962
823 Ga0207693_10001900 3300025915 Bacteria 18277
824 Ga0207693_10060143 3300025915 Unclassified 2976
825 Ga0207693_10097756 3300025915 Bacteria 2302
826 Ga0207693_10170937 3300025915 Bacteria 1711
827 Ga0207693_10178145 3300025915 Bacteria 1673
828 Ga0207693_10809518 3300025915 Unclassified 722
829 Ga0207663_10001610 3300025916 Bacteria 10621
830 Ga0207663_10011339 3300025916 Bacteria 4784
831 Ga0207663_10022833 3300025916 Bacteria 3582
832 Ga0207663_10375983 3300025916 Bacteria 1081
833 Ga0207663_10560883 3300025916 Bacteria 894
834 Ga0207660_10003693 3300025917 Bacteria 9976
835 Ga0207660_10034629 3300025917 Bacteria 3501
836 Ga0207660_10069652 3300025917 Bacteria 2555
837 Ga0207660_10243281 3300025917 Bacteria 1418
838 Ga0207660_10266510 3300025917 Bacteria 1356
839 Ga0207662_10078310 3300025918 Bacteria 2012
840 Ga0207662_10098460 3300025918 Bacteria 1809
841 Ga0207657_10001481 3300025919 Bacteria 25110
842 Ga0207657_10004756 3300025919 Bacteria 14337
843 Ga0207657_10006029 3300025919 Bacteria 12603
844 Ga0207657_10047641 3300025919 Bacteria 3746
845 Ga0207657_10317688 3300025919 Unclassified 1232
846 Ga0207649_10000928 3300025920 Bacteria 18426
847 Ga0207649_10017747 3300025920 Unclassified 4035
848 Ga0207649_10130552 3300025920 Bacteria 1706
849 Ga0207649_10161879 3300025920 Bacteria 1551
850 Ga0207652_10024100 3300025921 Bacteria 5047
851 Ga0207652_10027799 3300025921 Bacteria 4716
852 Ga0207652_10032565 3300025921 Bacteria 4384
853 Ga0207652_10053965 3300025921 Bacteria 3454
854 Ga0207652_10068406 3300025921 Bacteria 3082
855 Ga0207652_10145945 3300025921 Unclassified 2118
856 Ga0207652_10226851 3300025921 Bacteria 1684
857 Ga0207652_10273299 3300025921 Bacteria 1524
858 Ga0207646_10000438 3300025922 Bacteria 55782
859 Ga0207646_10000566 3300025922 Bacteria 48722
860 Ga0207646_10114337 3300025922 Bacteria 2423
861 Ga0207646_10376221 3300025922 Bacteria 1283
862 Ga0207646_10422278 3300025922 Bacteria 1204
863 Ga0207646_10433024 3300025922 Unclassified 1187
864 Ga0207646_10703509 3300025922 Bacteria 903
865 Ga0207646_11020863 3300025922 Bacteria 730
866 Ga0207646_11113805 3300025922 Bacteria 694
867 Ga0207681_10006380 3300025923 Bacteria 7240
868 Ga0207681_10358309 3300025923 Bacteria 1169
869 Ga0207681_10420807 3300025923 Bacteria 1082
870 Ga0207681_10490377 3300025923 Bacteria 1005
871 Ga0207681_10599294 3300025923 Bacteria 910
872 Ga0207694_10025020 3300025924 Bacteria 4537
873 Ga0207694_10062368 3300025924 Unclassified 2903
874 Ga0207694_10088736 3300025924 Bacteria 2438
875 Ga0207694_10449021 3300025924 Bacteria 1076
876 Ga0207694_10500357 3300025924 Bacteria 1017
877 Ga0207694_10694407 3300025924 Bacteria 858
878 Ga0207694_10975350 3300025924 Bacteria 717
879 Ga0207650_10000059 3300025925 Bacteria 151427
880 Ga0207650_10110308 3300025925 Bacteria 2129
881 Ga0207650_10363936 3300025925 Bacteria 1192
882 Ga0207659_10007240 3300025926 Bacteria 6817
883 Ga0207687_10000033 3300025927 Bacteria 135886
884 Ga0207687_10000216 3300025927 Bacteria 39182
885 Ga0207687_10011223 3300025927 Bacteria 5851
886 Ga0207687_10013840 3300025927 Bacteria 5269
887 Ga0207687_10017470 3300025927 Unclassified 4724
888 Ga0207687_10229547 3300025927 Bacteria 1466
889 Ga0207687_10270560 3300025927 Bacteria 1358
890 Ga0207687_10286932 3300025927 Bacteria 1321
891 Ga0207687_10526460 3300025927 Bacteria 989
892 Ga0207687_10863114 3300025927 Bacteria 774
893 Ga0207687_10921383 3300025927 Bacteria 748
894 Ga0207687_10934192 3300025927 Bacteria 743
895 Ga0207700_10001497 3300025928 Bacteria 13217
896 Ga0207700_10069893 3300025928 Bacteria 2697
897 Ga0207700_10076719 3300025928 Bacteria 2594
898 Ga0207700_10176797 3300025928 Bacteria 1784
899 Ga0207700_10313576 3300025928 Bacteria 1357
900 Ga0207700_10457171 3300025928 Bacteria 1126
901 Ga0207700_10594840 3300025928 Bacteria 984
902 Ga0207700_10640883 3300025928 Bacteria 947
903 Ga0207700_10782180 3300025928 Bacteria 853
904 Ga0207664_10000007 3300025929 Bacteria 374590
905 Ga0207664_10002861 3300025929 Bacteria 11466
906 Ga0207664_10007384 3300025929 Bacteria 7619
907 Ga0207664_10142515 3300025929 Bacteria 2029
908 Ga0207664_10260993 3300025929 Bacteria 1515
909 Ga0207664_10291770 3300025929 Bacteria 1433
910 Ga0207644_10002945 3300025931 Bacteria 10965
911 Ga0207644_10249392 3300025931 Bacteria 1416
912 Ga0207644_10403022 3300025931 Bacteria 1118
913 Ga0207644_10774623 3300025931 Bacteria 802
914 Ga0207644_10921177 3300025931 Unclassified 733
915 Ga0207690_10016612 3300025932 Bacteria 4482
916 Ga0207690_10019122 3300025932 Bacteria 4210
917 Ga0207706_10002202 3300025933 Bacteria 18999
918 Ga0207706_10004234 3300025933 Bacteria 13519
919 Ga0207706_10018524 3300025933 Bacteria 6264
920 Ga0207706_10051063 3300025933 Unclassified 3653
921 Ga0207706_10353558 3300025933 Bacteria 1277
922 Ga0207706_10451213 3300025933 Bacteria 1112
923 Ga0207686_10074262 3300025934 Unclassified 2196
924 Ga0207686_10126552 3300025934 Bacteria 1747
925 Ga0207686_10127610 3300025934 Bacteria 1740
926 Ga0207686_10252524 3300025934 Bacteria 1289
927 Ga0207709_10010662 3300025935 Bacteria 5062
928 Ga0207709_10063794 3300025935 Bacteria 2310
929 Ga0207709_10066368 3300025935 Bacteria 2273
930 Ga0207709_10101127 3300025935 Bacteria 1906
931 Ga0207709_10153431 3300025935 Bacteria 1598
932 Ga0207709_10163686 3300025935 Bacteria 1554
933 Ga0207709_10882351 3300025935 Bacteria 726
934 Ga0207670_10036038 3300025936 Bacteria 3214
935 Ga0207670_10115771 3300025936 Bacteria 1940
936 Ga0207670_10211823 3300025936 Unclassified 1478
937 Ga0207669_10045622 3300025937 Bacteria 2583
938 Ga0207669_10393958 3300025937 Bacteria 1083
939 Ga0207704_10003936 3300025938 Bacteria 6751
940 Ga0207704_10012816 3300025938 Bacteria 4171
941 Ga0207704_10374175 3300025938 Bacteria 1116
942 Ga0207704_10412398 3300025938 Bacteria 1069
943 Ga0207704_10487954 3300025938 Bacteria 990
944 Ga0207665_10013558 3300025939 Bacteria 5361
945 Ga0207665_10018694 3300025939 Bacteria 4554
946 Ga0207665_10027606 3300025939 Bacteria 3749
947 Ga0207665_10027964 3300025939 Bacteria 3725
948 Ga0207665_10051025 3300025939 Bacteria 2783
949 Ga0207665_10095611 3300025939 Bacteria 2065
950 Ga0207665_10096401 3300025939 Bacteria 2057
951 Ga0207665_10117889 3300025939 Bacteria 1872
952 Ga0207665_10170751 3300025939 Bacteria 1570
953 Ga0207665_10264241 3300025939 Bacteria 1276
954 Ga0207665_10443492 3300025939 Bacteria 995
955 Ga0207691_10002255 3300025940 Bacteria 18873
956 Ga0207711_10003247 3300025941 Bacteria 14169
957 Ga0207711_10003820 3300025941 Bacteria 12956
958 Ga0207711_10006897 3300025941 Bacteria 9535
959 Ga0207711_10241887 3300025941 Bacteria 1655
960 Ga0207711_10305271 3300025941 Bacteria 1468
961 Ga0207711_10525971 3300025941 Bacteria 1103
962 Ga0207711_10577774 3300025941 Unclassified 1048
963 Ga0207711_10623751 3300025941 Bacteria 1006
964 Ga0207689_10000231 3300025942 Bacteria 49731
965 Ga0207689_10003650 3300025942 Bacteria 14045
966 Ga0207689_10078972 3300025942 Bacteria 2705
967 Ga0207689_10292483 3300025942 Bacteria 1349
968 Ga0207689_10948871 3300025942 Bacteria 726
969 Ga0207661_10000352 3300025944 Bacteria 29636
970 Ga0207661_10001688 3300025944 Bacteria 15064
971 Ga0207661_10035826 3300025944 Bacteria 3870
972 Ga0207661_10453799 3300025944 Bacteria 1168
973 Ga0207661_10454930 3300025944 Bacteria 1166
974 Ga0207661_10730110 3300025944 Bacteria 911
975 Ga0207679_10000039 3300025945 Bacteria 127661
976 Ga0207679_10062887 3300025945 Bacteria 2768
977 Ga0207679_10125658 3300025945 Bacteria 2049
978 Ga0207679_10149706 3300025945 Bacteria 1898
979 Ga0207679_10307233 3300025945 Bacteria 1369
980 Ga0207679_10647701 3300025945 Unclassified 955
981 Ga0207667_10022540 3300025949 Bacteria 6953
982 Ga0207667_10034306 3300025949 Bacteria 5450
983 Ga0207667_10069420 3300025949 Unclassified 3667
984 Ga0207667_10126288 3300025949 Bacteria 2635
985 Ga0207667_10403584 3300025949 Bacteria 1391
986 Ga0207667_10429324 3300025949 Unclassified 1344
987 Ga0207667_10991043 3300025949 Unclassified 828
988 Ga0207667_11061489 3300025949 Bacteria 795
989 Ga0207651_10004287 3300025960 Bacteria 7160
990 Ga0207651_10411644 3300025960 Bacteria 1152
991 Ga0207712_10036684 3300025961 Unclassified 3341
992 Ga0207712_10215360 3300025961 Bacteria 1532
993 Ga0207712_10221227 3300025961 Bacteria 1514
994 Ga0207712_10226425 3300025961 Bacteria 1498
995 Ga0207668_10049335 3300025972 Bacteria 2893
996 Ga0207668_10279111 3300025972 Bacteria 1369
997 Ga0207640_10036219 3300025981 Bacteria 3096
998 Ga0207640_10052292 3300025981 Bacteria 2660
999 Ga0207640_10059086 3300025981 Bacteria 2529
1000 Ga0207640_10113990 3300025981 Unclassified 1923
1001 Ga0207640_10148247 3300025981 Bacteria 1720
1002 Ga0207640_10287556 3300025981 Bacteria 1294
1003 Ga0207640_10577482 3300025981 Bacteria 948
1004 Ga0207658_10003811 3300025986 Bacteria 10616
1005 Ga0207658_10018733 3300025986 Bacteria 4786
1006 Ga0207658_10077811 3300025986 Unclassified 2532
1007 Ga0207658_10700725 3300025986 Bacteria 915
1008 Ga0207658_11431883 3300025986 Bacteria 632
1009 Ga0207677_10008019 3300026023 Bacteria 5876
1010 Ga0207677_10030886 3300026023 Unclassified 3425
1011 Ga0207677_10040439 3300026023 Bacteria 3074
1012 Ga0207677_10058462 3300026023 Unclassified 2655
1013 Ga0207677_10101150 3300026023 Bacteria 2121
1014 Ga0207677_10157151 3300026023 Unclassified 1762
1015 Ga0207677_10238835 3300026023 Bacteria 1468
1016 Ga0207677_10263765 3300026023 Bacteria 1405
1017 Ga0207677_10456550 3300026023 Bacteria 1096
1018 Ga0207703_10003512 3300026035 Bacteria 13111
1019 Ga0207703_10006788 3300026035 Bacteria 9123
1020 Ga0207703_10013574 3300026035 Bacteria 6347
1021 Ga0207703_10365902 3300026035 Unclassified 1331
1022 Ga0207703_10489979 3300026035 Bacteria 1153
1023 Ga0207639_10011693 3300026041 Bacteria 6102
1024 Ga0207639_10017254 3300026041 Bacteria 5117
1025 Ga0207639_10067193 3300026041 Bacteria 2789
1026 Ga0207639_10083971 3300026041 Bacteria 2529
1027 Ga0207639_10088666 3300026041 Bacteria 2469
1028 Ga0207678_10001919 3300026067 Bacteria 18985
1029 Ga0207678_10003647 3300026067 Bacteria 13847
1030 Ga0207678_10112962 3300026067 Unclassified 2317
1031 Ga0207708_10478734 3300026075 Bacteria 1041
1032 Ga0207702_10009291 3300026078 Bacteria 8260
1033 Ga0207702_10010311 3300026078 Bacteria 7827
1034 Ga0207702_10041278 3300026078 Bacteria 3868
1035 Ga0207702_10073966 3300026078 Bacteria 2940
1036 Ga0207702_10097741 3300026078 Bacteria 2584
1037 Ga0207702_10174606 3300026078 Bacteria 1973
1038 Ga0207702_10456564 3300026078 Bacteria 1240
1039 Ga0207702_10624825 3300026078 Bacteria 1058
1040 Ga0207702_10987448 3300026078 Unclassified 835
1041 Ga0207641_10000025 3300026088 Bacteria 247727
1042 Ga0207641_10037037 3300026088 Bacteria 4073
1043 Ga0207641_10048891 3300026088 Bacteria 3572
1044 Ga0207641_10071045 3300026088 Bacteria 2993
1045 Ga0207641_10110708 3300026088 Bacteria 2434
1046 Ga0207641_10787238 3300026088 Bacteria 940
1047 Ga0207648_10000420 3300026089 Bacteria 46606
1048 Ga0207648_10019763 3300026089 Bacteria 6078
1049 Ga0207648_10096315 3300026089 Bacteria 2589
1050 Ga0207648_10289459 3300026089 Bacteria 1466
1051 Ga0207676_10000104 3300026095 Bacteria 74872
1052 Ga0207676_10068161 3300026095 Bacteria 2845
1053 Ga0207676_10098824 3300026095 Bacteria 2414
1054 Ga0207676_10101999 3300026095 Unclassified 2381
1055 Ga0207674_10000604 3300026116 Bacteria 47244
1056 Ga0207674_10003553 3300026116 Bacteria 19023
1057 Ga0207674_10007458 3300026116 Bacteria 12749
1058 Ga0207674_10081701 3300026116 Bacteria 3234
1059 Ga0207674_10102178 3300026116 Bacteria 2847
1060 Ga0207674_10250624 3300026116 Bacteria 1718
1061 Ga0207674_10280800 3300026116 Bacteria 1613
1062 Ga0207674_11059391 3300026116 Bacteria 780
1063 Ga0207675_100080496 3300026118 Unclassified 3054
1064 Ga0207675_100099450 3300026118 Bacteria 2739
1065 Ga0207675_100189550 3300026118 Bacteria 1972
1066 Ga0207683_10000726 3300026121 Bacteria 29917
1067 Ga0207683_10000784 3300026121 Bacteria 28919
1068 Ga0207683_10051743 3300026121 Bacteria 3598
1069 Ga0207698_10066545 3300026142 Bacteria 2837
1070 Ga0207698_10080478 3300026142 Bacteria 2624
1071 Ga0207698_10114920 3300026142 Unclassified 2265
1072 Ga0207698_10172118 3300026142 Bacteria 1908
1073 Ga0207698_10565960 3300026142 Bacteria 1116
1074 Ga0209969_1003076 3300027360 Bacteria 2305
1075 Ga0209967_1020940 3300027364 Unclassified 954
1076 Ga0209984_1004486 3300027424 Bacteria 1648
1077 Ga0209999_1024040 3300027543 Bacteria 1123
1078 Ga0209982_1013863 3300027552 Bacteria 1215
1079 Ga0209983_1003284 3300027665 Bacteria 3472
1080 Ga0209588_1121532 3300027671 Bacteria 835
1081 Ga0209971_1003683 3300027682 Bacteria 3633
1082 Ga0209966_1033663 3300027695 Bacteria 1047
1083 Ga0209998_10002447 3300027717 Bacteria 4255
1084 Ga0209813_10095887 3300027866 Bacteria 1003
1085 Ga0209974_10003894 3300027876 Bacteria 5344
1086 Ga0207428_10273998 3300027907 Bacteria 1254
1087 Ga0265356_1000527 3300028017 Bacteria 6876
1088 Ga0268266_10004403 3300028379 Bacteria 13498
1089 Ga0268266_10041977 3300028379 Bacteria 3905
1090 Ga0268266_10766107 3300028379 Bacteria 932
1091 Ga0268265_10020364 3300028380 Unclassified 4628
1092 Ga0268265_10277840 3300028380 Bacteria 1497
1093 Ga0268264_10022623 3300028381 Bacteria 5130
1094 Ga0268264_10085044 3300028381 Bacteria 2714
1095 Ga0268264_10432780 3300028381 Unclassified 1271
1096 Ga0268264_10642697 3300028381 Bacteria 1049
1097 Ga0268264_10732282 3300028381 Bacteria 984
1098 Ga0265319_1044689 3300028563 Bacteria 1484
1099 Ga0265318_10049734 3300028577 Bacteria 1576
1100 Ga0265338_10176457 3300028800 Bacteria 1633
1101 Ga0265338_10181701 3300028800 Bacteria 1603
1102 Ga0265338_10194674 3300028800 Bacteria 1533
1103 Ga0265338_10227727 3300028800 Bacteria 1388
1104 Ga0265338_10534887 3300028800 Bacteria 822
1105 Ga0265762_1012486 3300030760 Bacteria 1524
1106 Ga0265762_1027107 3300030760 Bacteria 1074
1107 Ga0265770_1008450 3300030878 Bacteria 1469
1108 Ga0265760_10006141 3300031090 Bacteria 3432
1109 Ga0265760_10008589 3300031090 Bacteria 2917
1110 Ga0265330_10003430 3300031235 Bacteria 8293
1111 Ga0265332_10000189 3300031238 Bacteria 50320
1112 Ga0265328_10059431 3300031239 Bacteria 1403
1113 Ga0265320_10019109 3300031240 Bacteria 3755
1114 Ga0265320_10070919 3300031240 Bacteria 1642
1115 Ga0265325_10014749 3300031241 Bacteria 4410
1116 Ga0265325_10016662 3300031241 Unclassified 4103
1117 Ga0265325_10035936 3300031241 Bacteria 2627
1118 Ga0265329_10001491 3300031242 Bacteria 11228
1119 Ga0265340_10171934 3300031247 Bacteria 981
1120 Ga0265339_10059325 3300031249 Bacteria 2064
1121 Ga0265339_10099337 3300031249 Bacteria 1517
1122 Ga0265331_10203104 3300031250 Bacteria 892
1123 Ga0265331_10258071 3300031250 Bacteria 782
1124 Ga0265316_10000012 3300031344 Bacteria 223661
1125 Ga0265316_10004115 3300031344 Bacteria 14560
1126 Ga0265316_10337922 3300031344 Bacteria 1092
1127 Ga0307408_100021105 3300031548 Bacteria 4403
1128 Ga0307408_100033371 3300031548 Unclassified 3596
1129 Ga0307408_100084069 3300031548 Bacteria 2386
1130 Ga0316575_10013005 3300031665 Bacteria 3106
1131 Ga0316579_10008336 3300031691 Bacteria 4318
1132 Ga0316579_10022015 3300031691 Bacteria 2847
1133 Ga0265314_10000018 3300031711 Bacteria 328404
1134 Ga0265314_10000198 3300031711 Bacteria 89925
1135 Ga0265314_10084831 3300031711 Bacteria 2078
1136 Ga0265342_10000167 3300031712 Bacteria 72872
1137 Ga0316576_10018144 3300031727 Bacteria 4797
1138 Ga0316576_10088811 3300031727 Bacteria 2301
1139 Ga0316576_10236788 3300031727 Bacteria 1372
1140 Ga0316576_10283905 3300031727 Bacteria 1239
1141 Ga0316578_10000459 3300031728 Bacteria 13556
1142 Ga0316578_10060867 3300031728 Bacteria 2223
1143 Ga0307405_10026290 3300031731 Bacteria 3356
1144 Ga0307405_10034813 3300031731 Unclassified 3001
1145 Ga0307405_10062762 3300031731 Bacteria 2354
1146 Ga0307405_11040072 3300031731 Bacteria 701
1147 Ga0316577_10002831 3300031733 Bacteria 8666
1148 Ga0316577_10004740 3300031733 Bacteria 7063
1149 Ga0307413_10026956 3300031824 Bacteria 3176
1150 Ga0307413_10098532 3300031824 Bacteria 1925
1151 Ga0307413_10265507 3300031824 Bacteria 1282
1152 Ga0307413_10280236 3300031824 Bacteria 1253
1153 Ga0307410_10006506 3300031852 Bacteria 6310
1154 Ga0307410_10036760 3300031852 Bacteria 3192
1155 Ga0307410_10045493 3300031852 Bacteria 2923
1156 Ga0307410_10106518 3300031852 Bacteria 2020
1157 Ga0307410_10157474 3300031852 Bacteria 1698
1158 Ga0307410_10173140 3300031852 Bacteria 1628
1159 Ga0307406_10002519 3300031901 Bacteria 9980
1160 Ga0307406_10209314 3300031901 Bacteria 1441
1161 Ga0307406_10396645 3300031901 Unclassified 1092
1162 Ga0307406_10827253 3300031901 Unclassified 783
1163 Ga0307407_10059452 3300031903 Bacteria 2226
1164 Ga0307407_10127520 3300031903 Bacteria 1623
1165 Ga0307407_10132461 3300031903 Bacteria 1597
1166 Ga0307412_10175028 3300031911 Bacteria 1608
1167 Ga0307409_100008862 3300031995 Bacteria 6138
1168 Ga0307409_100013554 3300031995 Bacteria 5254
1169 Ga0307409_100114459 3300031995 Bacteria 2269
1170 Ga0307409_100745578 3300031995 Bacteria 983
1171 Ga0307409_101064836 3300031995 Bacteria 829
1172 Ga0307409_101335469 3300031995 Bacteria 742
1173 Ga0307416_100004516 3300032002 Bacteria 8401
1174 Ga0307416_100012241 3300032002 Bacteria 5767
1175 Ga0307416_100040761 3300032002 Bacteria 3611
1176 Ga0307416_100053112 3300032002 Bacteria 3249
1177 Ga0307416_100100859 3300032002 Bacteria 2512
1178 Ga0307416_100103287 3300032002 Bacteria 2488
1179 Ga0307416_101422444 3300032002 Bacteria 799
1180 Ga0307414_10010303 3300032004 Bacteria 5417
1181 Ga0307414_10047896 3300032004 Bacteria 2945
1182 Ga0307414_10067577 3300032004 Bacteria 2561
1183 Ga0307414_10341622 3300032004 Bacteria 1282
1184 Ga0307414_10544958 3300032004 Unclassified 1033
1185 Ga0307411_10001054 3300032005 Bacteria 10681
1186 Ga0307411_10003990 3300032005 Bacteria 6972
1187 Ga0307411_10137510 3300032005 Bacteria 1796
1188 Ga0307415_100080220 3300032126 Bacteria 2327
1189 Ga0307415_100080643 3300032126 Bacteria 2322
1190 Ga0307415_100123368 3300032126 Unclassified 1947
1191 Ga0307415_100163389 3300032126 Bacteria 1728
1192 Ga0307415_100596985 3300032126 Bacteria 982
1193 Ga0316585_10053905 3300032137 Bacteria 1293
1194 Ga0316593_10003588 3300032168 Bacteria 3875
1195 Ga0307510_10077326 3300033180 Bacteria 3265
1196 Ga0373930_0001318 3300034816 Bacteria 3653
1197 Ga0373926_0006837 3300035083 Bacteria 3791
1198 Ga0373926_0108075 3300035083 Bacteria 1044
1199 Ga0373929_0001585 3300035085 Bacteria 4321
1200 Ga0373934_0003679 3300035086 Bacteria 5636
1201 Ga0373934_0228158 3300035086 Bacteria 769
1202 Ga0373934_0243621 3300035086 Unclassified 743
1203 Ga0373940_0047643 3300035088 Bacteria 1196
1204 Ga0373951_0088134 3300035091 Bacteria 811
1205 Ga0373952_0053819 3300035092 Bacteria 967
1206 Ga0373932_0000834 3300035112 Bacteria 9113
1207 Ga0373932_0022647 3300035112 Bacteria 1671
1208 Ga0373936_0019252 3300035113 Bacteria 2645
1209 Ga0373936_0259423 3300035113 Bacteria 778
1210 Ga0373939_0020664 3300035114 Bacteria 1792
1211 Ga0373941_0217303 3300035115 Bacteria 733
1212 Ga0373945_0004252 3300035116 Bacteria 4540
1213 Ga0373945_0032184 3300035116 Bacteria 1857
1214 Ga0373954_0156515 3300035118 Unclassified 1114
1215 Ga0373954_0246503 3300035118 Bacteria 879
1216 Ga0373956_0004940 3300035119 Bacteria 5343
1217 Ga0373957_0005470 3300035120 Bacteria 3939
1218 Ga0373943_0045635 3300035170 Bacteria 2136
1219 Ga0373943_0275191 3300035170 Bacteria 950
1220 Ga0373946_0008084 3300035171 Bacteria 3861
1221 Ga0373946_0094293 3300035171 Bacteria 1331
1222 Ga0373946_0173279 3300035171 Bacteria 1020
1223 Ga0373955_0000551 3300035172 Bacteria 15891
1224 Ga0373955_0006577 3300035172 Bacteria 5302
1225 Ga0373955_0225354 3300035172 Unclassified 1121
1226 Ga0373942_0092768 3300035207 Bacteria 912
1227 Ga0316574_0016508 3300035398 Bacteria 4304
1228 Ga0373924_0000008 3300035410 Bacteria 53662
1229 Ga0373924_0110893 3300035410 Bacteria 1186
1230 Ga0373931_0000023 3300035691 Bacteria 130307
1231 Ga0373931_0000032 3300035691 Bacteria 96498
1232 Ga0373931_0020792 3300035691 Bacteria 3286
1233 Ga0373931_0068215 3300035691 Bacteria 1935
1234 Ga0373931_0072542 3300035691 Bacteria 1883
1235 Ga0373931_0275927 3300035691 Bacteria 1030
1236 Ga0373935_0009180 3300035692 Bacteria 5919
1237 Ga0373935_0017413 3300035692 Bacteria 4359
1238 Ga0373935_0017443 3300035692 Bacteria 4356
1239 Ga0373935_0110276 3300035692 Bacteria 1826
1240 Ga0373935_0271716 3300035692 Bacteria 1191
1241 Ga0373935_0314129 3300035692 Bacteria 1110
1242 Ga0373935_0596052 3300035692 Bacteria 808
1243 Ga0373935_0820505 3300035692 Bacteria 687
1244 Ga0373927_0010002 3300035695 Bacteria 6356
1245 Ga0373927_0038549 3300035695 Bacteria 3102
1246 Ga0373933_0001024 3300035724 Bacteria 16990
1247 Ga0373933_0135349 3300035724 Bacteria 1552
1248 Ga0373933_0343492 3300035724 Bacteria 969
1249 Ga0373933_0385597 3300035724 Bacteria 913
1250 Ga0373947_0002990 3300035725 Bacteria 10083
1251 Ga0373947_0023398 3300035725 Bacteria 3593
1252 Ga0373947_0197742 3300035725 Bacteria 1314
1253 Ga0373947_0527720 3300035725 Unclassified 803
1254 Ga0373937_0001557 3300036401 Bacteria 19271
1255 Ga0373937_0002112 3300036401 Bacteria 16616
1256 Ga0373937_0010757 3300036401 Bacteria 8007
1257 Ga0373937_0042785 3300036401 Bacteria 4133
1258 Ga0373937_0091057 3300036401 Unclassified 2826
1259 Ga0373937_0094383 3300036401 Bacteria 2774
1260 Ga0373937_0152521 3300036401 Bacteria 2165
1261 Ga0373937_0289171 3300036401 Bacteria 1548
1262 Ga0316582_0017219 3300036647 Bacteria 4176
1263 Ga0316584_0007974 3300036712 Bacteria 7269
1264 Ga0316584_0052742 3300036712 Bacteria 3042
1265 Ga0316584_0098649 3300036712 Bacteria 2187
1266 Ga0316584_0250530 3300036712 Bacteria 1294
1267 Ga0373925_0002316 3300037068 Bacteria 15322
1268 Ga0373925_0084762 3300037068 Bacteria 2415
1269 Ga0373925_0176184 3300037068 Bacteria 1690
1270 Ga0373925_0817616 3300037068 Bacteria 768
1271 Ga0373925_1298761 3300037068 Bacteria 597
1272 Ga0395900_0892221 3300037418 Bacteria 813
1273 Ga0395898_0053514 3300037466 Bacteria 3943
1274 Ga0395898_0204508 3300037466 Bacteria 1884
1275 Ga0395898_0314219 3300037466 Bacteria 1495
1276 Ga0395898_0583094 3300037466 Bacteria 1061
1277 Ga0395905_0862101 3300037471 Bacteria 809
1278 Ga0395905_0993944 3300037471 Bacteria 742
1279 Ga0316581_0000534 3300037588 Bacteria 7400
1280 Ga0395901_0259104 3300038443 Bacteria 1810
1281 Ga0395901_0289175 3300038443 Bacteria 1701
1282 Ga0395901_0707038 3300038443 Bacteria 1005
1283 Ga0395901_0817143 3300038443 Bacteria 920
1284 Ga0242420_043691 3300038996 Bacteria 861
1285 Ga0436365_1934168 3300039437 Bacteria 901
1286 Ga0436360_0101956 3300039438 Bacteria 1195
1287 Ga0436361_0045848 3300039447 Bacteria 1941
1288 Ga0436363_0072374 3300039450 Bacteria 1034
1289 Ga0436363_0772685 3300039450 Bacteria 765
1290 Ga0436363_1061698 3300039450 Bacteria 1205
1291 Ga0436363_1440667 3300039450 Bacteria 1746
1292 Ga0436362_0132200 3300039453 Bacteria 1517
1293 Ga0436362_0209279 3300039453 Unclassified 2173
1294 Ga0436362_0360508 3300039453 Bacteria 2428
1295 Ga0436362_0562393 3300039453 Bacteria 766
1296 Ga0451837_1267093 3300041494 Bacteria 738
1297 Ga0439452_022732 3300042010 Bacteria 1620
1298 Ga0450890_019146 3300042127 Bacteria 921
1299 Ga0439434_0101256 3300042435 Bacteria 928
1300 Ga0439435_0107811 3300042436 Bacteria 862
1301 Ga0451577_0003187 3300042876 Bacteria 18440
1302 Ga0451577_0025229 3300042876 Bacteria 5396
1303 Ga0451577_0114947 3300042876 Bacteria 2409
1304 Ga0451577_0263264 3300042876 Bacteria 1561
1305 Ga0451577_0339552 3300042876 Bacteria 1362
1306 Ga0453683_0001085 3300044673 Bacteria 25080
1307 Ga0453683_0024608 3300044673 Bacteria 3829
1308 Ga0453683_0032832 3300044673 Bacteria 3273
1309 Ga0453683_0135304 3300044673 Bacteria 1554
1310 Ga0466961_0191167 3300044693 Bacteria 1269
1311 Ga0466963_0002972 3300044694 Bacteria 9576
1312 Ga0466963_0040370 3300044694 Bacteria 3059
1313 Ga0466963_0093332 3300044694 Bacteria 2052
1314 Ga0466963_0115917 3300044694 Bacteria 1841
1315 Ga0466963_0791828 3300044694 Bacteria 669
1316 Ga0466964_0078311 3300044706 Bacteria 1413
1317 Ga0466964_0080654 3300044706 Bacteria 1396
1318 Ga0453684_0000289 3300044712 Bacteria 215476
1319 Ga0453684_0122496 3300044712 Bacteria 3137
1320 Ga0453684_0408078 3300044712 Bacteria 1520
1321 Ga0453684_0440748 3300044712 Bacteria 1452
1322 Ga0453684_0483926 3300044712 Bacteria 1373
1323 Ga0453684_0824404 3300044712 Bacteria 999
1324 Ga0453684_1323518 3300044712 Bacteria 750
1325 Ga0466968_0202575 3300044735 Bacteria 930
1326 Ga0466957_0539321 3300044842 Unclassified 812
1327 Ga0466959_0031915 3300045049 Bacteria 3899
1328 Ga0466959_0074023 3300045049 Bacteria 2463
1329 Ga0466959_0253707 3300045049 Bacteria 1213
1330 Ga0466959_0374583 3300045049 Bacteria 969
1331 Ga0451576_0009204 3300045051 Bacteria 11477
1332 Ga0451576_0009293 3300045051 Bacteria 11419
1333 Ga0451576_0022408 3300045051 Bacteria 6849
1334 Ga0451576_0112881 3300045051 Bacteria 2828
1335 Ga0451576_0271136 3300045051 Bacteria 1774
1336 Ga0451576_0276661 3300045051 Bacteria 1755
1337 Ga0451576_0395683 3300045051 Bacteria 1448
1338 Ga0451576_0461007 3300045051 Bacteria 1334
1339 Ga0451576_0537069 3300045051 Unclassified 1228
1340 Ga0451576_0544031 3300045051 Bacteria 1220
1341 Ga0466958_0069080 3300045836 Bacteria 2160
1342 Ga0466967_0016446 3300045976 Bacteria 5834
1343 Ga0466967_0025416 3300045976 Bacteria 4884
1344 Ga0466967_0085038 3300045976 Bacteria 2863
1345 Ga0466967_0187090 3300045976 Bacteria 1956
1346 Ga0466967_0223882 3300045976 Bacteria 1789
1347 Ga0466967_0305023 3300045976 Bacteria 1533
1348 Ga0466967_0336400 3300045976 Bacteria 1459
1349 Ga0495629_0013152 3300046459 Bacteria 5976
1350 Ga0495651_0011185 3300046462 Bacteria 6899
1351 Ga0495651_0138209 3300046462 Bacteria 1770
1352 Ga0495651_0402484 3300046462 Bacteria 893
1353 Ga0495580_0002574 3300046472 Bacteria 15779
1354 Ga0495580_0005542 3300046472 Bacteria 10411
1355 Ga0495580_0028292 3300046472 Bacteria 4075
1356 Ga0495580_0058402 3300046472 Bacteria 2713
1357 Ga0495580_0063840 3300046472 Bacteria 2582
1358 Ga0495580_0186918 3300046472 Bacteria 1430
1359 Ga0495580_0373021 3300046472 Bacteria 965
1360 Ga0495582_0001652 3300046473 Bacteria 12577
1361 Ga0495582_0092998 3300046473 Bacteria 1683
1362 Ga0495639_0003842 3300046475 Bacteria 6451
1363 Ga0495639_0102090 3300046475 Bacteria 1355
1364 Ga0495662_0113307 3300046476 Bacteria 1330
1365 Ga0495664_0054274 3300046477 Bacteria 2383
1366 Ga0495594_0036766 3300046499 Bacteria 2671
1367 Ga0495628_0073403 3300046516 Bacteria 2666
1368 Ga0495628_0166705 3300046516 Bacteria 1672
1369 Ga0495628_0222875 3300046516 Bacteria 1416
1370 Ga0495628_0415342 3300046516 Bacteria 981
1371 Ga0495630_0202986 3300046517 Bacteria 1513
1372 Ga0495644_0099158 3300046523 Bacteria 1102
1373 Ga0495665_0122690 3300046531 Bacteria 1360
1374 Ga0495586_0395564 3300046535 Bacteria 795
1375 Ga0495621_0081877 3300046539 Bacteria 1205
1376 Ga0495645_0035667 3300046543 Bacteria 3626
1377 Ga0495645_0164261 3300046543 Bacteria 1533
1378 Ga0495667_0297279 3300046559 Bacteria 1023
1379 Ga0495668_0093682 3300046616 Bacteria 1645
1380 Ga0495635_0050678 3300046663 Bacteria 2862
1381 Ga0495635_0175464 3300046663 Unclassified 1457
1382 Ga0495623_0037269 3300046679 Bacteria 3113
1383 Ga0495646_0277758 3300046680 Bacteria 891
1384 Ga0495658_0023444 3300046683 Bacteria 3276
1385 Ga0495658_0148109 3300046683 Bacteria 1440
1386 Ga0495658_0387816 3300046683 Bacteria 890
1387 Ga0495658_0715268 3300046683 Bacteria 641
1388 Ga0495669_0006857 3300046684 Unclassified 4768
1389 Ga0495669_0012756 3300046684 Unclassified 3578
1390 Ga0495613_0398384 3300046689 Bacteria 939
1391 Ga0495624_0035583 3300046690 Bacteria 3215
1392 Ga0495670_0225097 3300046691 Bacteria 997
1393 Ga0495600_0067007 3300046809 Bacteria 2347
1394 Ga0495581_0053750 3300047315 Unclassified 2326
1395 Ga0495604_0607895 3300047317 Bacteria 700
1396 Ga0495674_0115303 3300047319 Bacteria 2274
1397 Ga0495674_0231538 3300047319 Bacteria 1525
1398 Ga0495674_0570611 3300047319 Bacteria 899
1399 Ga0495674_0683553 3300047319 Bacteria 807
1400 Ga0495676_0067792 3300047321 Bacteria 2760
1401 Ga0495676_0225335 3300047321 Bacteria 1290
1402 Ga0495680_0105558 3300047322 Bacteria 2095
1403 Ga0495675_0060822 3300047444 Bacteria 2393
1404 Ga0495675_0203734 3300047444 Bacteria 1203
1405 Ga0495675_0543453 3300047444 Unclassified 663
1406 Ga0495684_0323674 3300047471 Bacteria 1102
1407 Ga0495602_0130583 3300048088 Bacteria 2005
1408 Ga0495602_0499360 3300048088 Bacteria 851
1409 Ga0495602_0536088 3300048088 Bacteria 813
1410 Ga0495602_0739539 3300048088 Bacteria 665
1411 Ga0495614_0198950 3300048089 Bacteria 906
1412 Ga0496100_0026308 3300048903 Bacteria 3566
1413 Ga0496100_0165865 3300048903 Bacteria 1587
1414 Ga0496100_0172610 3300048903 Bacteria 1558
1415 Ga0496100_0469835 3300048903 Bacteria 966
1416 Ga0496101_0005020 3300048904 Bacteria 8410
1417 Ga0496101_0035888 3300048904 Bacteria 3508
1418 Ga0496101_0062982 3300048904 Bacteria 2698
1419 Ga0496101_0079088 3300048904 Bacteria 2427
1420 Ga0496101_0084067 3300048904 Bacteria 2357
1421 Ga0496101_0087991 3300048904 Unclassified 2306
1422 Ga0496101_0210728 3300048904 Bacteria 1505
1423 Ga0496101_0250499 3300048904 Bacteria 1380
1424 Ga0496101_0262310 3300048904 Bacteria 1348
1425 Ga0496101_0667462 3300048904 Bacteria 821
1426 Ga0496102_0010205 3300048905 Bacteria 8071
1427 Ga0496102_0014302 3300048905 Bacteria 6896
1428 Ga0496102_0020890 3300048905 Bacteria 5788
1429 Ga0496102_0044459 3300048905 Bacteria 4031
1430 Ga0496102_0154164 3300048905 Bacteria 2159
1431 Ga0496102_0199049 3300048905 Bacteria 1888
1432 Ga0496102_0305931 3300048905 Bacteria 1498
1433 Ga0496102_0404395 3300048905 Bacteria 1283
1434 Ga0496102_0586093 3300048905 Bacteria 1038
1435 Ga0496102_0777368 3300048905 Unclassified 880
1436 Ga0496102_0867109 3300048905 Bacteria 825
1437 Ga0496103_0002447 3300048906 Bacteria 11676
1438 Ga0496103_0035163 3300048906 Unclassified 3067
1439 Ga0496103_0037172 3300048906 Bacteria 2983
1440 Ga0496103_0037479 3300048906 Bacteria 2971
1441 Ga0496103_0108497 3300048906 Bacteria 1761
1442 Ga0496103_0378352 3300048906 Bacteria 910
1443 Ga0496104_0004149 3300048907 Bacteria 12580
1444 Ga0496104_0028506 3300048907 Bacteria 5175
1445 Ga0496104_0046203 3300048907 Bacteria 4099
1446 Ga0496104_0076858 3300048907 Bacteria 3180
1447 Ga0496104_0081184 3300048907 Bacteria 3092
1448 Ga0496104_0092780 3300048907 Bacteria 2887
1449 Ga0496104_0098153 3300048907 Bacteria 2804
1450 Ga0496104_0258536 3300048907 Bacteria 1654
1451 Ga0496104_0277247 3300048907 Bacteria 1590
1452 Ga0496104_0404369 3300048907 Bacteria 1277
1453 Ga0496104_0434156 3300048907 Bacteria 1225
1454 Ga0496104_0518006 3300048907 Bacteria 1104
1455 Ga0496104_1432061 3300048907 Bacteria 594
1456 Ga0496105_0003388 3300048908 Bacteria 11780
1457 Ga0496105_0036976 3300048908 Bacteria 4022
1458 Ga0496105_0069733 3300048908 Unclassified 2905
1459 Ga0496105_0184719 3300048908 Bacteria 1706
1460 Ga0496105_0258319 3300048908 Bacteria 1409
1461 Ga0496105_0347190 3300048908 Bacteria 1186
1462 Ga0496105_0930822 3300048908 Bacteria 653
1463 Ga0496106_0034077 3300048909 Unclassified 3802
1464 Ga0496106_0035232 3300048909 Bacteria 3742
1465 Ga0496106_0138456 3300048909 Bacteria 1913
1466 Ga0496106_0152622 3300048909 Bacteria 1823
1467 Ga0496106_0260681 3300048909 Bacteria 1387
1468 Ga0496106_0279529 3300048909 Bacteria 1337
1469 Ga0496106_0309574 3300048909 Unclassified 1267
1470 Ga0496107_0011189 3300048910 Bacteria 6245
1471 Ga0496107_0032731 3300048910 Bacteria 3717
1472 Ga0496107_0036181 3300048910 Bacteria 3541
1473 Ga0496107_0055006 3300048910 Bacteria 2874
1474 Ga0496107_0059174 3300048910 Bacteria 2772
1475 Ga0496107_0145824 3300048910 Bacteria 1750
1476 Ga0496108_0000539 3300048911 Bacteria 29583
1477 Ga0496108_0000624 3300048911 Bacteria 27681
1478 Ga0496108_0008317 3300048911 Bacteria 8414
1479 Ga0496108_0012878 3300048911 Bacteria 6814
1480 Ga0496108_0481259 3300048911 Bacteria 1084
1481 Ga0496108_0536816 3300048911 Bacteria 1021
1482 Ga0496108_0587144 3300048911 Bacteria 971
1483 Ga0496108_1105606 3300048911 Unclassified 673
1484 Ga0496109_0000099 3300048912 Bacteria 89901
1485 Ga0496109_0000476 3300048912 Bacteria 34082
1486 Ga0496109_0001321 3300048912 Bacteria 20438
1487 Ga0496109_0010275 3300048912 Bacteria 7992
1488 Ga0496109_0026455 3300048912 Bacteria 5174
1489 Ga0496109_0126835 3300048912 Unclassified 2380
1490 Ga0496109_0224959 3300048912 Bacteria 1765
1491 Ga0496109_0225897 3300048912 Bacteria 1761
1492 Ga0496109_0456729 3300048912 Bacteria 1206
1493 Ga0496109_1045323 3300048912 Bacteria 754
1494 Ga0496109_1372316 3300048912 Bacteria 642
1495 Ga0496110_0005089 3300048913 Bacteria 10269
1496 Ga0496110_0016292 3300048913 Bacteria 6204
1497 Ga0496110_0033897 3300048913 Unclassified 4419
1498 Ga0496110_0158280 3300048913 Bacteria 2053
1499 Ga0496110_0238635 3300048913 Bacteria 1654
1500 Ga0496110_0389532 3300048913 Bacteria 1270
1501 Ga0496110_0431488 3300048913 Unclassified 1201
1502 Ga0496110_0572911 3300048913 Bacteria 1025
1503 Ga0496110_0765974 3300048913 Bacteria 869
1504 Ga0496110_1099719 3300048913 Bacteria 703
1505 Ga0496111_0007248 3300048914 Bacteria 7256
1506 Ga0496111_0020308 3300048914 Bacteria 4623
1507 Ga0496111_0022731 3300048914 Bacteria 4393
1508 Ga0496111_0024930 3300048914 Unclassified 4218
1509 Ga0496111_0066648 3300048914 Bacteria 2615
1510 Ga0496111_0242643 3300048914 Bacteria 1338
1511 Ga0496111_0246108 3300048914 Bacteria 1327
1512 Ga0496112_0000043 3300048915 Bacteria 87684
1513 Ga0496112_0000881 3300048915 Bacteria 21551
1514 Ga0496112_0003352 3300048915 Bacteria 13216
1515 Ga0496112_0004846 3300048915 Bacteria 11494
1516 Ga0496112_0010012 3300048915 Bacteria 8581
1517 Ga0496112_0010923 3300048915 Bacteria 8268
1518 Ga0496112_0014955 3300048915 Bacteria 7222
1519 Ga0496112_0048523 3300048915 Bacteria 4163
1520 Ga0496112_0072190 3300048915 Bacteria 3412
1521 Ga0496112_0099888 3300048915 Bacteria 2872
1522 Ga0496112_0102119 3300048915 Unclassified 2837
1523 Ga0496112_0124787 3300048915 Unclassified 2545
1524 Ga0496112_0128008 3300048915 Unclassified 2510
1525 Ga0496112_0836055 3300048915 Bacteria 845
1526 Ga0496113_0000107 3300048916 Bacteria 35660
1527 Ga0496113_0001162 3300048916 Bacteria 14346
1528 Ga0496113_0041349 3300048916 Bacteria 3401
1529 Ga0496113_0046287 3300048916 Bacteria 3229
1530 Ga0496113_0051842 3300048916 Bacteria 3062
1531 Ga0496113_0517256 3300048916 Bacteria 958
1532 Ga0496113_0695343 3300048916 Bacteria 812
1533 Ga0496114_0020768 3300048917 Bacteria 5331
1534 Ga0496115_0014767 3300048918 Bacteria 5920
1535 Ga0496115_0025648 3300048918 Bacteria 4592
1536 Ga0496115_0042413 3300048918 Bacteria 3624
1537 Ga0496115_0103329 3300048918 Bacteria 2337
1538 Ga0496116_0000497 3300048919 Bacteria 53982
1539 Ga0496117_0002230 3300048920 Bacteria 25036
1540 Ga0496118_0005525 3300048921 Bacteria 14342
1541 Ga0496119_0003539 3300048922 Bacteria 16119
1542 Ga0501290_030934 3300049513 Unclassified 767
1543 Ga0501298_024576 3300049521 Bacteria 1149
1544 Ga0501031_0002507 3300049568 Bacteria 11694
1545 Ga0501031_0118149 3300049568 Bacteria 1732
1546 Ga0501032_0014295 3300049569 Bacteria 5622
1547 Ga0501032_0027826 3300049569 Bacteria 3885
1548 Ga0501033_0009488 3300049570 Bacteria 7496
1549 Ga0501033_0181521 3300049570 Unclassified 1508
1550 Ga0501034_0077362 3300049571 Bacteria 3333
1551 Ga0501034_0449545 3300049571 Bacteria 1206
1552 Ga0501036_0001561 3300049572 Bacteria 17690
1553 Ga0501036_0009639 3300049572 Bacteria 7944
1554 Ga0501036_0459169 3300049572 Bacteria 1061
1555 Ga0501037_0004456 3300049573 Bacteria 10172
1556 Ga0501037_0046219 3300049573 Bacteria 3193
1557 Ga0501037_0072998 3300049573 Bacteria 2495
1558 Ga0501037_0080298 3300049573 Bacteria 2367
1559 Ga0501038_0011663 3300049574 Bacteria 8016
1560 Ga0501038_0058831 3300049574 Bacteria 3293
1561 Ga0501038_0143995 3300049574 Bacteria 1947
1562 Ga0501039_0001505 3300049575 Bacteria 17162
1563 Ga0501039_0065597 3300049575 Bacteria 2816
1564 Ga0501039_0315236 3300049575 Bacteria 1229
1565 Ga0501040_0000411 3300049576 Bacteria 25323
1566 Ga0501040_0181177 3300049576 Bacteria 1493
1567 Ga0501040_0412740 3300049576 Bacteria 970
1568 Ga0501041_0008505 3300049577 Bacteria 6039
1569 Ga0501041_0035751 3300049577 Bacteria 3010
1570 Ga0501041_0057285 3300049577 Bacteria 2383
1571 Ga0501041_0066702 3300049577 Unclassified 2205
1572 Ga0501041_0204296 3300049577 Bacteria 1239
1573 Ga0501041_0670575 3300049577 Bacteria 663
1574 Ga0501042_0000863 3300049578 Bacteria 16929
1575 Ga0501042_0011345 3300049578 Bacteria 6010
1576 Ga0501042_0024759 3300049578 Bacteria 4211
1577 Ga0501043_0004222 3300049579 Bacteria 11721
1578 Ga0501043_0057987 3300049579 Bacteria 3039
1579 Ga0501043_0299864 3300049579 Bacteria 1228
1580 Ga0501046_0010572 3300049580 Bacteria 7918
1581 Ga0501046_0022710 3300049580 Bacteria 5166
1582 Ga0501046_0040961 3300049580 Bacteria 3698
1583 Ga0501046_0178425 3300049580 Unclassified 1589
1584 Ga0501046_0418445 3300049580 Bacteria 966
1585 Ga0501047_0747062 3300049581 Bacteria 794
1586 Ga0501048_0000930 3300049582 Bacteria 21593
1587 Ga0501048_0034945 3300049582 Bacteria 3622
1588 Ga0501048_0043170 3300049582 Bacteria 3227
1589 Ga0501048_0067449 3300049582 Bacteria 2529
1590 Ga0501068_0003203 3300049584 Bacteria 8767
1591 Ga0501068_0006736 3300049584 Bacteria 6347
1592 Ga0501068_0700812 3300049584 Bacteria 662
1593 Ga0501070_0476588 3300049586 Bacteria 1004
1594 Ga0501070_0851229 3300049586 Unclassified 713
1595 Ga0501071_0000546 3300049587 Bacteria 19380
1596 Ga0501071_0032377 3300049587 Bacteria 3712
1597 Ga0501071_0156579 3300049587 Bacteria 1701
1598 Ga0501071_0618014 3300049587 Bacteria 833
1599 Ga0501072_0022783 3300049588 Bacteria 4860
1600 Ga0501072_0136216 3300049588 Unclassified 1957
1601 Ga0501072_0450346 3300049588 Bacteria 1019
1602 Ga0501073_0043633 3300049589 Bacteria 3162
1603 Ga0501073_0206082 3300049589 Bacteria 1359
1604 Ga0501074_0059820 3300049590 Bacteria 2744
1605 Ga0501075_0000466 3300049591 Bacteria 24054
1606 Ga0501075_0067040 3300049591 Bacteria 2709
1607 Ga0501075_0163379 3300049591 Bacteria 1699
1608 Ga0501075_0165603 3300049591 Bacteria 1686
1609 Ga0501075_0520033 3300049591 Bacteria 908
1610 Ga0501076_0000395 3300049592 Bacteria 27358
1611 Ga0501076_0013431 3300049592 Bacteria 6143
1612 Ga0501076_0169115 3300049592 Bacteria 1781
1613 Ga0501076_0344221 3300049592 Bacteria 1224
1614 Ga0501076_0355216 3300049592 Bacteria 1204
1615 Ga0501077_0008250 3300049593 Bacteria 6444
1616 Ga0501077_0021133 3300049593 Bacteria 4118
1617 Ga0501077_0078270 3300049593 Bacteria 2095
1618 Ga0501077_0183182 3300049593 Bacteria 1331
1619 Ga0501206_025042 3300049653 Bacteria 867
1620 Ga0501233_076047 3300049668 Unclassified 858
1621 Ga0501221_033781 3300049704 Unclassified 1082
1622 Ga0501225_0143732 3300049705 Unclassified 723
1623 Ga0501245_047057 3300049708 Unclassified 755
1624 Ga0501079_0000187 3300049741 Bacteria 35452
1625 Ga0501079_0083078 3300049741 Bacteria 2478
1626 Ga0501079_0247917 3300049741 Bacteria 1392
1627 Ga0501079_0315480 3300049741 Bacteria 1224
1628 Ga0501079_0362258 3300049741 Bacteria 1136
1629 Ga0501079_1136173 3300049741 Bacteria 615
1630 Ga0501080_0005523 3300049742 Bacteria 11287
1631 Ga0501080_0024091 3300049742 Bacteria 5642
1632 Ga0501080_0025086 3300049742 Bacteria 5532
1633 Ga0501080_0068579 3300049742 Bacteria 3299
1634 Ga0501081_0013627 3300049743 Bacteria 5344
1635 Ga0501081_0033734 3300049743 Bacteria 3480
1636 Ga0501081_0036893 3300049743 Bacteria 3334
1637 Ga0501081_0099773 3300049743 Unclassified 2051
1638 Ga0501081_0324007 3300049743 Bacteria 1133
1639 Ga0501081_0362429 3300049743 Bacteria 1069
1640 Ga0501081_0548003 3300049743 Bacteria 864
1641 Ga0501083_0008767 3300049744 Bacteria 7136
1642 Ga0501083_0081137 3300049744 Bacteria 2150
1643 Ga0501083_0305412 3300049744 Bacteria 1035
1644 Ga0501264_024411 3300049761 Unclassified 661
1645 Ga0501264_026269 3300049761 Bacteria 646
1646 Ga0501283_006432 3300049779 Bacteria 1645
1647 Ga0501283_008243 3300049779 Bacteria 1498
1648 Ga0501035_0009687 3300049822 Bacteria 8960
1649 Ga0501035_0044832 3300049822 Bacteria 3980
1650 Ga0501035_0083942 3300049822 Bacteria 2810
1651 Ga0501044_0001508 3300049823 Bacteria 27283
1652 Ga0501044_0202590 3300049823 Unclassified 1942
1653 Ga0501044_0218969 3300049823 Bacteria 1855
1654 Ga0501045_0012759 3300049824 Bacteria 5920
1655 Ga0501045_0068534 3300049824 Bacteria 2607
1656 Ga0501045_0320923 3300049824 Bacteria 1152
1657 Ga0501204_004271 3300049850 Bacteria 1536
1658 Ga0501212_022108 3300049851 Bacteria 991
1659 nmdc:mga03683_205176_c1 3300050489 Bacteria 905
1660 nmdc:mga03n38_146018_c1 3300050490 Bacteria 1186
1661 nmdc:mga03n38_17955_c1 3300050490 Bacteria 2782
1662 nmdc:mga00v17_224940_c1 3300050491 Bacteria 1215
1663 nmdc:mga0yw44_75338_c1 3300050492 Bacteria 2104
1664 nmdc:mga0k408_13_c1 3300050493 Bacteria 48149
1665 nmdc:mga06z11_115172_c1 3300050494 Bacteria 1493
1666 nmdc:mga05p37_119553_c1 3300050507 Bacteria 3237
1667 nmdc:mga05p37_18711_c1 3300050507 Bacteria 8370
1668 nmdc:mga05p37_218807_c1 3300050507 Bacteria 2299
1669 nmdc:mga05p37_236442_c1 3300050507 Bacteria 2199
1670 nmdc:mga05p37_31102_c1 3300050507 Bacteria 6518
1671 nmdc:mga05p37_323625_c1 3300050507 Bacteria 1824
1672 nmdc:mga05p37_329402_c1 3300050507 Bacteria 1804
1673 nmdc:mga05p37_716504_c1 3300050507 Bacteria 1109
1674 nmdc:mga05p37_83259_c1 3300050507 Bacteria 3941
1675 nmdc:mga09592_662436_c1 3300050508 Bacteria 891
1676 nmdc:mga0qj67_252207_c1 3300050509 Bacteria 1432
1677 nmdc:mga0qj67_568836_c1 3300050509 Bacteria 908
1678 nmdc:mga0qj67_79916_c1 3300050509 Bacteria 2619
1679 nmdc:mga06r32_206636_c1 3300050510 Bacteria 1952
1680 nmdc:mga06r32_224555_c1 3300050510 Bacteria 1867
1681 nmdc:mga06r32_230522_c1 3300050510 Bacteria 1840
1682 nmdc:mga08y16_142191_c1 3300050511 Bacteria 2494
1683 nmdc:mga08y16_247590_c1 3300050511 Bacteria 1842
1684 nmdc:mga08y16_57975_c1 3300050511 Bacteria 4046
1685 nmdc:mga08y16_59486_c1 3300050511 Unclassified 3990
1686 nmdc:mga08y16_619231_c1 3300050511 Bacteria 1089
1687 nmdc:mga08y16_883724_c1 3300050511 Unclassified 881
1688 nmdc:mga0n895_113204_c1 3300050512 Bacteria 2731
1689 nmdc:mga0n895_11810_c1 3300050512 Bacteria 7809
1690 nmdc:mga0n895_1413665_c1 3300050512 Bacteria 664
1691 nmdc:mga0n895_31823_c1 3300050512 Bacteria 5056
1692 nmdc:mga0n895_337791_c1 3300050512 Bacteria 1526
1693 nmdc:mga0n895_348863_c1 3300050512 Bacteria 1499
1694 nmdc:mga0n895_411254_c1 3300050512 Bacteria 1368
1695 nmdc:mga0n895_613_c1 3300050512 Bacteria 24760
1696 nmdc:mga0rr50_1002051_c1 3300050513 Bacteria 712
1697 nmdc:mga0rr50_144417_c1 3300050513 Bacteria 1917
1698 nmdc:mga0rr50_1604_c1 3300050513 Bacteria 12458
1699 nmdc:mga0rr50_279033_c1 3300050513 Bacteria 1394
1700 nmdc:mga0rr50_356262_c1 3300050513 Bacteria 1231
1701 nmdc:mga0rr50_493_c1 3300050513 Bacteria 21017
1702 nmdc:mga0rr50_61902_c1 3300050513 Bacteria 2821
1703 nmdc:mga0rr50_732522_c1 3300050513 Bacteria 844
1704 nmdc:mga08x19_14736_c1 3300050514 Bacteria 4747
1705 nmdc:mga08x19_1727_c1 3300050514 Bacteria 13445
1706 nmdc:mga08x19_19368_c1 3300050514 Bacteria 4175
1707 nmdc:mga08x19_20550_c1 3300050514 Bacteria 4065
1708 nmdc:mga08x19_379734_c1 3300050514 Bacteria 989
1709 nmdc:mga08x19_5161_c1 3300050514 Bacteria 7722
1710 nmdc:mga08x19_623715_c1 3300050514 Unclassified 764
1711 nmdc:mga08x19_71817_c1 3300050514 Bacteria 2257
1712 nmdc:mga08x19_797796_c1 3300050514 Bacteria 671
1713 nmdc:mga0a205_171_c1 3300050515 Bacteria 43456
1714 nmdc:mga0a205_25992_c1 3300050515 Bacteria 5577
1715 nmdc:mga0a205_323500_c1 3300050515 Bacteria 1413
1716 nmdc:mga0a205_646791_c1 3300050515 Bacteria 909
1717 nmdc:mga0a205_96090_c1 3300050515 Bacteria 2862
1718 nmdc:mga0sz30_115418_c1 3300050516 Bacteria 1178
1719 Ga0495601_0003789 3300053077 Bacteria 8705
1720 Ga0495601_0437256 3300053077 Bacteria 847
1721 Ga0495619_0008559 3300053085 Bacteria 6475
1722 Ga0501084_0007763 3300054114 Bacteria 8830
1723 Ga0501084_0081657 3300054114 Bacteria 2712
1724 Ga0501084_0251792 3300054114 Bacteria 1491
1725 Ga0501084_0255501 3300054114 Bacteria 1479
1726 Ga0501084_0659070 3300054114 Bacteria 884
1727 Ga0501084_0681045 3300054114 Unclassified 867
1728 Ga0590075_063291 3300059424 Bacteria 954
1729 Ga0587085_087134 3300059506 Bacteria 639
1730 Ga0587078_046634 3300059646 Bacteria 626
1731 Ga0501082_0000775 3300060353 Bacteria 28022
1732 Ga0501082_0017025 3300060353 Bacteria 6260
1733 Ga0501082_0034104 3300060353 Bacteria 4391
1734 Ga0501082_0044260 3300060353 Bacteria 3840
1735 Ga0501082_0048352 3300060353 Bacteria 3666
1736 Ga0501082_0061639 3300060353 Bacteria 3229
1737 Ga0530510_0000511 3300061734 Bacteria 24701
1738 Ga0530510_0029248 3300061734 Bacteria 3954
1739 Ga0530510_0104214 3300061734 Bacteria 2075
1740 Ga0530510_0206643 3300061734 Bacteria 1459
1741 Ga0530510_0706150 3300061734 Bacteria 768

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025920 Ga0207649_10130552 Ga0207649_101305521 137
2 3300025945 Ga0207679_10149706 Ga0207679_101497063 137
3 3300005578 Ga0068854_100236973 Ga0068854_1002369732 141
4 3300025981 Ga0207640_10577482 Ga0207640_105774822 141
5 3300005564 Ga0070664_100008488 Ga0070664_1000084885 142
6 3300025945 Ga0207679_10125658 Ga0207679_101256583 142
7 3300031995 Ga0307409_100745578 Ga0307409_1007455782 147
8 3300048904 Ga0496101_0005020 Ga0496101_0005020_2245_2985 150
9 3300048907 Ga0496104_0004149 Ga0496104_0004149_2537_3277 150
10 3300006871 Ga0075434_100070034 Ga0075434_1000700343 152
11 3300005981 Ga0081538_10159909 Ga0081538_101599091 153
12 3300013105 Ga0157369_11037290 Ga0157369_110372901 153
13 3300037466 Ga0395898_0053514 Ga0395898_0053514_1586_2176 153
14 3300038443 Ga0395901_0259104 Ga0395901_0259104_569_1159 153
15 3300005983 Ga0081540_1004933 Ga0081540_10049332 154
16 3300028563 Ga0265319_1044689 Ga0265319_10446892 155
17 3300031240 Ga0265320_10019109 Ga0265320_100191094 155
18 3300028800 Ga0265338_10227727 Ga0265338_102277272 156
19 3300039438 Ga0436360_0101956 Ga0436360_0101956_491_1084 157
20 3300005434 Ga0070709_10141588 Ga0070709_101415882 158
21 3300005539 Ga0068853_100014807 Ga0068853_1000148074 158
22 3300009093 Ga0105240_10057871 Ga0105240_100578715 158
23 3300009093 Ga0105240_10088470 Ga0105240_100884702 158
24 3300009545 Ga0105237_10836354 Ga0105237_108363542 158
25 3300013307 Ga0157372_10058516 Ga0157372_100585162 158
26 3300025906 Ga0207699_10040762 Ga0207699_100407622 158
27 3300025913 Ga0207695_10065803 Ga0207695_100658032 158
28 3300026041 Ga0207639_10017254 Ga0207639_100172544 158
29 3300009177 Ga0105248_10973324 Ga0105248_109733241 159
30 3300005435 Ga0070714_100584879 Ga0070714_1005848791 161
31 3300026142 Ga0207698_10565960 Ga0207698_105659603 161
32 3300027671 Ga0209588_1121532 Ga0209588_11215322 161
33 3300039450 Ga0436363_1061698 Ga0436363_1061698_191_769 161
34 3300005937 Ga0081455_10066268 Ga0081455_100662682 162
35 3300006038 Ga0075365_10705328 Ga0075365_107053281 162
36 3300006237 Ga0097621_100000275 Ga0097621_10000027535 163
37 3300006358 Ga0068871_100000038 Ga0068871_10000003864 163
38 3300009098 Ga0105245_10000044 Ga0105245_100000447 163
39 3300013296 Ga0157374_10000058 Ga0157374_10000058115 163
40 3300014745 Ga0157377_10493976 Ga0157377_104939762 163
41 3300025927 Ga0207687_10000033 Ga0207687_100000337 163
42 3300035410 Ga0373924_0110893 Ga0373924_0110893_545_1099 163
43 3300048912 Ga0496109_0001321 Ga0496109_0001321_13266_13829 163
44 3300050509 nmdc:mga0qj67_568836_c1 nmdc:mga0qj67_568836_c1_189_746 163
45 3300054114 Ga0501084_0081657 Ga0501084_0081657_356_913 163
46 3300005438 Ga0070701_10673404 Ga0070701_106734041 164
47 3300006914 Ga0075436_100526665 Ga0075436_1005266652 164
48 3300010375 Ga0105239_10604113 Ga0105239_106041131 164
49 3300013105 Ga0157369_10058507 Ga0157369_100585072 164
50 3300013307 Ga0157372_10232396 Ga0157372_102323962 164
51 3300020078 Ga0206352_11025838 Ga0206352_110258382 164
52 3300027907 Ga0207428_10273998 Ga0207428_102739982 164
53 3300035086 Ga0373934_0243621 Ga0373934_0243621_76_624 164
54 3300035172 Ga0373955_0225354 Ga0373955_0225354_503_1051 164
55 3300036401 Ga0373937_0010757 Ga0373937_0010757_6477_7025 164
56 3300039453 Ga0436362_0562393 Ga0436362_0562393_74_622 164
57 3300046679 Ga0495623_0037269 Ga0495623_0037269_338_892 164
58 3300046689 Ga0495613_0398384 Ga0495613_0398384_142_696 164
59 3300046690 Ga0495624_0035583 Ga0495624_0035583_2155_2718 164
60 3300046809 Ga0495600_0067007 Ga0495600_0067007_1252_1806 164
61 3300047317 Ga0495604_0607895 Ga0495604_0607895_79_633 164
62 3300047444 Ga0495675_0060822 Ga0495675_0060822_1043_1597 164
63 3300047444 Ga0495675_0203734 Ga0495675_0203734_489_1043 164
64 3300047471 Ga0495684_0323674 Ga0495684_0323674_459_1013 164
65 3300048912 Ga0496109_0000476 Ga0496109_0000476_13323_13877 164
66 3300050514 nmdc:mga08x19_379734_c1 nmdc:mga08x19_379734_c1_382_933 164
67 3300005328 Ga0070676_10323154 Ga0070676_103231542 165
68 3300005330 Ga0070690_100051706 Ga0070690_1000517063 165
69 3300005331 Ga0070670_100093976 Ga0070670_1000939762 165
70 3300005336 Ga0070680_100178114 Ga0070680_1001781141 165
71 3300005337 Ga0070682_100021067 Ga0070682_1000210671 165
72 3300005338 Ga0068868_100016893 Ga0068868_1000168932 165
73 3300005339 Ga0070660_100033849 Ga0070660_1000338492 165
74 3300005355 Ga0070671_100488681 Ga0070671_1004886812 165
75 3300005365 Ga0070688_100495202 Ga0070688_1004952022 165
76 3300005366 Ga0070659_100046840 Ga0070659_1000468402 165
77 3300005434 Ga0070709_10082073 Ga0070709_100820732 165
78 3300005440 Ga0070705_100117258 Ga0070705_1001172582 165
79 3300005440 Ga0070705_100144706 Ga0070705_1001447062 165
80 3300005444 Ga0070694_100368724 Ga0070694_1003687242 165
81 3300005456 Ga0070678_100030245 Ga0070678_1000302454 165
82 3300005458 Ga0070681_10093083 Ga0070681_100930834 165
83 3300005530 Ga0070679_100407152 Ga0070679_1004071522 165
84 3300005544 Ga0070686_100103538 Ga0070686_1001035382 165
85 3300005546 Ga0070696_100297545 Ga0070696_1002975452 165
86 3300005547 Ga0070693_100055541 Ga0070693_1000555412 165
87 3300005548 Ga0070665_100209917 Ga0070665_1002099173 165
88 3300005563 Ga0068855_100099285 Ga0068855_1000992853 165
89 3300005614 Ga0068856_100003956 Ga0068856_10000395611 165
90 3300005615 Ga0070702_100241384 Ga0070702_1002413842 165
91 3300005616 Ga0068852_100151548 Ga0068852_1001515483 165
92 3300005616 Ga0068852_101047792 Ga0068852_1010477922 165
93 3300005617 Ga0068859_100055800 Ga0068859_1000558003 165
94 3300005841 Ga0068863_100094731 Ga0068863_1000947313 165
95 3300005843 Ga0068860_100104168 Ga0068860_1001041683 165
96 3300005981 Ga0081538_10004085 Ga0081538_100040857 165
97 3300006048 Ga0075363_100239662 Ga0075363_1002396621 165
98 3300006163 Ga0070715_10287272 Ga0070715_102872722 165
99 3300006177 Ga0075362_10364442 Ga0075362_103644421 165
100 3300006195 Ga0075366_10012237 Ga0075366_100122377 165
101 3300006237 Ga0097621_100493242 Ga0097621_1004932422 165
102 3300006358 Ga0068871_100315728 Ga0068871_1003157282 165
103 3300006846 Ga0075430_100128733 Ga0075430_1001287333 165
104 3300006847 Ga0075431_100340474 Ga0075431_1003404742 165
105 3300006852 Ga0075433_10193315 Ga0075433_101933152 165
106 3300006871 Ga0075434_100001570 Ga0075434_1000015704 165
107 3300006880 Ga0075429_100039199 Ga0075429_1000391991 165
108 3300006914 Ga0075436_100016713 Ga0075436_1000167135 165
109 3300006931 Ga0097620_100055799 Ga0097620_1000557993 165
110 3300007076 Ga0075435_100068268 Ga0075435_1000682685 165
111 3300009093 Ga0105240_10294162 Ga0105240_102941622 165
112 3300009098 Ga0105245_10009105 Ga0105245_100091055 165
113 3300009101 Ga0105247_10008740 Ga0105247_100087404 165
114 3300009147 Ga0114129_10081420 Ga0114129_100814203 165
115 3300009174 Ga0105241_10129586 Ga0105241_101295863 165
116 3300009176 Ga0105242_10686412 Ga0105242_106864122 165
117 3300009177 Ga0105248_10133114 Ga0105248_101331142 165
118 3300009545 Ga0105237_10022409 Ga0105237_100224094 165
119 3300009551 Ga0105238_10023637 Ga0105238_100236374 165
120 3300009553 Ga0105249_10339079 Ga0105249_103390792 165
121 3300009553 Ga0105249_10820977 Ga0105249_108209772 165
122 3300010375 Ga0105239_10030644 Ga0105239_100306443 165
123 3300011119 Ga0105246_10032732 Ga0105246_100327322 165
124 3300013105 Ga0157369_10332837 Ga0157369_103328371 165
125 3300013296 Ga0157374_10042362 Ga0157374_100423625 165
126 3300013297 Ga0157378_10236756 Ga0157378_102367562 165
127 3300013297 Ga0157378_10431736 Ga0157378_104317362 165
128 3300013306 Ga0163162_10688094 Ga0163162_106880942 165
129 3300013307 Ga0157372_10203240 Ga0157372_102032401 165
130 3300014325 Ga0163163_10006709 Ga0163163_100067096 165
131 3300014745 Ga0157377_10146281 Ga0157377_101462812 165
132 3300014969 Ga0157376_10253623 Ga0157376_102536232 165
133 3300025900 Ga0207710_10015056 Ga0207710_100150564 165
134 3300025905 Ga0207685_10282681 Ga0207685_102826812 165
135 3300025906 Ga0207699_10098448 Ga0207699_100984482 165
136 3300025910 Ga0207684_10284087 Ga0207684_102840872 165
137 3300025912 Ga0207707_10056879 Ga0207707_100568794 165
138 3300025913 Ga0207695_10702478 Ga0207695_107024781 165
139 3300025914 Ga0207671_10083013 Ga0207671_100830132 165
140 3300025918 Ga0207662_10078310 Ga0207662_100783101 165
141 3300025919 Ga0207657_10047641 Ga0207657_100476414 165
142 3300025920 Ga0207649_10161879 Ga0207649_101618792 165
143 3300025924 Ga0207694_10025020 Ga0207694_100250204 165
144 3300025925 Ga0207650_10110308 Ga0207650_101103082 165
145 3300025927 Ga0207687_10000216 Ga0207687_100002162 165
146 3300025927 Ga0207687_10229547 Ga0207687_102295472 165
147 3300025927 Ga0207687_10270560 Ga0207687_102705602 165
148 3300025931 Ga0207644_10403022 Ga0207644_104030222 165
149 3300025932 Ga0207690_10019122 Ga0207690_100191224 165
150 3300025935 Ga0207709_10101127 Ga0207709_101011272 165
151 3300025935 Ga0207709_10153431 Ga0207709_101534312 165
152 3300025935 Ga0207709_10882351 Ga0207709_108823511 165
153 3300025938 Ga0207704_10012816 Ga0207704_100128161 165
154 3300025939 Ga0207665_10117889 Ga0207665_101178892 165
155 3300025941 Ga0207711_10525971 Ga0207711_105259712 165
156 3300025942 Ga0207689_10292483 Ga0207689_102924831 165
157 3300025949 Ga0207667_10022540 Ga0207667_100225406 165
158 3300025961 Ga0207712_10215360 Ga0207712_102153603 165
159 3300025961 Ga0207712_10221227 Ga0207712_102212272 165
160 3300025981 Ga0207640_10052292 Ga0207640_100522923 165
161 3300026023 Ga0207677_10040439 Ga0207677_100404392 165
162 3300026078 Ga0207702_10009291 Ga0207702_100092916 165
163 3300026088 Ga0207641_10048891 Ga0207641_100488912 165
164 3300026095 Ga0207676_10068161 Ga0207676_100681614 165
165 3300026121 Ga0207683_10051743 Ga0207683_100517434 165
166 3300026142 Ga0207698_10080478 Ga0207698_100804783 165
167 3300027866 Ga0209813_10095887 Ga0209813_100958872 165
168 3300028381 Ga0268264_10085044 Ga0268264_100850442 165
169 3300031852 Ga0307410_10106518 Ga0307410_101065182 165
170 3300031911 Ga0307412_10175028 Ga0307412_101750282 165
171 3300032002 Ga0307416_100100859 Ga0307416_1001008591 165
172 3300032004 Ga0307414_10067577 Ga0307414_100675772 165
173 3300032005 Ga0307411_10137510 Ga0307411_101375102 165
174 3300048903 Ga0496100_0026308 Ga0496100_0026308_2813_3469 165
175 3300048904 Ga0496101_0035888 Ga0496101_0035888_2755_3411 165
176 3300048905 Ga0496102_0010205 Ga0496102_0010205_4921_5577 165
177 3300048905 Ga0496102_0404395 Ga0496102_0404395_572_1228 165
178 3300048906 Ga0496103_0108497 Ga0496103_0108497_369_1025 165
179 3300048907 Ga0496104_0404369 Ga0496104_0404369_86_742 165
180 3300048908 Ga0496105_0036976 Ga0496105_0036976_1528_2184 165
181 3300048908 Ga0496105_0347190 Ga0496105_0347190_566_1129 165
182 3300048909 Ga0496106_0035232 Ga0496106_0035232_1261_1917 165
183 3300048910 Ga0496107_0011189 Ga0496107_0011189_1269_1925 165
184 3300048911 Ga0496108_0000624 Ga0496108_0000624_1442_2098 165
185 3300048911 Ga0496108_0481259 Ga0496108_0481259_39_695 165
186 3300048912 Ga0496109_0026455 Ga0496109_0026455_3267_3923 165
187 3300048913 Ga0496110_0016292 Ga0496110_0016292_1330_1986 165
188 3300048914 Ga0496111_0022731 Ga0496111_0022731_3508_4155 165
189 3300048915 Ga0496112_0003352 Ga0496112_0003352_9875_10531 165
190 3300048915 Ga0496112_0048523 Ga0496112_0048523_3143_3706 165
191 3300048916 Ga0496113_0041349 Ga0496113_0041349_1301_1957 165
192 3300048917 Ga0496114_0020768 Ga0496114_0020768_1908_2564 165
193 3300048918 Ga0496115_0042413 Ga0496115_0042413_1891_2547 165
194 3300048918 Ga0496115_0103329 Ga0496115_0103329_1426_2082 165
195 3300049584 Ga0501068_0700812 Ga0501068_0700812_49_642 165
196 3300049705 Ga0501225_0143732 Ga0501225_0143732_94_633 165
197 3300050489 nmdc:mga03683_205176_c1 nmdc:mga03683_205176_c1_74_628 165
198 3300050490 nmdc:mga03n38_146018_c1 nmdc:mga03n38_146018_c1_579_1133 165
199 3300050492 nmdc:mga0yw44_75338_c1 nmdc:mga0yw44_75338_c1_760_1314 165
200 3300050493 nmdc:mga0k408_13_c1 nmdc:mga0k408_13_c1_1596_2159 165
201 3300050494 nmdc:mga06z11_115172_c1 nmdc:mga06z11_115172_c1_413_967 165
202 3300050507 nmdc:mga05p37_323625_c1 nmdc:mga05p37_323625_c1_288_857 165
203 3300050508 nmdc:mga09592_662436_c1 nmdc:mga09592_662436_c1_48_617 165
204 3300050510 nmdc:mga06r32_224555_c1 nmdc:mga06r32_224555_c1_353_922 165
205 3300050511 nmdc:mga08y16_57975_c1 nmdc:mga08y16_57975_c1_2636_3217 165
206 3300050512 nmdc:mga0n895_31823_c1 nmdc:mga0n895_31823_c1_2852_3508 165
207 3300050513 nmdc:mga0rr50_1604_c1 nmdc:mga0rr50_1604_c1_10641_11297 165
208 3300050514 nmdc:mga08x19_71817_c1 nmdc:mga08x19_71817_c1_1430_2086 165
209 3300050516 nmdc:mga0sz30_115418_c1 nmdc:mga0sz30_115418_c1_298_852 165
210 3300003320 rootH2_10000244 rootH2_10000244563 166
211 3300005290 Ga0065712_10479653 Ga0065712_104796531 166
212 3300005337 Ga0070682_100579563 Ga0070682_1005795631 166
213 3300005338 Ga0068868_100056205 Ga0068868_1000562052 166
214 3300005343 Ga0070687_100364756 Ga0070687_1003647561 166
215 3300005355 Ga0070671_100087622 Ga0070671_1000876221 166
216 3300005364 Ga0070673_100069635 Ga0070673_1000696352 166
217 3300005365 Ga0070688_100124820 Ga0070688_1001248202 166
218 3300005366 Ga0070659_100342279 Ga0070659_1003422793 166
219 3300005435 Ga0070714_100055256 Ga0070714_1000552563 166
220 3300005440 Ga0070705_100163677 Ga0070705_1001636772 166
221 3300005456 Ga0070678_100042664 Ga0070678_1000426644 166
222 3300005459 Ga0068867_100176330 Ga0068867_1001763302 166
223 3300005535 Ga0070684_100771022 Ga0070684_1007710222 166
224 3300005549 Ga0070704_100457776 Ga0070704_1004577762 166
225 3300005563 Ga0068855_101229943 Ga0068855_1012299432 166
226 3300005564 Ga0070664_100241514 Ga0070664_1002415142 166
227 3300005564 Ga0070664_100287483 Ga0070664_1002874832 166
228 3300005577 Ga0068857_100025607 Ga0068857_1000256078 166
229 3300005614 Ga0068856_101017403 Ga0068856_1010174031 166
230 3300005617 Ga0068859_100229052 Ga0068859_1002290522 166
231 3300005718 Ga0068866_10093485 Ga0068866_100934852 166
232 3300005841 Ga0068863_100034449 Ga0068863_1000344496 166
233 3300005843 Ga0068860_100163094 Ga0068860_1001630942 166
234 3300005843 Ga0068860_100521626 Ga0068860_1005216262 166
235 3300005937 Ga0081455_10066271 Ga0081455_100662712 166
236 3300005983 Ga0081540_1001342 Ga0081540_100134222 166
237 3300006028 Ga0070717_11054527 Ga0070717_110545271 166
238 3300006237 Ga0097621_100083457 Ga0097621_1000834572 166
239 3300006914 Ga0075436_100046917 Ga0075436_1000469172 166
240 3300006931 Ga0097620_100229044 Ga0097620_1002290442 166
241 3300007265 Ga0099794_10017550 Ga0099794_100175503 166
242 3300009148 Ga0105243_10017452 Ga0105243_100174525 166
243 3300009176 Ga0105242_11975542 Ga0105242_119755421 166
244 3300009177 Ga0105248_10074037 Ga0105248_100740372 166
245 3300009177 Ga0105248_10358738 Ga0105248_103587382 166
246 3300009177 Ga0105248_10616585 Ga0105248_106165852 166
247 3300009551 Ga0105238_11059326 Ga0105238_110593261 166
248 3300013297 Ga0157378_10328927 Ga0157378_103289272 166
249 3300013306 Ga0163162_10350898 Ga0163162_103508982 166
250 3300013306 Ga0163162_11266242 Ga0163162_112662421 166
251 3300013307 Ga0157372_10075817 Ga0157372_100758173 166
252 3300013307 Ga0157372_10388772 Ga0157372_103887723 166
253 3300014325 Ga0163163_10022849 Ga0163163_100228495 166
254 3300014968 Ga0157379_10006464 Ga0157379_100064644 166
255 3300017792 Ga0163161_10147217 Ga0163161_101472172 166
256 3300025903 Ga0207680_10485340 Ga0207680_104853402 166
257 3300025919 Ga0207657_10317688 Ga0207657_103176882 166
258 3300025923 Ga0207681_10490377 Ga0207681_104903772 166
259 3300025927 Ga0207687_10526460 Ga0207687_105264602 166
260 3300025929 Ga0207664_10260993 Ga0207664_102609931 166
261 3300025931 Ga0207644_10249392 Ga0207644_102493922 166
262 3300025931 Ga0207644_10921177 Ga0207644_109211771 166
263 3300025933 Ga0207706_10051063 Ga0207706_100510633 166
264 3300025934 Ga0207686_10127610 Ga0207686_101276102 166
265 3300025935 Ga0207709_10010662 Ga0207709_100106622 166
266 3300025936 Ga0207670_10211823 Ga0207670_102118232 166
267 3300025941 Ga0207711_10305271 Ga0207711_103052712 166
268 3300025941 Ga0207711_10577774 Ga0207711_105777741 166
269 3300025945 Ga0207679_10647701 Ga0207679_106477012 166
270 3300025949 Ga0207667_10429324 Ga0207667_104293242 166
271 3300025986 Ga0207658_10077811 Ga0207658_100778112 166
272 3300026023 Ga0207677_10238835 Ga0207677_102388352 166
273 3300026078 Ga0207702_10987448 Ga0207702_109874481 166
274 3300026088 Ga0207641_10787238 Ga0207641_107872382 166
275 3300026089 Ga0207648_10289459 Ga0207648_102894591 166
276 3300026095 Ga0207676_10101999 Ga0207676_101019993 166
277 3300026116 Ga0207674_10007458 Ga0207674_1000745810 166
278 3300026121 Ga0207683_10000784 Ga0207683_100007845 166
279 3300028577 Ga0265318_10049734 Ga0265318_100497342 166
280 3300031240 Ga0265320_10070919 Ga0265320_100709192 166
281 3300031727 Ga0316576_10088811 Ga0316576_100888113 166
282 3300033180 Ga0307510_10077326 Ga0307510_100773264 166
283 3300034816 Ga0373930_0001318 Ga0373930_0001318_1634_2203 166
284 3300035085 Ga0373929_0001585 Ga0373929_0001585_3275_3844 166
285 3300035112 Ga0373932_0000834 Ga0373932_0000834_6464_7033 166
286 3300035691 Ga0373931_0000032 Ga0373931_0000032_3516_4085 166
287 3300035692 Ga0373935_0110276 Ga0373935_0110276_289_837 166
288 3300035725 Ga0373947_0023398 Ga0373947_0023398_1292_1840 166
289 3300036712 Ga0316584_0052742 Ga0316584_0052742_2371_2961 166
290 3300037068 Ga0373925_0817616 Ga0373925_0817616_162_710 166
291 3300037418 Ga0395900_0892221 Ga0395900_0892221_240_797 166
292 3300039450 Ga0436363_0072374 Ga0436363_0072374_113_661 166
293 3300042876 Ga0451577_0339552 Ga0451577_0339552_350_898 166
294 3300044712 Ga0453684_0440748 Ga0453684_0440748_516_1064 166
295 3300044712 Ga0453684_0483926 Ga0453684_0483926_238_786 166
296 3300044735 Ga0466968_0202575 Ga0466968_0202575_133_678 166
297 3300045049 Ga0466959_0253707 Ga0466959_0253707_543_1088 166
298 3300045051 Ga0451576_0009293 Ga0451576_0009293_6728_7285 166
299 3300045051 Ga0451576_0544031 Ga0451576_0544031_392_940 166
300 3300046477 Ga0495664_0054274 Ga0495664_0054274_1684_2238 166
301 3300046499 Ga0495594_0036766 Ga0495594_0036766_483_1037 166
302 3300046535 Ga0495586_0395564 Ga0495586_0395564_223_777 166
303 3300046616 Ga0495668_0093682 Ga0495668_0093682_31_585 166
304 3300046684 Ga0495669_0006857 Ga0495669_0006857_3352_3900 166
305 3300047319 Ga0495674_0683553 Ga0495674_0683553_151_774 166
306 3300048904 Ga0496101_0210728 Ga0496101_0210728_337_993 166
307 3300048904 Ga0496101_0250499 Ga0496101_0250499_136_684 166
308 3300048904 Ga0496101_0262310 Ga0496101_0262310_514_1095 166
309 3300048907 Ga0496104_0076858 Ga0496104_0076858_1364_2020 166
310 3300048908 Ga0496105_0184719 Ga0496105_0184719_517_1173 166
311 3300048909 Ga0496106_0152622 Ga0496106_0152622_324_905 166
312 3300048909 Ga0496106_0309574 Ga0496106_0309574_100_648 166
313 3300048910 Ga0496107_0055006 Ga0496107_0055006_1427_2008 166
314 3300048910 Ga0496107_0059174 Ga0496107_0059174_179_835 166
315 3300048911 Ga0496108_1105606 Ga0496108_1105606_63_611 166
316 3300048912 Ga0496109_0126835 Ga0496109_0126835_1595_2143 166
317 3300048912 Ga0496109_0225897 Ga0496109_0225897_731_1312 166
318 3300048913 Ga0496110_0389532 Ga0496110_0389532_608_1189 166
319 3300048913 Ga0496110_0431488 Ga0496110_0431488_505_1053 166
320 3300048914 Ga0496111_0066648 Ga0496111_0066648_608_1189 166
321 3300048915 Ga0496112_0124787 Ga0496112_0124787_339_887 166
322 3300049741 Ga0501079_0315480 Ga0501079_0315480_196_747 166
323 3300050514 nmdc:mga08x19_5161_c1 nmdc:mga08x19_5161_c1_2839_3384 166
324 3300005327 Ga0070658_10000415 Ga0070658_1000041521 167
325 3300005434 Ga0070709_10013852 Ga0070709_100138527 167
326 3300005435 Ga0070714_100238599 Ga0070714_1002385993 167
327 3300005436 Ga0070713_100018943 Ga0070713_1000189437 167
328 3300005439 Ga0070711_100244337 Ga0070711_1002443372 167
329 3300005937 Ga0081455_10339008 Ga0081455_103390082 167
330 3300005981 Ga0081538_10011151 Ga0081538_100111514 167
331 3300006028 Ga0070717_10608668 Ga0070717_106086681 167
332 3300006173 Ga0070716_100653261 Ga0070716_1006532611 167
333 3300006914 Ga0075436_100144481 Ga0075436_1001444812 167
334 3300007076 Ga0075435_100016483 Ga0075435_1000164837 167
335 3300009094 Ga0111539_10133285 Ga0111539_101332852 167
336 3300014325 Ga0163163_10010296 Ga0163163_100102962 167
337 3300025906 Ga0207699_10523103 Ga0207699_105231032 167
338 3300025909 Ga0207705_10000914 Ga0207705_1000091422 167
339 3300025917 Ga0207660_10266510 Ga0207660_102665102 167
340 3300025928 Ga0207700_10313576 Ga0207700_103135762 167
341 3300031241 Ga0265325_10035936 Ga0265325_100359361 167
342 3300031247 Ga0265340_10171934 Ga0265340_101719341 167
343 3300031344 Ga0265316_10337922 Ga0265316_103379222 167
344 3300031733 Ga0316577_10002831 Ga0316577_100028314 167
345 3300035691 Ga0373931_0000023 Ga0373931_0000023_60702_61286 167
346 3300035725 Ga0373947_0527720 Ga0373947_0527720_254_781 167
347 3300039453 Ga0436362_0132200 Ga0436362_0132200_174_722 167
348 3300045051 Ga0451576_0271136 Ga0451576_0271136_139_687 167
349 3300045976 Ga0466967_0016446 Ga0466967_0016446_3873_4424 167
350 3300045976 Ga0466967_0187090 Ga0466967_0187090_316_867 167
351 3300045976 Ga0466967_0223882 Ga0466967_0223882_419_970 167
352 3300045976 Ga0466967_0336400 Ga0466967_0336400_641_1186 167
353 3300049576 Ga0501040_0412740 Ga0501040_0412740_136_699 167
354 3300049580 Ga0501046_0418445 Ga0501046_0418445_112_675 167
355 3300049587 Ga0501071_0618014 Ga0501071_0618014_257_820 167
356 3300049592 Ga0501076_0013431 Ga0501076_0013431_461_1024 167
357 3300049592 Ga0501076_0344221 Ga0501076_0344221_306_845 167
358 3300049741 Ga0501079_0362258 Ga0501079_0362258_506_1069 167
359 3300049743 Ga0501081_0033734 Ga0501081_0033734_194_757 167
360 3300050513 nmdc:mga0rr50_279033_c1 nmdc:mga0rr50_279033_c1_467_1018 167
361 3300054114 Ga0501084_0251792 Ga0501084_0251792_207_770 167
362 3300060353 Ga0501082_0034104 Ga0501082_0034104_3050_3613 167
363 3300061734 Ga0530510_0029248 Ga0530510_0029248_2400_2963 167
364 3300005337 Ga0070682_100139439 Ga0070682_1001394391 168
365 3300005434 Ga0070709_10021996 Ga0070709_100219962 168
366 3300005434 Ga0070709_10092593 Ga0070709_100925932 168
367 3300005435 Ga0070714_100000001 Ga0070714_100000001319 168
368 3300005435 Ga0070714_100002228 Ga0070714_1000022283 168
369 3300005435 Ga0070714_100063336 Ga0070714_1000633362 168
370 3300005435 Ga0070714_100153714 Ga0070714_1001537141 168
371 3300005436 Ga0070713_100001895 Ga0070713_10000189512 168
372 3300005436 Ga0070713_100457695 Ga0070713_1004576952 168
373 3300005437 Ga0070710_10004847 Ga0070710_100048474 168
374 3300005439 Ga0070711_100015430 Ga0070711_1000154302 168
375 3300005445 Ga0070708_100017257 Ga0070708_1000172572 168
376 3300005467 Ga0070706_100021710 Ga0070706_1000217103 168
377 3300005468 Ga0070707_100140351 Ga0070707_1001403512 168
378 3300005518 Ga0070699_100531153 Ga0070699_1005311532 168
379 3300005518 Ga0070699_101204698 Ga0070699_1012046981 168
380 3300005536 Ga0070697_100003493 Ga0070697_1000034938 168
381 3300005614 Ga0068856_100386099 Ga0068856_1003860992 168
382 3300005616 Ga0068852_100255041 Ga0068852_1002550412 168
383 3300006028 Ga0070717_10000971 Ga0070717_1000097111 168
384 3300006028 Ga0070717_10028808 Ga0070717_100288083 168
385 3300006173 Ga0070716_100035101 Ga0070716_1000351012 168
386 3300006175 Ga0070712_100001023 Ga0070712_1000010236 168
387 3300006914 Ga0075436_100003169 Ga0075436_1000031693 168
388 3300009174 Ga0105241_10113792 Ga0105241_101137922 168
389 3300013100 Ga0157373_10321102 Ga0157373_103211021 168
390 3300021358 Ga0213873_10134793 Ga0213873_101347932 168
391 3300021361 Ga0213872_10091988 Ga0213872_100919882 168
392 3300021384 Ga0213876_10453699 Ga0213876_104536991 168
393 3300025898 Ga0207692_10005577 Ga0207692_100055774 168
394 3300025898 Ga0207692_10136710 Ga0207692_101367102 168
395 3300025906 Ga0207699_10007868 Ga0207699_100078682 168
396 3300025906 Ga0207699_10073947 Ga0207699_100739471 168
397 3300025913 Ga0207695_10349128 Ga0207695_103491281 168
398 3300025915 Ga0207693_10000235 Ga0207693_1000023510 168
399 3300025916 Ga0207663_10011339 Ga0207663_100113392 168
400 3300025922 Ga0207646_11020863 Ga0207646_110208632 168
401 3300025928 Ga0207700_10076719 Ga0207700_100767192 168
402 3300025928 Ga0207700_10457171 Ga0207700_104571712 168
403 3300025929 Ga0207664_10000007 Ga0207664_10000007309 168
404 3300025929 Ga0207664_10002861 Ga0207664_100028613 168
405 3300025929 Ga0207664_10007384 Ga0207664_100073844 168
406 3300025939 Ga0207665_10013558 Ga0207665_100135585 168
407 3300035083 Ga0373926_0108075 Ga0373926_0108075_399_944 168
408 3300035116 Ga0373945_0032184 Ga0373945_0032184_818_1363 168
409 3300035171 Ga0373946_0094293 Ga0373946_0094293_108_653 168
410 3300035692 Ga0373935_0009180 Ga0373935_0009180_2764_3309 168
411 3300037471 Ga0395905_0862101 Ga0395905_0862101_162_710 168
412 3300039437 Ga0436365_1934168 Ga0436365_1934168_76_624 168
413 3300039447 Ga0436361_0045848 Ga0436361_0045848_1076_1669 168
414 3300039453 Ga0436362_0360508 Ga0436362_0360508_909_1457 168
415 3300042127 Ga0450890_019146 Ga0450890_019146_36_608 168
416 3300042876 Ga0451577_0025229 Ga0451577_0025229_2193_2753 168
417 3300044694 Ga0466963_0115917 Ga0466963_0115917_231_782 168
418 3300044694 Ga0466963_0791828 Ga0466963_0791828_64_615 168
419 3300045051 Ga0451576_0022408 Ga0451576_0022408_3018_3578 168
420 3300046459 Ga0495629_0013152 Ga0495629_0013152_3925_4470 168
421 3300046472 Ga0495580_0002574 Ga0495580_0002574_1716_2261 168
422 3300046472 Ga0495580_0186918 Ga0495580_0186918_374_922 168
423 3300046473 Ga0495582_0001652 Ga0495582_0001652_618_1163 168
424 3300046473 Ga0495582_0092998 Ga0495582_0092998_759_1307 168
425 3300046475 Ga0495639_0003842 Ga0495639_0003842_906_1454 168
426 3300046517 Ga0495630_0202986 Ga0495630_0202986_940_1485 168
427 3300046663 Ga0495635_0175464 Ga0495635_0175464_601_1149 168
428 3300046683 Ga0495658_0023444 Ga0495658_0023444_2613_3158 168
429 3300047321 Ga0495676_0067792 Ga0495676_0067792_1424_1969 168
430 3300047321 Ga0495676_0225335 Ga0495676_0225335_621_1256 168
431 3300048905 Ga0496102_0305931 Ga0496102_0305931_51_632 168
432 3300048907 Ga0496104_0518006 Ga0496104_0518006_83_628 168
433 3300048918 Ga0496115_0025648 Ga0496115_0025648_2563_3108 168
434 3300049653 Ga0501206_025042 Ga0501206_025042_73_621 168
435 3300049761 Ga0501264_026269 Ga0501264_026269_63_611 168
436 3300049779 Ga0501283_006432 Ga0501283_006432_664_1212 168
437 3300050514 nmdc:mga08x19_1727_c1 nmdc:mga08x19_1727_c1_8365_8916 168
438 3300005347 Ga0070668_100083953 Ga0070668_1000839533 169
439 3300005356 Ga0070674_100056747 Ga0070674_1000567473 169
440 3300005434 Ga0070709_10279863 Ga0070709_102798631 169
441 3300005439 Ga0070711_100457982 Ga0070711_1004579822 169
442 3300005518 Ga0070699_100189572 Ga0070699_1001895722 169
443 3300005718 Ga0068866_10093740 Ga0068866_100937402 169
444 3300005842 Ga0068858_100033926 Ga0068858_1000339262 169
445 3300006038 Ga0075365_10000261 Ga0075365_1000026118 169
446 3300006173 Ga0070716_100056881 Ga0070716_1000568812 169
447 3300009148 Ga0105243_10091139 Ga0105243_100911392 169
448 3300013105 Ga0157369_10000770 Ga0157369_1000077036 169
449 3300025899 Ga0207642_10044725 Ga0207642_100447253 169
450 3300025906 Ga0207699_10051463 Ga0207699_100514632 169
451 3300025915 Ga0207693_10178145 Ga0207693_101781452 169
452 3300025933 Ga0207706_10451213 Ga0207706_104512132 169
453 3300025935 Ga0207709_10066368 Ga0207709_100663683 169
454 3300025937 Ga0207669_10045622 Ga0207669_100456223 169
455 3300025939 Ga0207665_10096401 Ga0207665_100964013 169
456 3300025972 Ga0207668_10279111 Ga0207668_102791112 169
457 3300026035 Ga0207703_10013574 Ga0207703_100135743 169
458 3300026041 Ga0207639_10083971 Ga0207639_100839712 169
459 3300031548 Ga0307408_100021105 Ga0307408_1000211052 169
460 3300031824 Ga0307413_10265507 Ga0307413_102655072 169
461 3300031852 Ga0307410_10006506 Ga0307410_100065064 169
462 3300031852 Ga0307410_10157474 Ga0307410_101574742 169
463 3300031901 Ga0307406_10827253 Ga0307406_108272532 169
464 3300031903 Ga0307407_10132461 Ga0307407_101324612 169
465 3300031995 Ga0307409_100013554 Ga0307409_1000135542 169
466 3300031995 Ga0307409_100114459 Ga0307409_1001144591 169
467 3300032002 Ga0307416_100053112 Ga0307416_1000531122 169
468 3300032004 Ga0307414_10047896 Ga0307414_100478962 169
469 3300032004 Ga0307414_10341622 Ga0307414_103416222 169
470 3300032004 Ga0307414_10544958 Ga0307414_105449581 169
471 3300032005 Ga0307411_10003990 Ga0307411_100039905 169
472 3300032126 Ga0307415_100080643 Ga0307415_1000806432 169
473 3300038443 Ga0395901_0817143 Ga0395901_0817143_208_792 169
474 3300048913 Ga0496110_0572911 Ga0496110_0572911_488_1015 169
475 3300049704 Ga0501221_033781 Ga0501221_033781_132_680 169
476 3300049779 Ga0501283_008243 Ga0501283_008243_928_1476 169
477 3300049850 Ga0501204_004271 Ga0501204_004271_856_1404 169
478 3300005329 Ga0070683_101094204 Ga0070683_1010942042 170
479 3300005367 Ga0070667_100899211 Ga0070667_1008992111 170
480 3300005434 Ga0070709_10029199 Ga0070709_100291994 170
481 3300005435 Ga0070714_100323511 Ga0070714_1003235112 170
482 3300005435 Ga0070714_100467637 Ga0070714_1004676372 170
483 3300005436 Ga0070713_100416125 Ga0070713_1004161251 170
484 3300005436 Ga0070713_100564723 Ga0070713_1005647232 170
485 3300005437 Ga0070710_10306054 Ga0070710_103060542 170
486 3300005445 Ga0070708_100000372 Ga0070708_10000037229 170
487 3300005445 Ga0070708_100228681 Ga0070708_1002286812 170
488 3300005445 Ga0070708_100792944 Ga0070708_1007929442 170
489 3300005445 Ga0070708_100882211 Ga0070708_1008822112 170
490 3300005458 Ga0070681_10041266 Ga0070681_100412662 170
491 3300005467 Ga0070706_100014149 Ga0070706_1000141492 170
492 3300005468 Ga0070707_100004759 Ga0070707_1000047592 170
493 3300005468 Ga0070707_100656843 Ga0070707_1006568431 170
494 3300005471 Ga0070698_100003025 Ga0070698_10000302512 170
495 3300005518 Ga0070699_100001645 Ga0070699_10000164511 170
496 3300005530 Ga0070679_100157072 Ga0070679_1001570722 170
497 3300005536 Ga0070697_100001970 Ga0070697_1000019706 170
498 3300005536 Ga0070697_100153507 Ga0070697_1001535072 170
499 3300005564 Ga0070664_100560606 Ga0070664_1005606062 170
500 3300005577 Ga0068857_100854571 Ga0068857_1008545712 170
501 3300005841 Ga0068863_100147320 Ga0068863_1001473202 170
502 3300005843 Ga0068860_100395150 Ga0068860_1003951502 170
503 3300006028 Ga0070717_10214387 Ga0070717_102143872 170
504 3300006173 Ga0070716_100015394 Ga0070716_1000153943 170
505 3300006173 Ga0070716_100094668 Ga0070716_1000946681 170
506 3300007788 Ga0099795_10090210 Ga0099795_100902102 170
507 3300009093 Ga0105240_10105976 Ga0105240_101059764 170
508 3300009174 Ga0105241_10159953 Ga0105241_101599532 170
509 3300009545 Ga0105237_10173261 Ga0105237_101732613 170
510 3300013100 Ga0157373_10162363 Ga0157373_101623632 170
511 3300013104 Ga0157370_10651349 Ga0157370_106513492 170
512 3300013306 Ga0163162_10216568 Ga0163162_102165682 170
513 3300013307 Ga0157372_10199277 Ga0157372_101992773 170
514 3300014968 Ga0157379_11174642 Ga0157379_111746422 170
515 3300025910 Ga0207684_10000343 Ga0207684_1000034355 170
516 3300025912 Ga0207707_10027170 Ga0207707_100271702 170
517 3300025913 Ga0207695_10115336 Ga0207695_101153362 170
518 3300025914 Ga0207671_10256906 Ga0207671_102569062 170
519 3300025915 Ga0207693_10060143 Ga0207693_100601433 170
520 3300025921 Ga0207652_10226851 Ga0207652_102268512 170
521 3300025922 Ga0207646_10000566 Ga0207646_1000056629 170
522 3300025922 Ga0207646_10433024 Ga0207646_104330241 170
523 3300025922 Ga0207646_11113805 Ga0207646_111138051 170
524 3300025924 Ga0207694_10975350 Ga0207694_109753501 170
525 3300025927 Ga0207687_10921383 Ga0207687_109213831 170
526 3300025928 Ga0207700_10069893 Ga0207700_100698931 170
527 3300025929 Ga0207664_10142515 Ga0207664_101425152 170
528 3300025929 Ga0207664_10291770 Ga0207664_102917702 170
529 3300025939 Ga0207665_10018694 Ga0207665_100186943 170
530 3300025939 Ga0207665_10027964 Ga0207665_100279642 170
531 3300025941 Ga0207711_10241887 Ga0207711_102418872 170
532 3300025986 Ga0207658_10700725 Ga0207658_107007252 170
533 3300028380 Ga0268265_10277840 Ga0268265_102778401 170
534 3300028800 Ga0265338_10534887 Ga0265338_105348871 170
535 3300032002 Ga0307416_101422444 Ga0307416_1014224442 170
536 3300035691 Ga0373931_0068215 Ga0373931_0068215_1290_1865 170
537 3300035692 Ga0373935_0596052 Ga0373935_0596052_220_768 170
538 3300035724 Ga0373933_0135349 Ga0373933_0135349_57_605 170
539 3300036401 Ga0373937_0289171 Ga0373937_0289171_117_665 170
540 3300038996 Ga0242420_043691 Ga0242420_043691_191_766 170
541 3300048907 Ga0496104_0046203 Ga0496104_0046203_2633_3208 170
542 3300048909 Ga0496106_0279529 Ga0496106_0279529_525_1100 170
543 3300048911 Ga0496108_0008317 Ga0496108_0008317_4848_5423 170
544 3300048912 Ga0496109_0010275 Ga0496109_0010275_6990_7565 170
545 3300048914 Ga0496111_0246108 Ga0496111_0246108_123_698 170
546 3300048916 Ga0496113_0051842 Ga0496113_0051842_1552_2127 170
547 3300048919 Ga0496116_0000497 Ga0496116_0000497_614_1276 170
548 3300048920 Ga0496117_0002230 Ga0496117_0002230_18151_18813 170
549 3300048921 Ga0496118_0005525 Ga0496118_0005525_7521_8183 170
550 3300048922 Ga0496119_0003539 Ga0496119_0003539_14744_15406 170
551 3300005336 Ga0070680_100008338 Ga0070680_10000833810 171
552 3300005338 Ga0068868_101417912 Ga0068868_1014179121 171
553 3300005467 Ga0070706_100136859 Ga0070706_1001368591 171
554 3300005536 Ga0070697_100108193 Ga0070697_1001081932 171
555 3300005539 Ga0068853_100260879 Ga0068853_1002608791 171
556 3300005546 Ga0070696_100204851 Ga0070696_1002048512 171
557 3300006028 Ga0070717_10218078 Ga0070717_102180782 171
558 3300006175 Ga0070712_100874125 Ga0070712_1008741251 171
559 3300007076 Ga0075435_100492273 Ga0075435_1004922732 171
560 3300009147 Ga0114129_10050255 Ga0114129_100502554 171
561 3300009147 Ga0114129_10659315 Ga0114129_106593152 171
562 3300011119 Ga0105246_11017491 Ga0105246_110174911 171
563 3300025910 Ga0207684_10114447 Ga0207684_101144473 171
564 3300025915 Ga0207693_10170937 Ga0207693_101709372 171
565 3300025916 Ga0207663_10560883 Ga0207663_105608832 171
566 3300030878 Ga0265770_1008450 Ga0265770_10084502 171
567 3300031090 Ga0265760_10006141 Ga0265760_100061416 171
568 3300031691 Ga0316579_10008336 Ga0316579_100083362 171
569 3300031727 Ga0316576_10018144 Ga0316576_100181445 171
570 3300031727 Ga0316576_10236788 Ga0316576_102367882 171
571 3300031727 Ga0316576_10283905 Ga0316576_102839051 171
572 3300031728 Ga0316578_10000459 Ga0316578_1000045911 171
573 3300031733 Ga0316577_10004740 Ga0316577_100047404 171
574 3300032137 Ga0316585_10053905 Ga0316585_100539052 171
575 3300035086 Ga0373934_0003679 Ga0373934_0003679_1718_2284 171
576 3300035113 Ga0373936_0259423 Ga0373936_0259423_191_757 171
577 3300035119 Ga0373956_0004940 Ga0373956_0004940_3330_3896 171
578 3300035172 Ga0373955_0006577 Ga0373955_0006577_1525_2091 171
579 3300035398 Ga0316574_0016508 Ga0316574_0016508_232_777 171
580 3300035724 Ga0373933_0001024 Ga0373933_0001024_6156_6722 171
581 3300036401 Ga0373937_0002112 Ga0373937_0002112_15574_16140 171
582 3300036712 Ga0316584_0007974 Ga0316584_0007974_3293_3838 171
583 3300036712 Ga0316584_0098649 Ga0316584_0098649_817_1362 171
584 3300037588 Ga0316581_0000534 Ga0316581_0000534_4974_5519 171
585 3300042010 Ga0439452_022732 Ga0439452_022732_676_1248 171
586 3300042435 Ga0439434_0101256 Ga0439434_0101256_138_710 171
587 3300044706 Ga0466964_0078311 Ga0466964_0078311_685_1233 171
588 3300044706 Ga0466964_0080654 Ga0466964_0080654_653_1201 171
589 3300045976 Ga0466967_0305023 Ga0466967_0305023_948_1508 171
590 3300046462 Ga0495651_0011185 Ga0495651_0011185_3351_3917 171
591 3300046516 Ga0495628_0166705 Ga0495628_0166705_424_984 171
592 3300046539 Ga0495621_0081877 Ga0495621_0081877_279_881 171
593 3300048905 Ga0496102_0867109 Ga0496102_0867109_260_808 171
594 3300050507 nmdc:mga05p37_31102_c1 nmdc:mga05p37_31102_c1_2917_3477 171
595 3300050507 nmdc:mga05p37_716504_c1 nmdc:mga05p37_716504_c1_116_688 171
596 3300050513 nmdc:mga0rr50_732522_c1 nmdc:mga0rr50_732522_c1_245_805 171
597 3300050514 nmdc:mga08x19_623715_c1 nmdc:mga08x19_623715_c1_72_617 171
598 3300000043 ARcpr5yngRDRAFT_c007790 ARcpr5yngRDRAFT_0077902 172
599 3300000044 ARSoilOldRDRAFT_c005492 ARSoilOldRDRAFT_0054922 172
600 3300000652 ARCol0yngRDRAFT_1004408 ARCol0yngRDRAFT_10044082 172
601 3300005290 Ga0065712_10079424 Ga0065712_100794242 172
602 3300005293 Ga0065715_10000426 Ga0065715_1000042624 172
603 3300005293 Ga0065715_10101767 Ga0065715_101017673 172
604 3300005295 Ga0065707_10140158 Ga0065707_101401581 172
605 3300005295 Ga0065707_10442587 Ga0065707_104425872 172
606 3300005327 Ga0070658_10013843 Ga0070658_100138436 172
607 3300005328 Ga0070676_10083314 Ga0070676_100833142 172
608 3300005329 Ga0070683_100028438 Ga0070683_1000284381 172
609 3300005330 Ga0070690_100033519 Ga0070690_1000335196 172
610 3300005336 Ga0070680_100117900 Ga0070680_1001179003 172
611 3300005336 Ga0070680_100156993 Ga0070680_1001569931 172
612 3300005336 Ga0070680_100280149 Ga0070680_1002801492 172
613 3300005336 Ga0070680_101047478 Ga0070680_1010474781 172
614 3300005337 Ga0070682_100366757 Ga0070682_1003667572 172
615 3300005338 Ga0068868_100096085 Ga0068868_1000960852 172
616 3300005339 Ga0070660_100002598 Ga0070660_1000025987 172
617 3300005340 Ga0070689_100052150 Ga0070689_1000521506 172
618 3300005340 Ga0070689_101235810 Ga0070689_1012358101 172
619 3300005344 Ga0070661_100065186 Ga0070661_1000651862 172
620 3300005347 Ga0070668_100058931 Ga0070668_1000589312 172
621 3300005353 Ga0070669_100160756 Ga0070669_1001607562 172
622 3300005353 Ga0070669_100401410 Ga0070669_1004014101 172
623 3300005354 Ga0070675_100139800 Ga0070675_1001398002 172
624 3300005355 Ga0070671_100094604 Ga0070671_1000946042 172
625 3300005355 Ga0070671_101094966 Ga0070671_1010949661 172
626 3300005356 Ga0070674_100234341 Ga0070674_1002343412 172
627 3300005364 Ga0070673_100182508 Ga0070673_1001825082 172
628 3300005366 Ga0070659_100059085 Ga0070659_1000590852 172
629 3300005441 Ga0070700_100800130 Ga0070700_1008001301 172
630 3300005444 Ga0070694_100088398 Ga0070694_1000883983 172
631 3300005444 Ga0070694_100088707 Ga0070694_1000887072 172
632 3300005445 Ga0070708_100371082 Ga0070708_1003710822 172
633 3300005455 Ga0070663_100660043 Ga0070663_1006600432 172
634 3300005457 Ga0070662_100060162 Ga0070662_1000601622 172
635 3300005458 Ga0070681_10129149 Ga0070681_101291492 172
636 3300005458 Ga0070681_10272375 Ga0070681_102723752 172
637 3300005468 Ga0070707_100370465 Ga0070707_1003704652 172
638 3300005518 Ga0070699_100187921 Ga0070699_1001879212 172
639 3300005530 Ga0070679_100045783 Ga0070679_1000457832 172
640 3300005530 Ga0070679_100175118 Ga0070679_1001751182 172
641 3300005530 Ga0070679_100203956 Ga0070679_1002039563 172
642 3300005530 Ga0070679_100283527 Ga0070679_1002835272 172
643 3300005535 Ga0070684_100075141 Ga0070684_1000751412 172
644 3300005536 Ga0070697_100040091 Ga0070697_1000400913 172
645 3300005536 Ga0070697_100540761 Ga0070697_1005407612 172
646 3300005536 Ga0070697_100965291 Ga0070697_1009652911 172
647 3300005539 Ga0068853_100028841 Ga0068853_1000288414 172
648 3300005546 Ga0070696_100028701 Ga0070696_1000287012 172
649 3300005546 Ga0070696_100151388 Ga0070696_1001513882 172
650 3300005546 Ga0070696_100364533 Ga0070696_1003645332 172
651 3300005547 Ga0070693_100100428 Ga0070693_1001004282 172
652 3300005548 Ga0070665_101531013 Ga0070665_1015310131 172
653 3300005549 Ga0070704_100046726 Ga0070704_1000467263 172
654 3300005549 Ga0070704_100713841 Ga0070704_1007138412 172
655 3300005563 Ga0068855_100205910 Ga0068855_1002059102 172
656 3300005564 Ga0070664_100002608 Ga0070664_10000260811 172
657 3300005564 Ga0070664_100050193 Ga0070664_1000501931 172
658 3300005564 Ga0070664_100290949 Ga0070664_1002909492 172
659 3300005577 Ga0068857_100083950 Ga0068857_1000839502 172
660 3300005578 Ga0068854_100235883 Ga0068854_1002358832 172
661 3300005578 Ga0068854_101101216 Ga0068854_1011012161 172
662 3300005614 Ga0068856_100006181 Ga0068856_1000061814 172
663 3300005616 Ga0068852_100046782 Ga0068852_1000467824 172
664 3300005618 Ga0068864_100068370 Ga0068864_1000683702 172
665 3300005719 Ga0068861_101355200 Ga0068861_1013552001 172
666 3300005834 Ga0068851_10007273 Ga0068851_100072731 172
667 3300005841 Ga0068863_100112876 Ga0068863_1001128762 172
668 3300005841 Ga0068863_100267392 Ga0068863_1002673922 172
669 3300006048 Ga0075363_100104048 Ga0075363_1001040483 172
670 3300006058 Ga0075432_10169357 Ga0075432_101693572 172
671 3300006173 Ga0070716_100166388 Ga0070716_1001663882 172
672 3300006175 Ga0070712_100501254 Ga0070712_1005012542 172
673 3300006844 Ga0075428_100058499 Ga0075428_1000584993 172
674 3300006846 Ga0075430_100243690 Ga0075430_1002436902 172
675 3300006846 Ga0075430_100496611 Ga0075430_1004966112 172
676 3300006847 Ga0075431_100297664 Ga0075431_1002976642 172
677 3300006847 Ga0075431_101292601 Ga0075431_1012926011 172
678 3300006852 Ga0075433_10002659 Ga0075433_100026593 172
679 3300006852 Ga0075433_10053918 Ga0075433_100539184 172
680 3300006852 Ga0075433_10200416 Ga0075433_102004162 172
681 3300006852 Ga0075433_10721402 Ga0075433_107214022 172
682 3300006871 Ga0075434_100000912 Ga0075434_10000091221 172
683 3300006871 Ga0075434_100015123 Ga0075434_1000151235 172
684 3300006871 Ga0075434_100302700 Ga0075434_1003027002 172
685 3300006871 Ga0075434_100353601 Ga0075434_1003536012 172
686 3300006871 Ga0075434_100674820 Ga0075434_1006748201 172
687 3300006880 Ga0075429_100076639 Ga0075429_1000766392 172
688 3300006881 Ga0068865_100135850 Ga0068865_1001358502 172
689 3300006881 Ga0068865_100209418 Ga0068865_1002094183 172
690 3300006914 Ga0075436_100018709 Ga0075436_1000187093 172
691 3300006914 Ga0075436_100803209 Ga0075436_1008032092 172
692 3300007076 Ga0075435_100022612 Ga0075435_1000226123 172
693 3300007076 Ga0075435_100033363 Ga0075435_1000333632 172
694 3300007076 Ga0075435_100431308 Ga0075435_1004313082 172
695 3300007265 Ga0099794_10337808 Ga0099794_103378081 172
696 3300009093 Ga0105240_10023418 Ga0105240_100234184 172
697 3300009094 Ga0111539_10237137 Ga0111539_102371373 172
698 3300009094 Ga0111539_10539472 Ga0111539_105394722 172
699 3300009094 Ga0111539_11039632 Ga0111539_110396322 172
700 3300009147 Ga0114129_10049957 Ga0114129_100499574 172
701 3300009147 Ga0114129_10234029 Ga0114129_102340293 172
702 3300009147 Ga0114129_11289176 Ga0114129_112891762 172
703 3300009176 Ga0105242_10162929 Ga0105242_101629292 172
704 3300009176 Ga0105242_10358676 Ga0105242_103586763 172
705 3300009177 Ga0105248_11087086 Ga0105248_110870862 172
706 3300009545 Ga0105237_10024941 Ga0105237_100249412 172
707 3300009551 Ga0105238_10010036 Ga0105238_100100367 172
708 3300009553 Ga0105249_10864635 Ga0105249_108646352 172
709 3300010375 Ga0105239_10008739 Ga0105239_100087392 172
710 3300011119 Ga0105246_10237114 Ga0105246_102371142 172
711 3300012512 Ga0157327_1025599 Ga0157327_10255992 172
712 3300013100 Ga0157373_10031435 Ga0157373_100314353 172
713 3300013105 Ga0157369_10044152 Ga0157369_100441524 172
714 3300013296 Ga0157374_10024711 Ga0157374_100247112 172
715 3300013297 Ga0157378_10065647 Ga0157378_100656473 172
716 3300013297 Ga0157378_10300693 Ga0157378_103006932 172
717 3300013306 Ga0163162_11370864 Ga0163162_113708641 172
718 3300013306 Ga0163162_12432425 Ga0163162_124324251 172
719 3300013307 Ga0157372_10046345 Ga0157372_100463452 172
720 3300013308 Ga0157375_12457249 Ga0157375_124572491 172
721 3300014325 Ga0163163_10049606 Ga0163163_100496062 172
722 3300014497 Ga0182008_10025720 Ga0182008_100257202 172
723 3300015261 Ga0182006_1019715 Ga0182006_10197152 172
724 3300015262 Ga0182007_10004292 Ga0182007_100042923 172
725 3300015265 Ga0182005_1008218 Ga0182005_10082182 172
726 3300025315 Ga0207697_10041840 Ga0207697_100418402 172
727 3300025321 Ga0207656_10050952 Ga0207656_100509522 172
728 3300025907 Ga0207645_10086172 Ga0207645_100861722 172
729 3300025909 Ga0207705_10364029 Ga0207705_103640292 172
730 3300025912 Ga0207707_10123354 Ga0207707_101233543 172
731 3300025912 Ga0207707_10299705 Ga0207707_102997051 172
732 3300025913 Ga0207695_10487500 Ga0207695_104875002 172
733 3300025914 Ga0207671_10042026 Ga0207671_100420262 172
734 3300025915 Ga0207693_10097756 Ga0207693_100977563 172
735 3300025917 Ga0207660_10243281 Ga0207660_102432812 172
736 3300025919 Ga0207657_10006029 Ga0207657_100060298 172
737 3300025920 Ga0207649_10017747 Ga0207649_100177472 172
738 3300025921 Ga0207652_10053965 Ga0207652_100539654 172
739 3300025921 Ga0207652_10145945 Ga0207652_101459452 172
740 3300025923 Ga0207681_10599294 Ga0207681_105992941 172
741 3300025924 Ga0207694_10062368 Ga0207694_100623682 172
742 3300025932 Ga0207690_10016612 Ga0207690_100166125 172
743 3300025933 Ga0207706_10018524 Ga0207706_100185242 172
744 3300025933 Ga0207706_10353558 Ga0207706_103535582 172
745 3300025938 Ga0207704_10487954 Ga0207704_104879542 172
746 3300025939 Ga0207665_10443492 Ga0207665_104434922 172
747 3300025944 Ga0207661_10035826 Ga0207661_100358264 172
748 3300025944 Ga0207661_10453799 Ga0207661_104537991 172
749 3300025944 Ga0207661_10454930 Ga0207661_104549302 172
750 3300025945 Ga0207679_10307233 Ga0207679_103072332 172
751 3300025949 Ga0207667_10069420 Ga0207667_100694202 172
752 3300025949 Ga0207667_10403584 Ga0207667_104035842 172
753 3300025960 Ga0207651_10411644 Ga0207651_104116441 172
754 3300025961 Ga0207712_10226425 Ga0207712_102264252 172
755 3300025981 Ga0207640_10287556 Ga0207640_102875562 172
756 3300026023 Ga0207677_10058462 Ga0207677_100584622 172
757 3300026041 Ga0207639_10067193 Ga0207639_100671931 172
758 3300026067 Ga0207678_10112962 Ga0207678_101129622 172
759 3300026075 Ga0207708_10478734 Ga0207708_104787342 172
760 3300026078 Ga0207702_10041278 Ga0207702_100412784 172
761 3300026116 Ga0207674_10102178 Ga0207674_101021782 172
762 3300026116 Ga0207674_10280800 Ga0207674_102808002 172
763 3300026142 Ga0207698_10114920 Ga0207698_101149202 172
764 3300027360 Ga0209969_1003076 Ga0209969_10030763 172
765 3300027364 Ga0209967_1020940 Ga0209967_10209401 172
766 3300027424 Ga0209984_1004486 Ga0209984_10044862 172
767 3300027543 Ga0209999_1024040 Ga0209999_10240402 172
768 3300027552 Ga0209982_1013863 Ga0209982_10138632 172
769 3300027665 Ga0209983_1003284 Ga0209983_10032842 172
770 3300027682 Ga0209971_1003683 Ga0209971_10036832 172
771 3300027695 Ga0209966_1033663 Ga0209966_10336632 172
772 3300027717 Ga0209998_10002447 Ga0209998_100024474 172
773 3300027876 Ga0209974_10003894 Ga0209974_100038943 172
774 3300028017 Ga0265356_1000527 Ga0265356_10005274 172
775 3300028379 Ga0268266_10766107 Ga0268266_107661072 172
776 3300028800 Ga0265338_10194674 Ga0265338_101946742 172
777 3300030760 Ga0265762_1012486 Ga0265762_10124862 172
778 3300030760 Ga0265762_1027107 Ga0265762_10271072 172
779 3300031241 Ga0265325_10016662 Ga0265325_100166622 172
780 3300031548 Ga0307408_100033371 Ga0307408_1000333713 172
781 3300031548 Ga0307408_100084069 Ga0307408_1000840692 172
782 3300031665 Ga0316575_10013005 Ga0316575_100130052 172
783 3300031691 Ga0316579_10022015 Ga0316579_100220152 172
784 3300031728 Ga0316578_10060867 Ga0316578_100608673 172
785 3300031731 Ga0307405_10034813 Ga0307405_100348132 172
786 3300031731 Ga0307405_11040072 Ga0307405_110400722 172
787 3300031824 Ga0307413_10026956 Ga0307413_100269561 172
788 3300031824 Ga0307413_10098532 Ga0307413_100985321 172
789 3300031852 Ga0307410_10036760 Ga0307410_100367603 172
790 3300031852 Ga0307410_10045493 Ga0307410_100454932 172
791 3300031901 Ga0307406_10396645 Ga0307406_103966452 172
792 3300031903 Ga0307407_10059452 Ga0307407_100594523 172
793 3300031903 Ga0307407_10127520 Ga0307407_101275203 172
794 3300031995 Ga0307409_100008862 Ga0307409_1000088625 172
795 3300031995 Ga0307409_101335469 Ga0307409_1013354691 172
796 3300032002 Ga0307416_100012241 Ga0307416_1000122415 172
797 3300032002 Ga0307416_100103287 Ga0307416_1001032873 172
798 3300032004 Ga0307414_10010303 Ga0307414_100103035 172
799 3300032005 Ga0307411_10001054 Ga0307411_1000105410 172
800 3300032126 Ga0307415_100123368 Ga0307415_1001233682 172
801 3300032126 Ga0307415_100163389 Ga0307415_1001633891 172
802 3300032126 Ga0307415_100596985 Ga0307415_1005969852 172
803 3300035086 Ga0373934_0228158 Ga0373934_0228158_73_618 172
804 3300035091 Ga0373951_0088134 Ga0373951_0088134_221_778 172
805 3300035092 Ga0373952_0053819 Ga0373952_0053819_226_783 172
806 3300035118 Ga0373954_0156515 Ga0373954_0156515_271_828 172
807 3300035170 Ga0373943_0045635 Ga0373943_0045635_351_908 172
808 3300035692 Ga0373935_0017443 Ga0373935_0017443_2662_3219 172
809 3300035692 Ga0373935_0271716 Ga0373935_0271716_526_1071 172
810 3300036401 Ga0373937_0091057 Ga0373937_0091057_193_750 172
811 3300036712 Ga0316584_0250530 Ga0316584_0250530_238_828 172
812 3300037068 Ga0373925_0176184 Ga0373925_0176184_335_880 172
813 3300037471 Ga0395905_0993944 Ga0395905_0993944_25_570 172
814 3300039450 Ga0436363_0772685 Ga0436363_0772685_66_614 172
815 3300041494 Ga0451837_1267093 Ga0451837_1267093_123_674 172
816 3300042436 Ga0439435_0107811 Ga0439435_0107811_219_776 172
817 3300042876 Ga0451577_0263264 Ga0451577_0263264_147_704 172
818 3300044673 Ga0453683_0001085 Ga0453683_0001085_14315_14932 172
819 3300044673 Ga0453683_0135304 Ga0453683_0135304_819_1370 172
820 3300044712 Ga0453684_0408078 Ga0453684_0408078_511_1068 172
821 3300044712 Ga0453684_0824404 Ga0453684_0824404_320_868 172
822 3300044712 Ga0453684_1323518 Ga0453684_1323518_116_673 172
823 3300045051 Ga0451576_0112881 Ga0451576_0112881_447_998 172
824 3300045051 Ga0451576_0395683 Ga0451576_0395683_279_836 172
825 3300045051 Ga0451576_0461007 Ga0451576_0461007_305_856 172
826 3300045051 Ga0451576_0537069 Ga0451576_0537069_202_759 172
827 3300046472 Ga0495580_0063840 Ga0495580_0063840_1854_2402 172
828 3300046516 Ga0495628_0415342 Ga0495628_0415342_439_963 172
829 3300046543 Ga0495645_0035667 Ga0495645_0035667_599_1144 172
830 3300046680 Ga0495646_0277758 Ga0495646_0277758_257_802 172
831 3300046683 Ga0495658_0387816 Ga0495658_0387816_34_591 172
832 3300047319 Ga0495674_0115303 Ga0495674_0115303_156_701 172
833 3300047319 Ga0495674_0570611 Ga0495674_0570611_40_597 172
834 3300048088 Ga0495602_0130583 Ga0495602_0130583_836_1384 172
835 3300048904 Ga0496101_0667462 Ga0496101_0667462_243_791 172
836 3300048905 Ga0496102_0014302 Ga0496102_0014302_2571_3119 172
837 3300048906 Ga0496103_0037479 Ga0496103_0037479_1157_1705 172
838 3300048907 Ga0496104_0028506 Ga0496104_0028506_2572_3120 172
839 3300048907 Ga0496104_1432061 Ga0496104_1432061_12_569 172
840 3300048908 Ga0496105_0069733 Ga0496105_0069733_1442_1990 172
841 3300048909 Ga0496106_0034077 Ga0496106_0034077_1489_2037 172
842 3300048909 Ga0496106_0138456 Ga0496106_0138456_55_630 172
843 3300048910 Ga0496107_0145824 Ga0496107_0145824_158_706 172
844 3300048911 Ga0496108_0012878 Ga0496108_0012878_1893_2441 172
845 3300048911 Ga0496108_0536816 Ga0496108_0536816_224_781 172
846 3300048913 Ga0496110_0005089 Ga0496110_0005089_7838_8386 172
847 3300048914 Ga0496111_0024930 Ga0496111_0024930_1150_1698 172
848 3300048915 Ga0496112_0004846 Ga0496112_0004846_10806_11363 172
849 3300048915 Ga0496112_0102119 Ga0496112_0102119_1267_1815 172
850 3300048916 Ga0496113_0046287 Ga0496113_0046287_166_714 172
851 3300048916 Ga0496113_0695343 Ga0496113_0695343_42_593 172
852 3300049513 Ga0501290_030934 Ga0501290_030934_67_630 172
853 3300049521 Ga0501298_024576 Ga0501298_024576_437_1000 172
854 3300049568 Ga0501031_0002507 Ga0501031_0002507_3070_3627 172
855 3300049569 Ga0501032_0014295 Ga0501032_0014295_3650_4207 172
856 3300049570 Ga0501033_0181521 Ga0501033_0181521_923_1480 172
857 3300049571 Ga0501034_0077362 Ga0501034_0077362_1996_2553 172
858 3300049572 Ga0501036_0009639 Ga0501036_0009639_2452_3009 172
859 3300049572 Ga0501036_0459169 Ga0501036_0459169_257_814 172
860 3300049573 Ga0501037_0046219 Ga0501037_0046219_397_954 172
861 3300049574 Ga0501038_0143995 Ga0501038_0143995_992_1549 172
862 3300049575 Ga0501039_0065597 Ga0501039_0065597_399_956 172
863 3300049576 Ga0501040_0181177 Ga0501040_0181177_863_1420 172
864 3300049577 Ga0501041_0057285 Ga0501041_0057285_855_1412 172
865 3300049577 Ga0501041_0066702 Ga0501041_0066702_1535_2092 172
866 3300049577 Ga0501041_0204296 Ga0501041_0204296_295_852 172
867 3300049578 Ga0501042_0024759 Ga0501042_0024759_3001_3558 172
868 3300049579 Ga0501043_0004222 Ga0501043_0004222_500_1057 172
869 3300049580 Ga0501046_0040961 Ga0501046_0040961_2621_3178 172
870 3300049580 Ga0501046_0178425 Ga0501046_0178425_243_800 172
871 3300049582 Ga0501048_0043170 Ga0501048_0043170_1869_2426 172
872 3300049584 Ga0501068_0006736 Ga0501068_0006736_2875_3432 172
873 3300049586 Ga0501070_0851229 Ga0501070_0851229_26_583 172
874 3300049587 Ga0501071_0032377 Ga0501071_0032377_762_1319 172
875 3300049587 Ga0501071_0156579 Ga0501071_0156579_600_1157 172
876 3300049588 Ga0501072_0136216 Ga0501072_0136216_1287_1844 172
877 3300049588 Ga0501072_0450346 Ga0501072_0450346_119_676 172
878 3300049589 Ga0501073_0043633 Ga0501073_0043633_2206_2763 172
879 3300049590 Ga0501074_0059820 Ga0501074_0059820_1706_2263 172
880 3300049591 Ga0501075_0067040 Ga0501075_0067040_1632_2189 172
881 3300049591 Ga0501075_0163379 Ga0501075_0163379_848_1435 172
882 3300049591 Ga0501075_0165603 Ga0501075_0165603_1005_1562 172
883 3300049592 Ga0501076_0169115 Ga0501076_0169115_936_1493 172
884 3300049593 Ga0501077_0021133 Ga0501077_0021133_197_754 172
885 3300049593 Ga0501077_0183182 Ga0501077_0183182_231_788 172
886 3300049668 Ga0501233_076047 Ga0501233_076047_146_709 172
887 3300049708 Ga0501245_047057 Ga0501245_047057_29_592 172
888 3300049741 Ga0501079_0083078 Ga0501079_0083078_1462_2019 172
889 3300049742 Ga0501080_0024091 Ga0501080_0024091_2267_2824 172
890 3300049742 Ga0501080_0068579 Ga0501080_0068579_701_1258 172
891 3300049743 Ga0501081_0036893 Ga0501081_0036893_262_819 172
892 3300049743 Ga0501081_0099773 Ga0501081_0099773_114_671 172
893 3300049743 Ga0501081_0324007 Ga0501081_0324007_288_848 172
894 3300049743 Ga0501081_0362429 Ga0501081_0362429_291_878 172
895 3300049743 Ga0501081_0548003 Ga0501081_0548003_30_587 172
896 3300049744 Ga0501083_0081137 Ga0501083_0081137_1287_1844 172
897 3300049744 Ga0501083_0305412 Ga0501083_0305412_138_695 172
898 3300049761 Ga0501264_024411 Ga0501264_024411_57_620 172
899 3300049822 Ga0501035_0009687 Ga0501035_0009687_5186_5743 172
900 3300049823 Ga0501044_0202590 Ga0501044_0202590_113_670 172
901 3300049824 Ga0501045_0320923 Ga0501045_0320923_399_956 172
902 3300049851 Ga0501212_022108 Ga0501212_022108_34_597 172
903 3300050490 nmdc:mga03n38_17955_c1 nmdc:mga03n38_17955_c1_1447_2001 172
904 3300050507 nmdc:mga05p37_18711_c1 nmdc:mga05p37_18711_c1_534_1091 172
905 3300050507 nmdc:mga05p37_236442_c1 nmdc:mga05p37_236442_c1_976_1533 172
906 3300050507 nmdc:mga05p37_329402_c1 nmdc:mga05p37_329402_c1_247_804 172
907 3300050507 nmdc:mga05p37_83259_c1 nmdc:mga05p37_83259_c1_1665_2222 172
908 3300050509 nmdc:mga0qj67_252207_c1 nmdc:mga0qj67_252207_c1_648_1220 172
909 3300050510 nmdc:mga06r32_230522_c1 nmdc:mga06r32_230522_c1_970_1527 172
910 3300050511 nmdc:mga08y16_142191_c1 nmdc:mga08y16_142191_c1_912_1463 172
911 3300050511 nmdc:mga08y16_247590_c1 nmdc:mga08y16_247590_c1_64_621 172
912 3300050511 nmdc:mga08y16_59486_c1 nmdc:mga08y16_59486_c1_1427_1984 172
913 3300050511 nmdc:mga08y16_619231_c1 nmdc:mga08y16_619231_c1_88_636 172
914 3300050512 nmdc:mga0n895_113204_c1 nmdc:mga0n895_113204_c1_365_922 172
915 3300050512 nmdc:mga0n895_11810_c1 nmdc:mga0n895_11810_c1_5278_5835 172
916 3300050512 nmdc:mga0n895_1413665_c1 nmdc:mga0n895_1413665_c1_15_572 172
917 3300050512 nmdc:mga0n895_348863_c1 nmdc:mga0n895_348863_c1_539_1096 172
918 3300050512 nmdc:mga0n895_613_c1 nmdc:mga0n895_613_c1_6910_7467 172
919 3300050513 nmdc:mga0rr50_1002051_c1 nmdc:mga0rr50_1002051_c1_58_615 172
920 3300050513 nmdc:mga0rr50_144417_c1 nmdc:mga0rr50_144417_c1_1298_1855 172
921 3300050513 nmdc:mga0rr50_61902_c1 nmdc:mga0rr50_61902_c1_790_1347 172
922 3300050514 nmdc:mga08x19_14736_c1 nmdc:mga08x19_14736_c1_2826_3383 172
923 3300050514 nmdc:mga08x19_797796_c1 nmdc:mga08x19_797796_c1_38_595 172
924 3300050515 nmdc:mga0a205_25992_c1 nmdc:mga0a205_25992_c1_1097_1654 172
925 3300050515 nmdc:mga0a205_323500_c1 nmdc:mga0a205_323500_c1_64_621 172
926 3300050515 nmdc:mga0a205_646791_c1 nmdc:mga0a205_646791_c1_233_790 172
927 3300050515 nmdc:mga0a205_96090_c1 nmdc:mga0a205_96090_c1_2016_2573 172
928 3300054114 Ga0501084_0255501 Ga0501084_0255501_387_944 172
929 3300054114 Ga0501084_0659070 Ga0501084_0659070_126_683 172
930 3300054114 Ga0501084_0681045 Ga0501084_0681045_114_671 172
931 3300059424 Ga0590075_063291 Ga0590075_063291_29_586 172
932 3300060353 Ga0501082_0017025 Ga0501082_0017025_517_1074 172
933 3300060353 Ga0501082_0048352 Ga0501082_0048352_2052_2609 172
934 3300060353 Ga0501082_0061639 Ga0501082_0061639_1727_2314 172
935 3300061734 Ga0530510_0104214 Ga0530510_0104214_906_1463 172
936 3300061734 Ga0530510_0706150 Ga0530510_0706150_115_675 172
937 3300003578 Ga0006562J51391_1037240 Ga0006562J51391_10372402 173
938 3300004803 Ga0058862_12075184 Ga0058862_120751842 173
939 3300005441 Ga0070700_100771977 Ga0070700_1007719772 173
940 3300005458 Ga0070681_10022625 Ga0070681_100226253 173
941 3300005530 Ga0070679_100047053 Ga0070679_1000470532 173
942 3300005530 Ga0070679_100464006 Ga0070679_1004640062 173
943 3300005614 Ga0068856_100039924 Ga0068856_1000399242 173
944 3300005937 Ga0081455_10480170 Ga0081455_104801701 173
945 3300006028 Ga0070717_10026709 Ga0070717_100267094 173
946 3300006175 Ga0070712_100116848 Ga0070712_1001168482 173
947 3300006844 Ga0075428_101401296 Ga0075428_1014012961 173
948 3300006847 Ga0075431_100010526 Ga0075431_1000105262 173
949 3300009147 Ga0114129_10700674 Ga0114129_107006743 173
950 3300010375 Ga0105239_10908548 Ga0105239_109085482 173
951 3300014326 Ga0157380_10991591 Ga0157380_109915912 173
952 3300025915 Ga0207693_10809518 Ga0207693_108095181 173
953 3300025921 Ga0207652_10024100 Ga0207652_100241008 173
954 3300025923 Ga0207681_10420807 Ga0207681_104208072 173
955 3300026078 Ga0207702_10097741 Ga0207702_100977413 173
956 3300031090 Ga0265760_10008589 Ga0265760_100085891 173
957 3300031235 Ga0265330_10003430 Ga0265330_100034308 173
958 3300031238 Ga0265332_10000189 Ga0265332_1000018919 173
959 3300031239 Ga0265328_10059431 Ga0265328_100594312 173
960 3300031241 Ga0265325_10014749 Ga0265325_100147493 173
961 3300031242 Ga0265329_10001491 Ga0265329_100014918 173
962 3300031249 Ga0265339_10099337 Ga0265339_100993372 173
963 3300031250 Ga0265331_10258071 Ga0265331_102580711 173
964 3300031344 Ga0265316_10000012 Ga0265316_100000128 173
965 3300031711 Ga0265314_10000018 Ga0265314_10000018181 173
966 3300031712 Ga0265342_10000167 Ga0265342_1000016758 173
967 3300031731 Ga0307405_10026290 Ga0307405_100262901 173
968 3300031731 Ga0307405_10062762 Ga0307405_100627623 173
969 3300031824 Ga0307413_10280236 Ga0307413_102802362 173
970 3300031852 Ga0307410_10173140 Ga0307410_101731402 173
971 3300031901 Ga0307406_10002519 Ga0307406_100025199 173
972 3300031901 Ga0307406_10209314 Ga0307406_102093142 173
973 3300031995 Ga0307409_101064836 Ga0307409_1010648361 173
974 3300032002 Ga0307416_100004516 Ga0307416_1000045169 173
975 3300032002 Ga0307416_100040761 Ga0307416_1000407617 173
976 3300032126 Ga0307415_100080220 Ga0307415_1000802202 173
977 3300032168 Ga0316593_10003588 Ga0316593_100035882 173
978 3300036647 Ga0316582_0017219 Ga0316582_0017219_1393_1941 173
979 3300037466 Ga0395898_0314219 Ga0395898_0314219_154_738 173
980 3300038443 Ga0395901_0289175 Ga0395901_0289175_234_809 173
981 3300039450 Ga0436363_1440667 Ga0436363_1440667_714_1268 173
982 3300042876 Ga0451577_0114947 Ga0451577_0114947_1561_2178 173
983 3300044673 Ga0453683_0032832 Ga0453683_0032832_2472_3029 173
984 3300044694 Ga0466963_0040370 Ga0466963_0040370_1927_2481 173
985 3300044712 Ga0453684_0122496 Ga0453684_0122496_337_903 173
986 3300044842 Ga0466957_0539321 Ga0466957_0539321_151_720 173
987 3300045049 Ga0466959_0074023 Ga0466959_0074023_194_763 173
988 3300045049 Ga0466959_0374583 Ga0466959_0374583_261_812 173
989 3300046523 Ga0495644_0099158 Ga0495644_0099158_348_902 173
990 3300046691 Ga0495670_0225097 Ga0495670_0225097_199_753 173
991 3300048906 Ga0496103_0002447 Ga0496103_0002447_4584_5324 173
992 3300048912 Ga0496109_1372316 Ga0496109_1372316_35_592 173
993 3300048915 Ga0496112_0014955 Ga0496112_0014955_5917_6465 173
994 3300049568 Ga0501031_0118149 Ga0501031_0118149_1160_1711 173
995 3300049569 Ga0501032_0027826 Ga0501032_0027826_1024_1575 173
996 3300049570 Ga0501033_0009488 Ga0501033_0009488_3356_3907 173
997 3300049571 Ga0501034_0449545 Ga0501034_0449545_484_1035 173
998 3300049572 Ga0501036_0001561 Ga0501036_0001561_4397_4948 173
999 3300049573 Ga0501037_0004456 Ga0501037_0004456_5955_6506 173
1000 3300049573 Ga0501037_0072998 Ga0501037_0072998_1103_1654 173
1001 3300049573 Ga0501037_0080298 Ga0501037_0080298_262_846 173
1002 3300049574 Ga0501038_0011663 Ga0501038_0011663_3173_3724 173
1003 3300049574 Ga0501038_0058831 Ga0501038_0058831_752_1303 173
1004 3300049575 Ga0501039_0001505 Ga0501039_0001505_12906_13457 173
1005 3300049575 Ga0501039_0315236 Ga0501039_0315236_129_680 173
1006 3300049576 Ga0501040_0000411 Ga0501040_0000411_14126_14677 173
1007 3300049577 Ga0501041_0008505 Ga0501041_0008505_3463_4014 173
1008 3300049577 Ga0501041_0035751 Ga0501041_0035751_377_928 173
1009 3300049577 Ga0501041_0670575 Ga0501041_0670575_16_564 173
1010 3300049578 Ga0501042_0000863 Ga0501042_0000863_3719_4270 173
1011 3300049578 Ga0501042_0011345 Ga0501042_0011345_3377_3928 173
1012 3300049579 Ga0501043_0057987 Ga0501043_0057987_1391_1942 173
1013 3300049579 Ga0501043_0299864 Ga0501043_0299864_623_1174 173
1014 3300049580 Ga0501046_0010572 Ga0501046_0010572_406_957 173
1015 3300049580 Ga0501046_0022710 Ga0501046_0022710_1660_2211 173
1016 3300049581 Ga0501047_0747062 Ga0501047_0747062_110_694 173
1017 3300049582 Ga0501048_0000930 Ga0501048_0000930_18648_19199 173
1018 3300049582 Ga0501048_0034945 Ga0501048_0034945_257_808 173
1019 3300049582 Ga0501048_0067449 Ga0501048_0067449_1403_2011 173
1020 3300049584 Ga0501068_0003203 Ga0501068_0003203_4303_4854 173
1021 3300049586 Ga0501070_0476588 Ga0501070_0476588_384_968 173
1022 3300049587 Ga0501071_0000546 Ga0501071_0000546_7990_8541 173
1023 3300049588 Ga0501072_0022783 Ga0501072_0022783_719_1270 173
1024 3300049589 Ga0501073_0206082 Ga0501073_0206082_50_601 173
1025 3300049591 Ga0501075_0000466 Ga0501075_0000466_9268_9819 173
1026 3300049591 Ga0501075_0520033 Ga0501075_0520033_230_781 173
1027 3300049592 Ga0501076_0000395 Ga0501076_0000395_15526_16077 173
1028 3300049592 Ga0501076_0355216 Ga0501076_0355216_392_940 173
1029 3300049593 Ga0501077_0008250 Ga0501077_0008250_1204_1755 173
1030 3300049593 Ga0501077_0078270 Ga0501077_0078270_807_1370 173
1031 3300049741 Ga0501079_0000187 Ga0501079_0000187_29665_30216 173
1032 3300049741 Ga0501079_0247917 Ga0501079_0247917_449_1003 173
1033 3300049741 Ga0501079_1136173 Ga0501079_1136173_24_575 173
1034 3300049742 Ga0501080_0005523 Ga0501080_0005523_10639_11190 173
1035 3300049742 Ga0501080_0025086 Ga0501080_0025086_2800_3384 173
1036 3300049743 Ga0501081_0013627 Ga0501081_0013627_3590_4141 173
1037 3300049744 Ga0501083_0008767 Ga0501083_0008767_4103_4654 173
1038 3300049822 Ga0501035_0044832 Ga0501035_0044832_365_916 173
1039 3300049822 Ga0501035_0083942 Ga0501035_0083942_372_923 173
1040 3300049823 Ga0501044_0001508 Ga0501044_0001508_19934_20518 173
1041 3300049823 Ga0501044_0218969 Ga0501044_0218969_614_1198 173
1042 3300049824 Ga0501045_0012759 Ga0501045_0012759_1100_1651 173
1043 3300049824 Ga0501045_0068534 Ga0501045_0068534_1315_1866 173
1044 3300050491 nmdc:mga00v17_224940_c1 nmdc:mga00v17_224940_c1_132_686 173
1045 3300050507 nmdc:mga05p37_119553_c1 nmdc:mga05p37_119553_c1_47_595 173
1046 3300050509 nmdc:mga0qj67_79916_c1 nmdc:mga0qj67_79916_c1_1993_2577 173
1047 3300050510 nmdc:mga06r32_206636_c1 nmdc:mga06r32_206636_c1_242_826 173
1048 3300054114 Ga0501084_0007763 Ga0501084_0007763_4690_5241 173
1049 3300060353 Ga0501082_0000775 Ga0501082_0000775_16545_17096 173
1050 3300060353 Ga0501082_0044260 Ga0501082_0044260_2118_2702 173
1051 3300061734 Ga0530510_0000511 Ga0530510_0000511_9878_10429 173
1052 3300061734 Ga0530510_0206643 Ga0530510_0206643_724_1275 173
1053 2162886012 MBSR1b_contig_10465430 MBSR1b_0912.00000410 174
1054 3300001976 JGI24752J21851_1000481 JGI24752J21851_10004814 174
1055 3300001978 JGI24747J21853_1003305 JGI24747J21853_10033052 174
1056 3300002074 JGI24748J21848_1004413 JGI24748J21848_10044131 174
1057 3300002075 JGI24738J21930_10070394 JGI24738J21930_100703942 174
1058 3300002076 JGI24749J21850_1021608 JGI24749J21850_10216082 174
1059 3300002239 JGI24034J26672_10002026 JGI24034J26672_100020263 174
1060 3300002459 JGI24751J29686_10006924 JGI24751J29686_100069242 174
1061 3300003323 rootH1_10360082 rootH1_103600822 174
1062 3300004799 Ga0058863_10041361 Ga0058863_100413612 174
1063 3300004799 Ga0058863_11504263 Ga0058863_115042632 174
1064 3300004801 Ga0058860_11414818 Ga0058860_114148181 174
1065 3300005290 Ga0065712_10076396 Ga0065712_100763962 174
1066 3300005293 Ga0065715_10105520 Ga0065715_101055203 174
1067 3300005293 Ga0065715_10479286 Ga0065715_104792861 174
1068 3300005295 Ga0065707_10373448 Ga0065707_103734481 174
1069 3300005327 Ga0070658_10063359 Ga0070658_100633592 174
1070 3300005328 Ga0070676_10013881 Ga0070676_100138815 174
1071 3300005328 Ga0070676_10093002 Ga0070676_100930022 174
1072 3300005329 Ga0070683_100007493 Ga0070683_1000074932 174
1073 3300005329 Ga0070683_100130767 Ga0070683_1001307672 174
1074 3300005329 Ga0070683_101219870 Ga0070683_1012198701 174
1075 3300005330 Ga0070690_100114469 Ga0070690_1001144692 174
1076 3300005330 Ga0070690_100268639 Ga0070690_1002686392 174
1077 3300005331 Ga0070670_100033325 Ga0070670_1000333252 174
1078 3300005334 Ga0068869_100024792 Ga0068869_1000247923 174
1079 3300005334 Ga0068869_100114402 Ga0068869_1001144022 174
1080 3300005334 Ga0068869_100184223 Ga0068869_1001842232 174
1081 3300005335 Ga0070666_10015277 Ga0070666_100152773 174
1082 3300005335 Ga0070666_10028837 Ga0070666_100288374 174
1083 3300005335 Ga0070666_10128994 Ga0070666_101289942 174
1084 3300005336 Ga0070680_100001534 Ga0070680_1000015342 174
1085 3300005336 Ga0070680_100147484 Ga0070680_1001474842 174
1086 3300005336 Ga0070680_100843899 Ga0070680_1008438991 174
1087 3300005337 Ga0070682_100116890 Ga0070682_1001168902 174
1088 3300005338 Ga0068868_100001807 Ga0068868_10000180710 174
1089 3300005338 Ga0068868_100011209 Ga0068868_1000112094 174
1090 3300005338 Ga0068868_100031985 Ga0068868_1000319852 174
1091 3300005338 Ga0068868_100190940 Ga0068868_1001909402 174
1092 3300005339 Ga0070660_100011061 Ga0070660_1000110615 174
1093 3300005339 Ga0070660_100198155 Ga0070660_1001981552 174
1094 3300005340 Ga0070689_100007514 Ga0070689_1000075144 174
1095 3300005340 Ga0070689_100124353 Ga0070689_1001243533 174
1096 3300005341 Ga0070691_10028917 Ga0070691_100289172 174
1097 3300005343 Ga0070687_100082981 Ga0070687_1000829812 174
1098 3300005343 Ga0070687_100126158 Ga0070687_1001261582 174
1099 3300005344 Ga0070661_100004168 Ga0070661_1000041683 174
1100 3300005344 Ga0070661_100165133 Ga0070661_1001651332 174
1101 3300005344 Ga0070661_100709575 Ga0070661_1007095751 174
1102 3300005347 Ga0070668_100004857 Ga0070668_1000048577 174
1103 3300005353 Ga0070669_100002184 Ga0070669_1000021848 174
1104 3300005353 Ga0070669_100081119 Ga0070669_1000811192 174
1105 3300005354 Ga0070675_100006210 Ga0070675_1000062107 174
1106 3300005355 Ga0070671_100313508 Ga0070671_1003135082 174
1107 3300005355 Ga0070671_100680847 Ga0070671_1006808472 174
1108 3300005356 Ga0070674_100001002 Ga0070674_1000010022 174
1109 3300005364 Ga0070673_100148335 Ga0070673_1001483352 174
1110 3300005365 Ga0070688_100000618 Ga0070688_1000006189 174
1111 3300005365 Ga0070688_100338052 Ga0070688_1003380521 174
1112 3300005366 Ga0070659_100021268 Ga0070659_1000212684 174
1113 3300005366 Ga0070659_100038918 Ga0070659_1000389181 174
1114 3300005367 Ga0070667_100065506 Ga0070667_1000655062 174
1115 3300005367 Ga0070667_100234987 Ga0070667_1002349872 174
1116 3300005367 Ga0070667_101503943 Ga0070667_1015039431 174
1117 3300005434 Ga0070709_10085027 Ga0070709_100850272 174
1118 3300005434 Ga0070709_10103055 Ga0070709_101030552 174
1119 3300005434 Ga0070709_10248035 Ga0070709_102480351 174
1120 3300005434 Ga0070709_10252448 Ga0070709_102524481 174
1121 3300005434 Ga0070709_10262567 Ga0070709_102625672 174
1122 3300005434 Ga0070709_10630909 Ga0070709_106309091 174
1123 3300005435 Ga0070714_100302551 Ga0070714_1003025511 174
1124 3300005435 Ga0070714_100351002 Ga0070714_1003510022 174
1125 3300005436 Ga0070713_100006778 Ga0070713_1000067781 174
1126 3300005436 Ga0070713_100081104 Ga0070713_1000811043 174
1127 3300005436 Ga0070713_100198128 Ga0070713_1001981281 174
1128 3300005436 Ga0070713_100271411 Ga0070713_1002714111 174
1129 3300005436 Ga0070713_100472479 Ga0070713_1004724791 174
1130 3300005436 Ga0070713_100594777 Ga0070713_1005947772 174
1131 3300005436 Ga0070713_101601251 Ga0070713_1016012511 174
1132 3300005436 Ga0070713_101621348 Ga0070713_1016213481 174
1133 3300005437 Ga0070710_10045654 Ga0070710_100456543 174
1134 3300005437 Ga0070710_10122117 Ga0070710_101221171 174
1135 3300005437 Ga0070710_10132588 Ga0070710_101325882 174
1136 3300005439 Ga0070711_100102674 Ga0070711_1001026742 174
1137 3300005439 Ga0070711_100236503 Ga0070711_1002365032 174
1138 3300005439 Ga0070711_100437727 Ga0070711_1004377271 174
1139 3300005440 Ga0070705_100651516 Ga0070705_1006515161 174
1140 3300005445 Ga0070708_100002762 Ga0070708_1000027623 174
1141 3300005445 Ga0070708_100003709 Ga0070708_1000037092 174
1142 3300005445 Ga0070708_100018103 Ga0070708_1000181032 174
1143 3300005445 Ga0070708_100154230 Ga0070708_1001542302 174
1144 3300005445 Ga0070708_100161895 Ga0070708_1001618952 174
1145 3300005445 Ga0070708_100240708 Ga0070708_1002407081 174
1146 3300005445 Ga0070708_100301930 Ga0070708_1003019302 174
1147 3300005445 Ga0070708_100576751 Ga0070708_1005767511 174
1148 3300005445 Ga0070708_100579954 Ga0070708_1005799542 174
1149 3300005445 Ga0070708_100632382 Ga0070708_1006323822 174
1150 3300005455 Ga0070663_100008834 Ga0070663_1000088345 174
1151 3300005455 Ga0070663_100015403 Ga0070663_1000154032 174
1152 3300005456 Ga0070678_100789425 Ga0070678_1007894252 174
1153 3300005457 Ga0070662_100010482 Ga0070662_1000104823 174
1154 3300005457 Ga0070662_100084544 Ga0070662_1000845442 174
1155 3300005458 Ga0070681_10006970 Ga0070681_1000697011 174
1156 3300005458 Ga0070681_10150165 Ga0070681_101501652 174
1157 3300005458 Ga0070681_10258264 Ga0070681_102582642 174
1158 3300005458 Ga0070681_10306514 Ga0070681_103065142 174
1159 3300005458 Ga0070681_10340991 Ga0070681_103409911 174
1160 3300005458 Ga0070681_10456317 Ga0070681_104563171 174
1161 3300005459 Ga0068867_100001118 Ga0068867_10000111811 174
1162 3300005459 Ga0068867_100006293 Ga0068867_1000062932 174
1163 3300005466 Ga0070685_10004156 Ga0070685_100041562 174
1164 3300005466 Ga0070685_10042193 Ga0070685_100421932 174
1165 3300005467 Ga0070706_100000644 Ga0070706_10000064427 174
1166 3300005467 Ga0070706_100026447 Ga0070706_1000264472 174
1167 3300005468 Ga0070707_100003588 Ga0070707_1000035886 174
1168 3300005468 Ga0070707_100091156 Ga0070707_1000911562 174
1169 3300005468 Ga0070707_100201331 Ga0070707_1002013312 174
1170 3300005468 Ga0070707_100298482 Ga0070707_1002984822 174
1171 3300005468 Ga0070707_100421747 Ga0070707_1004217472 174
1172 3300005468 Ga0070707_100457091 Ga0070707_1004570912 174
1173 3300005471 Ga0070698_100000345 Ga0070698_1000003457 174
1174 3300005471 Ga0070698_100297825 Ga0070698_1002978252 174
1175 3300005518 Ga0070699_100168716 Ga0070699_1001687161 174
1176 3300005518 Ga0070699_100405753 Ga0070699_1004057532 174
1177 3300005518 Ga0070699_100982487 Ga0070699_1009824871 174
1178 3300005530 Ga0070679_100003763 Ga0070679_10000376312 174
1179 3300005530 Ga0070679_100053750 Ga0070679_1000537501 174
1180 3300005530 Ga0070679_100057247 Ga0070679_1000572472 174
1181 3300005530 Ga0070679_100242568 Ga0070679_1002425682 174
1182 3300005535 Ga0070684_100001860 Ga0070684_1000018609 174
1183 3300005535 Ga0070684_100094772 Ga0070684_1000947722 174
1184 3300005535 Ga0070684_100271516 Ga0070684_1002715162 174
1185 3300005536 Ga0070697_100000927 Ga0070697_1000009277 174
1186 3300005536 Ga0070697_100003305 Ga0070697_1000033057 174
1187 3300005536 Ga0070697_100013903 Ga0070697_1000139032 174
1188 3300005536 Ga0070697_100015972 Ga0070697_1000159723 174
1189 3300005536 Ga0070697_100076900 Ga0070697_1000769002 174
1190 3300005536 Ga0070697_100108191 Ga0070697_1001081912 174
1191 3300005536 Ga0070697_100568564 Ga0070697_1005685641 174
1192 3300005539 Ga0068853_100033502 Ga0068853_1000335022 174
1193 3300005539 Ga0068853_100091707 Ga0068853_1000917072 174
1194 3300005539 Ga0068853_100123884 Ga0068853_1001238842 174
1195 3300005543 Ga0070672_100043049 Ga0070672_1000430492 174
1196 3300005544 Ga0070686_100003814 Ga0070686_1000038146 174
1197 3300005544 Ga0070686_100313215 Ga0070686_1003132151 174
1198 3300005545 Ga0070695_100010137 Ga0070695_1000101374 174
1199 3300005545 Ga0070695_100064987 Ga0070695_1000649872 174
1200 3300005545 Ga0070695_100621149 Ga0070695_1006211491 174
1201 3300005546 Ga0070696_100141779 Ga0070696_1001417792 174
1202 3300005546 Ga0070696_100207245 Ga0070696_1002072452 174
1203 3300005546 Ga0070696_100305943 Ga0070696_1003059432 174
1204 3300005546 Ga0070696_100726675 Ga0070696_1007266751 174
1205 3300005546 Ga0070696_101074793 Ga0070696_1010747931 174
1206 3300005547 Ga0070693_100024396 Ga0070693_1000243963 174
1207 3300005547 Ga0070693_100078923 Ga0070693_1000789231 174
1208 3300005547 Ga0070693_100167788 Ga0070693_1001677881 174
1209 3300005547 Ga0070693_100296391 Ga0070693_1002963911 174
1210 3300005547 Ga0070693_100398810 Ga0070693_1003988102 174
1211 3300005547 Ga0070693_100622326 Ga0070693_1006223261 174
1212 3300005548 Ga0070665_100068270 Ga0070665_1000682701 174
1213 3300005548 Ga0070665_101257690 Ga0070665_1012576902 174
1214 3300005549 Ga0070704_100288182 Ga0070704_1002881822 174
1215 3300005563 Ga0068855_100018428 Ga0068855_1000184285 174
1216 3300005563 Ga0068855_100022413 Ga0068855_1000224137 174
1217 3300005563 Ga0068855_100123510 Ga0068855_1001235102 174
1218 3300005563 Ga0068855_100133568 Ga0068855_1001335682 174
1219 3300005563 Ga0068855_100889334 Ga0068855_1008893342 174
1220 3300005563 Ga0068855_101186004 Ga0068855_1011860042 174
1221 3300005564 Ga0070664_100025124 Ga0070664_1000251242 174
1222 3300005564 Ga0070664_100027778 Ga0070664_1000277783 174
1223 3300005577 Ga0068857_100003629 Ga0068857_1000036298 174
1224 3300005577 Ga0068857_100065148 Ga0068857_1000651483 174
1225 3300005578 Ga0068854_100004141 Ga0068854_1000041412 174
1226 3300005578 Ga0068854_100031226 Ga0068854_1000312262 174
1227 3300005578 Ga0068854_100111034 Ga0068854_1001110342 174
1228 3300005578 Ga0068854_100264231 Ga0068854_1002642311 174
1229 3300005614 Ga0068856_100007666 Ga0068856_1000076665 174
1230 3300005614 Ga0068856_100010385 Ga0068856_1000103852 174
1231 3300005614 Ga0068856_100012749 Ga0068856_1000127496 174
1232 3300005614 Ga0068856_100157011 Ga0068856_1001570111 174
1233 3300005614 Ga0068856_100308155 Ga0068856_1003081552 174
1234 3300005615 Ga0070702_100064086 Ga0070702_1000640862 174
1235 3300005616 Ga0068852_100000901 Ga0068852_1000009012 174
1236 3300005616 Ga0068852_100326593 Ga0068852_1003265931 174
1237 3300005616 Ga0068852_100651192 Ga0068852_1006511922 174
1238 3300005617 Ga0068859_100022867 Ga0068859_1000228674 174
1239 3300005617 Ga0068859_100115692 Ga0068859_1001156922 174
1240 3300005617 Ga0068859_100119181 Ga0068859_1001191813 174
1241 3300005617 Ga0068859_100555714 Ga0068859_1005557142 174
1242 3300005618 Ga0068864_100104835 Ga0068864_1001048352 174
1243 3300005718 Ga0068866_10005774 Ga0068866_100057742 174
1244 3300005718 Ga0068866_10192552 Ga0068866_101925522 174
1245 3300005719 Ga0068861_100082223 Ga0068861_1000822232 174
1246 3300005719 Ga0068861_100166005 Ga0068861_1001660052 174
1247 3300005719 Ga0068861_100246939 Ga0068861_1002469392 174
1248 3300005834 Ga0068851_10001293 Ga0068851_100012939 174
1249 3300005834 Ga0068851_10168697 Ga0068851_101686972 174
1250 3300005840 Ga0068870_10001527 Ga0068870_100015278 174
1251 3300005840 Ga0068870_10117731 Ga0068870_101177312 174
1252 3300005841 Ga0068863_100130082 Ga0068863_1001300822 174
1253 3300005841 Ga0068863_100150540 Ga0068863_1001505402 174
1254 3300005842 Ga0068858_100010129 Ga0068858_1000101292 174
1255 3300005842 Ga0068858_100034480 Ga0068858_1000344802 174
1256 3300005842 Ga0068858_100409547 Ga0068858_1004095472 174
1257 3300005842 Ga0068858_100503165 Ga0068858_1005031651 174
1258 3300005842 Ga0068858_101206951 Ga0068858_1012069512 174
1259 3300005843 Ga0068860_100015576 Ga0068860_1000155761 174
1260 3300005843 Ga0068860_100078197 Ga0068860_1000781971 174
1261 3300005843 Ga0068860_100150734 Ga0068860_1001507342 174
1262 3300005843 Ga0068860_100457612 Ga0068860_1004576122 174
1263 3300005844 Ga0068862_100003799 Ga0068862_1000037999 174
1264 3300005844 Ga0068862_100032388 Ga0068862_1000323883 174
1265 3300006028 Ga0070717_10000912 Ga0070717_1000091214 174
1266 3300006028 Ga0070717_10032961 Ga0070717_100329613 174
1267 3300006028 Ga0070717_10239165 Ga0070717_102391652 174
1268 3300006028 Ga0070717_10258689 Ga0070717_102586892 174
1269 3300006028 Ga0070717_10437517 Ga0070717_104375172 174
1270 3300006163 Ga0070715_10371778 Ga0070715_103717781 174
1271 3300006173 Ga0070716_100017733 Ga0070716_1000177332 174
1272 3300006173 Ga0070716_100075275 Ga0070716_1000752751 174
1273 3300006173 Ga0070716_100432979 Ga0070716_1004329792 174
1274 3300006175 Ga0070712_100000979 Ga0070712_10000097913 174
1275 3300006237 Ga0097621_100003995 Ga0097621_1000039959 174
1276 3300006237 Ga0097621_100022764 Ga0097621_1000227645 174
1277 3300006237 Ga0097621_100091661 Ga0097621_1000916612 174
1278 3300006237 Ga0097621_100562913 Ga0097621_1005629132 174
1279 3300006237 Ga0097621_100627356 Ga0097621_1006273562 174
1280 3300006237 Ga0097621_101422884 Ga0097621_1014228841 174
1281 3300006358 Ga0068871_100001288 Ga0068871_1000012885 174
1282 3300006358 Ga0068871_100016161 Ga0068871_1000161614 174
1283 3300006358 Ga0068871_100229886 Ga0068871_1002298862 174
1284 3300006358 Ga0068871_100356860 Ga0068871_1003568602 174
1285 3300006358 Ga0068871_100376877 Ga0068871_1003768772 174
1286 3300006358 Ga0068871_100380687 Ga0068871_1003806872 174
1287 3300006358 Ga0068871_100814285 Ga0068871_1008142852 174
1288 3300006358 Ga0068871_100997286 Ga0068871_1009972861 174
1289 3300006852 Ga0075433_10002016 Ga0075433_1000201610 174
1290 3300006871 Ga0075434_100010769 Ga0075434_1000107694 174
1291 3300006871 Ga0075434_100281353 Ga0075434_1002813532 174
1292 3300006871 Ga0075434_100402876 Ga0075434_1004028761 174
1293 3300006881 Ga0068865_100009700 Ga0068865_1000097002 174
1294 3300006881 Ga0068865_100014699 Ga0068865_1000146992 174
1295 3300006914 Ga0075436_100031006 Ga0075436_1000310062 174
1296 3300006914 Ga0075436_100045752 Ga0075436_1000457522 174
1297 3300006914 Ga0075436_100747853 Ga0075436_1007478531 174
1298 3300006931 Ga0097620_100022868 Ga0097620_1000228683 174
1299 3300006931 Ga0097620_100115698 Ga0097620_1001156982 174
1300 3300006931 Ga0097620_100119182 Ga0097620_1001191823 174
1301 3300006931 Ga0097620_100555676 Ga0097620_1005556761 174
1302 3300007076 Ga0075435_100000025 Ga0075435_10000002579 174
1303 3300007076 Ga0075435_100391065 Ga0075435_1003910652 174
1304 3300007265 Ga0099794_10019429 Ga0099794_100194293 174
1305 3300007788 Ga0099795_10151583 Ga0099795_101515831 174
1306 3300009011 Ga0105251_10214756 Ga0105251_102147562 174
1307 3300009093 Ga0105240_10120632 Ga0105240_101206322 174
1308 3300009093 Ga0105240_10432752 Ga0105240_104327522 174
1309 3300009093 Ga0105240_10625556 Ga0105240_106255562 174
1310 3300009093 Ga0105240_10808246 Ga0105240_108082461 174
1311 3300009093 Ga0105240_10966193 Ga0105240_109661932 174
1312 3300009093 Ga0105240_12013736 Ga0105240_120137361 174
1313 3300009098 Ga0105245_10003953 Ga0105245_100039536 174
1314 3300009098 Ga0105245_10006423 Ga0105245_100064239 174
1315 3300009098 Ga0105245_10011327 Ga0105245_100113272 174
1316 3300009098 Ga0105245_10020569 Ga0105245_100205693 174
1317 3300009098 Ga0105245_10046318 Ga0105245_100463185 174
1318 3300009098 Ga0105245_10369533 Ga0105245_103695332 174
1319 3300009098 Ga0105245_10676734 Ga0105245_106767342 174
1320 3300009101 Ga0105247_10002094 Ga0105247_100020949 174
1321 3300009101 Ga0105247_10026603 Ga0105247_100266032 174
1322 3300009101 Ga0105247_10035392 Ga0105247_100353923 174
1323 3300009101 Ga0105247_10079904 Ga0105247_100799042 174
1324 3300009101 Ga0105247_10235547 Ga0105247_102355472 174
1325 3300009147 Ga0114129_10243982 Ga0114129_102439822 174
1326 3300009148 Ga0105243_10100490 Ga0105243_101004902 174
1327 3300009148 Ga0105243_10216604 Ga0105243_102166042 174
1328 3300009174 Ga0105241_10017538 Ga0105241_100175384 174
1329 3300009174 Ga0105241_10024484 Ga0105241_100244844 174
1330 3300009174 Ga0105241_10038843 Ga0105241_100388432 174
1331 3300009174 Ga0105241_10122154 Ga0105241_101221542 174
1332 3300009174 Ga0105241_10143892 Ga0105241_101438921 174
1333 3300009176 Ga0105242_10017421 Ga0105242_100174215 174
1334 3300009176 Ga0105242_10019694 Ga0105242_100196944 174
1335 3300009176 Ga0105242_10065111 Ga0105242_100651112 174
1336 3300009177 Ga0105248_10008359 Ga0105248_100083599 174
1337 3300009177 Ga0105248_10107113 Ga0105248_101071133 174
1338 3300009177 Ga0105248_10170669 Ga0105248_101706692 174
1339 3300009177 Ga0105248_10263330 Ga0105248_102633302 174
1340 3300009177 Ga0105248_10427190 Ga0105248_104271901 174
1341 3300009177 Ga0105248_10855629 Ga0105248_108556292 174
1342 3300009545 Ga0105237_10023293 Ga0105237_100232933 174
1343 3300009545 Ga0105237_10286532 Ga0105237_102865322 174
1344 3300009545 Ga0105237_10371453 Ga0105237_103714532 174
1345 3300009545 Ga0105237_10862768 Ga0105237_108627682 174
1346 3300009551 Ga0105238_10025506 Ga0105238_100255065 174
1347 3300009551 Ga0105238_10180433 Ga0105238_101804332 174
1348 3300009551 Ga0105238_10329964 Ga0105238_103299641 174
1349 3300009551 Ga0105238_10351322 Ga0105238_103513222 174
1350 3300009553 Ga0105249_10009154 Ga0105249_100091546 174
1351 3300009553 Ga0105249_10015097 Ga0105249_100150975 174
1352 3300010159 Ga0099796_10021595 Ga0099796_100215952 174
1353 3300010375 Ga0105239_10004244 Ga0105239_100042444 174
1354 3300010375 Ga0105239_10260669 Ga0105239_102606692 174
1355 3300010375 Ga0105239_10527058 Ga0105239_105270582 174
1356 3300011119 Ga0105246_10006082 Ga0105246_100060827 174
1357 3300011119 Ga0105246_10215110 Ga0105246_102151101 174
1358 3300011119 Ga0105246_10266143 Ga0105246_102661431 174
1359 3300013100 Ga0157373_10008605 Ga0157373_100086052 174
1360 3300013100 Ga0157373_10054918 Ga0157373_100549182 174
1361 3300013102 Ga0157371_10003594 Ga0157371_100035948 174
1362 3300013102 Ga0157371_10007472 Ga0157371_100074724 174
1363 3300013104 Ga0157370_10022504 Ga0157370_100225043 174
1364 3300013104 Ga0157370_10142618 Ga0157370_101426182 174
1365 3300013104 Ga0157370_10449490 Ga0157370_104494902 174
1366 3300013105 Ga0157369_10008874 Ga0157369_100088749 174
1367 3300013105 Ga0157369_10394244 Ga0157369_103942441 174
1368 3300013105 Ga0157369_10585664 Ga0157369_105856642 174
1369 3300013296 Ga0157374_10051213 Ga0157374_100512132 174
1370 3300013296 Ga0157374_10080656 Ga0157374_100806562 174
1371 3300013296 Ga0157374_10101030 Ga0157374_101010302 174
1372 3300013296 Ga0157374_10108999 Ga0157374_101089992 174
1373 3300013296 Ga0157374_10259486 Ga0157374_102594862 174
1374 3300013296 Ga0157374_10281762 Ga0157374_102817622 174
1375 3300013296 Ga0157374_10500917 Ga0157374_105009171 174
1376 3300013297 Ga0157378_10000203 Ga0157378_1000020310 174
1377 3300013297 Ga0157378_10018251 Ga0157378_100182513 174
1378 3300013297 Ga0157378_10034794 Ga0157378_100347945 174
1379 3300013297 Ga0157378_10042358 Ga0157378_100423583 174
1380 3300013297 Ga0157378_10422306 Ga0157378_104223062 174
1381 3300013306 Ga0163162_10001530 Ga0163162_100015304 174
1382 3300013306 Ga0163162_10007539 Ga0163162_100075393 174
1383 3300013306 Ga0163162_10075718 Ga0163162_100757182 174
1384 3300013306 Ga0163162_10406688 Ga0163162_104066882 174
1385 3300013306 Ga0163162_10896649 Ga0163162_108966491 174
1386 3300013307 Ga0157372_10009715 Ga0157372_100097152 174
1387 3300013307 Ga0157372_10550512 Ga0157372_105505122 174
1388 3300013307 Ga0157372_10652357 Ga0157372_106523571 174
1389 3300013307 Ga0157372_11092229 Ga0157372_110922291 174
1390 3300013308 Ga0157375_10080999 Ga0157375_100809992 174
1391 3300013308 Ga0157375_10122075 Ga0157375_101220753 174
1392 3300013308 Ga0157375_10266886 Ga0157375_102668862 174
1393 3300013308 Ga0157375_10322840 Ga0157375_103228402 174
1394 3300014325 Ga0163163_10001263 Ga0163163_1000126320 174
1395 3300014325 Ga0163163_10091822 Ga0163163_100918222 174
1396 3300014326 Ga0157380_10016601 Ga0157380_100166014 174
1397 3300014326 Ga0157380_10344802 Ga0157380_103448021 174
1398 3300014497 Ga0182008_10258326 Ga0182008_102583262 174
1399 3300014745 Ga0157377_10000395 Ga0157377_100003959 174
1400 3300014968 Ga0157379_10049801 Ga0157379_100498012 174
1401 3300014968 Ga0157379_10147959 Ga0157379_101479592 174
1402 3300014968 Ga0157379_10411730 Ga0157379_104117302 174
1403 3300014968 Ga0157379_10773400 Ga0157379_107734002 174
1404 3300014969 Ga0157376_10041699 Ga0157376_100416993 174
1405 3300014969 Ga0157376_10134559 Ga0157376_101345593 174
1406 3300014969 Ga0157376_10255663 Ga0157376_102556632 174
1407 3300014969 Ga0157376_11256503 Ga0157376_112565032 174
1408 3300015265 Ga0182005_1073494 Ga0182005_10734941 174
1409 3300017792 Ga0163161_10010982 Ga0163161_100109822 174
1410 3300020070 Ga0206356_10001441 Ga0206356_100014411 174
1411 3300020070 Ga0206356_10679129 Ga0206356_106791291 174
1412 3300020076 Ga0206355_1591506 Ga0206355_15915061 174
1413 3300020081 Ga0206354_10296184 Ga0206354_102961841 174
1414 3300020610 Ga0154015_1331403 Ga0154015_13314031 174
1415 3300021358 Ga0213873_10031710 Ga0213873_100317102 174
1416 3300022467 Ga0224712_10118900 Ga0224712_101189002 174
1417 3300024227 Ga0228598_1029955 Ga0228598_10299552 174
1418 3300025315 Ga0207697_10000518 Ga0207697_1000051812 174
1419 3300025321 Ga0207656_10008283 Ga0207656_100082833 174
1420 3300025321 Ga0207656_10015548 Ga0207656_100155482 174
1421 3300025893 Ga0207682_10047427 Ga0207682_100474271 174
1422 3300025898 Ga0207692_10089903 Ga0207692_100899032 174
1423 3300025898 Ga0207692_10242650 Ga0207692_102426501 174
1424 3300025898 Ga0207692_10259860 Ga0207692_102598601 174
1425 3300025899 Ga0207642_10029513 Ga0207642_100295133 174
1426 3300025899 Ga0207642_10133864 Ga0207642_101338642 174
1427 3300025899 Ga0207642_10159154 Ga0207642_101591542 174
1428 3300025901 Ga0207688_10007908 Ga0207688_100079086 174
1429 3300025903 Ga0207680_10001286 Ga0207680_100012866 174
1430 3300025903 Ga0207680_10186447 Ga0207680_101864472 174
1431 3300025903 Ga0207680_10483885 Ga0207680_104838851 174
1432 3300025904 Ga0207647_10004047 Ga0207647_100040475 174
1433 3300025904 Ga0207647_10007521 Ga0207647_100075213 174
1434 3300025904 Ga0207647_10070647 Ga0207647_100706471 174
1435 3300025905 Ga0207685_10008335 Ga0207685_100083352 174
1436 3300025906 Ga0207699_10127702 Ga0207699_101277022 174
1437 3300025906 Ga0207699_10174785 Ga0207699_101747852 174
1438 3300025906 Ga0207699_10989310 Ga0207699_109893101 174
1439 3300025907 Ga0207645_10000351 Ga0207645_1000035121 174
1440 3300025907 Ga0207645_10002958 Ga0207645_100029588 174
1441 3300025908 Ga0207643_10001192 Ga0207643_1000119211 174
1442 3300025910 Ga0207684_10006350 Ga0207684_100063508 174
1443 3300025910 Ga0207684_10028989 Ga0207684_100289892 174
1444 3300025911 Ga0207654_10035734 Ga0207654_100357342 174
1445 3300025911 Ga0207654_10039066 Ga0207654_100390662 174
1446 3300025911 Ga0207654_10083465 Ga0207654_100834652 174
1447 3300025911 Ga0207654_10103670 Ga0207654_101036702 174
1448 3300025911 Ga0207654_10137514 Ga0207654_101375142 174
1449 3300025912 Ga0207707_10119238 Ga0207707_101192382 174
1450 3300025912 Ga0207707_10353334 Ga0207707_103533342 174
1451 3300025912 Ga0207707_10729047 Ga0207707_107290472 174
1452 3300025913 Ga0207695_10014655 Ga0207695_100146552 174
1453 3300025913 Ga0207695_10225722 Ga0207695_102257222 174
1454 3300025913 Ga0207695_10760367 Ga0207695_107603672 174
1455 3300025914 Ga0207671_10262137 Ga0207671_102621371 174
1456 3300025914 Ga0207671_10328486 Ga0207671_103284862 174
1457 3300025914 Ga0207671_10417490 Ga0207671_104174902 174
1458 3300025915 Ga0207693_10001900 Ga0207693_1000190012 174
1459 3300025916 Ga0207663_10001610 Ga0207663_100016102 174
1460 3300025916 Ga0207663_10022833 Ga0207663_100228333 174
1461 3300025916 Ga0207663_10375983 Ga0207663_103759832 174
1462 3300025917 Ga0207660_10003693 Ga0207660_100036932 174
1463 3300025917 Ga0207660_10034629 Ga0207660_100346292 174
1464 3300025917 Ga0207660_10069652 Ga0207660_100696522 174
1465 3300025918 Ga0207662_10098460 Ga0207662_100984601 174
1466 3300025919 Ga0207657_10001481 Ga0207657_1000148113 174
1467 3300025919 Ga0207657_10004756 Ga0207657_1000475613 174
1468 3300025920 Ga0207649_10000928 Ga0207649_1000092811 174
1469 3300025921 Ga0207652_10027799 Ga0207652_100277992 174
1470 3300025921 Ga0207652_10032565 Ga0207652_100325652 174
1471 3300025921 Ga0207652_10068406 Ga0207652_100684062 174
1472 3300025921 Ga0207652_10273299 Ga0207652_102732992 174
1473 3300025922 Ga0207646_10000438 Ga0207646_1000043839 174
1474 3300025922 Ga0207646_10114337 Ga0207646_101143371 174
1475 3300025922 Ga0207646_10376221 Ga0207646_103762212 174
1476 3300025922 Ga0207646_10422278 Ga0207646_104222782 174
1477 3300025922 Ga0207646_10703509 Ga0207646_107035091 174
1478 3300025923 Ga0207681_10006380 Ga0207681_100063804 174
1479 3300025923 Ga0207681_10358309 Ga0207681_103583091 174
1480 3300025924 Ga0207694_10088736 Ga0207694_100887362 174
1481 3300025924 Ga0207694_10449021 Ga0207694_104490212 174
1482 3300025924 Ga0207694_10500357 Ga0207694_105003571 174
1483 3300025924 Ga0207694_10694407 Ga0207694_106944071 174
1484 3300025925 Ga0207650_10000059 Ga0207650_1000005998 174
1485 3300025925 Ga0207650_10363936 Ga0207650_103639362 174
1486 3300025926 Ga0207659_10007240 Ga0207659_100072404 174
1487 3300025927 Ga0207687_10011223 Ga0207687_100112235 174
1488 3300025927 Ga0207687_10013840 Ga0207687_100138405 174
1489 3300025927 Ga0207687_10017470 Ga0207687_100174704 174
1490 3300025927 Ga0207687_10286932 Ga0207687_102869321 174
1491 3300025927 Ga0207687_10863114 Ga0207687_108631142 174
1492 3300025927 Ga0207687_10934192 Ga0207687_109341922 174
1493 3300025928 Ga0207700_10001497 Ga0207700_100014976 174
1494 3300025928 Ga0207700_10176797 Ga0207700_101767972 174
1495 3300025928 Ga0207700_10594840 Ga0207700_105948402 174
1496 3300025928 Ga0207700_10640883 Ga0207700_106408831 174
1497 3300025928 Ga0207700_10782180 Ga0207700_107821802 174
1498 3300025931 Ga0207644_10002945 Ga0207644_100029453 174
1499 3300025931 Ga0207644_10774623 Ga0207644_107746232 174
1500 3300025933 Ga0207706_10002202 Ga0207706_100022026 174
1501 3300025933 Ga0207706_10004234 Ga0207706_100042345 174
1502 3300025934 Ga0207686_10074262 Ga0207686_100742622 174
1503 3300025934 Ga0207686_10126552 Ga0207686_101265522 174
1504 3300025934 Ga0207686_10252524 Ga0207686_102525241 174
1505 3300025935 Ga0207709_10063794 Ga0207709_100637942 174
1506 3300025935 Ga0207709_10163686 Ga0207709_101636863 174
1507 3300025936 Ga0207670_10036038 Ga0207670_100360382 174
1508 3300025936 Ga0207670_10115771 Ga0207670_101157712 174
1509 3300025937 Ga0207669_10393958 Ga0207669_103939581 174
1510 3300025938 Ga0207704_10003936 Ga0207704_100039362 174
1511 3300025938 Ga0207704_10374175 Ga0207704_103741751 174
1512 3300025938 Ga0207704_10412398 Ga0207704_104123981 174
1513 3300025939 Ga0207665_10027606 Ga0207665_100276062 174
1514 3300025939 Ga0207665_10051025 Ga0207665_100510251 174
1515 3300025939 Ga0207665_10095611 Ga0207665_100956113 174
1516 3300025939 Ga0207665_10170751 Ga0207665_101707512 174
1517 3300025939 Ga0207665_10264241 Ga0207665_102642411 174
1518 3300025940 Ga0207691_10002255 Ga0207691_100022552 174
1519 3300025941 Ga0207711_10003247 Ga0207711_100032476 174
1520 3300025941 Ga0207711_10003820 Ga0207711_100038205 174
1521 3300025941 Ga0207711_10006897 Ga0207711_100068979 174
1522 3300025941 Ga0207711_10623751 Ga0207711_106237511 174
1523 3300025942 Ga0207689_10000231 Ga0207689_100002312 174
1524 3300025942 Ga0207689_10003650 Ga0207689_100036509 174
1525 3300025942 Ga0207689_10078972 Ga0207689_100789722 174
1526 3300025942 Ga0207689_10948871 Ga0207689_109488711 174
1527 3300025944 Ga0207661_10000352 Ga0207661_100003527 174
1528 3300025944 Ga0207661_10001688 Ga0207661_100016884 174
1529 3300025944 Ga0207661_10730110 Ga0207661_107301102 174
1530 3300025945 Ga0207679_10000039 Ga0207679_1000003941 174
1531 3300025945 Ga0207679_10062887 Ga0207679_100628873 174
1532 3300025949 Ga0207667_10034306 Ga0207667_100343062 174
1533 3300025949 Ga0207667_10126288 Ga0207667_101262882 174
1534 3300025949 Ga0207667_10991043 Ga0207667_109910432 174
1535 3300025949 Ga0207667_11061489 Ga0207667_110614892 174
1536 3300025960 Ga0207651_10004287 Ga0207651_100042872 174
1537 3300025961 Ga0207712_10036684 Ga0207712_100366842 174
1538 3300025972 Ga0207668_10049335 Ga0207668_100493352 174
1539 3300025981 Ga0207640_10036219 Ga0207640_100362192 174
1540 3300025981 Ga0207640_10059086 Ga0207640_100590862 174
1541 3300025981 Ga0207640_10113990 Ga0207640_101139902 174
1542 3300025981 Ga0207640_10148247 Ga0207640_101482472 174
1543 3300025986 Ga0207658_10003811 Ga0207658_100038114 174
1544 3300025986 Ga0207658_10018733 Ga0207658_100187332 174
1545 3300025986 Ga0207658_11431883 Ga0207658_114318831 174
1546 3300026023 Ga0207677_10008019 Ga0207677_100080195 174
1547 3300026023 Ga0207677_10030886 Ga0207677_100308862 174
1548 3300026023 Ga0207677_10101150 Ga0207677_101011502 174
1549 3300026023 Ga0207677_10157151 Ga0207677_101571512 174
1550 3300026023 Ga0207677_10263765 Ga0207677_102637651 174
1551 3300026023 Ga0207677_10456550 Ga0207677_104565502 174
1552 3300026035 Ga0207703_10003512 Ga0207703_100035125 174
1553 3300026035 Ga0207703_10006788 Ga0207703_100067887 174
1554 3300026035 Ga0207703_10365902 Ga0207703_103659022 174
1555 3300026035 Ga0207703_10489979 Ga0207703_104899791 174
1556 3300026041 Ga0207639_10011693 Ga0207639_100116935 174
1557 3300026041 Ga0207639_10088666 Ga0207639_100886663 174
1558 3300026067 Ga0207678_10001919 Ga0207678_1000191911 174
1559 3300026067 Ga0207678_10003647 Ga0207678_100036476 174
1560 3300026078 Ga0207702_10010311 Ga0207702_100103113 174
1561 3300026078 Ga0207702_10073966 Ga0207702_100739662 174
1562 3300026078 Ga0207702_10174606 Ga0207702_101746062 174
1563 3300026078 Ga0207702_10456564 Ga0207702_104565641 174
1564 3300026078 Ga0207702_10624825 Ga0207702_106248251 174
1565 3300026088 Ga0207641_10000025 Ga0207641_10000025100 174
1566 3300026088 Ga0207641_10037037 Ga0207641_100370373 174
1567 3300026088 Ga0207641_10071045 Ga0207641_100710453 174
1568 3300026088 Ga0207641_10110708 Ga0207641_101107082 174
1569 3300026089 Ga0207648_10000420 Ga0207648_1000042023 174
1570 3300026089 Ga0207648_10019763 Ga0207648_100197634 174
1571 3300026089 Ga0207648_10096315 Ga0207648_100963152 174
1572 3300026095 Ga0207676_10000104 Ga0207676_100001048 174
1573 3300026095 Ga0207676_10098824 Ga0207676_100988242 174
1574 3300026116 Ga0207674_10000604 Ga0207674_1000060410 174
1575 3300026116 Ga0207674_10003553 Ga0207674_1000355313 174
1576 3300026116 Ga0207674_10081701 Ga0207674_100817012 174
1577 3300026116 Ga0207674_10250624 Ga0207674_102506242 174
1578 3300026116 Ga0207674_11059391 Ga0207674_110593912 174
1579 3300026118 Ga0207675_100080496 Ga0207675_1000804962 174
1580 3300026118 Ga0207675_100099450 Ga0207675_1000994503 174
1581 3300026118 Ga0207675_100189550 Ga0207675_1001895502 174
1582 3300026121 Ga0207683_10000726 Ga0207683_100007268 174
1583 3300026142 Ga0207698_10066545 Ga0207698_100665451 174
1584 3300026142 Ga0207698_10172118 Ga0207698_101721182 174
1585 3300028379 Ga0268266_10004403 Ga0268266_100044035 174
1586 3300028379 Ga0268266_10041977 Ga0268266_100419773 174
1587 3300028380 Ga0268265_10020364 Ga0268265_100203642 174
1588 3300028381 Ga0268264_10022623 Ga0268264_100226234 174
1589 3300028381 Ga0268264_10432780 Ga0268264_104327802 174
1590 3300028381 Ga0268264_10642697 Ga0268264_106426971 174
1591 3300028381 Ga0268264_10732282 Ga0268264_107322821 174
1592 3300028800 Ga0265338_10176457 Ga0265338_101764572 174
1593 3300028800 Ga0265338_10181701 Ga0265338_101817012 174
1594 3300031249 Ga0265339_10059325 Ga0265339_100593252 174
1595 3300031250 Ga0265331_10203104 Ga0265331_102031042 174
1596 3300031344 Ga0265316_10004115 Ga0265316_100041159 174
1597 3300031711 Ga0265314_10000198 Ga0265314_1000019846 174
1598 3300031711 Ga0265314_10084831 Ga0265314_100848312 174
1599 3300035083 Ga0373926_0006837 Ga0373926_0006837_1082_1636 174
1600 3300035088 Ga0373940_0047643 Ga0373940_0047643_517_1062 174
1601 3300035112 Ga0373932_0022647 Ga0373932_0022647_767_1312 174
1602 3300035113 Ga0373936_0019252 Ga0373936_0019252_1997_2551 174
1603 3300035114 Ga0373939_0020664 Ga0373939_0020664_276_821 174
1604 3300035115 Ga0373941_0217303 Ga0373941_0217303_34_579 174
1605 3300035116 Ga0373945_0004252 Ga0373945_0004252_3683_4237 174
1606 3300035118 Ga0373954_0246503 Ga0373954_0246503_63_617 174
1607 3300035120 Ga0373957_0005470 Ga0373957_0005470_2413_2967 174
1608 3300035170 Ga0373943_0275191 Ga0373943_0275191_175_729 174
1609 3300035171 Ga0373946_0008084 Ga0373946_0008084_1675_2229 174
1610 3300035171 Ga0373946_0173279 Ga0373946_0173279_377_922 174
1611 3300035172 Ga0373955_0000551 Ga0373955_0000551_4708_5262 174
1612 3300035207 Ga0373942_0092768 Ga0373942_0092768_143_688 174
1613 3300035410 Ga0373924_0000008 Ga0373924_0000008_41527_42081 174
1614 3300035691 Ga0373931_0020792 Ga0373931_0020792_71_616 174
1615 3300035691 Ga0373931_0072542 Ga0373931_0072542_17_562 174
1616 3300035691 Ga0373931_0275927 Ga0373931_0275927_58_603 174
1617 3300035692 Ga0373935_0017413 Ga0373935_0017413_796_1350 174
1618 3300035692 Ga0373935_0314129 Ga0373935_0314129_26_580 174
1619 3300035692 Ga0373935_0820505 Ga0373935_0820505_56_601 174
1620 3300035695 Ga0373927_0010002 Ga0373927_0010002_5279_5833 174
1621 3300035695 Ga0373927_0038549 Ga0373927_0038549_1840_2394 174
1622 3300035724 Ga0373933_0343492 Ga0373933_0343492_130_678 174
1623 3300035724 Ga0373933_0385597 Ga0373933_0385597_160_705 174
1624 3300035725 Ga0373947_0002990 Ga0373947_0002990_2176_2730 174
1625 3300035725 Ga0373947_0197742 Ga0373947_0197742_658_1212 174
1626 3300036401 Ga0373937_0001557 Ga0373937_0001557_6346_6900 174
1627 3300036401 Ga0373937_0042785 Ga0373937_0042785_2743_3297 174
1628 3300036401 Ga0373937_0094383 Ga0373937_0094383_1123_1677 174
1629 3300036401 Ga0373937_0152521 Ga0373937_0152521_593_1141 174
1630 3300037068 Ga0373925_0002316 Ga0373925_0002316_11898_12452 174
1631 3300037068 Ga0373925_0084762 Ga0373925_0084762_1664_2209 174
1632 3300037068 Ga0373925_1298761 Ga0373925_1298761_18_563 174
1633 3300037466 Ga0395898_0204508 Ga0395898_0204508_451_1005 174
1634 3300037466 Ga0395898_0583094 Ga0395898_0583094_243_797 174
1635 3300038443 Ga0395901_0707038 Ga0395901_0707038_220_774 174
1636 3300039453 Ga0436362_0209279 Ga0436362_0209279_998_1546 174
1637 3300042876 Ga0451577_0003187 Ga0451577_0003187_12777_13331 174
1638 3300044673 Ga0453683_0024608 Ga0453683_0024608_3065_3616 174
1639 3300044693 Ga0466961_0191167 Ga0466961_0191167_258_821 174
1640 3300044694 Ga0466963_0002972 Ga0466963_0002972_2065_2619 174
1641 3300044694 Ga0466963_0093332 Ga0466963_0093332_861_1415 174
1642 3300044712 Ga0453684_0000289 Ga0453684_0000289_9517_10071 174
1643 3300045049 Ga0466959_0031915 Ga0466959_0031915_2015_2566 174
1644 3300045051 Ga0451576_0009204 Ga0451576_0009204_3481_4035 174
1645 3300045051 Ga0451576_0276661 Ga0451576_0276661_121_669 174
1646 3300045836 Ga0466958_0069080 Ga0466958_0069080_1485_2039 174
1647 3300045976 Ga0466967_0025416 Ga0466967_0025416_3821_4366 174
1648 3300045976 Ga0466967_0085038 Ga0466967_0085038_1321_1875 174
1649 3300046462 Ga0495651_0138209 Ga0495651_0138209_852_1469 174
1650 3300046462 Ga0495651_0402484 Ga0495651_0402484_62_616 174
1651 3300046472 Ga0495580_0005542 Ga0495580_0005542_8828_9373 174
1652 3300046472 Ga0495580_0028292 Ga0495580_0028292_1407_1952 174
1653 3300046472 Ga0495580_0058402 Ga0495580_0058402_1948_2502 174
1654 3300046472 Ga0495580_0373021 Ga0495580_0373021_336_881 174
1655 3300046475 Ga0495639_0102090 Ga0495639_0102090_70_624 174
1656 3300046476 Ga0495662_0113307 Ga0495662_0113307_601_1182 174
1657 3300046516 Ga0495628_0073403 Ga0495628_0073403_68_622 174
1658 3300046516 Ga0495628_0222875 Ga0495628_0222875_21_566 174
1659 3300046531 Ga0495665_0122690 Ga0495665_0122690_425_979 174
1660 3300046543 Ga0495645_0164261 Ga0495645_0164261_887_1441 174
1661 3300046559 Ga0495667_0297279 Ga0495667_0297279_289_843 174
1662 3300046663 Ga0495635_0050678 Ga0495635_0050678_920_1474 174
1663 3300046683 Ga0495658_0148109 Ga0495658_0148109_459_1013 174
1664 3300046683 Ga0495658_0715268 Ga0495658_0715268_73_627 174
1665 3300046684 Ga0495669_0012756 Ga0495669_0012756_983_1531 174
1666 3300047315 Ga0495581_0053750 Ga0495581_0053750_1624_2178 174
1667 3300047319 Ga0495674_0231538 Ga0495674_0231538_231_785 174
1668 3300047322 Ga0495680_0105558 Ga0495680_0105558_47_601 174
1669 3300047444 Ga0495675_0543453 Ga0495675_0543453_13_567 174
1670 3300048088 Ga0495602_0499360 Ga0495602_0499360_28_573 174
1671 3300048088 Ga0495602_0536088 Ga0495602_0536088_151_696 174
1672 3300048088 Ga0495602_0739539 Ga0495602_0739539_93_647 174
1673 3300048089 Ga0495614_0198950 Ga0495614_0198950_46_600 174
1674 3300048903 Ga0496100_0165865 Ga0496100_0165865_1032_1577 174
1675 3300048903 Ga0496100_0172610 Ga0496100_0172610_539_1084 174
1676 3300048903 Ga0496100_0469835 Ga0496100_0469835_374_928 174
1677 3300048904 Ga0496101_0062982 Ga0496101_0062982_1777_2322 174
1678 3300048904 Ga0496101_0079088 Ga0496101_0079088_910_1455 174
1679 3300048904 Ga0496101_0084067 Ga0496101_0084067_1660_2205 174
1680 3300048904 Ga0496101_0087991 Ga0496101_0087991_1460_2008 174
1681 3300048905 Ga0496102_0020890 Ga0496102_0020890_4708_5262 174
1682 3300048905 Ga0496102_0044459 Ga0496102_0044459_1652_2269 174
1683 3300048905 Ga0496102_0154164 Ga0496102_0154164_1437_1982 174
1684 3300048905 Ga0496102_0199049 Ga0496102_0199049_1249_1797 174
1685 3300048905 Ga0496102_0586093 Ga0496102_0586093_470_1024 174
1686 3300048905 Ga0496102_0777368 Ga0496102_0777368_29_577 174
1687 3300048906 Ga0496103_0035163 Ga0496103_0035163_160_714 174
1688 3300048906 Ga0496103_0037172 Ga0496103_0037172_1201_1746 174
1689 3300048906 Ga0496103_0378352 Ga0496103_0378352_181_798 174
1690 3300048907 Ga0496104_0081184 Ga0496104_0081184_46_600 174
1691 3300048907 Ga0496104_0092780 Ga0496104_0092780_1980_2525 174
1692 3300048907 Ga0496104_0098153 Ga0496104_0098153_1108_1662 174
1693 3300048907 Ga0496104_0258536 Ga0496104_0258536_560_1114 174
1694 3300048907 Ga0496104_0277247 Ga0496104_0277247_85_630 174
1695 3300048907 Ga0496104_0434156 Ga0496104_0434156_291_839 174
1696 3300048908 Ga0496105_0003388 Ga0496105_0003388_6278_6832 174
1697 3300048908 Ga0496105_0258319 Ga0496105_0258319_239_784 174
1698 3300048908 Ga0496105_0930822 Ga0496105_0930822_71_616 174
1699 3300048909 Ga0496106_0260681 Ga0496106_0260681_187_732 174
1700 3300048910 Ga0496107_0032731 Ga0496107_0032731_664_1209 174
1701 3300048910 Ga0496107_0036181 Ga0496107_0036181_145_693 174
1702 3300048911 Ga0496108_0000539 Ga0496108_0000539_19127_19675 174
1703 3300048911 Ga0496108_0587144 Ga0496108_0587144_339_884 174
1704 3300048912 Ga0496109_0000099 Ga0496109_0000099_68513_69061 174
1705 3300048912 Ga0496109_0224959 Ga0496109_0224959_252_797 174
1706 3300048912 Ga0496109_0456729 Ga0496109_0456729_330_875 174
1707 3300048912 Ga0496109_1045323 Ga0496109_1045323_140_697 174
1708 3300048913 Ga0496110_0033897 Ga0496110_0033897_1806_2354 174
1709 3300048913 Ga0496110_0158280 Ga0496110_0158280_402_956 174
1710 3300048913 Ga0496110_0238635 Ga0496110_0238635_880_1425 174
1711 3300048913 Ga0496110_0765974 Ga0496110_0765974_95_640 174
1712 3300048913 Ga0496110_1099719 Ga0496110_1099719_60_677 174
1713 3300048914 Ga0496111_0007248 Ga0496111_0007248_4221_4769 174
1714 3300048914 Ga0496111_0020308 Ga0496111_0020308_3185_3739 174
1715 3300048914 Ga0496111_0242643 Ga0496111_0242643_659_1276 174
1716 3300048915 Ga0496112_0000043 Ga0496112_0000043_30994_31542 174
1717 3300048915 Ga0496112_0000881 Ga0496112_0000881_18350_18904 174
1718 3300048915 Ga0496112_0010012 Ga0496112_0010012_2748_3296 174
1719 3300048915 Ga0496112_0010923 Ga0496112_0010923_5632_6177 174
1720 3300048915 Ga0496112_0072190 Ga0496112_0072190_2456_3001 174
1721 3300048915 Ga0496112_0099888 Ga0496112_0099888_51_668 174
1722 3300048915 Ga0496112_0128008 Ga0496112_0128008_1917_2465 174
1723 3300048915 Ga0496112_0836055 Ga0496112_0836055_227_781 174
1724 3300048916 Ga0496113_0000107 Ga0496113_0000107_12899_13447 174
1725 3300048916 Ga0496113_0001162 Ga0496113_0001162_7070_7624 174
1726 3300048916 Ga0496113_0517256 Ga0496113_0517256_118_675 174
1727 3300048918 Ga0496115_0014767 Ga0496115_0014767_103_648 174
1728 3300050507 nmdc:mga05p37_218807_c1 nmdc:mga05p37_218807_c1_950_1495 174
1729 3300050511 nmdc:mga08y16_883724_c1 nmdc:mga08y16_883724_c1_20_568 174
1730 3300050512 nmdc:mga0n895_337791_c1 nmdc:mga0n895_337791_c1_451_996 174
1731 3300050512 nmdc:mga0n895_411254_c1 nmdc:mga0n895_411254_c1_553_1107 174
1732 3300050513 nmdc:mga0rr50_356262_c1 nmdc:mga0rr50_356262_c1_165_710 174
1733 3300050513 nmdc:mga0rr50_493_c1 nmdc:mga0rr50_493_c1_4370_4915 174
1734 3300050514 nmdc:mga08x19_19368_c1 nmdc:mga08x19_19368_c1_2802_3347 174
1735 3300050514 nmdc:mga08x19_20550_c1 nmdc:mga08x19_20550_c1_206_757 174
1736 3300050515 nmdc:mga0a205_171_c1 nmdc:mga0a205_171_c1_38562_39107 174
1737 3300053077 Ga0495601_0003789 Ga0495601_0003789_1734_2345 174
1738 3300053077 Ga0495601_0437256 Ga0495601_0437256_213_758 174
1739 3300053085 Ga0495619_0008559 Ga0495619_0008559_2461_3006 174
1740 3300059506 Ga0587085_087134 Ga0587085_087134_69_623 174
1741 3300059646 Ga0587078_046634 Ga0587078_046634_49_603 174

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04011

LemA

LemA family

60

209

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2etd-assembly1.cif.gz_A crystal structure of a lema protein (tm0961) from thermotoga maritima msb8 at 2.28 a resolution 0.943 15 162
2etd-assembly1.cif.gz_A crystal structure of a lema protein (tm0961) from thermotoga maritima msb8 at 2.28 a resolution 0.9173 15 162
4a55-assembly1.cif.gz_B crystal structure of p110alpha in complex with ish2 of p85alpha and the inhibitor pik-108 0.6174 11 154
4mh6-assembly1.cif.gz_A 2.8 angstrom crystal structure of type iii secretion protein ysco from vibrio parahaemolyticus 0.6067 3 153
3k29-assembly1.cif.gz_A structure of a putative ysco homolog ct670 from chlamydia trachomatis 0.5723 14 153
ID Description Score Start End Superfamily
2etdA00 Mainly Alpha;Up-down Bundle;de novo design (two linked rop proteins);LemA-like domain 0.9521 15 161 1.20.1440.20
2etdA00 Mainly Alpha;Up-down Bundle;de novo design (two linked rop proteins);LemA-like domain 0.9237 15 161 1.20.1440.20
af_Q58971_21_189_1.20.1440.20 Mainly Alpha;Up-down Bundle;de novo design (two linked rop proteins);LemA-like domain 0.822 7 174 1.20.1440.20
af_Q58971_21_189_1.20.1440.20 Mainly Alpha;Up-down Bundle;de novo design (two linked rop proteins);LemA-like domain 0.8133 7 174 1.20.1440.20
af_I6YDV4_1_171_1.10.287.1490 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.7974 2 161 1.10.287.1490
ID Description Score Start End GO Terms
AF-A0A1Q7AW07-F1-model_v4 LemA family protein 1.003 2 161 GO:0016020
AF-A0A7Y0CSD0-F1-model_v4 LemA family protein 0.9873 2 164 GO:0016020
AF-A0A1F5C680-F1-model_v4 LemA family protein 0.9859 2 161 GO:0016020
AF-A0A1F9EZD8-F1-model_v4 LemA family protein 0.9841 2 163 GO:0016020
AF-A0A5J6LA26-F1-model_v4 LemA family protein 0.9835 3 160 GO:0016020

Feature Viewer

pLDDT pTM Quality
87.65 0.77 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map