F495519

General Info

Members Datasets Scaffolds Average Seq Length
1735 752 1488 322

Family's Representative Sequence

Representative Sequence 3300003794|Ga0055531_10006079|Ga0055531_100060793
Length 392
Sequence VIFDGAAVLPPRLLFRAFHTRLRSPVAERLFLISTKTYATAAEPIRQAADLLLCILEENAPVRRALKIDHLGKAMTEPCYDVAHLGHVELYSDRFEESLDFFTRVYGLTESGREGDSVYLRAYDDYEFHTLKLTRHHTTGVGHIAYRTSSAEALERRVKVIEEKGWGVGWTDGDLGHGRAYQFKSPDGHLFELYWDTREYVAPPEEKPALKNIAQRYHGRGASPRRLDHVNLLAADVSLIREFMTTALGSRVTEMIQLDNGRLGGCWFTINNKTYDLACSEDHTGSHGRFHHVTYACDQREDILRAADIFLENGVHIESGPHKHAIQGTFFLYVWEPAGNRVELANAGARLILRPDWKPVVWTEADRKKGQAWGMKTIETFHTHGTPPVAHK

Samples

Sample ID Description Type Environment
1 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
2 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
3 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
4 2508501050 Microvirga lupini Lut6 Isolate Nodule
5 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
6 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
7 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
8 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
9 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
10 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
11 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
12 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
13 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
14 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
15 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
16 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
17 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
18 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
19 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
20 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
21 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
22 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
23 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
24 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
25 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
26 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
27 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
28 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
29 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
30 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
31 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
32 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
33 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
34 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
35 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
36 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
37 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
38 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
39 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
40 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
41 2643221580 Devosia sp. Root635 Isolate Unclassified
42 2643221674 Devosia sp. Root436 Isolate Unclassified
43 2643221736 Bosea sp. Root483D1 Isolate Unclassified
44 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
45 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
46 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
47 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
48 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
49 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
50 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
51 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
52 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
53 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
54 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
55 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
56 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
57 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
58 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
59 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
60 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
61 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
62 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
63 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
64 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
65 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
66 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
67 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
68 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
69 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
70 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
71 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
72 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
73 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
74 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
75 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
76 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
77 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
78 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
79 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
80 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
81 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
82 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
83 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
84 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
85 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
86 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
87 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
88 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
89 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
90 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
91 2851182111 Bosea sp. Tri-44 Isolate Nodule
92 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
93 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
94 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
95 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
96 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
97 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
98 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
99 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
100 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
101 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
102 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
103 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
104 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
105 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
106 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
107 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
108 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
109 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
110 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
111 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
112 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
113 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
114 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
115 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
116 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
117 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
118 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
119 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
120 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
121 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
122 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
123 2904504865 Serratia marcescens 1822 Isolate Unclassified
124 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
125 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
126 2905926851 Arthrobacter sedimenti MIC A30 Isolate Rhizosphere
127 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
128 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
129 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
130 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
131 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
132 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
133 2922368715
134 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
135 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
136 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
137 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
138 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
139 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
140 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
141 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
142 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
143 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
144 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
145 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
146 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
147 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
148 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
149 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
150 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
151 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
152 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
153 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
154 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
155 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
156 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
157 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
158 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
159 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
160 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
161 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
162 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
163 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
164 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
165 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
166 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
167 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
168 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
169 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
170 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
171 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
172 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
173 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
174 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
175 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
176 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
177 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
178 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
179 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
180 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
181 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
182 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
183 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
184 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
185 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
186 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
187 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
188 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
189 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
190 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
191 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
192 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
193 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
194 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
195 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
196 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
197 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
198 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
199 2995392953 Martelella limonii NBRC 109441 Isolate Unclassified
200 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
201 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
202 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
203 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
204 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
205 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
206 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
207 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
208 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
209 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
210 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
211 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
212 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
213 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
214 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
215 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
216 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
217 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
218 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
219 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
220 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
221 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
222 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
223 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
224 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
225 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
226 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
227 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
228 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
229 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
230 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
231 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
232 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
233 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
234 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
235 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
236 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
237 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
238 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
239 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
240 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
241 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
242 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
243 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
244 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
245 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
246 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
247 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
248 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
249 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
250 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
251 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
252 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
253 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
254 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
255 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
256 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
257 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
258 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
259 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
260 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
261 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
262 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
263 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
264 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
265 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
266 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
267 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
268 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
269 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
270 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
271 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
272 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
273 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
274 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
275 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
276 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
277 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
278 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
279 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
280 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
281 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
282 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
283 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
284 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
285 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
286 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
287 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
288 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
289 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
290 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
291 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
292 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
293 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
294 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
295 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
296 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
297 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
298 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
299 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
300 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
301 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
302 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
303 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
304 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
305 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
306 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
307 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
308 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
309 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
310 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
311 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
312 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
313 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
314 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
315 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
316 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
317 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
318 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
319 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
320 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
321 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
322 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
323 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
324 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
325 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
326 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
327 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
328 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
329 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
330 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
331 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
332 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
333 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
334 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
335 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
336 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
337 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
338 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
339 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
340 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
341 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
342 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
343 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
344 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
345 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
346 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
347 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
348 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
349 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
350 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
351 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
352 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
353 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
354 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
355 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
356 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
357 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
358 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
359 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
360 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
361 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
362 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
363 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
364 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
365 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
366 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
367 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
368 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
369 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
370 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
371 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
372 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
373 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
374 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
375 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
376 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
377 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
378 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
379 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
380 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
381 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
382 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
383 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
384 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
385 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
386 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
387 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
388 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
389 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
390 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
391 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
392 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
393 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
394 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
395 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
396 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
397 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
398 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
399 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
400 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
401 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
402 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
403 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
404 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
405 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
406 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
407 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
408 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
409 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
410 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
411 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
412 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
413 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
414 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
415 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
416 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
417 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
418 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
419 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
420 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
421 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
422 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
423 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
424 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
425 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
426 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
427 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
428 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
429 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
430 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
431 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
432 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
433 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
434 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
435 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
436 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
437 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
438 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
439 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
440 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
441 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
442 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
443 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
444 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
445 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
446 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
447 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
448 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
449 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
450 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
451 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
452 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
453 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
454 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
455 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
456 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
457 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
458 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
459 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
460 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
461 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
462 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
463 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
464 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
465 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
466 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
467 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
468 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
469 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
470 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
471 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
472 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
473 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
474 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
475 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
476 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
477 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
478 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
479 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
480 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
481 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
482 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
483 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
484 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
485 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
486 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
487 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
488 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
489 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
490 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
491 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
492 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
493 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
494 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
495 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
496 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
497 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
498 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
499 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
500 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
501 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
502 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
503 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
504 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
505 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
506 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
507 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
508 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
509 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
510 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
511 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
512 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
513 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
514 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
515 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
516 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
517 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
518 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
519 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
520 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
521 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
522 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
523 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
524 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
525 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
526 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
527 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
528 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
529 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
530 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
531 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
532 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
533 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
534 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
535 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
536 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
537 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
538 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
539 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
540 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
541 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
542 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
543 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
544 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
545 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
546 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
547 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
548 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
549 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
550 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
551 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
552 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
553 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
554 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
555 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
556 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
557 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
558 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
559 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
560 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
561 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
562 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
563 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
564 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
565 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
566 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
567 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
568 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
569 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
570 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
571 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
572 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
573 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
574 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
575 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
576 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
577 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
578 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
579 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
580 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
581 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
582 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
583 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
584 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
585 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
586 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
587 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
588 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
589 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
590 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
591 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
592 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
593 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
594 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
595 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
596 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
597 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
598 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
599 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
600 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
601 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
602 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
603 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
604 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
605 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
606 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
607 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
608 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
609 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
610 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
611 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
612 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
613 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
614 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
615 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
616 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
617 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
618 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
619 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
620 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
621 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
622 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
623 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
624 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
625 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
626 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
627 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
628 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
629 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
630 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
631 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
632 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
633 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
634 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
635 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
636 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
637 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
638 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
639 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
640 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
641 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
642 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
643 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
644 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
645 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
646 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
647 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
648 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
649 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
650 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
651 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
652 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
653 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
654 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
655 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
656 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
657 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
658 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
659 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
660 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
661 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
662 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
663 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
664 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
665 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
666 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
667 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
668 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
669 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
670 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
671 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
672 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
673 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
674 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
675 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
676 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
677 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
678 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
679 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
680 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
681 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
682 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
683 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
684 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
685 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
686 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
687 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
688 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
689 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
690 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
691 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
692 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
693 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
694 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
695 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
696 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
697 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
698 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
699 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
700 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
701 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
702 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
703 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
704 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
705 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
706 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
707 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
708 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
709 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
710 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
711 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
712 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
713 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
714 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
715 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
716 8001845381 Ancylobacter sonchi VKM B-3145 Isolate Unclassified
717 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
718 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
719 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
720 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
721 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
722 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
723 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
724 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
725 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
726 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
727 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
728 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
729 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
730 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
731 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
732 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
733 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
734 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
735 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
736 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
737 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
738 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
739 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
740 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
741 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
742 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
743 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
744 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
745 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
746 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
747 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
748 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
749 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
750 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule
751 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
752 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 85.87
Metatranscriptomes 0
Isolates 14.13

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.3
Nodule 10.09
Rhizoplane 3.8
Rhizosphere 65.65
Stem 0
Stem Tuber 0
Unclassified 9.16

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10040402 3300001989 Bacteria 1557
2 JGI25158J39367_1000010 3300002739 Bacteria 53338
3 JGI25152J39213_1004785 3300002773 Bacteria 4154
4 JGI25159J45721_1000233 3300002987 Bacteria 26229
5 JGI25159J45721_1002514 3300002987 Bacteria 6905
6 JGI25406J46586_10004884 3300003203 Bacteria 6230
7 JGI25165J46597_1004128 3300003214 Bacteria 3238
8 JGI25153J46596_10000613 3300003215 Bacteria 21789
9 JGI25153J46596_10002476 3300003215 Bacteria 10601
10 JGI25153J46596_10004034 3300003215 Bacteria 8006
11 JGI25153J46596_10010269 3300003215 Bacteria 4253
12 JGI25153J46596_10015548 3300003215 Bacteria 3092
13 JGI25160J50197_1000921 3300003354 Bacteria 15453
14 JGI25160J50197_1008043 3300003354 Bacteria 4054
15 JGI25160J50197_1011234 3300003354 Bacteria 3185
16 JGI25161J50226_1000294 3300003374 Bacteria 28171
17 Ga0055526_1000231 3300003771 Bacteria 46760
18 Ga0055526_1003587 3300003771 Bacteria 9752
19 Ga0055524_1007582 3300003775 Bacteria 4589
20 Ga0055524_1023928 3300003775 Bacteria 1953
21 Ga0055528_1010157 3300003790 Bacteria 3859
22 Ga0055540_1005072 3300003792 Bacteria 5690
23 Ga0055531_10006079 3300003794 Bacteria 6914
24 Ga0055531_10021273 3300003794 Bacteria 2524
25 Ga0058692_1000046 3300003856 Bacteria 114274
26 Ga0058692_1000567 3300003856 Bacteria 15742
27 Ga0058692_1000687 3300003856 Bacteria 13920
28 Ga0055543_1000031 3300004625 Bacteria 130583
29 Ga0055543_1006477 3300004625 Bacteria 2823
30 Ga0065165_1000778 3300005262 Bacteria 42765
31 Ga0065165_1002034 3300005262 Bacteria 18805
32 Ga0065165_1002156 3300005262 Bacteria 17812
33 Ga0065165_1006341 3300005262 Bacteria 6245
34 Ga0065714_10087552 3300005288 Bacteria 2053
35 Ga0065714_10094003 3300005288 Bacteria 1830
36 Ga0065712_10077700 3300005290 Bacteria 3455
37 Ga0065712_10124474 3300005290 Bacteria 1625
38 Ga0065715_10147769 3300005293 Bacteria 1766
39 Ga0065715_10190426 3300005293 Bacteria 1418
40 Ga0065707_10107060 3300005295 Bacteria 2571
41 Ga0070658_10110642 3300005327 Bacteria 2275
42 Ga0070676_10056574 3300005328 Bacteria 2318
43 Ga0070676_10087046 3300005328 Bacteria 1906
44 Ga0070683_100003379 3300005329 Bacteria 12929
45 Ga0070683_100016094 3300005329 Bacteria 6583
46 Ga0070683_100019245 3300005329 Bacteria 6064
47 Ga0070683_100048946 3300005329 Bacteria 3908
48 Ga0070683_100250262 3300005329 Bacteria 1685
49 Ga0070690_100018459 3300005330 Bacteria 4214
50 Ga0070690_100031364 3300005330 Bacteria 3310
51 Ga0070670_100009760 3300005331 Bacteria 8196
52 Ga0070670_100029544 3300005331 Bacteria 4719
53 Ga0070670_100029832 3300005331 Bacteria 4697
54 Ga0068869_100027508 3300005334 Bacteria 3964
55 Ga0068869_100208530 3300005334 Bacteria 1544
56 Ga0070680_100391849 3300005336 Bacteria 1183
57 Ga0070682_100311399 3300005337 Bacteria 1159
58 Ga0070682_100317739 3300005337 Bacteria 1149
59 Ga0068868_100028693 3300005338 Bacteria 4257
60 Ga0068868_100107240 3300005338 Bacteria 2267
61 Ga0070660_100001944 3300005339 Bacteria 14250
62 Ga0070660_100045469 3300005339 Bacteria 3361
63 Ga0070689_100108554 3300005340 Bacteria 2205
64 Ga0070689_100227197 3300005340 Bacteria 1533
65 Ga0070689_100246889 3300005340 Bacteria 1472
66 Ga0070691_10001349 3300005341 Bacteria 10469
67 Ga0070687_100198558 3300005343 Bacteria 1214
68 Ga0070661_100053057 3300005344 Bacteria 2967
69 Ga0070661_100102961 3300005344 Bacteria 2126
70 Ga0070692_10033162 3300005345 Bacteria 2602
71 Ga0070668_100105570 3300005347 Bacteria 2237
72 Ga0070668_100420711 3300005347 Bacteria 1144
73 Ga0070669_100059894 3300005353 Bacteria 2796
74 Ga0070669_100073634 3300005353 Bacteria 2531
75 Ga0070675_100004522 3300005354 Bacteria 10618
76 Ga0070675_100015967 3300005354 Bacteria 5949
77 Ga0070675_100024111 3300005354 Bacteria 4871
78 Ga0070675_100036688 3300005354 Bacteria 3991
79 Ga0070675_100077652 3300005354 Bacteria 2764
80 Ga0070675_100138658 3300005354 Bacteria 2077
81 Ga0070675_100165269 3300005354 Bacteria 1906
82 Ga0070675_100277361 3300005354 Bacteria 1472
83 Ga0070671_100049765 3300005355 Bacteria 3486
84 Ga0070671_100318682 3300005355 Bacteria 1325
85 Ga0070674_100068569 3300005356 Bacteria 2499
86 Ga0070674_100212123 3300005356 Bacteria 1501
87 Ga0070673_100007974 3300005364 Bacteria 7016
88 Ga0070673_100010819 3300005364 Bacteria 6197
89 Ga0070673_100016264 3300005364 Bacteria 5254
90 Ga0070673_100026894 3300005364 Bacteria 4256
91 Ga0070673_100060690 3300005364 Bacteria 2997
92 Ga0070673_100134286 3300005364 Bacteria 2081
93 Ga0070688_100056573 3300005365 Bacteria 2463
94 Ga0070688_100070855 3300005365 Bacteria 2230
95 Ga0070688_100174067 3300005365 Bacteria 1488
96 Ga0070659_100017692 3300005366 Bacteria 5368
97 Ga0070659_100046969 3300005366 Bacteria 3385
98 Ga0070667_100106442 3300005367 Bacteria 2427
99 Ga0070703_10001433 3300005406 Bacteria 7187
100 Ga0070709_10115580 3300005434 Bacteria 1810
101 Ga0070709_10168631 3300005434 Bacteria 1528
102 Ga0070714_100014768 3300005435 Bacteria 6276
103 Ga0070714_100031982 3300005435 Bacteria 4393
104 Ga0070714_100045004 3300005435 Bacteria 3739
105 Ga0070714_100263799 3300005435 Bacteria 1596
106 Ga0070714_100391365 3300005435 Unclassified 1312
107 Ga0070713_100002844 3300005436 Bacteria 11319
108 Ga0070713_100063806 3300005436 Bacteria 3090
109 Ga0070713_100073363 3300005436 Bacteria 2897
110 Ga0070713_100134222 3300005436 Bacteria 2186
111 Ga0070713_100387884 3300005436 Bacteria 1302
112 Ga0070701_10039009 3300005438 Bacteria 2407
113 Ga0070701_10046898 3300005438 Bacteria 2224
114 Ga0070711_100037458 3300005439 Bacteria 3255
115 Ga0070711_100069023 3300005439 Bacteria 2486
116 Ga0070705_100000669 3300005440 Bacteria 19603
117 Ga0070705_100010431 3300005440 Bacteria 4651
118 Ga0070700_100005764 3300005441 Bacteria 6574
119 Ga0070700_100081418 3300005441 Bacteria 2092
120 Ga0070700_100119040 3300005441 Bacteria 1767
121 Ga0070700_100211505 3300005441 Bacteria 1369
122 Ga0070663_100031364 3300005455 Bacteria 3652
123 Ga0070663_100102135 3300005455 Bacteria 2142
124 Ga0070663_100114185 3300005455 Bacteria 2033
125 Ga0070678_100275582 3300005456 Bacteria 1420
126 Ga0070662_100035666 3300005457 Bacteria 3514
127 Ga0070681_10001512 3300005458 Bacteria 20594
128 Ga0070681_10020468 3300005458 Bacteria 6631
129 Ga0070681_10049614 3300005458 Bacteria 4191
130 Ga0070681_10081006 3300005458 Bacteria 3202
131 Ga0070681_10196840 3300005458 Bacteria 1934
132 Ga0068867_100171300 3300005459 Bacteria 1719
133 Ga0068867_100233593 3300005459 Bacteria 1488
134 Ga0070685_10028593 3300005466 Bacteria 3089
135 Ga0070698_100058814 3300005471 Bacteria 3885
136 Ga0070698_100095814 3300005471 Bacteria 2945
137 Ga0070699_100002092 3300005518 Bacteria 18069
138 Ga0070699_100070950 3300005518 Bacteria 3029
139 Ga0070699_100187693 3300005518 Bacteria 1836
140 Ga0070679_100001481 3300005530 Bacteria 20822
141 Ga0070679_100021572 3300005530 Bacteria 6289
142 Ga0070679_100087010 3300005530 Bacteria 3112
143 Ga0070679_100385539 3300005530 Bacteria 1348
144 Ga0070684_100000195 3300005535 Bacteria 42452
145 Ga0070684_100025533 3300005535 Bacteria 4968
146 Ga0070684_100070862 3300005535 Bacteria 3068
147 Ga0070684_100201132 3300005535 Bacteria 1814
148 Ga0070697_100126985 3300005536 Bacteria 2137
149 Ga0068853_100023195 3300005539 Bacteria 5193
150 Ga0068853_100408035 3300005539 Bacteria 1273
151 Ga0070672_100010592 3300005543 Bacteria 6398
152 Ga0070672_100029624 3300005543 Bacteria 4106
153 Ga0070672_100042329 3300005543 Bacteria 3506
154 Ga0070686_100089086 3300005544 Bacteria 2061
155 Ga0070695_100001854 3300005545 Bacteria 11929
156 Ga0070695_100006971 3300005545 Bacteria 6696
157 Ga0070695_100027466 3300005545 Bacteria 3525
158 Ga0070696_100000152 3300005546 Bacteria 38688
159 Ga0070696_100052288 3300005546 Bacteria 2842
160 Ga0070665_100020306 3300005548 Bacteria 6671
161 Ga0070665_100036959 3300005548 Bacteria 4910
162 Ga0070665_100059576 3300005548 Bacteria 3827
163 Ga0070665_100125579 3300005548 Bacteria 2568
164 Ga0070665_100224591 3300005548 Bacteria 1878
165 Ga0070665_100364644 3300005548 Bacteria 1451
166 Ga0068855_100004931 3300005563 Bacteria 16277
167 Ga0068855_100021749 3300005563 Bacteria 7692
168 Ga0068855_100044490 3300005563 Bacteria 5253
169 Ga0068855_100053737 3300005563 Bacteria 4737
170 Ga0068855_100617586 3300005563 Bacteria 1167
171 Ga0068855_100641467 3300005563 Bacteria 1141
172 Ga0070664_100005311 3300005564 Bacteria 10333
173 Ga0070664_100020607 3300005564 Bacteria 5430
174 Ga0070664_100058923 3300005564 Bacteria 3267
175 Ga0070664_100077578 3300005564 Bacteria 2856
176 Ga0068857_100002134 3300005577 Bacteria 16080
177 Ga0068857_100009442 3300005577 Bacteria 8469
178 Ga0068857_100011760 3300005577 Bacteria 7611
179 Ga0068854_100064089 3300005578 Bacteria 2670
180 Ga0068854_100279804 3300005578 Bacteria 1343
181 Ga0068856_100000020 3300005614 Bacteria 146775
182 Ga0068856_100046098 3300005614 Bacteria 4294
183 Ga0068856_100090861 3300005614 Bacteria 3038
184 Ga0068856_100216491 3300005614 Bacteria 1931
185 Ga0068852_100072755 3300005616 Bacteria 3022
186 Ga0068859_100004116 3300005617 Bacteria 14831
187 Ga0068859_100016330 3300005617 Bacteria 7459
188 Ga0068859_100355007 3300005617 Bacteria 1561
189 Ga0068864_100262706 3300005618 Bacteria 1606
190 Ga0068864_100303716 3300005618 Bacteria 1495
191 Ga0068864_100426247 3300005618 Bacteria 1265
192 Ga0068866_10012011 3300005718 Bacteria 3767
193 Ga0068866_10038218 3300005718 Bacteria 2362
194 Ga0068866_10110876 3300005718 Bacteria 1531
195 Ga0068861_100107591 3300005719 Bacteria 2229
196 Ga0068861_100124129 3300005719 Bacteria 2087
197 Ga0068861_100148512 3300005719 Bacteria 1921
198 Ga0068861_100291950 3300005719 Bacteria 1408
199 Ga0068851_10064105 3300005834 Bacteria 1888
200 Ga0068870_10033317 3300005840 Bacteria 2628
201 Ga0068863_100198158 3300005841 Bacteria 1931
202 Ga0068858_100059754 3300005842 Bacteria 3523
203 Ga0068858_100071961 3300005842 Bacteria 3207
204 Ga0068858_100209323 3300005842 Bacteria 1845
205 Ga0068858_100581369 3300005842 Bacteria 1085
206 Ga0068860_100034482 3300005843 Bacteria 4854
207 Ga0068860_100041013 3300005843 Bacteria 4422
208 Ga0068860_100241907 3300005843 Bacteria 1756
209 Ga0068862_100003721 3300005844 Bacteria 13015
210 Ga0068862_100124093 3300005844 Bacteria 2279
211 Ga0068862_100164261 3300005844 Bacteria 1984
212 Ga0068862_100279568 3300005844 Bacteria 1529
213 Ga0068862_100288452 3300005844 Bacteria 1506
214 Ga0081455_10000052 3300005937 Bacteria 123035
215 Ga0081455_10037106 3300005937 Bacteria 4332
216 Ga0081455_10131599 3300005937 Bacteria 1956
217 Ga0081538_10034813 3300005981 Bacteria 3321
218 Ga0081540_1000413 3300005983 Bacteria 42230
219 Ga0081540_1001108 3300005983 Bacteria 23889
220 Ga0081540_1003143 3300005983 Bacteria 13194
221 Ga0081540_1004962 3300005983 Bacteria 10006
222 Ga0081540_1006279 3300005983 Bacteria 8697
223 Ga0081540_1017195 3300005983 Bacteria 4485
224 Ga0081540_1030904 3300005983 Bacteria 2957
225 Ga0081540_1044360 3300005983 Bacteria 2270
226 Ga0081539_10000074 3300005985 Bacteria 231435
227 Ga0081539_10001407 3300005985 Bacteria 41418
228 Ga0081539_10003527 3300005985 Bacteria 19053
229 Ga0081539_10003710 3300005985 Bacteria 18198
230 Ga0081539_10003717 3300005985 Bacteria 18179
231 Ga0081539_10046864 3300005985 Bacteria 2474
232 Ga0081539_10049992 3300005985 Bacteria 2368
233 Ga0081539_10118279 3300005985 Bacteria 1321
234 Ga0070717_10020633 3300006028 Bacteria 5186
235 Ga0070717_10051575 3300006028 Bacteria 3387
236 Ga0070717_10064475 3300006028 Bacteria 3043
237 Ga0075365_10014008 3300006038 Bacteria 4814
238 Ga0075365_10022859 3300006038 Bacteria 3924
239 Ga0075365_10040659 3300006038 Bacteria 3033
240 Ga0075365_10190749 3300006038 Bacteria 1434
241 Ga0075368_10002315 3300006042 Bacteria 6182
242 Ga0075368_10002426 3300006042 Bacteria 6083
243 Ga0075363_100001035 3300006048 Bacteria 10003
244 Ga0075363_100022143 3300006048 Bacteria 3210
245 Ga0075363_100045005 3300006048 Bacteria 2340
246 Ga0075363_100158317 3300006048 Bacteria 1281
247 Ga0075364_10026851 3300006051 Bacteria 3676
248 Ga0075364_10080132 3300006051 Bacteria 2158
249 Ga0075364_10084514 3300006051 Bacteria 2102
250 Ga0075364_10152519 3300006051 Bacteria 1558
251 Ga0075362_10098213 3300006177 Bacteria 1366
252 Ga0075367_10000988 3300006178 Bacteria 11650
253 Ga0075367_10014301 3300006178 Bacteria 4293
254 Ga0075367_10026637 3300006178 Bacteria 3281
255 Ga0075367_10062247 3300006178 Bacteria 2228
256 Ga0075367_10067544 3300006178 Bacteria 2143
257 Ga0075367_10069585 3300006178 Bacteria 2113
258 Ga0075367_10093920 3300006178 Bacteria 1828
259 Ga0075367_10096783 3300006178 Bacteria 1800
260 Ga0075367_10155238 3300006178 Bacteria 1422
261 Ga0075369_10011766 3300006186 Bacteria 3446
262 Ga0075369_10059790 3300006186 Bacteria 1661
263 Ga0075366_10164527 3300006195 Bacteria 1345
264 Ga0097621_100030570 3300006237 Bacteria 4265
265 Ga0097621_100032276 3300006237 Bacteria 4162
266 Ga0097621_100081299 3300006237 Bacteria 2696
267 Ga0097621_100202310 3300006237 Bacteria 1725
268 Ga0075370_10052123 3300006353 Bacteria 2320
269 Ga0075370_10131105 3300006353 Bacteria 1463
270 Ga0068871_100043283 3300006358 Bacteria 3617
271 Ga0075428_100009268 3300006844 Bacteria 10915
272 Ga0075428_100017074 3300006844 Bacteria 8019
273 Ga0075428_100038731 3300006844 Bacteria 5246
274 Ga0075428_100049703 3300006844 Bacteria 4601
275 Ga0075428_100079146 3300006844 Bacteria 3587
276 Ga0075428_100231309 3300006844 Bacteria 1995
277 Ga0075430_100003793 3300006846 Bacteria 12715
278 Ga0075430_100013634 3300006846 Bacteria 6929
279 Ga0075430_100018911 3300006846 Bacteria 5861
280 Ga0075430_100105716 3300006846 Bacteria 2349
281 Ga0075431_100277703 3300006847 Bacteria 1696
282 Ga0075433_10000461 3300006852 Bacteria 26442
283 Ga0075433_10018233 3300006852 Bacteria 5830
284 Ga0075433_10081604 3300006852 Bacteria 2852
285 Ga0075434_100000022 3300006871 Bacteria 68968
286 Ga0075434_100005354 3300006871 Bacteria 11675
287 Ga0075434_100006016 3300006871 Bacteria 11101
288 Ga0075434_100021666 3300006871 Bacteria 6249
289 Ga0075434_100037997 3300006871 Bacteria 4768
290 Ga0075434_100048888 3300006871 Bacteria 4198
291 Ga0075434_100059447 3300006871 Bacteria 3800
292 Ga0075434_100083949 3300006871 Bacteria 3183
293 Ga0075434_100228416 3300006871 Bacteria 1880
294 Ga0075429_100024553 3300006880 Bacteria 5230
295 Ga0075429_100026775 3300006880 Bacteria 5006
296 Ga0075429_100035041 3300006880 Bacteria 4362
297 Ga0075429_100081922 3300006880 Bacteria 2813
298 Ga0075429_100125144 3300006880 Bacteria 2248
299 Ga0075436_100017867 3300006914 Bacteria 4856
300 Ga0075436_100057646 3300006914 Bacteria 2682
301 Ga0097620_100004116 3300006931 Bacteria 14831
302 Ga0097620_100016330 3300006931 Bacteria 7459
303 Ga0097620_100354971 3300006931 Bacteria 1561
304 Ga0099824_1029573 3300006942 Bacteria 2315
305 Ga0099824_1037481 3300006942 Bacteria 1344
306 Ga0099822_1001130 3300006943 Bacteria 29740
307 Ga0075435_100000010 3300007076 Bacteria 112658
308 Ga0075435_100002387 3300007076 Bacteria 12450
309 Ga0075435_100016178 3300007076 Bacteria 5621
310 Ga0075435_100023068 3300007076 Bacteria 4806
311 Ga0075435_100035148 3300007076 Bacteria 3976
312 Ga0075435_100037657 3300007076 Bacteria 3852
313 Ga0075435_100047761 3300007076 Bacteria 3438
314 Ga0099795_10028929 3300007788 Bacteria 1890
315 Ga0105250_10000007 3300009092 Bacteria 355249
316 Ga0105240_10000902 3300009093 Bacteria 53015
317 Ga0105240_10006904 3300009093 Bacteria 16585
318 Ga0105240_10011564 3300009093 Bacteria 12282
319 Ga0105240_10039681 3300009093 Bacteria 6027
320 Ga0105240_10236800 3300009093 Bacteria 2118
321 Ga0111539_10000422 3300009094 Bacteria 53066
322 Ga0111539_10001890 3300009094 Bacteria 27853
323 Ga0111539_10004985 3300009094 Bacteria 17272
324 Ga0111539_10008576 3300009094 Bacteria 12979
325 Ga0111539_10026841 3300009094 Bacteria 7035
326 Ga0111539_10027691 3300009094 Bacteria 6923
327 Ga0111539_10054645 3300009094 Bacteria 4750
328 Ga0111539_10087413 3300009094 Bacteria 3662
329 Ga0111539_10194327 3300009094 Bacteria 2367
330 Ga0111539_10281415 3300009094 Bacteria 1935
331 Ga0111539_10320066 3300009094 Bacteria 1805
332 Ga0105245_10001847 3300009098 Bacteria 19281
333 Ga0105245_10003047 3300009098 Bacteria 15009
334 Ga0105245_10038373 3300009098 Bacteria 4262
335 Ga0105245_10200714 3300009098 Bacteria 1915
336 Ga0105245_10241088 3300009098 Bacteria 1752
337 Ga0105245_10290505 3300009098 Bacteria 1601
338 Ga0105247_10032205 3300009101 Bacteria 3185
339 Ga0105247_10033309 3300009101 Bacteria 3133
340 Ga0105247_10038361 3300009101 Bacteria 2924
341 Ga0114129_10015168 3300009147 Bacteria 10967
342 Ga0114129_10025222 3300009147 Bacteria 8423
343 Ga0114129_10026135 3300009147 Bacteria 8267
344 Ga0114129_10039868 3300009147 Bacteria 6625
345 Ga0114129_10059053 3300009147 Bacteria 5364
346 Ga0114129_10071739 3300009147 Bacteria 4829
347 Ga0114129_10077640 3300009147 Bacteria 4619
348 Ga0114129_10204778 3300009147 Bacteria 2670
349 Ga0114129_10251470 3300009147 Bacteria 2372
350 Ga0114129_10279660 3300009147 Bacteria 2230
351 Ga0114129_10288986 3300009147 Bacteria 2188
352 Ga0114129_10526894 3300009147 Bacteria 1540
353 Ga0105243_10014896 3300009148 Bacteria 5886
354 Ga0105243_10286668 3300009148 Bacteria 1486
355 Ga0105243_10301626 3300009148 Bacteria 1452
356 Ga0105241_10032147 3300009174 Bacteria 3931
357 Ga0105241_10035110 3300009174 Bacteria 3771
358 Ga0105241_10317976 3300009174 Bacteria 1341
359 Ga0105242_10031769 3300009176 Bacteria 4220
360 Ga0105242_10050983 3300009176 Bacteria 3371
361 Ga0105242_10138954 3300009176 Bacteria 2106
362 Ga0105242_10295817 3300009176 Bacteria 1476
363 Ga0105242_10454668 3300009176 Bacteria 1208
364 Ga0105248_10008703 3300009177 Bacteria 11152
365 Ga0105248_10016786 3300009177 Bacteria 8061
366 Ga0105248_10022852 3300009177 Bacteria 6943
367 Ga0105248_10130741 3300009177 Bacteria 2832
368 Ga0105248_10382733 3300009177 Bacteria 1584
369 Ga0105248_10580746 3300009177 Bacteria 1264
370 Ga0105237_10003966 3300009545 Bacteria 17317
371 Ga0105237_10004278 3300009545 Bacteria 16579
372 Ga0105237_10005103 3300009545 Bacteria 14902
373 Ga0105237_10024796 3300009545 Bacteria 6137
374 Ga0105237_10044091 3300009545 Bacteria 4491
375 Ga0105238_10003029 3300009551 Bacteria 16761
376 Ga0105238_10006597 3300009551 Bacteria 11565
377 Ga0105238_10016557 3300009551 Bacteria 7463
378 Ga0105238_10018653 3300009551 Bacteria 7064
379 Ga0105238_10074830 3300009551 Bacteria 3379
380 Ga0105238_10095463 3300009551 Bacteria 2960
381 Ga0105238_10133883 3300009551 Bacteria 2456
382 Ga0105249_10008780 3300009553 Bacteria 8821
383 Ga0105239_10002707 3300010375 Bacteria 22284
384 Ga0105239_10006453 3300010375 Bacteria 13605
385 Ga0105239_10077120 3300010375 Bacteria 3667
386 Ga0105239_10110545 3300010375 Bacteria 3046
387 Ga0105239_10271018 3300010375 Bacteria 1909
388 Ga0105239_10367855 3300010375 Bacteria 1625
389 Ga0105246_10076413 3300011119 Bacteria 2373
390 Ga0157371_10079089 3300013102 Bacteria 2329
391 Ga0157370_10003480 3300013104 Bacteria 18471
392 Ga0157370_10005340 3300013104 Bacteria 14432
393 Ga0157370_10046104 3300013104 Bacteria 4180
394 Ga0157370_10187365 3300013104 Bacteria 1921
395 Ga0157370_10503671 3300013104 Bacteria 1112
396 Ga0157369_10007409 3300013105 Bacteria 12634
397 Ga0157369_10016886 3300013105 Bacteria 8203
398 Ga0157369_10018316 3300013105 Bacteria 7852
399 Ga0157369_10043509 3300013105 Bacteria 4895
400 Ga0157369_10139837 3300013105 Bacteria 2562
401 Ga0171462_1027 3300013250 Bacteria 113319
402 Ga0157374_10031793 3300013296 Bacteria 4801
403 Ga0157374_10037660 3300013296 Bacteria 4441
404 Ga0157374_10045379 3300013296 Bacteria 4067
405 Ga0157374_10069517 3300013296 Bacteria 3316
406 Ga0157374_10117130 3300013296 Bacteria 2567
407 Ga0157374_10249791 3300013296 Bacteria 1745
408 Ga0157378_10050879 3300013297 Bacteria 3686
409 Ga0163162_10084245 3300013306 Bacteria 3254
410 Ga0163162_10427436 3300013306 Bacteria 1457
411 Ga0157372_10015165 3300013307 Bacteria 8248
412 Ga0157372_10015355 3300013307 Bacteria 8207
413 Ga0157372_10018641 3300013307 Bacteria 7466
414 Ga0157372_10037708 3300013307 Bacteria 5332
415 Ga0157375_10006056 3300013308 Bacteria 10547
416 Ga0157375_10034118 3300013308 Bacteria 4844
417 Ga0157375_10041991 3300013308 Bacteria 4422
418 Ga0163163_10020481 3300014325 Bacteria 6229
419 Ga0163163_10205367 3300014325 Bacteria 2019
420 Ga0163163_10300763 3300014325 Bacteria 1657
421 Ga0163163_10483772 3300014325 Bacteria 1299
422 Ga0157380_10003657 3300014326 Bacteria 10573
423 Ga0157380_10116806 3300014326 Bacteria 2253
424 Ga0157380_10306919 3300014326 Bacteria 1464
425 Ga0157377_10123939 3300014745 Bacteria 1570
426 Ga0157379_10068648 3300014968 Bacteria 3169
427 Ga0157379_10118819 3300014968 Bacteria 2378
428 Ga0157376_10033493 3300014969 Bacteria 4137
429 Ga0157376_10048158 3300014969 Bacteria 3522
430 Ga0157376_10080773 3300014969 Bacteria 2790
431 Ga0157376_10099021 3300014969 Bacteria 2542
432 Ga0157376_10115361 3300014969 Bacteria 2371
433 Ga0214544_1000002 3300021320 Bacteria 753857
434 Ga0214542_1000001 3300021321 Bacteria 1018696
435 Ga0214545_1000001 3300021324 Bacteria 1092817
436 Ga0214543_1000001 3300021327 Bacteria 776921
437 Ga0213876_10001330 3300021384 Bacteria 15523
438 Ga0213876_10011164 3300021384 Bacteria 4802
439 Ga0213875_10012987 3300021388 Bacteria 4100
440 Ga0213875_10019425 3300021388 Bacteria 3268
441 Ga0213871_10001009 3300021441 Bacteria 4411
442 Ga0209436_100043 3300025208 Bacteria 71870
443 Ga0209563_101383 3300025230 Bacteria 6527
444 Ga0209677_101906 3300025253 Bacteria 8417
445 Ga0209148_1000500 3300025254 Bacteria 39994
446 Ga0209759_1023293 3300025256 Bacteria 1366
447 Ga0209129_1003909 3300025258 Bacteria 6192
448 Ga0209129_1008236 3300025258 Bacteria 2933
449 Ga0209455_1001381 3300025272 Bacteria 11081
450 Ga0209673_1018275 3300025273 Bacteria 2556
451 Ga0209673_1026004 3300025273 Bacteria 1933
452 Ga0209130_1000023 3300025284 Bacteria 359355
453 Ga0209130_1000080 3300025284 Bacteria 166684
454 Ga0209676_1013011 3300025292 Bacteria 3225
455 Ga0209025_1003280 3300025294 Bacteria 15574
456 Ga0209025_1019049 3300025294 Bacteria 3840
457 Ga0209564_1000023 3300025295 Bacteria 555102
458 Ga0209564_1004387 3300025295 Bacteria 8654
459 Ga0209564_1007411 3300025295 Bacteria 5674
460 Ga0209564_1011501 3300025295 Bacteria 3958
461 Ga0209758_1000024 3300025297 Bacteria 591966
462 Ga0209758_1000068 3300025297 Bacteria 286488
463 Ga0209758_1002091 3300025297 Bacteria 21224
464 Ga0209758_1002135 3300025297 Bacteria 20851
465 Ga0209758_1003095 3300025297 Bacteria 15755
466 Ga0209758_1004785 3300025297 Bacteria 10950
467 Ga0209758_1006039 3300025297 Bacteria 8935
468 Ga0209758_1007018 3300025297 Bacteria 7827
469 Ga0209758_1007020 3300025297 Bacteria 7826
470 Ga0209758_1007070 3300025297 Bacteria 7780
471 Ga0209256_1000234 3300025299 Bacteria 99080
472 Ga0209256_1003046 3300025299 Bacteria 12354
473 Ga0207426_1000087 3300025302 Bacteria 288870
474 Ga0207426_1000238 3300025302 Bacteria 124393
475 Ga0207426_1009267 3300025302 Bacteria 3910
476 Ga0207426_1023488 3300025302 Bacteria 2103
477 Ga0209051_1000544 3300025303 Bacteria 46205
478 Ga0209257_1001699 3300025304 Bacteria 24723
479 Ga0209257_1003871 3300025304 Bacteria 12217
480 Ga0209257_1024430 3300025304 Bacteria 2093
481 Ga0207697_10042306 3300025315 Bacteria 1872
482 Ga0207696_1000029 3300025711 Bacteria 398074
483 Ga0207682_10013911 3300025893 Bacteria 3134
484 Ga0207642_10018421 3300025899 Bacteria 2679
485 Ga0207642_10021409 3300025899 Bacteria 2545
486 Ga0207688_10035622 3300025901 Bacteria 2758
487 Ga0207688_10180969 3300025901 Bacteria 1257
488 Ga0207647_10138886 3300025904 Bacteria 1425
489 Ga0207699_10004016 3300025906 Bacteria 7041
490 Ga0207699_10102865 3300025906 Bacteria 1816
491 Ga0207645_10154927 3300025907 Bacteria 1497
492 Ga0207645_10193966 3300025907 Bacteria 1335
493 Ga0207645_10255182 3300025907 Bacteria 1161
494 Ga0207645_10292678 3300025907 Bacteria 1083
495 Ga0207643_10082667 3300025908 Bacteria 1862
496 Ga0207705_10133689 3300025909 Bacteria 1847
497 Ga0207684_10269682 3300025910 Bacteria 1468
498 Ga0207654_10015792 3300025911 Bacteria 3924
499 Ga0207654_10054538 3300025911 Bacteria 2310
500 Ga0207654_10060985 3300025911 Bacteria 2205
501 Ga0207654_10092243 3300025911 Bacteria 1849
502 Ga0207654_10137138 3300025911 Bacteria 1556
503 Ga0207654_10145798 3300025911 Bacteria 1515
504 Ga0207707_10000359 3300025912 Bacteria 47942
505 Ga0207707_10000744 3300025912 Bacteria 32131
506 Ga0207707_10026169 3300025912 Bacteria 5101
507 Ga0207707_10058115 3300025912 Bacteria 3366
508 Ga0207707_10270577 3300025912 Bacteria 1472
509 Ga0207695_10000008 3300025913 Bacteria 1058268
510 Ga0207695_10009469 3300025913 Bacteria 12052
511 Ga0207671_10009082 3300025914 Bacteria 8353
512 Ga0207671_10010012 3300025914 Bacteria 7865
513 Ga0207671_10021692 3300025914 Bacteria 4867
514 Ga0207693_10323066 3300025915 Bacteria 1208
515 Ga0207663_10142780 3300025916 Bacteria 1670
516 Ga0207660_10009094 3300025917 Bacteria 6436
517 Ga0207660_10027186 3300025917 Bacteria 3902
518 Ga0207660_10120479 3300025917 Bacteria 1987
519 Ga0207662_10044124 3300025918 Bacteria 2631
520 Ga0207662_10045145 3300025918 Bacteria 2604
521 Ga0207657_10034475 3300025919 Bacteria 4550
522 Ga0207657_10056793 3300025919 Bacteria 3375
523 Ga0207657_10067482 3300025919 Bacteria 3041
524 Ga0207649_10024543 3300025920 Bacteria 3506
525 Ga0207652_10003187 3300025921 Bacteria 13630
526 Ga0207652_10290066 3300025921 Bacteria 1476
527 Ga0207646_10232810 3300025922 Bacteria 1664
528 Ga0207681_10052102 3300025923 Bacteria 2774
529 Ga0207694_10003357 3300025924 Bacteria 12741
530 Ga0207694_10005094 3300025924 Bacteria 10156
531 Ga0207694_10008286 3300025924 Bacteria 7856
532 Ga0207694_10009150 3300025924 Bacteria 7476
533 Ga0207694_10031243 3300025924 Bacteria 4066
534 Ga0207694_10086697 3300025924 Bacteria 2465
535 Ga0207694_10144927 3300025924 Bacteria 1911
536 Ga0207650_10041006 3300025925 Bacteria 3390
537 Ga0207650_10118023 3300025925 Bacteria 2062
538 Ga0207659_10017723 3300025926 Bacteria 4655
539 Ga0207659_10024836 3300025926 Bacteria 4022
540 Ga0207659_10077989 3300025926 Bacteria 2440
541 Ga0207659_10122117 3300025926 Bacteria 1997
542 Ga0207659_10136054 3300025926 Bacteria 1902
543 Ga0207687_10004549 3300025927 Bacteria 9230
544 Ga0207687_10021887 3300025927 Bacteria 4250
545 Ga0207687_10039556 3300025927 Bacteria 3230
546 Ga0207687_10076793 3300025927 Bacteria 2400
547 Ga0207687_10087730 3300025927 Bacteria 2262
548 Ga0207700_10023915 3300025928 Bacteria 4222
549 Ga0207700_10026717 3300025928 Bacteria 4029
550 Ga0207700_10055871 3300025928 Bacteria 2969
551 Ga0207700_10113586 3300025928 Bacteria 2184
552 Ga0207700_10188591 3300025928 Bacteria 1731
553 Ga0207664_10039535 3300025929 Bacteria 3663
554 Ga0207664_10196525 3300025929 Bacteria 1739
555 Ga0207664_10251915 3300025929 Bacteria 1541
556 Ga0207664_10347918 3300025929 Bacteria 1311
557 Ga0207664_10518364 3300025929 Bacteria 1068
558 Ga0207644_10266496 3300025931 Bacteria 1371
559 Ga0207706_10021902 3300025933 Bacteria 5736
560 Ga0207706_10108108 3300025933 Bacteria 2447
561 Ga0207686_10005968 3300025934 Bacteria 6538
562 Ga0207686_10046220 3300025934 Bacteria 2684
563 Ga0207686_10063066 3300025934 Bacteria 2355
564 Ga0207686_10111461 3300025934 Bacteria 1846
565 Ga0207686_10280571 3300025934 Bacteria 1230
566 Ga0207709_10006551 3300025935 Bacteria 6537
567 Ga0207709_10319752 3300025935 Bacteria 1161
568 Ga0207669_10015325 3300025937 Bacteria 3864
569 Ga0207669_10028311 3300025937 Bacteria 3081
570 Ga0207669_10070247 3300025937 Bacteria 2195
571 Ga0207704_10019548 3300025938 Bacteria 3560
572 Ga0207665_10083764 3300025939 Bacteria 2200
573 Ga0207691_10005672 3300025940 Bacteria 12065
574 Ga0207691_10012642 3300025940 Bacteria 8088
575 Ga0207691_10022705 3300025940 Bacteria 5916
576 Ga0207691_10035421 3300025940 Bacteria 4633
577 Ga0207691_10079395 3300025940 Bacteria 2953
578 Ga0207691_10290799 3300025940 Bacteria 1405
579 Ga0207711_10002212 3300025941 Bacteria 17467
580 Ga0207711_10040298 3300025941 Bacteria 3974
581 Ga0207689_10002436 3300025942 Bacteria 17322
582 Ga0207689_10005152 3300025942 Bacteria 11743
583 Ga0207689_10168121 3300025942 Bacteria 1807
584 Ga0207689_10373434 3300025942 Bacteria 1187
585 Ga0207661_10007740 3300025944 Bacteria 7650
586 Ga0207661_10041643 3300025944 Bacteria 3616
587 Ga0207661_10056687 3300025944 Bacteria 3146
588 Ga0207661_10138075 3300025944 Bacteria 2095
589 Ga0207679_10153241 3300025945 Bacteria 1879
590 Ga0207679_10174312 3300025945 Bacteria 1774
591 Ga0207679_10320197 3300025945 Bacteria 1342
592 Ga0207667_10002299 3300025949 Bacteria 24006
593 Ga0207667_10033437 3300025949 Bacteria 5528
594 Ga0207667_10036213 3300025949 Bacteria 5290
595 Ga0207667_10509157 3300025949 Bacteria 1220
596 Ga0207651_10008552 3300025960 Bacteria 5535
597 Ga0207651_10117864 3300025960 Bacteria 2007
598 Ga0207651_10391362 3300025960 Bacteria 1180
599 Ga0207651_10432204 3300025960 Bacteria 1126
600 Ga0207712_10001793 3300025961 Bacteria 14233
601 Ga0207712_10038519 3300025961 Bacteria 3270
602 Ga0207712_10119336 3300025961 Bacteria 1992
603 Ga0207712_10230050 3300025961 Bacteria 1488
604 Ga0207712_10258713 3300025961 Bacteria 1410
605 Ga0207668_10156750 3300025972 Bacteria 1770
606 Ga0207668_10210277 3300025972 Bacteria 1555
607 Ga0207668_10243571 3300025972 Bacteria 1456
608 Ga0207668_10299740 3300025972 Bacteria 1326
609 Ga0207658_10382881 3300025986 Bacteria 1232
610 Ga0207677_10020108 3300026023 Bacteria 4047
611 Ga0207677_10168050 3300026023 Bacteria 1712
612 Ga0207703_10009471 3300026035 Bacteria 7647
613 Ga0207703_10013613 3300026035 Bacteria 6338
614 Ga0207703_10067160 3300026035 Bacteria 2951
615 Ga0207703_10077556 3300026035 Bacteria 2759
616 Ga0207703_10078444 3300026035 Bacteria 2744
617 Ga0207703_10241263 3300026035 Bacteria 1625
618 Ga0207639_10170581 3300026041 Bacteria 1842
619 Ga0207639_10314785 3300026041 Bacteria 1388
620 Ga0207678_10035639 3300026067 Bacteria 4332
621 Ga0207678_10046644 3300026067 Bacteria 3746
622 Ga0207678_10052618 3300026067 Bacteria 3512
623 Ga0207678_10121886 3300026067 Bacteria 2225
624 Ga0207678_10281857 3300026067 Bacteria 1426
625 Ga0207708_10001164 3300026075 Bacteria 19816
626 Ga0207708_10022061 3300026075 Bacteria 4807
627 Ga0207708_10023160 3300026075 Bacteria 4692
628 Ga0207708_10025696 3300026075 Bacteria 4456
629 Ga0207708_10155099 3300026075 Bacteria 1805
630 Ga0207708_10222277 3300026075 Bacteria 1513
631 Ga0207708_10378358 3300026075 Bacteria 1167
632 Ga0207708_10382026 3300026075 Bacteria 1161
633 Ga0207702_10000126 3300026078 Bacteria 90550
634 Ga0207702_10028749 3300026078 Bacteria 4623
635 Ga0207702_10227416 3300026078 Bacteria 1741
636 Ga0207648_10001001 3300026089 Bacteria 31868
637 Ga0207648_10018192 3300026089 Bacteria 6365
638 Ga0207648_10148275 3300026089 Bacteria 2070
639 Ga0207648_10207178 3300026089 Bacteria 1740
640 Ga0207676_10009243 3300026095 Bacteria 7014
641 Ga0207676_10155269 3300026095 Bacteria 1976
642 Ga0207676_10280765 3300026095 Bacteria 1512
643 Ga0207676_10426234 3300026095 Bacteria 1245
644 Ga0207676_10433158 3300026095 Bacteria 1236
645 Ga0207676_10553666 3300026095 Bacteria 1099
646 Ga0207674_10006609 3300026116 Bacteria 13629
647 Ga0207674_10013237 3300026116 Bacteria 9168
648 Ga0207674_10314527 3300026116 Bacteria 1515
649 Ga0207674_10328343 3300026116 Bacteria 1479
650 Ga0207675_100029061 3300026118 Bacteria 5151
651 Ga0207675_100075308 3300026118 Bacteria 3159
652 Ga0207675_100124679 3300026118 Bacteria 2439
653 Ga0207675_100159592 3300026118 Bacteria 2150
654 Ga0207675_100547934 3300026118 Bacteria 1155
655 Ga0207683_10048216 3300026121 Bacteria 3731
656 Ga0207683_10053445 3300026121 Bacteria 3542
657 Ga0207683_10059833 3300026121 Bacteria 3347
658 Ga0207683_10088288 3300026121 Bacteria 2759
659 Ga0207683_10115071 3300026121 Bacteria 2411
660 Ga0207698_10054545 3300026142 Bacteria 3076
661 Ga0207698_10055975 3300026142 Bacteria 3043
662 Ga0209389_1000107 3300027296 Bacteria 74129
663 Ga0209371_1000033 3300027312 Bacteria 381084
664 Ga0209371_1000064 3300027312 Bacteria 218637
665 Ga0209371_1000163 3300027312 Bacteria 100853
666 Ga0209371_1000419 3300027312 Bacteria 43661
667 Ga0209589_1000001 3300027357 Bacteria 794224
668 Ga0209589_1000092 3300027357 Bacteria 89530
669 Ga0209489_100001 3300027361 Bacteria 794224
670 Ga0209489_100006 3300027361 Bacteria 475698
671 Ga0209489_107740 3300027361 Bacteria 15589
672 Ga0209700_100001 3300027363 Bacteria 794224
673 Ga0209700_100005 3300027363 Bacteria 573969
674 Ga0209983_1008474 3300027665 Bacteria 2103
675 Ga0209588_1010555 3300027671 Bacteria 2778
676 Ga0209813_10015877 3300027866 Bacteria 2047
677 Ga0209813_10083591 3300027866 Bacteria 1060
678 Ga0209974_10022041 3300027876 Bacteria 2108
679 Ga0207428_10000975 3300027907 Bacteria 31671
680 Ga0207428_10001481 3300027907 Bacteria 24554
681 Ga0207428_10008324 3300027907 Bacteria 9371
682 Ga0207428_10015544 3300027907 Bacteria 6579
683 Ga0207428_10050454 3300027907 Bacteria 3329
684 Ga0207428_10074044 3300027907 Bacteria 2671
685 Ga0268266_10002394 3300028379 Bacteria 20226
686 Ga0268266_10003934 3300028379 Bacteria 14440
687 Ga0268266_10006297 3300028379 Bacteria 10880
688 Ga0268266_10227848 3300028379 Bacteria 1715
689 Ga0268266_10314020 3300028379 Bacteria 1465
690 Ga0268265_10011379 3300028380 Bacteria 6016
691 Ga0268265_10151298 3300028380 Bacteria 1958
692 Ga0268265_10156832 3300028380 Bacteria 1927
693 Ga0268265_10210575 3300028380 Bacteria 1693
694 Ga0268265_10243968 3300028380 Bacteria 1587
695 Ga0268264_10002929 3300028381 Bacteria 14834
696 Ga0268264_10024662 3300028381 Bacteria 4911
697 Ga0268264_10040245 3300028381 Bacteria 3862
698 Ga0268264_10454124 3300028381 Bacteria 1242
699 Ga0307517_10000008 3300028786 Bacteria 243202
700 Ga0307515_10006212 3300028794 Bacteria 23994
701 Ga0307515_10045960 3300028794 Bacteria 6689
702 Ga0268256_1000028 3300030500 Bacteria 433179
703 Ga0268256_1000491 3300030500 Bacteria 33677
704 Ga0268256_1002993 3300030500 Bacteria 7980
705 Ga0307511_10091215 3300030521 Bacteria 2064
706 Ga0265332_10000501 3300031238 Bacteria 26976
707 Ga0265325_10001718 3300031241 Bacteria 15212
708 Ga0265340_10006462 3300031247 Bacteria 6451
709 Ga0265339_10030057 3300031249 Bacteria 3078
710 Ga0265316_10213248 3300031344 Bacteria 1427
711 Ga0307513_10000003 3300031456 Bacteria 590921
712 Ga0307513_10027677 3300031456 Bacteria 6503
713 Ga0307513_10029676 3300031456 Bacteria 6228
714 Ga0307513_10328070 3300031456 Bacteria 1286
715 Ga0307509_10058934 3300031507 Bacteria 4064
716 Ga0307509_10152449 3300031507 Bacteria 2223
717 Ga0307408_100072011 3300031548 Bacteria 2558
718 Ga0307408_100085622 3300031548 Bacteria 2367
719 Ga0307408_100532510 3300031548 Bacteria 1034
720 Ga0265313_10009269 3300031595 Bacteria 6408
721 Ga0265313_10055801 3300031595 Bacteria 1870
722 Ga0307508_10074774 3300031616 Bacteria 2965
723 Ga0307508_10191595 3300031616 Bacteria 1646
724 Ga0265314_10000679 3300031711 Bacteria 41442
725 Ga0265314_10018231 3300031711 Bacteria 5478
726 Ga0265314_10038987 3300031711 Bacteria 3427
727 Ga0265342_10000026 3300031712 Bacteria 166610
728 Ga0307516_10049945 3300031730 Bacteria 4106
729 Ga0307516_10147702 3300031730 Bacteria 2115
730 Ga0307516_10154319 3300031730 Bacteria 2053
731 Ga0307516_10200107 3300031730 Bacteria 1718
732 Ga0307413_10110428 3300031824 Bacteria 1840
733 Ga0307413_10361800 3300031824 Bacteria 1124
734 Ga0307410_10000769 3300031852 Bacteria 13514
735 Ga0307410_10050355 3300031852 Bacteria 2801
736 Ga0307410_10092721 3300031852 Bacteria 2148
737 Ga0307407_10044508 3300031903 Bacteria 2502
738 Ga0307412_10088400 3300031911 Bacteria 2161
739 Ga0307412_10104878 3300031911 Bacteria 2007
740 Ga0307409_100066238 3300031995 Bacteria 2847
741 Ga0307409_100317472 3300031995 Bacteria 1457
742 Ga0307416_100005151 3300032002 Bacteria 7986
743 Ga0307416_100076634 3300032002 Bacteria 2804
744 Ga0307416_100101398 3300032002 Bacteria 2507
745 Ga0307416_100205492 3300032002 Bacteria 1873
746 Ga0307414_10088337 3300032004 Bacteria 2294
747 Ga0307411_10023299 3300032005 Bacteria 3665
748 Ga0307411_10053656 3300032005 Bacteria 2643
749 Ga0307415_100034731 3300032126 Bacteria 3287
750 Ga0307415_100168617 3300032126 Bacteria 1705
751 Ga0316583_10000161 3300032133 Bacteria 16491
752 Ga0307510_10001061 3300033180 Bacteria 29217
753 Ga0307510_10018144 3300033180 Bacteria 8285
754 Ga0307510_10189304 3300033180 Bacteria 1608
755 Ga0315911_1000006 3300033442 Bacteria 414563
756 Ga0373934_0000809 3300035086 Bacteria 11287
757 Ga0373923_0003551 3300035111 Bacteria 5018
758 Ga0373939_0005631 3300035114 Bacteria 2986
759 Ga0373945_0053327 3300035116 Bacteria 1492
760 Ga0373953_0010484 3300035117 Bacteria 3227
761 Ga0373954_0004460 3300035118 Bacteria 6022
762 Ga0373954_0025998 3300035118 Bacteria 2680
763 Ga0373954_0037996 3300035118 Bacteria 2238
764 Ga0373954_0091116 3300035118 Bacteria 1464
765 Ga0373956_0021293 3300035119 Bacteria 2766
766 Ga0373943_0003661 3300035170 Bacteria 6984
767 Ga0373946_0057262 3300035171 Bacteria 1648
768 Ga0373946_0088339 3300035171 Bacteria 1369
769 Ga0373955_0000579 3300035172 Bacteria 15567
770 Ga0373955_0016866 3300035172 Bacteria 3602
771 Ga0373955_0069708 3300035172 Bacteria 1962
772 Ga0316574_0006300 3300035398 Bacteria 6399
773 Ga0373931_0002685 3300035691 Bacteria 7914
774 Ga0373931_0010435 3300035691 Bacteria 4464
775 Ga0373931_0057170 3300035691 Bacteria 2091
776 Ga0373931_0084162 3300035691 Bacteria 1761
777 Ga0373935_0007313 3300035692 Bacteria 6603
778 Ga0373927_0004515 3300035695 Bacteria 9733
779 Ga0373933_0000199 3300035724 Bacteria 39593
780 Ga0373933_0006955 3300035724 Bacteria 6165
781 Ga0373933_0058226 3300035724 Bacteria 2323
782 Ga0373933_0100512 3300035724 Bacteria 1794
783 Ga0373933_0117121 3300035724 Bacteria 1666
784 Ga0373947_0005028 3300035725 Bacteria 7744
785 Ga0373947_0025405 3300035725 Bacteria 3455
786 Ga0373937_0003611 3300036401 Bacteria 13052
787 Ga0373937_0009848 3300036401 Bacteria 8332
788 Ga0373937_0044106 3300036401 Bacteria 4072
789 Ga0373937_0072242 3300036401 Bacteria 3182
790 Ga0373937_0167701 3300036401 Unclassified 2059
791 Ga0373937_0171885 3300036401 Bacteria 2033
792 Ga0373937_0286505 3300036401 Bacteria 1556
793 Ga0316584_0099828 3300036712 Bacteria 2174
794 Ga0373925_0003743 3300037068 Bacteria 11681
795 Ga0373925_0019045 3300037068 Bacteria 4991
796 Ga0373925_0112208 3300037068 Bacteria 2107
797 Ga0395900_0050280 3300037418 Bacteria 4294
798 Ga0395898_0010756 3300037466 Bacteria 9557
799 Ga0395905_0014248 3300037471 Bacteria 7596
800 Ga0436364_0159552 3300037853 Bacteria 6262
801 Ga0436364_0332886 3300037853 Bacteria 1358
802 Ga0436364_1002723 3300037853 Bacteria 2130
803 Ga0436364_1129914 3300037853 Bacteria 2237
804 Ga0436364_1263634 3300037853 Bacteria 18472
805 Ga0237819_07049 3300038705 Bacteria 1641
806 Ga0400483_012107 3300039062 Bacteria 4852
807 Ga0400483_060028 3300039062 Bacteria 29430
808 Ga0400483_174473 3300039062 Bacteria 6329
809 Ga0436365_0042699 3300039437 Bacteria 1950
810 Ga0436365_0373092 3300039437 Bacteria 1456
811 Ga0436365_0480269 3300039437 Bacteria 1296
812 Ga0436365_0874274 3300039437 Bacteria 7559
813 Ga0436365_1873205 3300039437 Bacteria 55177
814 Ga0436360_0005552 3300039438 Bacteria 3131
815 Ga0436360_0244839 3300039438 Bacteria 1983
816 Ga0436363_0061042 3300039450 Bacteria 2567
817 Ga0436362_0425310 3300039453 Bacteria 6005
818 Ga0436362_0814308 3300039453 Bacteria 2364
819 Ga0439465_0038199 3300041413 Bacteria 1546
820 Ga0451789_0334473 3300041443 Bacteria 1704
821 Ga0451800_1533366 3300041459 Bacteria 1190
822 Ga0451802_1612203 3300041460 Bacteria 1578
823 Ga0451849_0127253 3300041505 Bacteria 11771
824 Ga0451849_1297764 3300041505 Bacteria 1288
825 Ga0451851_0093989 3300041507 Bacteria 6581
826 Ga0451843_1116914 3300041509 Bacteria 9359
827 Ga0439460_0014163 3300042461 Bacteria 2094
828 Ga0466969_0001806 3300044656 Bacteria 11418
829 Ga0466972_0000122 3300044658 Bacteria 65679
830 Ga0466972_0021579 3300044658 Bacteria 3209
831 Ga0466965_0048068 3300044683 Bacteria 2113
832 Ga0466966_0015940 3300044684 Bacteria 4967
833 Ga0466966_0064475 3300044684 Bacteria 2306
834 Ga0466966_0112704 3300044684 Bacteria 1675
835 Ga0466961_0000038 3300044693 Bacteria 80721
836 Ga0466961_0003784 3300044693 Bacteria 9465
837 Ga0466961_0070685 3300044693 Bacteria 2216
838 Ga0466961_0088516 3300044693 Bacteria 1956
839 Ga0466963_0028188 3300044694 Bacteria 3603
840 Ga0466971_0001023 3300044719 Bacteria 11558
841 Ga0466968_0009822 3300044735 Bacteria 3693
842 Ga0466957_0005921 3300044842 Bacteria 6888
843 Ga0466957_0080037 3300044842 Bacteria 2034
844 Ga0466960_0007498 3300044901 Bacteria 4434
845 Ga0466960_0062909 3300044901 Bacteria 1825
846 Ga0466959_0032699 3300045049 Bacteria 3850
847 Ga0466959_0040592 3300045049 Bacteria 3437
848 Ga0466959_0047117 3300045049 Bacteria 3171
849 Ga0466958_0027541 3300045836 Bacteria 3364
850 Ga0466958_0034205 3300045836 Bacteria 3031
851 Ga0466967_0090124 3300045976 Bacteria 2785
852 Ga0466967_0115112 3300045976 Bacteria 2476
853 Ga0466967_0130579 3300045976 Bacteria 2332
854 Ga0495592_0055975 3300046454 Bacteria 2916
855 Ga0495592_0087118 3300046454 Bacteria 2247
856 Ga0495603_0000464 3300046455 Bacteria 22234
857 Ga0495629_0003217 3300046459 Bacteria 12360
858 Ga0495629_0003540 3300046459 Bacteria 11801
859 Ga0495638_0000646 3300046460 Bacteria 38171
860 Ga0495638_0006201 3300046460 Bacteria 8735
861 Ga0495638_0015466 3300046460 Bacteria 5122
862 Ga0495638_0023643 3300046460 Bacteria 4016
863 Ga0495638_0030281 3300046460 Bacteria 3485
864 Ga0495641_0001561 3300046461 Bacteria 19375
865 Ga0495641_0056133 3300046461 Bacteria 1786
866 Ga0495651_0001584 3300046462 Bacteria 17573
867 Ga0495651_0001733 3300046462 Bacteria 16846
868 Ga0495651_0015996 3300046462 Bacteria 5812
869 Ga0495651_0109695 3300046462 Bacteria 2042
870 Ga0495651_0185048 3300046462 Bacteria 1471
871 Ga0495580_0004125 3300046472 Bacteria 12248
872 Ga0495580_0006636 3300046472 Bacteria 9401
873 Ga0495580_0091349 3300046472 Bacteria 2119
874 Ga0495582_0000174 3300046473 Bacteria 34996
875 Ga0495639_0001275 3300046475 Bacteria 11330
876 Ga0495639_0009802 3300046475 Bacteria 4112
877 Ga0495639_0021828 3300046475 Bacteria 2805
878 Ga0495664_0243825 3300046477 Bacteria 1087
879 Ga0495584_0094171 3300046491 Bacteria 1512
880 Ga0495594_0000563 3300046499 Bacteria 19022
881 Ga0495594_0188595 3300046499 Bacteria 1174
882 Ga0495596_0014316 3300046500 Bacteria 3342
883 Ga0495583_0070594 3300046506 Bacteria 1536
884 Ga0495606_0001179 3300046507 Bacteria 36884
885 Ga0495606_0111298 3300046507 Bacteria 1651
886 Ga0495608_0028010 3300046511 Bacteria 3830
887 Ga0495608_0231671 3300046511 Bacteria 1156
888 Ga0495610_0030421 3300046512 Bacteria 2831
889 Ga0495610_0042360 3300046512 Bacteria 2278
890 Ga0495618_0028419 3300046514 Bacteria 3485
891 Ga0495620_0061273 3300046515 Bacteria 1566
892 Ga0495628_0019369 3300046516 Bacteria 5627
893 Ga0495628_0029386 3300046516 Bacteria 4457
894 Ga0495628_0082191 3300046516 Bacteria 2502
895 Ga0495628_0144481 3300046516 Bacteria 1814
896 Ga0495630_0003152 3300046517 Bacteria 11443
897 Ga0495630_0008895 3300046517 Bacteria 7209
898 Ga0495632_0125389 3300046519 Bacteria 1197
899 Ga0495643_0021747 3300046522 Bacteria 3672
900 Ga0495648_0000865 3300046524 Bacteria 31943
901 Ga0495666_0088999 3300046526 Bacteria 1458
902 Ga0495652_0015532 3300046529 Bacteria 6815
903 Ga0495652_0017033 3300046529 Bacteria 6492
904 Ga0495652_0022885 3300046529 Bacteria 5543
905 Ga0495652_0041715 3300046529 Bacteria 3960
906 Ga0495652_0079764 3300046529 Bacteria 2705
907 Ga0495652_0257214 3300046529 Bacteria 1291
908 Ga0495654_0040560 3300046530 Bacteria 2319
909 Ga0495665_0010190 3300046531 Bacteria 5093
910 Ga0495640_0008774 3300046533 Bacteria 7916
911 Ga0495640_0017386 3300046533 Bacteria 5362
912 Ga0495640_0034294 3300046533 Bacteria 3600
913 Ga0495587_0001909 3300046536 Bacteria 13882
914 Ga0495587_0076489 3300046536 Bacteria 1944
915 Ga0495587_0104887 3300046536 Bacteria 1627
916 Ga0495598_0007673 3300046537 Bacteria 2484
917 Ga0495598_0018080 3300046537 Bacteria 1827
918 Ga0495597_0086921 3300046542 Bacteria 1331
919 Ga0495645_0012837 3300046543 Bacteria 5914
920 Ga0495645_0013747 3300046543 Bacteria 5735
921 Ga0495645_0040500 3300046543 Bacteria 3399
922 Ga0495645_0059590 3300046543 Bacteria 2768
923 Ga0495645_0222516 3300046543 Bacteria 1269
924 Ga0495622_0002132 3300046557 Bacteria 9644
925 Ga0495622_0012510 3300046557 Bacteria 3929
926 Ga0495622_0026990 3300046557 Bacteria 2680
927 Ga0495633_0032937 3300046558 Bacteria 2501
928 Ga0495667_0006122 3300046559 Bacteria 8143
929 Ga0495667_0034339 3300046559 Bacteria 3392
930 Ga0495667_0063156 3300046559 Bacteria 2425
931 Ga0495667_0109179 3300046559 Bacteria 1787
932 Ga0495656_0022549 3300046615 Bacteria 2467
933 Ga0495634_0000440 3300046642 Bacteria 41444
934 Ga0495634_0049893 3300046642 Bacteria 2812
935 Ga0495634_0085724 3300046642 Bacteria 2052
936 Ga0495634_0092836 3300046642 Bacteria 1958
937 Ga0495625_0035955 3300046660 Bacteria 3645
938 Ga0495635_0001961 3300046663 Bacteria 13984
939 Ga0495635_0009786 3300046663 Bacteria 6702
940 Ga0495635_0024964 3300046663 Bacteria 4164
941 Ga0495659_0026162 3300046664 Bacteria 2003
942 Ga0495659_0059796 3300046664 Bacteria 1405
943 Ga0495661_0148357 3300046665 Bacteria 1269
944 Ga0495588_0009960 3300046674 Bacteria 4406
945 Ga0495588_0023069 3300046674 Bacteria 3078
946 Ga0495588_0083273 3300046674 Bacteria 1671
947 Ga0495657_0034816 3300046675 Bacteria 3495
948 Ga0495657_0150878 3300046675 Unclassified 1443
949 Ga0495599_0112054 3300046678 Bacteria 1699
950 Ga0495623_0019287 3300046679 Bacteria 4408
951 Ga0495623_0020874 3300046679 Bacteria 4233
952 Ga0495646_0006220 3300046680 Bacteria 7572
953 Ga0495646_0013106 3300046680 Bacteria 5269
954 Ga0495646_0033992 3300046680 Bacteria 3169
955 Ga0495647_0002733 3300046681 Bacteria 5597
956 Ga0495658_0003337 3300046683 Bacteria 7963
957 Ga0495658_0008316 3300046683 Bacteria 5142
958 Ga0495669_0007675 3300046684 Bacteria 4527
959 Ga0495669_0126986 3300046684 Bacteria 1199
960 Ga0495613_0014627 3300046689 Bacteria 5823
961 Ga0495613_0078948 3300046689 Bacteria 2394
962 Ga0495613_0171281 3300046689 Bacteria 1541
963 Ga0495624_0003651 3300046690 Bacteria 11381
964 Ga0495670_0004878 3300046691 Bacteria 6588
965 Ga0495649_0044550 3300046694 Bacteria 2422
966 Ga0495600_0019438 3300046809 Bacteria 4338
967 Ga0495600_0059008 3300046809 Bacteria 2506
968 Ga0495600_0069899 3300046809 Bacteria 2294
969 Ga0495581_0000364 3300047315 Bacteria 22725
970 Ga0495581_0016513 3300047315 Bacteria 4290
971 Ga0495581_0100495 3300047315 Bacteria 1680
972 Ga0495604_0013959 3300047317 Bacteria 6406
973 Ga0495604_0021611 3300047317 Bacteria 5138
974 Ga0495674_0002401 3300047319 Bacteria 18338
975 Ga0495674_0003465 3300047319 Bacteria 15330
976 Ga0495674_0097951 3300047319 Bacteria 2498
977 Ga0495672_0019817 3300047320 Bacteria 4426
978 Ga0495672_0026578 3300047320 Bacteria 3691
979 Ga0495676_0080271 3300047321 Bacteria 2478
980 Ga0495680_0009840 3300047322 Bacteria 8571
981 Ga0495680_0045691 3300047322 Bacteria 3457
982 Ga0495683_0111410 3300047323 Bacteria 1306
983 Ga0495687_014000 3300047443 Bacteria 4151
984 Ga0495675_0013433 3300047444 Bacteria 5169
985 Ga0495675_0028265 3300047444 Bacteria 3575
986 Ga0495675_0197503 3300047444 Bacteria 1225
987 Ga0495684_0073996 3300047471 Bacteria 2588
988 Ga0495684_0101158 3300047471 Bacteria 2179
989 Ga0495684_0370833 3300047471 Bacteria 1012
990 Ga0495593_0003073 3300047673 Bacteria 10047
991 Ga0495593_0017893 3300047673 Bacteria 3990
992 Ga0495602_0029423 3300048088 Bacteria 5230
993 Ga0495602_0061523 3300048088 Bacteria 3264
994 Ga0495602_0174668 3300048088 Bacteria 1663
995 Ga0495614_0033888 3300048089 Bacteria 2196
996 Ga0496100_0021283 3300048903 Bacteria 3903
997 Ga0496100_0055951 3300048903 Bacteria 2579
998 Ga0496101_0020482 3300048904 Bacteria 4529
999 Ga0496102_0018859 3300048905 Bacteria 6069
1000 Ga0496103_0021841 3300048906 Bacteria 3852
1001 Ga0496103_0146337 3300048906 Bacteria 1512
1002 Ga0496104_0002456 3300048907 Bacteria 15968
1003 Ga0496104_0003213 3300048907 Bacteria 14057
1004 Ga0496104_0006629 3300048907 Bacteria 10188
1005 Ga0496104_0011152 3300048907 Bacteria 8040
1006 Ga0496104_0110868 3300048907 Bacteria 2631
1007 Ga0496104_0386429 3300048907 Bacteria 1312
1008 Ga0496104_0535274 3300048907 Bacteria 1082
1009 Ga0496105_0006042 3300048908 Bacteria 9260
1010 Ga0496105_0017354 3300048908 Bacteria 5768
1011 Ga0496105_0019704 3300048908 Bacteria 5442
1012 Ga0496105_0036063 3300048908 Bacteria 4073
1013 Ga0496105_0271802 3300048908 Bacteria 1368
1014 Ga0496106_0000028 3300048909 Bacteria 143296
1015 Ga0496106_0002717 3300048909 Bacteria 13109
1016 Ga0496106_0007152 3300048909 Bacteria 8242
1017 Ga0496106_0019968 3300048909 Bacteria 4969
1018 Ga0496106_0138299 3300048909 Bacteria 1915
1019 Ga0496107_0002712 3300048910 Bacteria 11610
1020 Ga0496107_0063697 3300048910 Bacteria 2672
1021 Ga0496108_0007691 3300048911 Bacteria 8729
1022 Ga0496108_0018223 3300048911 Bacteria 5748
1023 Ga0496108_0020337 3300048911 Bacteria 5456
1024 Ga0496108_0050214 3300048911 Bacteria 3491
1025 Ga0496108_0144347 3300048911 Bacteria 2051
1026 Ga0496109_0001205 3300048912 Bacteria 21515
1027 Ga0496109_0010098 3300048912 Bacteria 8054
1028 Ga0496109_0013765 3300048912 Bacteria 7029
1029 Ga0496109_0105287 3300048912 Bacteria 2620
1030 Ga0496109_0285705 3300048912 Bacteria 1555
1031 Ga0496110_0001225 3300048913 Bacteria 18281
1032 Ga0496110_0023813 3300048913 Bacteria 5211
1033 Ga0496110_0083715 3300048913 Bacteria 2846
1034 Ga0496110_0387115 3300048913 Bacteria 1274
1035 Ga0496111_0000449 3300048914 Bacteria 20923
1036 Ga0496111_0031629 3300048914 Bacteria 3770
1037 Ga0496111_0035352 3300048914 Bacteria 3570
1038 Ga0496111_0081843 3300048914 Bacteria 2357
1039 Ga0496111_0130188 3300048914 Bacteria 1862
1040 Ga0496111_0213810 3300048914 Bacteria 1432
1041 Ga0496112_0057106 3300048915 Bacteria 3842
1042 Ga0496112_0075363 3300048915 Bacteria 3336
1043 Ga0496112_0095272 3300048915 Bacteria 2947
1044 Ga0496112_0097514 3300048915 Bacteria 2910
1045 Ga0496112_0122063 3300048915 Bacteria 2576
1046 Ga0496112_0443835 3300048915 Bacteria 1235
1047 Ga0496112_0600891 3300048915 Bacteria 1032
1048 Ga0496113_0000528 3300048916 Bacteria 18859
1049 Ga0496113_0036976 3300048916 Bacteria 3580
1050 Ga0496113_0048196 3300048916 Bacteria 3170
1051 Ga0496114_0078102 3300048917 Bacteria 2792
1052 Ga0496114_0120594 3300048917 Bacteria 2255
1053 Ga0496114_0187509 3300048917 Bacteria 1808
1054 Ga0496115_0008662 3300048918 Bacteria 7537
1055 Ga0496115_0012089 3300048918 Bacteria 6491
1056 Ga0496115_0046219 3300048918 Bacteria 3478
1057 Ga0496116_0006031 3300048919 Bacteria 11095
1058 Ga0496116_0034686 3300048919 Bacteria 3555
1059 Ga0496117_0000181 3300048920 Bacteria 128436
1060 Ga0496117_0041085 3300048920 Bacteria 3393
1061 Ga0496117_0046908 3300048920 Bacteria 3104
1062 Ga0496117_0058063 3300048920 Bacteria 2682
1063 Ga0496118_0000188 3300048921 Bacteria 108224
1064 Ga0496118_0003916 3300048921 Bacteria 18225
1065 Ga0496118_0061710 3300048921 Bacteria 2774
1066 Ga0496118_0063583 3300048921 Bacteria 2714
1067 Ga0496118_0079546 3300048921 Bacteria 2312
1068 Ga0496119_0000132 3300048922 Bacteria 104666
1069 Ga0496119_0014102 3300048922 Bacteria 6289
1070 Ga0496119_0023757 3300048922 Bacteria 4335
1071 Ga0496120_0000134 3300048923 Bacteria 126148
1072 Ga0496120_0002412 3300048923 Bacteria 18988
1073 Ga0496120_0017393 3300048923 Bacteria 4665
1074 Ga0496120_0055365 3300048923 Bacteria 2243
1075 Ga0496121_0000594 3300048924 Bacteria 67953
1076 Ga0496121_0006633 3300048924 Bacteria 14254
1077 Ga0496121_0028476 3300048924 Bacteria 5198
1078 Ga0496121_0032431 3300048924 Bacteria 4747
1079 Ga0496121_0050022 3300048924 Bacteria 3536
1080 Ga0496121_0090671 3300048924 Bacteria 2389
1081 Ga0496121_0146782 3300048924 Bacteria 1742
1082 Ga0496122_0000071 3300048925 Bacteria 222537
1083 Ga0496122_0000183 3300048925 Bacteria 147475
1084 Ga0496122_0010744 3300048925 Bacteria 9391
1085 Ga0496122_0027687 3300048925 Bacteria 4836
1086 Ga0496122_0083670 3300048925 Bacteria 2211
1087 Ga0496122_0098611 3300048925 Bacteria 1962
1088 Ga0496123_0000006 3300048926 Bacteria 647258
1089 Ga0496123_0000184 3300048926 Bacteria 126173
1090 Ga0496123_0082335 3300048926 Bacteria 1952
1091 Ga0496124_0001712 3300048927 Bacteria 30940
1092 Ga0496124_0083048 3300048927 Bacteria 2629
1093 Ga0496124_0083442 3300048927 Bacteria 2621
1094 Ga0496125_0001059 3300048928 Bacteria 42520
1095 Ga0496125_0025922 3300048928 Bacteria 5356
1096 Ga0496125_0111936 3300048928 Bacteria 1974
1097 Ga0496125_0123401 3300048928 Bacteria 1841
1098 Ga0496125_0202850 3300048928 Bacteria 1296
1099 Ga0496125_0238612 3300048928 Bacteria 1156
1100 Ga0496126_0000731 3300048929 Bacteria 59707
1101 Ga0496126_0001122 3300048929 Bacteria 44809
1102 Ga0496126_0005275 3300048929 Bacteria 14845
1103 Ga0496126_0007487 3300048929 Bacteria 11959
1104 Ga0496126_0091265 3300048929 Bacteria 2679
1105 Ga0496126_0122053 3300048929 Bacteria 2258
1106 Ga0496126_0223372 3300048929 Bacteria 1581
1107 Ga0501031_0135259 3300049568 Bacteria 1610
1108 Ga0501031_0199887 3300049568 Bacteria 1304
1109 Ga0501032_0000358 3300049569 Bacteria 38004
1110 Ga0501032_0039103 3300049569 Bacteria 3228
1111 Ga0501032_0114576 3300049569 Bacteria 1783
1112 Ga0501033_0000059 3300049570 Bacteria 105311
1113 Ga0501033_0000601 3300049570 Bacteria 33366
1114 Ga0501033_0114869 3300049570 Bacteria 1956
1115 Ga0501033_0140771 3300049570 Bacteria 1744
1116 Ga0501033_0198400 3300049570 Bacteria 1434
1117 Ga0501034_0000162 3300049571 Bacteria 125834
1118 Ga0501034_0011504 3300049571 Bacteria 9171
1119 Ga0501034_0018888 3300049571 Bacteria 7061
1120 Ga0501034_0055027 3300049571 Bacteria 4004
1121 Ga0501034_0150452 3300049571 Bacteria 2304
1122 Ga0501034_0160487 3300049571 Bacteria 2219
1123 Ga0501034_0507018 3300049571 Bacteria 1120
1124 Ga0501036_0000067 3300049572 Bacteria 66279
1125 Ga0501036_0047223 3300049572 Bacteria 3647
1126 Ga0501036_0071806 3300049572 Bacteria 2926
1127 Ga0501036_0107880 3300049572 Bacteria 2354
1128 Ga0501036_0221723 3300049572 Bacteria 1588
1129 Ga0501037_0000089 3300049573 Bacteria 85102
1130 Ga0501037_0008457 3300049573 Bacteria 7547
1131 Ga0501037_0143788 3300049573 Bacteria 1706
1132 Ga0501037_0167291 3300049573 Bacteria 1565
1133 Ga0501037_0250136 3300049573 Bacteria 1240
1134 Ga0501038_0045248 3300049574 Bacteria 3821
1135 Ga0501038_0080791 3300049574 Bacteria 2740
1136 Ga0501038_0101713 3300049574 Bacteria 2392
1137 Ga0501038_0132578 3300049574 Bacteria 2044
1138 Ga0501038_0318575 3300049574 Bacteria 1217
1139 Ga0501039_0002338 3300049575 Bacteria 14104
1140 Ga0501039_0057192 3300049575 Bacteria 3020
1141 Ga0501039_0070467 3300049575 Bacteria 2716
1142 Ga0501039_0128118 3300049575 Bacteria 1991
1143 Ga0501039_0130432 3300049575 Bacteria 1973
1144 Ga0501040_0003598 3300049576 Bacteria 10022
1145 Ga0501040_0004009 3300049576 Bacteria 9568
1146 Ga0501040_0007868 3300049576 Bacteria 6908
1147 Ga0501040_0008056 3300049576 Bacteria 6843
1148 Ga0501040_0028568 3300049576 Bacteria 3761
1149 Ga0501040_0093448 3300049576 Bacteria 2092
1150 Ga0501040_0216099 3300049576 Bacteria 1363
1151 Ga0501041_0002102 3300049577 Bacteria 11219
1152 Ga0501041_0003406 3300049577 Bacteria 9148
1153 Ga0501041_0045183 3300049577 Bacteria 2677
1154 Ga0501041_0152055 3300049577 Bacteria 1445
1155 Ga0501042_0001632 3300049578 Bacteria 13349
1156 Ga0501042_0006693 3300049578 Bacteria 7508
1157 Ga0501042_0085145 3300049578 Bacteria 2267
1158 Ga0501042_0091547 3300049578 Bacteria 2183
1159 Ga0501042_0198575 3300049578 Bacteria 1446
1160 Ga0501043_0000007 3300049579 Bacteria 224595
1161 Ga0501043_0007369 3300049579 Bacteria 8730
1162 Ga0501043_0040463 3300049579 Bacteria 3663
1163 Ga0501043_0070570 3300049579 Bacteria 2744
1164 Ga0501043_0393522 3300049579 Bacteria 1048
1165 Ga0501046_0003917 3300049580 Bacteria 13622
1166 Ga0501046_0020518 3300049580 Bacteria 5462
1167 Ga0501046_0020844 3300049580 Bacteria 5413
1168 Ga0501046_0080108 3300049580 Bacteria 2524
1169 Ga0501046_0087965 3300049580 Bacteria 2393
1170 Ga0501046_0201221 3300049580 Bacteria 1482
1171 Ga0501047_0000901 3300049581 Bacteria 30317
1172 Ga0501047_0053972 3300049581 Bacteria 3888
1173 Ga0501047_0067919 3300049581 Bacteria 3434
1174 Ga0501047_0246989 3300049581 Bacteria 1634
1175 Ga0501047_0267709 3300049581 Bacteria 1555
1176 Ga0501047_0294096 3300049581 Bacteria 1467
1177 Ga0501047_0304180 3300049581 Bacteria 1436
1178 Ga0501047_0323716 3300049581 Bacteria 1381
1179 Ga0501048_0002159 3300049582 Bacteria 14978
1180 Ga0501048_0130404 3300049582 Bacteria 1777
1181 Ga0501048_0150818 3300049582 Bacteria 1644
1182 Ga0501067_0000183 3300049583 Bacteria 35692
1183 Ga0501067_0021908 3300049583 Bacteria 3536
1184 Ga0501067_0057288 3300049583 Bacteria 2158
1185 Ga0501068_0008815 3300049584 Bacteria 5626
1186 Ga0501068_0023446 3300049584 Bacteria 3617
1187 Ga0501068_0037779 3300049584 Bacteria 2891
1188 Ga0501068_0057453 3300049584 Bacteria 2359
1189 Ga0501068_0149580 3300049584 Bacteria 1467
1190 Ga0501069_0000001 3300049585 Bacteria 289100
1191 Ga0501069_0003478 3300049585 Bacteria 8111
1192 Ga0501069_0027181 3300049585 Bacteria 3135
1193 Ga0501069_0108479 3300049585 Bacteria 1579
1194 Ga0501070_0000071 3300049586 Bacteria 86669
1195 Ga0501070_0001014 3300049586 Bacteria 25206
1196 Ga0501070_0001781 3300049586 Bacteria 19026
1197 Ga0501070_0040423 3300049586 Bacteria 3888
1198 Ga0501070_0101042 3300049586 Bacteria 2385
1199 Ga0501070_0126323 3300049586 Bacteria 2114
1200 Ga0501070_0148565 3300049586 Bacteria 1934
1201 Ga0501070_0257370 3300049586 Bacteria 1427
1202 Ga0501071_0000995 3300049587 Bacteria 15534
1203 Ga0501071_0001381 3300049587 Bacteria 13915
1204 Ga0501071_0003778 3300049587 Bacteria 9513
1205 Ga0501071_0042984 3300049587 Bacteria 3239
1206 Ga0501071_0062272 3300049587 Bacteria 2703
1207 Ga0501071_0074779 3300049587 Bacteria 2473
1208 Ga0501071_0108303 3300049587 Bacteria 2052
1209 Ga0501071_0132791 3300049587 Bacteria 1850
1210 Ga0501071_0166708 3300049587 Bacteria 1648
1211 Ga0501072_0001396 3300049588 Bacteria 18172
1212 Ga0501072_0009787 3300049588 Bacteria 7288
1213 Ga0501072_0078523 3300049588 Bacteria 2613
1214 Ga0501072_0093776 3300049588 Bacteria 2385
1215 Ga0501072_0251758 3300049588 Bacteria 1407
1216 Ga0501072_0265287 3300049588 Bacteria 1367
1217 Ga0501073_0018515 3300049589 Bacteria 5034
1218 Ga0501073_0023792 3300049589 Bacteria 4398
1219 Ga0501073_0083080 3300049589 Bacteria 2229
1220 Ga0501073_0144843 3300049589 Bacteria 1646
1221 Ga0501073_0149747 3300049589 Bacteria 1617
1222 Ga0501074_0000003 3300049590 Bacteria 116101
1223 Ga0501074_0009395 3300049590 Bacteria 7107
1224 Ga0501074_0010413 3300049590 Bacteria 6748
1225 Ga0501074_0014088 3300049590 Bacteria 5812
1226 Ga0501074_0027427 3300049590 Bacteria 4130
1227 Ga0501074_0102499 3300049590 Bacteria 2049
1228 Ga0501074_0107706 3300049590 Bacteria 1995
1229 Ga0501074_0229627 3300049590 Bacteria 1321
1230 Ga0501075_0001266 3300049591 Bacteria 16367
1231 Ga0501075_0002380 3300049591 Bacteria 12510
1232 Ga0501075_0010012 3300049591 Bacteria 6649
1233 Ga0501075_0023068 3300049591 Bacteria 4553
1234 Ga0501075_0032621 3300049591 Bacteria 3870
1235 Ga0501075_0136993 3300049591 Bacteria 1865
1236 Ga0501076_0003220 3300049592 Bacteria 11406
1237 Ga0501076_0030585 3300049592 Bacteria 4194
1238 Ga0501076_0041585 3300049592 Bacteria 3617
1239 Ga0501076_0047771 3300049592 Bacteria 3384
1240 Ga0501076_0050027 3300049592 Bacteria 3306
1241 Ga0501076_0146555 3300049592 Bacteria 1919
1242 Ga0501077_0004422 3300049593 Bacteria 8530
1243 Ga0501077_0029809 3300049593 Bacteria 3469
1244 Ga0501077_0034086 3300049593 Bacteria 3240
1245 Ga0501077_0041052 3300049593 Bacteria 2946
1246 Ga0501252_008995 3300049682 Bacteria 1158
1247 Ga0501079_0001105 3300049741 Bacteria 18754
1248 Ga0501079_0001367 3300049741 Bacteria 17165
1249 Ga0501079_0003178 3300049741 Bacteria 12031
1250 Ga0501079_0027398 3300049741 Bacteria 4369
1251 Ga0501079_0028121 3300049741 Bacteria 4314
1252 Ga0501079_0052679 3300049741 Bacteria 3140
1253 Ga0501079_0085369 3300049741 Bacteria 2443
1254 Ga0501079_0153775 3300049741 Bacteria 1793
1255 Ga0501079_0199306 3300049741 Bacteria 1563
1256 Ga0501080_0000209 3300049742 Bacteria 43431
1257 Ga0501080_0000470 3300049742 Bacteria 31361
1258 Ga0501080_0010814 3300049742 Bacteria 8350
1259 Ga0501080_0091709 3300049742 Bacteria 2822
1260 Ga0501080_0246001 3300049742 Bacteria 1631
1261 Ga0501080_0285558 3300049742 Bacteria 1499
1262 Ga0501081_0000257 3300049743 Bacteria 27543
1263 Ga0501081_0000797 3300049743 Bacteria 18573
1264 Ga0501081_0007912 3300049743 Bacteria 6896
1265 Ga0501081_0008343 3300049743 Bacteria 6723
1266 Ga0501081_0118112 3300049743 Bacteria 1887
1267 Ga0501081_0288942 3300049743 Bacteria 1201
1268 Ga0501081_0303169 3300049743 Bacteria 1172
1269 Ga0501083_0000080 3300049744 Bacteria 64705
1270 Ga0501083_0001378 3300049744 Bacteria 16511
1271 Ga0501083_0008847 3300049744 Bacteria 7109
1272 Ga0501083_0046021 3300049744 Bacteria 2951
1273 Ga0501083_0092065 3300049744 Bacteria 2001
1274 Ga0501083_0200771 3300049744 Bacteria 1300
1275 Ga0501083_0327736 3300049744 Bacteria 996
1276 Ga0501241_010018 3300049758 Bacteria 1724
1277 Ga0501268_004850 3300049765 Bacteria 1910
1278 Ga0501283_002244 3300049779 Bacteria 2506
1279 Ga0501035_0000037 3300049822 Bacteria 160921
1280 Ga0501035_0000213 3300049822 Bacteria 69670
1281 Ga0501035_0000581 3300049822 Bacteria 40293
1282 Ga0501035_0001584 3300049822 Bacteria 23082
1283 Ga0501035_0029223 3300049822 Bacteria 5026
1284 Ga0501035_0030183 3300049822 Bacteria 4942
1285 Ga0501035_0039760 3300049822 Bacteria 4255
1286 Ga0501035_0096497 3300049822 Bacteria 2597
1287 Ga0501035_0251260 3300049822 Bacteria 1501
1288 Ga0501035_0335096 3300049822 Bacteria 1269
1289 Ga0501035_0339850 3300049822 Bacteria 1258
1290 Ga0501035_0411487 3300049822 Bacteria 1124
1291 Ga0501044_0000018 3300049823 Bacteria 225885
1292 Ga0501044_0004948 3300049823 Bacteria 14902
1293 Ga0501044_0007966 3300049823 Bacteria 11640
1294 Ga0501044_0030190 3300049823 Bacteria 5713
1295 Ga0501044_0077831 3300049823 Bacteria 3362
1296 Ga0501044_0089116 3300049823 Bacteria 3114
1297 Ga0501044_0093205 3300049823 Bacteria 3037
1298 Ga0501044_0104749 3300049823 Bacteria 2842
1299 Ga0501044_0250080 3300049823 Bacteria 1714
1300 Ga0501045_0015832 3300049824 Bacteria 5348
1301 Ga0501045_0030529 3300049824 Bacteria 3901
1302 Ga0501045_0121980 3300049824 Bacteria 1935
1303 Ga0501045_0148823 3300049824 Bacteria 1741
1304 Ga0501045_0149095 3300049824 Bacteria 1740
1305 nmdc:mga03n38_13302_c1 3300050490 Bacteria 3121
1306 nmdc:mga00v17_244037_c1 3300050491 Bacteria 1165
1307 nmdc:mga00v17_62489_c1 3300050491 Bacteria 2291
1308 nmdc:mga00v17_67298_c1 3300050491 Bacteria 2213
1309 nmdc:mga00v17_69251_c1 3300050491 Bacteria 2183
1310 nmdc:mga00v17_95615_c1 3300050491 Bacteria 1870
1311 nmdc:mga0yw44_21367_c1 3300050492 Bacteria 3609
1312 nmdc:mga0yw44_23562_c2 3300050492 Bacteria 1544
1313 nmdc:mga0yw44_27119_c1 3300050492 Bacteria 3278
1314 nmdc:mga0yw44_27937_c1 3300050492 Bacteria 3239
1315 nmdc:mga0yw44_56798_c1 3300050492 Bacteria 2386
1316 nmdc:mga0yw44_6339_c1 3300050492 Bacteria 5709
1317 nmdc:mga0yw44_65487_c1 3300050492 Bacteria 2240
1318 nmdc:mga0k408_14459_c1 3300050493 Bacteria 4350
1319 nmdc:mga0k408_159055_c1 3300050493 Bacteria 1345
1320 nmdc:mga0k408_22966_c1 3300050493 Bacteria 3515
1321 nmdc:mga06z11_1878_c2 3300050494 Bacteria 5356
1322 nmdc:mga06z11_223703_c1 3300050494 Bacteria 1101
1323 nmdc:mga06z11_7550_c1 3300050494 Bacteria 4483
1324 nmdc:mga06z11_8998_c1 3300050494 Bacteria 4193
1325 nmdc:mga04h51_23128_c1 3300050495 Bacteria 1889
1326 nmdc:mga04h51_48203_c1 3300050495 Bacteria 1419
1327 nmdc:mga04h51_60850_c1 3300050495 Bacteria 1294
1328 nmdc:mga04h51_99319_c1 3300050495 Bacteria 1059
1329 nmdc:mga07m45_13999_c1 3300050496 Bacteria 4265
1330 nmdc:mga07m45_43289_c1 3300050496 Bacteria 2524
1331 nmdc:mga07m45_73106_c1 3300050496 Bacteria 1952
1332 nmdc:mga05p37_112398_c1 3300050507 Bacteria 3350
1333 nmdc:mga05p37_14606_c1 3300050507 Bacteria 9433
1334 nmdc:mga05p37_2371_c1 3300050507 Bacteria 21934
1335 nmdc:mga05p37_284136_c1 3300050507 Bacteria 1972
1336 nmdc:mga05p37_332899_c1 3300050507 Bacteria 1793
1337 nmdc:mga05p37_346856_c1 3300050507 Bacteria 1749
1338 nmdc:mga05p37_37371_c2 3300050507 Bacteria 2109
1339 nmdc:mga05p37_46906_c1 3300050507 Bacteria 5313
1340 nmdc:mga05p37_57709_c1 3300050507 Bacteria 4781
1341 nmdc:mga09592_216541_c1 3300050508 Bacteria 1659
1342 nmdc:mga09592_31291_c1 3300050508 Bacteria 4433
1343 nmdc:mga09592_59754_c1 3300050508 Bacteria 3222
1344 nmdc:mga09592_74554_c1 3300050508 Bacteria 2883
1345 nmdc:mga0qj67_173157_c1 3300050509 Bacteria 1753
1346 nmdc:mga0qj67_2705_c1 3300050509 Bacteria 12711
1347 nmdc:mga0qj67_94901_c1 3300050509 Bacteria 2400
1348 nmdc:mga0qj67_9586_c1 3300050509 Bacteria 7216
1349 nmdc:mga06r32_210164_c1 3300050510 Bacteria 1934
1350 nmdc:mga08y16_14581_c1 3300050511 Bacteria 8266
1351 nmdc:mga08y16_15806_c1 3300050511 Bacteria 7935
1352 nmdc:mga08y16_259804_c1 3300050511 Bacteria 1793
1353 nmdc:mga08y16_2822_c1 3300050511 Bacteria 17849
1354 nmdc:mga08y16_41809_c1 3300050511 Bacteria 4801
1355 nmdc:mga08y16_498387_c1 3300050511 Bacteria 1238
1356 nmdc:mga08y16_718_c1 3300050511 Bacteria 31510
1357 nmdc:mga0n895_11949_c1 3300050512 Bacteria 7770
1358 nmdc:mga0n895_23867_c1 3300050512 Bacteria 5755
1359 nmdc:mga0n895_27184_c1 3300050512 Bacteria 5432
1360 nmdc:mga0n895_3422_c1 3300050512 Bacteria 12798
1361 nmdc:mga0n895_364630_c1 3300050512 Bacteria 1463
1362 nmdc:mga0n895_48_c1 3300050512 Bacteria 73654
1363 nmdc:mga0n895_5346_c1 3300050512 Bacteria 10707
1364 nmdc:mga0n895_62545_c1 3300050512 Bacteria 3680
1365 nmdc:mga0n895_80547_c1 3300050512 Bacteria 3245
1366 nmdc:mga0rr50_108952_c1 3300050513 Bacteria 2189
1367 nmdc:mga0rr50_18_c1 3300050513 Bacteria 166751
1368 nmdc:mga0rr50_19346_c1 3300050513 Bacteria 4594
1369 nmdc:mga0rr50_24003_c1 3300050513 Bacteria 4217
1370 nmdc:mga0rr50_26786_c1 3300050513 Bacteria 4029
1371 nmdc:mga0rr50_37466_c1 3300050513 Bacteria 3501
1372 nmdc:mga0rr50_80697_c1 3300050513 Bacteria 2509
1373 nmdc:mga08x19_12824_c1 3300050514 Bacteria 5055
1374 nmdc:mga08x19_143_c1 3300050514 Bacteria 62934
1375 nmdc:mga08x19_15312_c1 3300050514 Bacteria 4666
1376 nmdc:mga0a205_2040_c1 3300050515 Bacteria 17638
1377 nmdc:mga0a205_239948_c1 3300050515 Bacteria 1694
1378 nmdc:mga0a205_29327_c1 3300050515 Bacteria 5265
1379 nmdc:mga0a205_3340_c1 3300050515 Bacteria 14294
1380 nmdc:mga0a205_49854_c1 3300050515 Bacteria 4042
1381 nmdc:mga0a205_80154_c1 3300050515 Bacteria 3155
1382 nmdc:mga0a205_86016_c1 3300050515 Bacteria 3036
1383 nmdc:mga0sz30_138188_c1 3300050516 Bacteria 1075
1384 nmdc:mga0sz30_19571_c1 3300050516 Bacteria 2723
1385 nmdc:mga0sz30_3474_c2 3300050516 Bacteria 4650
1386 nmdc:mga0sz30_57701_c1 3300050516 Bacteria 1325
1387 Ga0495601_0005620 3300053077 Bacteria 7311
1388 Ga0495601_0010254 3300053077 Bacteria 5572
1389 Ga0495601_0024080 3300053077 Bacteria 3747
1390 Ga0495612_0022715 3300053078 Bacteria 2514
1391 Ga0495612_0032398 3300053078 Bacteria 2112
1392 Ga0495612_0047992 3300053078 Bacteria 1750
1393 Ga0495612_0050367 3300053078 Bacteria 1710
1394 Ga0495595_0042699 3300053084 Bacteria 2077
1395 Ga0495595_0129829 3300053084 Bacteria 1231
1396 Ga0495619_0019038 3300053085 Bacteria 4361
1397 Ga0500643_000007 3300053087 Bacteria 462836
1398 Ga0500643_001354 3300053087 Bacteria 14257
1399 Ga0500643_005900 3300053087 Bacteria 5196
1400 Ga0500643_013214 3300053087 Bacteria 2924
1401 Ga0500644_0000529 3300053088 Bacteria 15960
1402 Ga0500644_0012687 3300053088 Bacteria 2336
1403 Ga0500647_0014787 3300053091 Bacteria 3556
1404 Ga0500583_0021347 3300053092 Bacteria 2691
1405 Ga0500651_0000483 3300053093 Bacteria 20822
1406 Ga0500651_0001970 3300053093 Bacteria 10645
1407 Ga0500651_0041450 3300053093 Bacteria 2902
1408 Ga0500566_0000732 3300053094 Bacteria 18439
1409 Ga0500566_0001155 3300053094 Bacteria 15356
1410 Ga0500566_0047464 3300053094 Bacteria 2465
1411 Ga0500650_0000157 3300053098 Bacteria 17929
1412 Ga0500554_003665 3300053102 Bacteria 3165
1413 Ga0500554_011814 3300053102 Bacteria 2176
1414 Ga0500556_0000002 3300053104 Bacteria 773626
1415 Ga0500556_0004146 3300053104 Bacteria 4148
1416 Ga0500557_000052 3300053105 Bacteria 50636
1417 Ga0500560_003776 3300053107 Bacteria 3116
1418 Ga0500562_036076 3300053108 Bacteria 1310
1419 Ga0500592_003479 3300053116 Bacteria 2515
1420 Ga0500595_000029 3300053119 Bacteria 122318
1421 Ga0500595_000062 3300053119 Bacteria 77506
1422 Ga0500595_000662 3300053119 Bacteria 20656
1423 Ga0500595_001510 3300053119 Bacteria 12357
1424 Ga0500595_001720 3300053119 Bacteria 11420
1425 Ga0500595_017250 3300053119 Bacteria 2669
1426 Ga0500595_062019 3300053119 Bacteria 1126
1427 Ga0500608_058711 3300053122 Bacteria 1841
1428 Ga0500618_006476 3300053125 Bacteria 3431
1429 Ga0500642_0000016 3300053130 Bacteria 176560
1430 Ga0500642_0000306 3300053130 Bacteria 17531
1431 Ga0500658_0000831 3300053134 Bacteria 12699
1432 Ga0500658_0006618 3300053134 Bacteria 4294
1433 Ga0500658_0086851 3300053134 Bacteria 1346
1434 Ga0500559_0000066 3300053136 Bacteria 84664
1435 Ga0500559_0004531 3300053136 Bacteria 6573
1436 Ga0500568_0001959 3300053139 Bacteria 12590
1437 Ga0500568_0011491 3300053139 Bacteria 4104
1438 Ga0500590_054921 3300053148 Bacteria 2016
1439 Ga0500603_002409 3300053150 Bacteria 4106
1440 Ga0500604_0000635 3300053151 Bacteria 9651
1441 Ga0500616_0000006 3300053153 Bacteria 944738
1442 Ga0500616_0000061 3300053153 Bacteria 249158
1443 Ga0500616_0004316 3300053153 Bacteria 10198
1444 Ga0500616_0024589 3300053153 Bacteria 3344
1445 Ga0500616_0050298 3300053153 Bacteria 2201
1446 Ga0500622_0000206 3300053156 Bacteria 62842
1447 Ga0500622_0000518 3300053156 Bacteria 35866
1448 Ga0500622_0024809 3300053156 Bacteria 3171
1449 Ga0500633_0000512 3300053160 Bacteria 6224
1450 Ga0500638_000568 3300053162 Bacteria 9420
1451 Ga0500638_034681 3300053162 Bacteria 2442
1452 Ga0500636_0000042 3300053177 Bacteria 69412
1453 Ga0500636_0001934 3300053177 Bacteria 11375
1454 Ga0500636_0003021 3300053177 Bacteria 9428
1455 Ga0500636_0063895 3300053177 Bacteria 2145
1456 Ga0500637_0000132 3300053178 Bacteria 27236
1457 Ga0500637_0012756 3300053178 Bacteria 4387
1458 Ga0500625_018538 3300053729 Bacteria 3262
1459 Ga0500645_025733 3300053730 Bacteria 1794
1460 Ga0500645_025918 3300053730 Bacteria 1786
1461 Ga0500599_001085 3300053736 Bacteria 3066
1462 Ga0501084_0001746 3300054114 Bacteria 17270
1463 Ga0501084_0009362 3300054114 Bacteria 8104
1464 Ga0501084_0033942 3300054114 Bacteria 4267
1465 Ga0501084_0037310 3300054114 Bacteria 4060
1466 Ga0501084_0098511 3300054114 Bacteria 2455
1467 Ga0500661_004435 3300055283 Bacteria 2624
1468 Ga0500661_007644 3300055283 Bacteria 1995
1469 Ga0501082_0002028 3300060353 Bacteria 17816
1470 Ga0501082_0002949 3300060353 Bacteria 14848
1471 Ga0501082_0007494 3300060353 Bacteria 9416
1472 Ga0501082_0029516 3300060353 Bacteria 4724
1473 Ga0501082_0032895 3300060353 Bacteria 4472
1474 Ga0501082_0038762 3300060353 Bacteria 4110
1475 Ga0501082_0075376 3300060353 Bacteria 2907
1476 Ga0501082_0076459 3300060353 Bacteria 2886
1477 Ga0501082_0100021 3300060353 Bacteria 2507
1478 Ga0501082_0129076 3300060353 Bacteria 2193
1479 Ga0501082_0148717 3300060353 Bacteria 2034
1480 Ga0466962_0001520 3300061719 Bacteria 10827
1481 Ga0530510_0002388 3300061734 Bacteria 12923
1482 Ga0530510_0004211 3300061734 Bacteria 9945
1483 Ga0530510_0012148 3300061734 Bacteria 6045
1484 Ga0530510_0031335 3300061734 Bacteria 3823
1485 Ga0530510_0034022 3300061734 Bacteria 3670
1486 Ga0530510_0071443 3300061734 Bacteria 2519
1487 Ga0530510_0149872 3300061734 Bacteria 1722
1488 Ga0530510_0165227 3300061734 Bacteria 1638

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2857531043 2857535669 312
2 iso_pu_bacteria 2905926851 2905929604 312
3 iso_pu_bacteria 2995392953 2995394574 312
4 3300031456 Ga0307513_10000003 Ga0307513_10000003478 313
5 3300039062 Ga0400483_012107 Ga0400483_012107_3481_4428 313
6 3300039062 Ga0400483_060028 Ga0400483_060028_15045_15992 313
7 3300039062 Ga0400483_174473 Ga0400483_174473_4609_5556 313
8 iso_pu_bacteria 2509276021 2509392467 314
9 iso_pu_bacteria 2510917030 2511197487 314
10 iso_pu_bacteria 2513237093 2513629891 314
11 iso_pu_bacteria 2513237103 2513708527 314
12 iso_pu_bacteria 2515154113 2515632817 314
13 iso_pu_bacteria 2515154114 2515639965 314
14 iso_pu_bacteria 2516653077 2517036215 314
15 iso_pu_bacteria 2582581304 2585255791 314
16 iso_pu_bacteria 2582581315 2585324966 314
17 iso_pu_bacteria 2585427590 2585820631 314
18 iso_pu_bacteria 2643221580 2643911182 314
19 iso_pu_bacteria 2643221674 2644412473 314
20 iso_pu_bacteria 2643221736 2644746088 314
21 iso_pu_bacteria 2738541317 2738944658 314
22 iso_pu_bacteria 2765235942 2766067367 314
23 iso_pu_bacteria 2802429605 2805931322 314
24 iso_pu_bacteria 2818991461 2819683300 314
25 iso_pu_bacteria 2842110456 2842114213 314
26 iso_pu_bacteria 2842217011 2842217443 314
27 iso_pu_bacteria 2842217011 2842223559 314
28 iso_pu_bacteria 2851182111 2851187636 314
29 iso_pu_bacteria 2857516855 2857519897 314
30 iso_pu_bacteria 2913308742 2913309279 314
31 iso_pu_bacteria 2919100787 2919105761 314
32 iso_pu_bacteria 2933586486 2933590309 314
33 iso_pu_bacteria 3005445848 3005448992 314
34 iso_pu_bacteria 639633055 639648730 314
35 iso_pu_bacteria 8005556819 8005557516 314
36 iso_pu_bacteria 8005563573 8005568692 314
37 iso_pu_bacteria 8018163183 8018166602 314
38 iso_pu_bacteria 8024479707 8024483348 314
39 iso_pu_bacteria 8057874678 8057874855 314
40 3300005439 Ga0070711_100037458 Ga0070711_1000374584 315
41 3300005983 Ga0081540_1030904 Ga0081540_10309042 315
42 3300006195 Ga0075366_10164527 Ga0075366_101645272 315
43 3300021388 Ga0213875_10012987 Ga0213875_100129874 315
44 3300025256 Ga0209759_1023293 Ga0209759_10232932 315
45 3300032002 Ga0307416_100076634 Ga0307416_1000766341 315
46 3300032126 Ga0307415_100034731 Ga0307415_1000347313 315
47 3300037853 Ga0436364_0159552 Ga0436364_0159552_4379_5326 315
48 3300044901 Ga0466960_0062909 Ga0466960_0062909_150_1100 315
49 3300049571 Ga0501034_0055027 Ga0501034_0055027_2854_3813 315
50 3300049588 Ga0501072_0093776 Ga0501072_0093776_654_1601 315
51 3300061734 Ga0530510_0031335 Ga0530510_0031335_577_1524 315
52 iso_pu_bacteria 2508501050 2508732765 315
53 iso_pu_bacteria 2510917022 2511135334 315
54 iso_pu_bacteria 2517572143 2517892065 315
55 iso_pu_bacteria 2582581307 2585271071 315
56 iso_pu_bacteria 2585427531 2585558795 315
57 iso_pu_bacteria 2585427609 2585904235 315
58 iso_pu_bacteria 2585428125 2587980648 315
59 iso_pu_bacteria 2602042107 2603856776 315
60 iso_pu_bacteria 2842509118 2842512718 315
61 iso_pu_bacteria 2857524615 2857528254 315
62 iso_pu_bacteria 2876808645 2876813030 315
63 iso_pu_bacteria 2879110137 2879115852 315
64 iso_pu_bacteria 2893066018 2893068687 315
65 iso_pu_bacteria 2989771324 2989776547 315
66 iso_pu_bacteria 8057575449 8057578850 315
67 3300003771 Ga0055526_1000231 Ga0055526_100023127 316
68 3300005331 Ga0070670_100029544 Ga0070670_1000295442 316
69 3300005337 Ga0070682_100317739 Ga0070682_1003177391 316
70 3300005338 Ga0068868_100028693 Ga0068868_1000286932 316
71 3300005340 Ga0070689_100246889 Ga0070689_1002468891 316
72 3300005356 Ga0070674_100212123 Ga0070674_1002121232 316
73 3300005435 Ga0070714_100031982 Ga0070714_1000319825 316
74 3300005435 Ga0070714_100045004 Ga0070714_1000450042 316
75 3300005436 Ga0070713_100073363 Ga0070713_1000733633 316
76 3300005455 Ga0070663_100102135 Ga0070663_1001021352 316
77 3300005544 Ga0070686_100089086 Ga0070686_1000890862 316
78 3300005548 Ga0070665_100059576 Ga0070665_1000595764 316
79 3300005548 Ga0070665_100125579 Ga0070665_1001255791 316
80 3300005548 Ga0070665_100224591 Ga0070665_1002245912 316
81 3300005719 Ga0068861_100107591 Ga0068861_1001075912 316
82 3300005842 Ga0068858_100071961 Ga0068858_1000719613 316
83 3300005842 Ga0068858_100209323 Ga0068858_1002093232 316
84 3300005842 Ga0068858_100581369 Ga0068858_1005813692 316
85 3300005843 Ga0068860_100241907 Ga0068860_1002419072 316
86 3300005844 Ga0068862_100279568 Ga0068862_1002795682 316
87 3300005844 Ga0068862_100288452 Ga0068862_1002884521 316
88 3300005983 Ga0081540_1003143 Ga0081540_100314310 316
89 3300005983 Ga0081540_1004962 Ga0081540_10049621 316
90 3300005983 Ga0081540_1017195 Ga0081540_10171952 316
91 3300005983 Ga0081540_1044360 Ga0081540_10443603 316
92 3300005985 Ga0081539_10046864 Ga0081539_100468642 316
93 3300006028 Ga0070717_10020633 Ga0070717_100206332 316
94 3300006048 Ga0075363_100001035 Ga0075363_1000010352 316
95 3300006051 Ga0075364_10026851 Ga0075364_100268512 316
96 3300006051 Ga0075364_10084514 Ga0075364_100845142 316
97 3300006178 Ga0075367_10000988 Ga0075367_100009883 316
98 3300006178 Ga0075367_10069585 Ga0075367_100695855 316
99 3300006844 Ga0075428_100079146 Ga0075428_1000791462 316
100 3300006871 Ga0075434_100059447 Ga0075434_1000594472 316
101 3300007788 Ga0099795_10028929 Ga0099795_100289292 316
102 3300009094 Ga0111539_10194327 Ga0111539_101943272 316
103 3300009147 Ga0114129_10279660 Ga0114129_102796602 316
104 3300009177 Ga0105248_10130741 Ga0105248_101307414 316
105 3300009551 Ga0105238_10133883 Ga0105238_101338833 316
106 3300013250 Ga0171462_1027 Ga0171462_102735 316
107 3300013308 Ga0157375_10041991 Ga0157375_100419912 316
108 3300014325 Ga0163163_10300763 Ga0163163_103007632 316
109 3300025294 Ga0209025_1003280 Ga0209025_10032804 316
110 3300025295 Ga0209564_1000023 Ga0209564_1000023383 316
111 3300025297 Ga0209758_1007070 Ga0209758_100707010 316
112 3300025925 Ga0207650_10118023 Ga0207650_101180232 316
113 3300025927 Ga0207687_10039556 Ga0207687_100395562 316
114 3300025927 Ga0207687_10076793 Ga0207687_100767932 316
115 3300025928 Ga0207700_10055871 Ga0207700_100558712 316
116 3300025929 Ga0207664_10196525 Ga0207664_101965252 316
117 3300025929 Ga0207664_10251915 Ga0207664_102519152 316
118 3300025933 Ga0207706_10108108 Ga0207706_101081081 316
119 3300025940 Ga0207691_10022705 Ga0207691_100227057 316
120 3300025940 Ga0207691_10290799 Ga0207691_102907992 316
121 3300025942 Ga0207689_10373434 Ga0207689_103734342 316
122 3300025960 Ga0207651_10432204 Ga0207651_104322042 316
123 3300025961 Ga0207712_10119336 Ga0207712_101193362 316
124 3300025972 Ga0207668_10210277 Ga0207668_102102771 316
125 3300025972 Ga0207668_10243571 Ga0207668_102435711 316
126 3300025972 Ga0207668_10299740 Ga0207668_102997401 316
127 3300026035 Ga0207703_10067160 Ga0207703_100671602 316
128 3300026067 Ga0207678_10035639 Ga0207678_100356392 316
129 3300026067 Ga0207678_10046644 Ga0207678_100466442 316
130 3300026067 Ga0207678_10121886 Ga0207678_101218861 316
131 3300026067 Ga0207678_10281857 Ga0207678_102818571 316
132 3300026075 Ga0207708_10025696 Ga0207708_100256963 316
133 3300026095 Ga0207676_10280765 Ga0207676_102807652 316
134 3300026121 Ga0207683_10048216 Ga0207683_100482163 316
135 3300026121 Ga0207683_10059833 Ga0207683_100598332 316
136 3300026142 Ga0207698_10054545 Ga0207698_100545452 316
137 3300028379 Ga0268266_10002394 Ga0268266_100023944 316
138 3300028379 Ga0268266_10003934 Ga0268266_100039347 316
139 3300028379 Ga0268266_10227848 Ga0268266_102278482 316
140 3300028380 Ga0268265_10210575 Ga0268265_102105751 316
141 3300028381 Ga0268264_10454124 Ga0268264_104541241 316
142 3300028786 Ga0307517_10000008 Ga0307517_10000008153 316
143 3300028794 Ga0307515_10045960 Ga0307515_100459604 316
144 3300031456 Ga0307513_10029676 Ga0307513_100296764 316
145 3300031456 Ga0307513_10328070 Ga0307513_103280701 316
146 3300031507 Ga0307509_10152449 Ga0307509_101524492 316
147 3300031548 Ga0307408_100072011 Ga0307408_1000720112 316
148 3300031548 Ga0307408_100532510 Ga0307408_1005325101 316
149 3300031730 Ga0307516_10049945 Ga0307516_100499454 316
150 3300031730 Ga0307516_10147702 Ga0307516_101477021 316
151 3300031730 Ga0307516_10154319 Ga0307516_101543192 316
152 3300031911 Ga0307412_10104878 Ga0307412_101048782 316
153 3300031995 Ga0307409_100317472 Ga0307409_1003174721 316
154 3300032002 Ga0307416_100205492 Ga0307416_1002054922 316
155 3300032005 Ga0307411_10053656 Ga0307411_100536562 316
156 3300033180 Ga0307510_10001061 Ga0307510_1000106110 316
157 3300035111 Ga0373923_0003551 Ga0373923_0003551_2786_3736 316
158 3300035116 Ga0373945_0053327 Ga0373945_0053327_383_1333 316
159 3300035119 Ga0373956_0021293 Ga0373956_0021293_792_1742 316
160 3300035171 Ga0373946_0057262 Ga0373946_0057262_27_977 316
161 3300035691 Ga0373931_0057170 Ga0373931_0057170_116_1066 316
162 3300035724 Ga0373933_0000199 Ga0373933_0000199_9934_10884 316
163 3300035724 Ga0373933_0006955 Ga0373933_0006955_3979_4929 316
164 3300035725 Ga0373947_0025405 Ga0373947_0025405_1061_2011 316
165 3300037068 Ga0373925_0112208 Ga0373925_0112208_20_970 316
166 3300037853 Ga0436364_1002723 Ga0436364_1002723_1128_2078 316
167 3300038705 Ga0237819_07049 Ga0237819_07049_392_1348 316
168 3300039437 Ga0436365_0480269 Ga0436365_0480269_267_1229 316
169 3300041459 Ga0451800_1533366 Ga0451800_1533366_97_1047 316
170 3300044693 Ga0466961_0088516 Ga0466961_0088516_684_1634 316
171 3300045049 Ga0466959_0047117 Ga0466959_0047117_893_1843 316
172 3300045836 Ga0466958_0034205 Ga0466958_0034205_1437_2387 316
173 3300046454 Ga0495592_0055975 Ga0495592_0055975_1567_2517 316
174 3300046460 Ga0495638_0030281 Ga0495638_0030281_2018_2968 316
175 3300046462 Ga0495651_0185048 Ga0495651_0185048_18_968 316
176 3300046472 Ga0495580_0006636 Ga0495580_0006636_1192_2142 316
177 3300046475 Ga0495639_0009802 Ga0495639_0009802_3115_4065 316
178 3300046511 Ga0495608_0231671 Ga0495608_0231671_48_998 316
179 3300046515 Ga0495620_0061273 Ga0495620_0061273_95_1045 316
180 3300046517 Ga0495630_0008895 Ga0495630_0008895_4504_5454 316
181 3300046519 Ga0495632_0125389 Ga0495632_0125389_161_1111 316
182 3300046526 Ga0495666_0088999 Ga0495666_0088999_247_1197 316
183 3300046536 Ga0495587_0104887 Ga0495587_0104887_582_1532 316
184 3300046542 Ga0495597_0086921 Ga0495597_0086921_371_1321 316
185 3300046543 Ga0495645_0222516 Ga0495645_0222516_252_1202 316
186 3300046558 Ga0495633_0032937 Ga0495633_0032937_809_1759 316
187 3300046664 Ga0495659_0026162 Ga0495659_0026162_122_1072 316
188 3300046665 Ga0495661_0148357 Ga0495661_0148357_129_1079 316
189 3300046674 Ga0495588_0009960 Ga0495588_0009960_3329_4279 316
190 3300046678 Ga0495599_0112054 Ga0495599_0112054_451_1401 316
191 3300046683 Ga0495658_0003337 Ga0495658_0003337_2380_3330 316
192 3300046684 Ga0495669_0007675 Ga0495669_0007675_1731_2681 316
193 3300047315 Ga0495581_0100495 Ga0495581_0100495_323_1273 316
194 3300047319 Ga0495674_0003465 Ga0495674_0003465_4651_5601 316
195 3300047319 Ga0495674_0097951 Ga0495674_0097951_1334_2284 316
196 3300048907 Ga0496104_0110868 Ga0496104_0110868_374_1336 316
197 3300048908 Ga0496105_0271802 Ga0496105_0271802_193_1143 316
198 3300048909 Ga0496106_0007152 Ga0496106_0007152_4432_5394 316
199 3300048910 Ga0496107_0002712 Ga0496107_0002712_10586_11548 316
200 3300048910 Ga0496107_0063697 Ga0496107_0063697_778_1728 316
201 3300048911 Ga0496108_0050214 Ga0496108_0050214_2130_3080 316
202 3300048912 Ga0496109_0105287 Ga0496109_0105287_102_1064 316
203 3300048912 Ga0496109_0285705 Ga0496109_0285705_46_996 316
204 3300048914 Ga0496111_0213810 Ga0496111_0213810_267_1217 316
205 3300048915 Ga0496112_0122063 Ga0496112_0122063_721_1671 316
206 3300048916 Ga0496113_0048196 Ga0496113_0048196_1719_2672 316
207 3300048917 Ga0496114_0078102 Ga0496114_0078102_20_970 316
208 3300048925 Ga0496122_0027687 Ga0496122_0027687_269_1222 316
209 3300048929 Ga0496126_0091265 Ga0496126_0091265_877_1827 316
210 3300048929 Ga0496126_0122053 Ga0496126_0122053_513_1601 316
211 3300049571 Ga0501034_0000162 Ga0501034_0000162_14619_15578 316
212 3300049571 Ga0501034_0018888 Ga0501034_0018888_25_981 316
213 3300049573 Ga0501037_0143788 Ga0501037_0143788_100_1053 316
214 3300049573 Ga0501037_0167291 Ga0501037_0167291_52_1008 316
215 3300049575 Ga0501039_0002338 Ga0501039_0002338_6928_7881 316
216 3300049575 Ga0501039_0057192 Ga0501039_0057192_620_1576 316
217 3300049576 Ga0501040_0004009 Ga0501040_0004009_2624_3580 316
218 3300049576 Ga0501040_0007868 Ga0501040_0007868_143_1096 316
219 3300049576 Ga0501040_0093448 Ga0501040_0093448_672_1625 316
220 3300049577 Ga0501041_0002102 Ga0501041_0002102_165_1118 316
221 3300049577 Ga0501041_0003406 Ga0501041_0003406_3015_3971 316
222 3300049577 Ga0501041_0152055 Ga0501041_0152055_153_1106 316
223 3300049578 Ga0501042_0006693 Ga0501042_0006693_6492_7445 316
224 3300049578 Ga0501042_0085145 Ga0501042_0085145_1158_2111 316
225 3300049578 Ga0501042_0198575 Ga0501042_0198575_411_1367 316
226 3300049579 Ga0501043_0393522 Ga0501043_0393522_28_978 316
227 3300049580 Ga0501046_0020518 Ga0501046_0020518_326_1282 316
228 3300049580 Ga0501046_0020844 Ga0501046_0020844_281_1234 316
229 3300049582 Ga0501048_0002159 Ga0501048_0002159_4670_5626 316
230 3300049582 Ga0501048_0150818 Ga0501048_0150818_10_963 316
231 3300049584 Ga0501068_0023446 Ga0501068_0023446_286_1242 316
232 3300049584 Ga0501068_0057453 Ga0501068_0057453_880_1833 316
233 3300049586 Ga0501070_0148565 Ga0501070_0148565_637_1593 316
234 3300049587 Ga0501071_0000995 Ga0501071_0000995_14004_14960 316
235 3300049587 Ga0501071_0001381 Ga0501071_0001381_6260_7213 316
236 3300049587 Ga0501071_0042984 Ga0501071_0042984_1427_2380 316
237 3300049587 Ga0501071_0062272 Ga0501071_0062272_705_1658 316
238 3300049587 Ga0501071_0074779 Ga0501071_0074779_1299_2252 316
239 3300049588 Ga0501072_0001396 Ga0501072_0001396_10178_11134 316
240 3300049588 Ga0501072_0009787 Ga0501072_0009787_5061_6014 316
241 3300049590 Ga0501074_0010413 Ga0501074_0010413_670_1626 316
242 3300049590 Ga0501074_0107706 Ga0501074_0107706_170_1123 316
243 3300049591 Ga0501075_0001266 Ga0501075_0001266_13857_14813 316
244 3300049591 Ga0501075_0010012 Ga0501075_0010012_94_1047 316
245 3300049591 Ga0501075_0032621 Ga0501075_0032621_538_1491 316
246 3300049592 Ga0501076_0003220 Ga0501076_0003220_3772_4725 316
247 3300049592 Ga0501076_0030585 Ga0501076_0030585_1994_2947 316
248 3300049592 Ga0501076_0050027 Ga0501076_0050027_980_1933 316
249 3300049593 Ga0501077_0004422 Ga0501077_0004422_4380_5336 316
250 3300049593 Ga0501077_0034086 Ga0501077_0034086_1190_2143 316
251 3300049741 Ga0501079_0001105 Ga0501079_0001105_6458_7411 316
252 3300049741 Ga0501079_0001367 Ga0501079_0001367_6919_7875 316
253 3300049741 Ga0501079_0028121 Ga0501079_0028121_2265_3218 316
254 3300049743 Ga0501081_0000797 Ga0501081_0000797_12502_13458 316
255 3300049743 Ga0501081_0288942 Ga0501081_0288942_64_1017 316
256 3300049744 Ga0501083_0046021 Ga0501083_0046021_1015_1980 316
257 3300049822 Ga0501035_0339850 Ga0501035_0339850_211_1164 316
258 3300049824 Ga0501045_0121980 Ga0501045_0121980_72_1025 316
259 3300049824 Ga0501045_0149095 Ga0501045_0149095_497_1450 316
260 3300050491 nmdc:mga00v17_69251_c1 nmdc:mga00v17_69251_c1_271_1221 316
261 3300050492 nmdc:mga0yw44_21367_c1 nmdc:mga0yw44_21367_c1_1183_2133 316
262 3300050492 nmdc:mga0yw44_27119_c1 nmdc:mga0yw44_27119_c1_1307_2257 316
263 3300050492 nmdc:mga0yw44_56798_c1 nmdc:mga0yw44_56798_c1_1088_2038 316
264 3300050492 nmdc:mga0yw44_65487_c1 nmdc:mga0yw44_65487_c1_289_1239 316
265 3300050494 nmdc:mga06z11_8998_c1 nmdc:mga06z11_8998_c1_71_1021 316
266 3300050496 nmdc:mga07m45_13999_c1 nmdc:mga07m45_13999_c1_766_1716 316
267 3300050512 nmdc:mga0n895_3422_c1 nmdc:mga0n895_3422_c1_9104_10054 316
268 3300050513 nmdc:mga0rr50_108952_c1 nmdc:mga0rr50_108952_c1_989_1939 316
269 3300053078 Ga0495612_0050367 Ga0495612_0050367_14_964 316
270 3300053102 Ga0500554_003665 Ga0500554_003665_2177_3127 316
271 3300053119 Ga0500595_001720 Ga0500595_001720_248_1198 316
272 3300053119 Ga0500595_062019 Ga0500595_062019_134_1084 316
273 3300053134 Ga0500658_0086851 Ga0500658_0086851_334_1284 316
274 3300053162 Ga0500638_000568 Ga0500638_000568_7773_8723 316
275 3300053178 Ga0500637_0000132 Ga0500637_0000132_26039_26989 316
276 3300053730 Ga0500645_025918 Ga0500645_025918_142_1092 316
277 3300054114 Ga0501084_0009362 Ga0501084_0009362_4423_5379 316
278 3300054114 Ga0501084_0037310 Ga0501084_0037310_170_1123 316
279 3300055283 Ga0500661_007644 Ga0500661_007644_247_1197 316
280 3300060353 Ga0501082_0002949 Ga0501082_0002949_2808_3764 316
281 3300060353 Ga0501082_0075376 Ga0501082_0075376_293_1246 316
282 3300060353 Ga0501082_0129076 Ga0501082_0129076_39_992 316
283 3300061734 Ga0530510_0002388 Ga0530510_0002388_9155_10108 316
284 3300061734 Ga0530510_0012148 Ga0530510_0012148_2363_3316 316
285 3300061734 Ga0530510_0071443 Ga0530510_0071443_1096_2049 316
286 3300061734 Ga0530510_0149872 Ga0530510_0149872_239_1195 316
287 3300061734 Ga0530510_0165227 Ga0530510_0165227_33_986 316
288 iso_pu_bacteria 2507262055 2507508218 316
289 iso_pu_bacteria 2508501009 2508542287 316
290 iso_pu_bacteria 2643221580 2643909914 316
291 iso_pu_bacteria 2791355196 2793062592 316
292 iso_pu_bacteria 2841840854 2841846294 316
293 iso_pu_bacteria 2842140634 2842146058 316
294 iso_pu_bacteria 2874590934 2874598412 316
295 iso_pu_bacteria 2876771140 2876778110 316
296 iso_pu_bacteria 2876818435 2876826021 316
297 iso_pu_bacteria 2879074833 2879081904 316
298 iso_pu_bacteria 2879127579 2879135026 316
299 iso_pu_bacteria 2879142872 2879149711 316
300 iso_pu_bacteria 2935608549 2935609299 316
301 iso_pu_bacteria 2935819856 2935822459 316
302 iso_pu_bacteria 2935847175 2935848042 316
303 iso_pu_bacteria 2935908558 2935908735 316
304 iso_pu_bacteria 2935916978 2935917880 316
305 iso_pu_bacteria 2935926038 2935926691 316
306 iso_pu_bacteria 2935934488 2935935141 316
307 iso_pu_bacteria 2935942939 2935943591 316
308 iso_pu_bacteria 2935951376 2935952029 316
309 iso_pu_bacteria 2935967501 2935968154 316
310 iso_pu_bacteria 2935975950 2935978770 316
311 iso_pu_bacteria 2935984226 2935987361 316
312 iso_pu_bacteria 8001845381 8001847668 316
313 iso_pu_bacteria 8019619141 8019628579 316
314 iso_pu_bacteria 8019638758 8019645671 316
315 iso_pu_bacteria 8019668869 8019671459 316
316 iso_pu_bacteria 8019687851 8019690466 316
317 3300002987 JGI25159J45721_1002514 JGI25159J45721_10025148 317
318 3300003203 JGI25406J46586_10004884 JGI25406J46586_100048845 317
319 3300003215 JGI25153J46596_10010269 JGI25153J46596_100102692 317
320 3300003794 Ga0055531_10006079 Ga0055531_100060793 317
321 3300005262 Ga0065165_1000778 Ga0065165_100077815 317
322 3300005329 Ga0070683_100019245 Ga0070683_1000192452 317
323 3300005336 Ga0070680_100391849 Ga0070680_1003918491 317
324 3300005339 Ga0070660_100001944 Ga0070660_10000194415 317
325 3300005436 Ga0070713_100002844 Ga0070713_10000284410 317
326 3300005563 Ga0068855_100641467 Ga0068855_1006414671 317
327 3300005985 Ga0081539_10003717 Ga0081539_100037173 317
328 3300006038 Ga0075365_10014008 Ga0075365_100140084 317
329 3300006038 Ga0075365_10040659 Ga0075365_100406593 317
330 3300006178 Ga0075367_10014301 Ga0075367_100143014 317
331 3300006178 Ga0075367_10093920 Ga0075367_100939202 317
332 3300009093 Ga0105240_10039681 Ga0105240_100396812 317
333 3300009545 Ga0105237_10024796 Ga0105237_100247966 317
334 3300009551 Ga0105238_10016557 Ga0105238_100165575 317
335 3300010375 Ga0105239_10367855 Ga0105239_103678552 317
336 3300013104 Ga0157370_10046104 Ga0157370_100461043 317
337 3300013104 Ga0157370_10187365 Ga0157370_101873652 317
338 3300013105 Ga0157369_10016886 Ga0157369_100168862 317
339 3300013105 Ga0157369_10043509 Ga0157369_100435091 317
340 3300013296 Ga0157374_10117130 Ga0157374_101171303 317
341 3300021384 Ga0213876_10001330 Ga0213876_1000133012 317
342 3300021384 Ga0213876_10011164 Ga0213876_100111645 317
343 3300021388 Ga0213875_10019425 Ga0213875_100194251 317
344 3300025284 Ga0209130_1000080 Ga0209130_100008099 317
345 3300025292 Ga0209676_1013011 Ga0209676_10130113 317
346 3300025297 Ga0209758_1002135 Ga0209758_100213518 317
347 3300025303 Ga0209051_1000544 Ga0209051_100054420 317
348 3300025304 Ga0209257_1003871 Ga0209257_10038714 317
349 3300025919 Ga0207657_10034475 Ga0207657_100344755 317
350 3300025924 Ga0207694_10009150 Ga0207694_100091502 317
351 3300025924 Ga0207694_10144927 Ga0207694_101449272 317
352 3300025928 Ga0207700_10026717 Ga0207700_100267174 317
353 3300025944 Ga0207661_10056687 Ga0207661_100566872 317
354 3300026041 Ga0207639_10170581 Ga0207639_101705811 317
355 3300027671 Ga0209588_1010555 Ga0209588_10105553 317
356 3300030521 Ga0307511_10091215 Ga0307511_100912153 317
357 3300031616 Ga0307508_10074774 Ga0307508_100747743 317
358 3300031824 Ga0307413_10361800 Ga0307413_103618002 317
359 3300033180 Ga0307510_10189304 Ga0307510_101893042 317
360 3300037418 Ga0395900_0050280 Ga0395900_0050280_451_1404 317
361 3300037466 Ga0395898_0010756 Ga0395898_0010756_3336_4289 317
362 3300037853 Ga0436364_1129914 Ga0436364_1129914_112_1137 317
363 3300041460 Ga0451802_1612203 Ga0451802_1612203_488_1528 317
364 3300045976 Ga0466967_0115112 Ga0466967_0115112_29_982 317
365 3300048924 Ga0496121_0090671 Ga0496121_0090671_478_1434 317
366 3300049568 Ga0501031_0135259 Ga0501031_0135259_485_1438 317
367 3300049569 Ga0501032_0000358 Ga0501032_0000358_16568_17521 317
368 3300049570 Ga0501033_0000601 Ga0501033_0000601_18906_19859 317
369 3300049572 Ga0501036_0047223 Ga0501036_0047223_832_1785 317
370 3300049572 Ga0501036_0221723 Ga0501036_0221723_154_1113 317
371 3300049573 Ga0501037_0000089 Ga0501037_0000089_3884_4837 317
372 3300049574 Ga0501038_0080791 Ga0501038_0080791_1384_2337 317
373 3300049574 Ga0501038_0132578 Ga0501038_0132578_297_1352 317
374 3300049575 Ga0501039_0130432 Ga0501039_0130432_269_1222 317
375 3300049576 Ga0501040_0003598 Ga0501040_0003598_2839_3822 317
376 3300049578 Ga0501042_0091547 Ga0501042_0091547_447_1430 317
377 3300049579 Ga0501043_0000007 Ga0501043_0000007_206425_207378 317
378 3300049579 Ga0501043_0040463 Ga0501043_0040463_1842_2801 317
379 3300049580 Ga0501046_0087965 Ga0501046_0087965_1200_2255 317
380 3300049581 Ga0501047_0053972 Ga0501047_0053972_154_1107 317
381 3300049581 Ga0501047_0267709 Ga0501047_0267709_391_1344 317
382 3300049581 Ga0501047_0323716 Ga0501047_0323716_382_1371 317
383 3300049583 Ga0501067_0000183 Ga0501067_0000183_30406_31368 317
384 3300049585 Ga0501069_0000001 Ga0501069_0000001_187808_188761 317
385 3300049585 Ga0501069_0027181 Ga0501069_0027181_911_1864 317
386 3300049586 Ga0501070_0000071 Ga0501070_0000071_29608_30561 317
387 3300049586 Ga0501070_0001014 Ga0501070_0001014_13762_14715 317
388 3300049586 Ga0501070_0126323 Ga0501070_0126323_578_1561 317
389 3300049587 Ga0501071_0003778 Ga0501071_0003778_1221_2204 317
390 3300049587 Ga0501071_0108303 Ga0501071_0108303_254_1207 317
391 3300049588 Ga0501072_0078523 Ga0501072_0078523_562_1545 317
392 3300049589 Ga0501073_0023792 Ga0501073_0023792_3356_4309 317
393 3300049589 Ga0501073_0083080 Ga0501073_0083080_799_1752 317
394 3300049590 Ga0501074_0000003 Ga0501074_0000003_81291_82244 317
395 3300049591 Ga0501075_0023068 Ga0501075_0023068_2401_3384 317
396 3300049592 Ga0501076_0041585 Ga0501076_0041585_2381_3343 317
397 3300049592 Ga0501076_0146555 Ga0501076_0146555_406_1389 317
398 3300049741 Ga0501079_0052679 Ga0501079_0052679_1992_2975 317
399 3300049742 Ga0501080_0000470 Ga0501080_0000470_10467_11420 317
400 3300049742 Ga0501080_0010814 Ga0501080_0010814_1858_2811 317
401 3300049743 Ga0501081_0008343 Ga0501081_0008343_276_1259 317
402 3300049744 Ga0501083_0000080 Ga0501083_0000080_35838_36791 317
403 3300049744 Ga0501083_0200771 Ga0501083_0200771_21_983 317
404 3300049744 Ga0501083_0327736 Ga0501083_0327736_22_978 317
405 3300049758 Ga0501241_010018 Ga0501241_010018_52_1179 317
406 3300049822 Ga0501035_0000037 Ga0501035_0000037_110669_111622 317
407 3300049822 Ga0501035_0001584 Ga0501035_0001584_9342_10295 317
408 3300049822 Ga0501035_0030183 Ga0501035_0030183_2455_3444 317
409 3300049823 Ga0501044_0000018 Ga0501044_0000018_113571_114524 317
410 3300049823 Ga0501044_0077831 Ga0501044_0077831_132_1187 317
411 3300049823 Ga0501044_0089116 Ga0501044_0089116_1436_2407 317
412 3300049823 Ga0501044_0104749 Ga0501044_0104749_135_1088 317
413 3300049824 Ga0501045_0015832 Ga0501045_0015832_1391_2374 317
414 3300050490 nmdc:mga03n38_13302_c1 nmdc:mga03n38_13302_c1_1175_2134 317
415 3300050491 nmdc:mga00v17_67298_c1 nmdc:mga00v17_67298_c1_16_975 317
416 3300050492 nmdc:mga0yw44_27937_c1 nmdc:mga0yw44_27937_c1_1496_2455 317
417 3300050495 nmdc:mga04h51_60850_c1 nmdc:mga04h51_60850_c1_310_1269 317
418 3300050496 nmdc:mga07m45_43289_c1 nmdc:mga07m45_43289_c1_1200_2159 317
419 3300053107 Ga0500560_003776 Ga0500560_003776_1343_2299 317
420 3300053177 Ga0500636_0063895 Ga0500636_0063895_205_1158 317
421 3300060353 Ga0501082_0002028 Ga0501082_0002028_14486_15448 317
422 3300060353 Ga0501082_0038762 Ga0501082_0038762_2305_3288 317
423 3300060353 Ga0501082_0100021 Ga0501082_0100021_223_1176 317
424 3300061734 Ga0530510_0004211 Ga0530510_0004211_1078_2061 317
425 iso_pu_bacteria 2513237141 2513892647 317
426 iso_pu_bacteria 2599185210 2599605331 317
427 iso_pu_bacteria 2617270741 2617375409 317
428 iso_pu_bacteria 2824732956 2824733430 317
429 iso_pu_bacteria 2824746037 2824746443 317
430 iso_pu_bacteria 2841957949 2841960981 317
431 iso_pu_bacteria 2881364244 2881368462 317
432 iso_pu_bacteria 2885409591 2885413311 317
433 iso_pu_bacteria 2889790730 2889794154 317
434 iso_pu_bacteria 2889914905 2889915079 317
435 iso_pu_bacteria 2908775508 2908780533 317
436 iso_pu_bacteria 2941499720 2941503381 317
437 iso_pu_bacteria 3005483717 3005484663 317
438 iso_pu_bacteria 3005587118 3005587686 317
439 iso_pu_bacteria 3005594810 3005599612 317
440 3300002739 JGI25158J39367_1000010 JGI25158J39367_100001015 318
441 3300002773 JGI25152J39213_1004785 JGI25152J39213_10047853 318
442 3300002987 JGI25159J45721_1000233 JGI25159J45721_100023311 318
443 3300003215 JGI25153J46596_10015548 JGI25153J46596_100155482 318
444 3300003354 JGI25160J50197_1008043 JGI25160J50197_10080433 318
445 3300003374 JGI25161J50226_1000294 JGI25161J50226_100029424 318
446 3300003771 Ga0055526_1003587 Ga0055526_10035877 318
447 3300003775 Ga0055524_1007582 Ga0055524_10075825 318
448 3300003775 Ga0055524_1023928 Ga0055524_10239282 318
449 3300003790 Ga0055528_1010157 Ga0055528_10101574 318
450 3300003792 Ga0055540_1005072 Ga0055540_10050723 318
451 3300003856 Ga0058692_1000046 Ga0058692_100004630 318
452 3300003856 Ga0058692_1000567 Ga0058692_10005678 318
453 3300004625 Ga0055543_1000031 Ga0055543_100003167 318
454 3300005262 Ga0065165_1006341 Ga0065165_10063415 318
455 3300005288 Ga0065714_10094003 Ga0065714_100940032 318
456 3300005293 Ga0065715_10147769 Ga0065715_101477692 318
457 3300005295 Ga0065707_10107060 Ga0065707_101070602 318
458 3300005328 Ga0070676_10056574 Ga0070676_100565742 318
459 3300005331 Ga0070670_100029832 Ga0070670_1000298322 318
460 3300005334 Ga0068869_100208530 Ga0068869_1002085301 318
461 3300005345 Ga0070692_10033162 Ga0070692_100331625 318
462 3300005347 Ga0070668_100105570 Ga0070668_1001055702 318
463 3300005354 Ga0070675_100015967 Ga0070675_1000159674 318
464 3300005354 Ga0070675_100277361 Ga0070675_1002773611 318
465 3300005364 Ga0070673_100060690 Ga0070673_1000606902 318
466 3300005365 Ga0070688_100070855 Ga0070688_1000708551 318
467 3300005366 Ga0070659_100046969 Ga0070659_1000469693 318
468 3300005435 Ga0070714_100263799 Ga0070714_1002637991 318
469 3300005436 Ga0070713_100063806 Ga0070713_1000638063 318
470 3300005436 Ga0070713_100134222 Ga0070713_1001342222 318
471 3300005439 Ga0070711_100069023 Ga0070711_1000690232 318
472 3300005458 Ga0070681_10049614 Ga0070681_100496141 318
473 3300005530 Ga0070679_100021572 Ga0070679_1000215725 318
474 3300005543 Ga0070672_100042329 Ga0070672_1000423293 318
475 3300005548 Ga0070665_100364644 Ga0070665_1003646442 318
476 3300005618 Ga0068864_100426247 Ga0068864_1004262471 318
477 3300005937 Ga0081455_10131599 Ga0081455_101315992 318
478 3300006028 Ga0070717_10064475 Ga0070717_100644754 318
479 3300006186 Ga0075369_10059790 Ga0075369_100597902 318
480 3300006880 Ga0075429_100125144 Ga0075429_1001251443 318
481 3300006942 Ga0099824_1037481 Ga0099824_10374811 318
482 3300006943 Ga0099822_1001130 Ga0099822_100113022 318
483 3300009098 Ga0105245_10241088 Ga0105245_102410882 318
484 3300009174 Ga0105241_10032147 Ga0105241_100321473 318
485 3300013306 Ga0163162_10427436 Ga0163162_104274362 318
486 3300025208 Ga0209436_100043 Ga0209436_10004312 318
487 3300025258 Ga0209129_1003909 Ga0209129_10039097 318
488 3300025258 Ga0209129_1008236 Ga0209129_10082362 318
489 3300025273 Ga0209673_1018275 Ga0209673_10182751 318
490 3300025284 Ga0209130_1000023 Ga0209130_1000023302 318
491 3300025294 Ga0209025_1019049 Ga0209025_10190493 318
492 3300025295 Ga0209564_1004387 Ga0209564_10043873 318
493 3300025297 Ga0209758_1003095 Ga0209758_100309511 318
494 3300025297 Ga0209758_1007018 Ga0209758_10070189 318
495 3300025297 Ga0209758_1007020 Ga0209758_10070209 318
496 3300025299 Ga0209256_1000234 Ga0209256_100023429 318
497 3300025299 Ga0209256_1003046 Ga0209256_100304611 318
498 3300025302 Ga0207426_1000087 Ga0207426_100008760 318
499 3300025315 Ga0207697_10042306 Ga0207697_100423062 318
500 3300025893 Ga0207682_10013911 Ga0207682_100139112 318
501 3300025901 Ga0207688_10035622 Ga0207688_100356221 318
502 3300025906 Ga0207699_10004016 Ga0207699_100040162 318
503 3300025907 Ga0207645_10193966 Ga0207645_101939662 318
504 3300025907 Ga0207645_10255182 Ga0207645_102551822 318
505 3300025912 Ga0207707_10000359 Ga0207707_1000035943 318
506 3300025912 Ga0207707_10270577 Ga0207707_102705771 318
507 3300025917 Ga0207660_10027186 Ga0207660_100271864 318
508 3300025921 Ga0207652_10290066 Ga0207652_102900662 318
509 3300025926 Ga0207659_10122117 Ga0207659_101221172 318
510 3300025928 Ga0207700_10113586 Ga0207700_101135863 318
511 3300025928 Ga0207700_10188591 Ga0207700_101885912 318
512 3300025929 Ga0207664_10347918 Ga0207664_103479182 318
513 3300025929 Ga0207664_10518364 Ga0207664_105183641 318
514 3300025933 Ga0207706_10021902 Ga0207706_100219025 318
515 3300025937 Ga0207669_10028311 Ga0207669_100283113 318
516 3300025940 Ga0207691_10005672 Ga0207691_1000567211 318
517 3300025942 Ga0207689_10005152 Ga0207689_1000515210 318
518 3300025960 Ga0207651_10117864 Ga0207651_101178641 318
519 3300026075 Ga0207708_10022061 Ga0207708_100220613 318
520 3300026116 Ga0207674_10314527 Ga0207674_103145272 318
521 3300026118 Ga0207675_100075308 Ga0207675_1000753083 318
522 3300026121 Ga0207683_10115071 Ga0207683_101150713 318
523 3300027312 Ga0209371_1000033 Ga0209371_1000033145 318
524 3300027312 Ga0209371_1000419 Ga0209371_10004195 318
525 3300027357 Ga0209589_1000001 Ga0209589_1000001275 318
526 3300027361 Ga0209489_100001 Ga0209489_100001275 318
527 3300027363 Ga0209700_100001 Ga0209700_100001275 318
528 3300028379 Ga0268266_10314020 Ga0268266_103140202 318
529 3300028794 Ga0307515_10006212 Ga0307515_100062128 318
530 3300030500 Ga0268256_1000491 Ga0268256_100049114 318
531 3300030500 Ga0268256_1002993 Ga0268256_10029937 318
532 3300031507 Ga0307509_10058934 Ga0307509_100589343 318
533 3300031616 Ga0307508_10191595 Ga0307508_101915951 318
534 3300031730 Ga0307516_10200107 Ga0307516_102001072 318
535 3300032133 Ga0316583_10000161 Ga0316583_100001619 318
536 3300033180 Ga0307510_10018144 Ga0307510_100181446 318
537 3300033442 Ga0315911_1000006 Ga0315911_1000006351 318
538 3300035170 Ga0373943_0003661 Ga0373943_0003661_1596_2552 318
539 3300035171 Ga0373946_0088339 Ga0373946_0088339_382_1338 318
540 3300035692 Ga0373935_0007313 Ga0373935_0007313_4914_5870 318
541 3300035695 Ga0373927_0004515 Ga0373927_0004515_3937_4893 318
542 3300035725 Ga0373947_0005028 Ga0373947_0005028_3523_4479 318
543 3300037068 Ga0373925_0003743 Ga0373925_0003743_8752_9708 318
544 3300039437 Ga0436365_0874274 Ga0436365_0874274_735_1691 318
545 3300041413 Ga0439465_0038199 Ga0439465_0038199_155_1114 318
546 3300041505 Ga0451849_0127253 Ga0451849_0127253_1935_2897 318
547 3300041507 Ga0451851_0093989 Ga0451851_0093989_3779_4741 318
548 3300041509 Ga0451843_1116914 Ga0451843_1116914_467_1429 318
549 3300044684 Ga0466966_0015940 Ga0466966_0015940_80_1045 318
550 3300045976 Ga0466967_0130579 Ga0466967_0130579_1194_2150 318
551 3300046455 Ga0495603_0000464 Ga0495603_0000464_8967_9923 318
552 3300046459 Ga0495629_0003540 Ga0495629_0003540_9710_10666 318
553 3300046461 Ga0495641_0001561 Ga0495641_0001561_18268_19224 318
554 3300046462 Ga0495651_0001584 Ga0495651_0001584_4823_5782 318
555 3300046472 Ga0495580_0004125 Ga0495580_0004125_8976_9932 318
556 3300046473 Ga0495582_0000174 Ga0495582_0000174_9021_9977 318
557 3300046475 Ga0495639_0001275 Ga0495639_0001275_9346_10302 318
558 3300046477 Ga0495664_0243825 Ga0495664_0243825_64_1023 318
559 3300046499 Ga0495594_0000563 Ga0495594_0000563_7329_8285 318
560 3300046499 Ga0495594_0188595 Ga0495594_0188595_92_1048 318
561 3300046500 Ga0495596_0014316 Ga0495596_0014316_1430_2398 318
562 3300046507 Ga0495606_0001179 Ga0495606_0001179_9348_10304 318
563 3300046512 Ga0495610_0030421 Ga0495610_0030421_491_1450 318
564 3300046516 Ga0495628_0019369 Ga0495628_0019369_3709_4665 318
565 3300046516 Ga0495628_0029386 Ga0495628_0029386_1997_2956 318
566 3300046516 Ga0495628_0082191 Ga0495628_0082191_94_1053 318
567 3300046517 Ga0495630_0003152 Ga0495630_0003152_1569_2525 318
568 3300046524 Ga0495648_0000865 Ga0495648_0000865_21309_22265 318
569 3300046529 Ga0495652_0022885 Ga0495652_0022885_450_1409 318
570 3300046529 Ga0495652_0041715 Ga0495652_0041715_1340_2296 318
571 3300046531 Ga0495665_0010190 Ga0495665_0010190_344_1300 318
572 3300046533 Ga0495640_0008774 Ga0495640_0008774_4006_4962 318
573 3300046537 Ga0495598_0018080 Ga0495598_0018080_327_1286 318
574 3300046543 Ga0495645_0013747 Ga0495645_0013747_854_1813 318
575 3300046557 Ga0495622_0002132 Ga0495622_0002132_80_1036 318
576 3300046559 Ga0495667_0034339 Ga0495667_0034339_1201_2157 318
577 3300046642 Ga0495634_0000440 Ga0495634_0000440_11132_12088 318
578 3300046663 Ga0495635_0001961 Ga0495635_0001961_4011_4967 318
579 3300046674 Ga0495588_0023069 Ga0495588_0023069_1699_2655 318
580 3300046680 Ga0495646_0006220 Ga0495646_0006220_3349_4308 318
581 3300046680 Ga0495646_0033992 Ga0495646_0033992_744_1700 318
582 3300046681 Ga0495647_0002733 Ga0495647_0002733_1712_2668 318
583 3300046683 Ga0495658_0008316 Ga0495658_0008316_3462_4418 318
584 3300046689 Ga0495613_0014627 Ga0495613_0014627_4472_5428 318
585 3300046690 Ga0495624_0003651 Ga0495624_0003651_4759_5715 318
586 3300047315 Ga0495581_0000364 Ga0495581_0000364_8773_9729 318
587 3300047319 Ga0495674_0002401 Ga0495674_0002401_14863_15819 318
588 3300047320 Ga0495672_0026578 Ga0495672_0026578_1845_2801 318
589 3300047321 Ga0495676_0080271 Ga0495676_0080271_874_1830 318
590 3300047673 Ga0495593_0003073 Ga0495593_0003073_146_1102 318
591 3300048089 Ga0495614_0033888 Ga0495614_0033888_1113_2069 318
592 3300048909 Ga0496106_0000028 Ga0496106_0000028_50073_51032 318
593 3300048919 Ga0496116_0034686 Ga0496116_0034686_1291_2253 318
594 3300048921 Ga0496118_0003916 Ga0496118_0003916_3159_4118 318
595 3300048924 Ga0496121_0032431 Ga0496121_0032431_1863_2822 318
596 3300048924 Ga0496121_0050022 Ga0496121_0050022_1164_2120 318
597 3300048924 Ga0496121_0146782 Ga0496121_0146782_67_1029 318
598 3300048925 Ga0496122_0083670 Ga0496122_0083670_376_1335 318
599 3300048926 Ga0496123_0082335 Ga0496123_0082335_489_1451 318
600 3300048927 Ga0496124_0083048 Ga0496124_0083048_39_995 318
601 3300048927 Ga0496124_0083442 Ga0496124_0083442_276_1238 318
602 3300048928 Ga0496125_0123401 Ga0496125_0123401_357_1316 318
603 3300048928 Ga0496125_0238612 Ga0496125_0238612_172_1131 318
604 3300049569 Ga0501032_0039103 Ga0501032_0039103_882_1841 318
605 3300049571 Ga0501034_0507018 Ga0501034_0507018_77_1036 318
606 3300049579 Ga0501043_0070570 Ga0501043_0070570_1726_2685 318
607 3300049580 Ga0501046_0201221 Ga0501046_0201221_488_1456 318
608 3300049581 Ga0501047_0246989 Ga0501047_0246989_292_1251 318
609 3300049581 Ga0501047_0294096 Ga0501047_0294096_141_1103 318
610 3300049583 Ga0501067_0021908 Ga0501067_0021908_2213_3175 318
611 3300049586 Ga0501070_0257370 Ga0501070_0257370_451_1416 318
612 3300049589 Ga0501073_0018515 Ga0501073_0018515_1424_2383 318
613 3300049589 Ga0501073_0144843 Ga0501073_0144843_585_1550 318
614 3300049742 Ga0501080_0246001 Ga0501080_0246001_526_1488 318
615 3300049744 Ga0501083_0008847 Ga0501083_0008847_5406_6365 318
616 3300049744 Ga0501083_0092065 Ga0501083_0092065_387_1352 318
617 3300049822 Ga0501035_0335096 Ga0501035_0335096_227_1189 318
618 3300049822 Ga0501035_0411487 Ga0501035_0411487_10_984 318
619 3300049823 Ga0501044_0250080 Ga0501044_0250080_507_1475 318
620 3300050508 nmdc:mga09592_74554_c1 nmdc:mga09592_74554_c1_1183_2145 318
621 3300050516 nmdc:mga0sz30_57701_c1 nmdc:mga0sz30_57701_c1_179_1138 318
622 3300053077 Ga0495601_0005620 Ga0495601_0005620_5371_6330 318
623 3300053077 Ga0495601_0010254 Ga0495601_0010254_2273_3232 318
624 3300053078 Ga0495612_0032398 Ga0495612_0032398_687_1643 318
625 3300053087 Ga0500643_005900 Ga0500643_005900_3965_4924 318
626 3300053087 Ga0500643_013214 Ga0500643_013214_822_1787 318
627 3300053088 Ga0500644_0000529 Ga0500644_0000529_11181_12140 318
628 3300053102 Ga0500554_011814 Ga0500554_011814_599_1555 318
629 3300053125 Ga0500618_006476 Ga0500618_006476_2331_3293 318
630 3300053134 Ga0500658_0000831 Ga0500658_0000831_2788_3747 318
631 3300053139 Ga0500568_0001959 Ga0500568_0001959_9041_10000 318
632 3300053150 Ga0500603_002409 Ga0500603_002409_2236_3192 318
633 3300053153 Ga0500616_0000006 Ga0500616_0000006_860253_861212 318
634 3300053156 Ga0500622_0000206 Ga0500622_0000206_15273_16232 318
635 3300053160 Ga0500633_0000512 Ga0500633_0000512_2046_3005 318
636 3300053178 Ga0500637_0012756 Ga0500637_0012756_2351_3307 318
637 3300060353 Ga0501082_0029516 Ga0501082_0029516_50_1015 318
638 3300060353 Ga0501082_0032895 Ga0501082_0032895_3360_4322 318
639 iso_pu_bacteria 2508501042 2508691951 318
640 iso_pu_bacteria 2511231028 2511397526 318
641 iso_pu_bacteria 2513237092 2513622347 318
642 iso_pu_bacteria 2513237094 2513640524 318
643 iso_pu_bacteria 2513237095 2513645442 318
644 iso_pu_bacteria 2513237102 2513701722 318
645 iso_pu_bacteria 2513237104 2513718390 318
646 iso_pu_bacteria 2513237139 2513873140 318
647 iso_pu_bacteria 2513237161 2514016515 318
648 iso_pu_bacteria 2515154112 2515627276 318
649 iso_pu_bacteria 2517093001 2517102621 318
650 iso_pu_bacteria 2524023205 2524437739 318
651 iso_pu_bacteria 2528768022 2528848708 318
652 iso_pu_bacteria 2617270735 2617346991 318
653 iso_pu_bacteria 2744054633 2745081206 318
654 iso_pu_bacteria 2775507049 2776911780 318
655 iso_pu_bacteria 2802429603 2805914961 318
656 iso_pu_bacteria 2816332527 2818239669 318
657 iso_pu_bacteria 2824600985 2824602351 318
658 iso_pu_bacteria 2824609381 2824610555 318
659 iso_pu_bacteria 2824617872 2824618115 318
660 iso_pu_bacteria 2824626560 2824626783 318
661 iso_pu_bacteria 2824635225 2824636582 318
662 iso_pu_bacteria 2824644064 2824645116 318
663 iso_pu_bacteria 2824653114 2824654320 318
664 iso_pu_bacteria 2824661429 2824661595 318
665 iso_pu_bacteria 2824671348 2824672044 318
666 iso_pu_bacteria 2824679649 2824679868 318
667 iso_pu_bacteria 2824687955 2824688643 318
668 iso_pu_bacteria 2824696289 2824697121 318
669 iso_pu_bacteria 2824704595 2824705085 318
670 iso_pu_bacteria 2824714736 2824720410 318
671 iso_pu_bacteria 2824723954 2824729456 318
672 iso_pu_bacteria 2824753945 2824754378 318
673 iso_pu_bacteria 2824763712 2824767877 318
674 iso_pu_bacteria 2824773399 2824775247 318
675 iso_pu_bacteria 2838122688 2838123345 318
676 iso_pu_bacteria 2841941048 2841946639 318
677 iso_pu_bacteria 2841949485 2841954129 318
678 iso_pu_bacteria 2841966195 2841969506 318
679 iso_pu_bacteria 2841974524 2841974610 318
680 iso_pu_bacteria 2841983080 2841983831 318
681 iso_pu_bacteria 2842038055 2842040187 318
682 iso_pu_bacteria 2842045827 2842046868 318
683 iso_pu_bacteria 2844315083 2844319411 318
684 iso_pu_bacteria 2847930680 2847936587 318
685 iso_pu_bacteria 2847939898 2847946931 318
686 iso_pu_bacteria 2849076700 2849078958 318
687 iso_pu_bacteria 2857509624 2857515917 318
688 iso_pu_bacteria 2874612657 2874619373 318
689 iso_pu_bacteria 2874620515 2874626412 318
690 iso_pu_bacteria 2874628541 2874632274 318
691 iso_pu_bacteria 2874645413 2874652533 318
692 iso_pu_bacteria 2876761206 2876764961 318
693 iso_pu_bacteria 2879083081 2879088069 318
694 iso_pu_bacteria 2879099564 2879108348 318
695 iso_pu_bacteria 2881665667 2881672527 318
696 iso_pu_bacteria 2885366525 2885369265 318
697 iso_pu_bacteria 2888378607 2888384480 318
698 iso_pu_bacteria 2888388044 2888393430 318
699 iso_pu_bacteria 2888419890 2888424930 318
700 iso_pu_bacteria 2903727486 2903734353 318
701 iso_pu_bacteria 2903768456 2903775765 318
702 iso_pu_bacteria 2904666416 2904671751 318
703 iso_pu_bacteria 2904711408 2904715101 318
704 iso_pu_bacteria 2906602504 2906605597 318
705 iso_pu_bacteria 2906626472 2906627157 318
706 iso_pu_bacteria 2906643746 2906646189 318
707 iso_pu_bacteria 2922368715 2922374892 318
708 iso_pu_bacteria 2922393267 2922400423 318
709 iso_pu_bacteria 2929615660 2929621936 318
710 iso_pu_bacteria 2929624759 2929629757 318
711 iso_pu_bacteria 2932784394 2932788803 318
712 iso_pu_bacteria 2932794094 2932797992 318
713 iso_pu_bacteria 2932801729 2932807166 318
714 iso_pu_bacteria 2932809354 2932812777 318
715 iso_pu_bacteria 2932818245 2932819131 318
716 iso_pu_bacteria 2932828146 2932830469 318
717 iso_pu_bacteria 2933577622 2933583788 318
718 iso_pu_bacteria 2935616580 2935616763 318
719 iso_pu_bacteria 2935638405 2935641907 318
720 iso_pu_bacteria 2935648319 2935650911 318
721 iso_pu_bacteria 2935656913 2935659092 318
722 iso_pu_bacteria 2935665750 2935673038 318
723 iso_pu_bacteria 2935675223 2935675843 318
724 iso_pu_bacteria 2935684952 2935685840 318
725 iso_pu_bacteria 2935694250 2935697914 318
726 iso_pu_bacteria 2935703347 2935705680 318
727 iso_pu_bacteria 2935713505 2935714392 318
728 iso_pu_bacteria 2935722832 2935725011 318
729 iso_pu_bacteria 2935732158 2935732630 318
730 iso_pu_bacteria 2935741537 2935742009 318
731 iso_pu_bacteria 2935750917 2935751805 318
732 iso_pu_bacteria 2935760218 2935765062 318
733 iso_pu_bacteria 2935769743 2935771677 318
734 iso_pu_bacteria 2935777560 2935778908 318
735 iso_pu_bacteria 2935785616 2935791171 318
736 iso_pu_bacteria 2935793552 2935795500 318
737 iso_pu_bacteria 2935801545 2935802658 318
738 iso_pu_bacteria 2935810662 2935813512 318
739 iso_pu_bacteria 2935827899 2935830074 318
740 iso_pu_bacteria 2935837841 2935837992 318
741 iso_pu_bacteria 2935855204 2935855387 318
742 iso_pu_bacteria 2935864058 2935867369 318
743 iso_pu_bacteria 2935873716 2935875812 318
744 iso_pu_bacteria 2935883170 2935886719 318
745 iso_pu_bacteria 2935959822 2935960792 318
746 iso_pu_bacteria 2935992306 2935996476 318
747 iso_pu_bacteria 2936002035 2936003756 318
748 iso_pu_bacteria 2936011229 2936013507 318
749 iso_pu_bacteria 2936019824 2936022366 318
750 iso_pu_bacteria 2936028420 2936030812 318
751 iso_pu_bacteria 2936037263 2936042461 318
752 iso_pu_bacteria 2936046547 2936048625 318
753 iso_pu_bacteria 2936055302 2936058839 318
754 iso_pu_bacteria 2940556831 2940557392 318
755 iso_pu_bacteria 2941531003 2941533183 318
756 iso_pu_bacteria 2941538514 2941539342 318
757 iso_pu_bacteria 3005506211 3005510675 318
758 iso_pu_bacteria 3005710791 3005715269 318
759 iso_pu_bacteria 3005718088 3005722649 318
760 iso_pu_bacteria 8016511872 8016521823 318
761 iso_pu_bacteria 8016522445 8016529231 318
762 iso_pu_bacteria 8016530956 8016534443 318
763 iso_pu_bacteria 8016539877 8016547665 318
764 iso_pu_bacteria 8016548790 8016554471 318
765 iso_pu_bacteria 8016557553 8016562845 318
766 iso_pu_bacteria 8016566248 8016572785 318
767 iso_pu_bacteria 8016575299 8016576942 318
768 iso_pu_bacteria 8016583857 8016593276 318
769 iso_pu_bacteria 8016595262 8016600620 318
770 iso_pu_bacteria 8016603502 8016610119 318
771 iso_pu_bacteria 8016613128 8016614817 318
772 iso_pu_bacteria 8016622563 8016626159 318
773 iso_pu_bacteria 8017057580 8017063830 318
774 iso_pu_bacteria 8019530166 8019534204 318
775 iso_pu_bacteria 8019538911 8019545254 318
776 iso_pu_bacteria 8019547302 8019553255 318
777 iso_pu_bacteria 8019555841 8019556211 318
778 iso_pu_bacteria 8019565922 8019569098 318
779 iso_pu_bacteria 8019576017 8019583179 318
780 iso_pu_bacteria 8019586578 8019590986 318
781 iso_pu_bacteria 8019597564 8019600362 318
782 iso_pu_bacteria 8019608314 8019618181 318
783 iso_pu_bacteria 8019629233 8019634057 318
784 iso_pu_bacteria 8055742211 8055745898 318
785 iso_pu_bacteria 8056967851 8056968400 318
786 3300003215 JGI25153J46596_10002476 JGI25153J46596_100024769 319
787 3300003856 Ga0058692_1000687 Ga0058692_10006875 319
788 3300005434 Ga0070709_10168631 Ga0070709_101686312 319
789 3300005435 Ga0070714_100014768 Ga0070714_1000147683 319
790 3300005458 Ga0070681_10081006 Ga0070681_100810062 319
791 3300005530 Ga0070679_100385539 Ga0070679_1003855391 319
792 3300005563 Ga0068855_100053737 Ga0068855_1000537375 319
793 3300005563 Ga0068855_100617586 Ga0068855_1006175861 319
794 3300005981 Ga0081538_10034813 Ga0081538_100348131 319
795 3300005983 Ga0081540_1006279 Ga0081540_10062797 319
796 3300005985 Ga0081539_10118279 Ga0081539_101182791 319
797 3300006028 Ga0070717_10051575 Ga0070717_100515752 319
798 3300006051 Ga0075364_10152519 Ga0075364_101525192 319
799 3300006178 Ga0075367_10067544 Ga0075367_100675444 319
800 3300006178 Ga0075367_10096783 Ga0075367_100967832 319
801 3300006237 Ga0097621_100030570 Ga0097621_1000305703 319
802 3300006353 Ga0075370_10052123 Ga0075370_100521232 319
803 3300009101 Ga0105247_10032205 Ga0105247_100322052 319
804 3300009551 Ga0105238_10095463 Ga0105238_100954632 319
805 3300010375 Ga0105239_10077120 Ga0105239_100771203 319
806 3300013104 Ga0157370_10503671 Ga0157370_105036711 319
807 3300013105 Ga0157369_10139837 Ga0157369_101398372 319
808 3300013296 Ga0157374_10069517 Ga0157374_100695173 319
809 3300013308 Ga0157375_10034118 Ga0157375_100341182 319
810 3300014325 Ga0163163_10483772 Ga0163163_104837721 319
811 3300014969 Ga0157376_10080773 Ga0157376_100807733 319
812 3300025295 Ga0209564_1011501 Ga0209564_10115011 319
813 3300025297 Ga0209758_1004785 Ga0209758_10047854 319
814 3300025912 Ga0207707_10026169 Ga0207707_100261692 319
815 3300025915 Ga0207693_10323066 Ga0207693_103230661 319
816 3300025919 Ga0207657_10067482 Ga0207657_100674822 319
817 3300025929 Ga0207664_10039535 Ga0207664_100395352 319
818 3300025939 Ga0207665_10083764 Ga0207665_100837642 319
819 3300025949 Ga0207667_10033437 Ga0207667_100334377 319
820 3300026023 Ga0207677_10020108 Ga0207677_100201084 319
821 3300026075 Ga0207708_10155099 Ga0207708_101550992 319
822 3300026121 Ga0207683_10053445 Ga0207683_100534453 319
823 3300027312 Ga0209371_1000064 Ga0209371_100006442 319
824 3300027312 Ga0209371_1000163 Ga0209371_100016380 319
825 3300030500 Ga0268256_1000028 Ga0268256_1000028202 319
826 3300031241 Ga0265325_10001718 Ga0265325_100017184 319
827 3300031595 Ga0265313_10055801 Ga0265313_100558012 319
828 3300031711 Ga0265314_10018231 Ga0265314_100182312 319
829 3300035117 Ga0373953_0010484 Ga0373953_0010484_50_1009 319
830 3300035118 Ga0373954_0091116 Ga0373954_0091116_29_988 319
831 3300035172 Ga0373955_0069708 Ga0373955_0069708_413_1372 319
832 3300035724 Ga0373933_0058226 Ga0373933_0058226_407_1366 319
833 3300036712 Ga0316584_0099828 Ga0316584_0099828_514_1482 319
834 3300039437 Ga0436365_0042699 Ga0436365_0042699_952_1911 319
835 3300039438 Ga0436360_0244839 Ga0436360_0244839_25_984 319
836 3300041505 Ga0451849_1297764 Ga0451849_1297764_261_1220 319
837 3300044684 Ga0466966_0112704 Ga0466966_0112704_100_1059 319
838 3300044693 Ga0466961_0070685 Ga0466961_0070685_1166_2125 319
839 3300044694 Ga0466963_0028188 Ga0466963_0028188_1778_2737 319
840 3300044842 Ga0466957_0005921 Ga0466957_0005921_517_1476 319
841 3300046454 Ga0495592_0087118 Ga0495592_0087118_1098_2057 319
842 3300046460 Ga0495638_0000646 Ga0495638_0000646_6081_7040 319
843 3300046460 Ga0495638_0015466 Ga0495638_0015466_51_1058 319
844 3300046460 Ga0495638_0023643 Ga0495638_0023643_1351_2310 319
845 3300046461 Ga0495641_0056133 Ga0495641_0056133_626_1594 319
846 3300046462 Ga0495651_0109695 Ga0495651_0109695_620_1579 319
847 3300046475 Ga0495639_0021828 Ga0495639_0021828_356_1324 319
848 3300046506 Ga0495583_0070594 Ga0495583_0070594_488_1447 319
849 3300046511 Ga0495608_0028010 Ga0495608_0028010_1472_2431 319
850 3300046514 Ga0495618_0028419 Ga0495618_0028419_2194_3153 319
851 3300046529 Ga0495652_0079764 Ga0495652_0079764_1458_2417 319
852 3300046530 Ga0495654_0040560 Ga0495654_0040560_1093_2052 319
853 3300046533 Ga0495640_0034294 Ga0495640_0034294_2179_3138 319
854 3300046543 Ga0495645_0012837 Ga0495645_0012837_1187_2146 319
855 3300046557 Ga0495622_0026990 Ga0495622_0026990_134_1093 319
856 3300046559 Ga0495667_0109179 Ga0495667_0109179_264_1223 319
857 3300046642 Ga0495634_0049893 Ga0495634_0049893_1274_2233 319
858 3300046660 Ga0495625_0035955 Ga0495625_0035955_2164_3123 319
859 3300046663 Ga0495635_0009786 Ga0495635_0009786_1409_2368 319
860 3300046674 Ga0495588_0083273 Ga0495588_0083273_448_1416 319
861 3300046679 Ga0495623_0020874 Ga0495623_0020874_2103_3062 319
862 3300046689 Ga0495613_0171281 Ga0495613_0171281_44_1003 319
863 3300046691 Ga0495670_0004878 Ga0495670_0004878_1329_2288 319
864 3300046809 Ga0495600_0059008 Ga0495600_0059008_676_1635 319
865 3300047315 Ga0495581_0016513 Ga0495581_0016513_2163_3131 319
866 3300047322 Ga0495680_0045691 Ga0495680_0045691_2207_3166 319
867 3300047444 Ga0495675_0013433 Ga0495675_0013433_2344_3303 319
868 3300047471 Ga0495684_0101158 Ga0495684_0101158_1171_2130 319
869 3300048088 Ga0495602_0174668 Ga0495602_0174668_167_1126 319
870 3300048903 Ga0496100_0021283 Ga0496100_0021283_1292_2260 319
871 3300048903 Ga0496100_0055951 Ga0496100_0055951_346_1305 319
872 3300048905 Ga0496102_0018859 Ga0496102_0018859_5078_6046 319
873 3300048906 Ga0496103_0146337 Ga0496103_0146337_277_1236 319
874 3300048907 Ga0496104_0002456 Ga0496104_0002456_14277_15245 319
875 3300048908 Ga0496105_0006042 Ga0496105_0006042_1244_2212 319
876 3300048908 Ga0496105_0019704 Ga0496105_0019704_4269_5228 319
877 3300048909 Ga0496106_0019968 Ga0496106_0019968_848_1807 319
878 3300048911 Ga0496108_0007691 Ga0496108_0007691_6741_7709 319
879 3300048911 Ga0496108_0018223 Ga0496108_0018223_51_1010 319
880 3300048912 Ga0496109_0010098 Ga0496109_0010098_6790_7758 319
881 3300048913 Ga0496110_0023813 Ga0496110_0023813_41_1000 319
882 3300048914 Ga0496111_0000449 Ga0496111_0000449_5699_6667 319
883 3300048914 Ga0496111_0035352 Ga0496111_0035352_824_1783 319
884 3300048914 Ga0496111_0130188 Ga0496111_0130188_384_1343 319
885 3300048915 Ga0496112_0075363 Ga0496112_0075363_1915_2874 319
886 3300048915 Ga0496112_0097514 Ga0496112_0097514_1005_1964 319
887 3300048916 Ga0496113_0000528 Ga0496113_0000528_11332_12300 319
888 3300048916 Ga0496113_0036976 Ga0496113_0036976_911_1870 319
889 3300048917 Ga0496114_0120594 Ga0496114_0120594_714_1673 319
890 3300048918 Ga0496115_0012089 Ga0496115_0012089_5472_6431 319
891 3300048919 Ga0496116_0006031 Ga0496116_0006031_6548_7507 319
892 3300048920 Ga0496117_0046908 Ga0496117_0046908_1062_2021 319
893 3300048920 Ga0496117_0058063 Ga0496117_0058063_142_1101 319
894 3300048921 Ga0496118_0063583 Ga0496118_0063583_1710_2675 319
895 3300048924 Ga0496121_0006633 Ga0496121_0006633_7202_8161 319
896 3300048925 Ga0496122_0010744 Ga0496122_0010744_4096_5055 319
897 3300048928 Ga0496125_0025922 Ga0496125_0025922_2522_3481 319
898 3300048929 Ga0496126_0001122 Ga0496126_0001122_37745_38704 319
899 3300048929 Ga0496126_0005275 Ga0496126_0005275_2795_3754 319
900 3300048929 Ga0496126_0223372 Ga0496126_0223372_290_1255 319
901 3300049569 Ga0501032_0114576 Ga0501032_0114576_178_1143 319
902 3300049570 Ga0501033_0000059 Ga0501033_0000059_45401_46366 319
903 3300049573 Ga0501037_0250136 Ga0501037_0250136_183_1145 319
904 3300049581 Ga0501047_0304180 Ga0501047_0304180_171_1133 319
905 3300049584 Ga0501068_0008815 Ga0501068_0008815_4130_5092 319
906 3300049585 Ga0501069_0003478 Ga0501069_0003478_195_1157 319
907 3300049586 Ga0501070_0001781 Ga0501070_0001781_6533_7495 319
908 3300049587 Ga0501071_0166708 Ga0501071_0166708_487_1449 319
909 3300049590 Ga0501074_0027427 Ga0501074_0027427_3030_3992 319
910 3300049591 Ga0501075_0002380 Ga0501075_0002380_10800_11777 319
911 3300049741 Ga0501079_0199306 Ga0501079_0199306_124_1101 319
912 3300049742 Ga0501080_0091709 Ga0501080_0091709_1118_2080 319
913 3300049742 Ga0501080_0285558 Ga0501080_0285558_291_1250 319
914 3300049743 Ga0501081_0007912 Ga0501081_0007912_4795_5772 319
915 3300049822 Ga0501035_0000213 Ga0501035_0000213_26419_27384 319
916 3300049822 Ga0501035_0000581 Ga0501035_0000581_158_1117 319
917 3300049822 Ga0501035_0039760 Ga0501035_0039760_2366_3331 319
918 3300049822 Ga0501035_0096497 Ga0501035_0096497_870_1832 319
919 3300049823 Ga0501044_0007966 Ga0501044_0007966_9624_10586 319
920 3300050491 nmdc:mga00v17_95615_c1 nmdc:mga00v17_95615_c1_488_1459 319
921 3300050492 nmdc:mga0yw44_6339_c1 nmdc:mga0yw44_6339_c1_1614_2573 319
922 3300050496 nmdc:mga07m45_73106_c1 nmdc:mga07m45_73106_c1_783_1742 319
923 3300050516 nmdc:mga0sz30_19571_c1 nmdc:mga0sz30_19571_c1_897_1856 319
924 3300050516 nmdc:mga0sz30_3474_c2 nmdc:mga0sz30_3474_c2_209_1168 319
925 3300053078 Ga0495612_0047992 Ga0495612_0047992_253_1212 319
926 3300053084 Ga0495595_0129829 Ga0495595_0129829_215_1174 319
927 3300053085 Ga0495619_0019038 Ga0495619_0019038_571_1530 319
928 3300053087 Ga0500643_001354 Ga0500643_001354_11579_12538 319
929 3300053088 Ga0500644_0012687 Ga0500644_0012687_201_1160 319
930 3300053093 Ga0500651_0000483 Ga0500651_0000483_18620_19579 319
931 3300053093 Ga0500651_0041450 Ga0500651_0041450_1821_2780 319
932 3300053094 Ga0500566_0000732 Ga0500566_0000732_8275_9234 319
933 3300053094 Ga0500566_0047464 Ga0500566_0047464_1245_2204 319
934 3300053098 Ga0500650_0000157 Ga0500650_0000157_2265_3224 319
935 3300053104 Ga0500556_0000002 Ga0500556_0000002_382765_383724 319
936 3300053116 Ga0500592_003479 Ga0500592_003479_1186_2145 319
937 3300053119 Ga0500595_000029 Ga0500595_000029_31067_32026 319
938 3300053122 Ga0500608_058711 Ga0500608_058711_522_1481 319
939 3300053130 Ga0500642_0000016 Ga0500642_0000016_74418_75377 319
940 3300053134 Ga0500658_0006618 Ga0500658_0006618_1735_2694 319
941 3300053148 Ga0500590_054921 Ga0500590_054921_627_1586 319
942 3300053151 Ga0500604_0000635 Ga0500604_0000635_3367_4326 319
943 3300053153 Ga0500616_0000006 Ga0500616_0000006_145368_146327 319
944 3300053153 Ga0500616_0000061 Ga0500616_0000061_186155_187114 319
945 3300053153 Ga0500616_0024589 Ga0500616_0024589_619_1578 319
946 3300053156 Ga0500622_0000518 Ga0500622_0000518_30423_31382 319
947 3300053156 Ga0500622_0024809 Ga0500622_0024809_427_1392 319
948 3300053177 Ga0500636_0001934 Ga0500636_0001934_4735_5700 319
949 3300053177 Ga0500636_0003021 Ga0500636_0003021_470_1429 319
950 3300053730 Ga0500645_025733 Ga0500645_025733_137_1096 319
951 3300054114 Ga0501084_0033942 Ga0501084_0033942_1168_2145 319
952 3300060353 Ga0501082_0076459 Ga0501082_0076459_1054_2031 319
953 iso_pu_bacteria 2513237351 2514589121 319
954 iso_pu_bacteria 2582581298 2585225086 319
955 iso_pu_bacteria 2585427529 2585547642 319
956 iso_pu_bacteria 2937843397 2937845013 319
957 3300005548 Ga0070665_100020306 Ga0070665_1000203063 320
958 3300006038 Ga0075365_10022859 Ga0075365_100228596 320
959 3300006042 Ga0075368_10002315 Ga0075368_100023151 320
960 3300006048 Ga0075363_100045005 Ga0075363_1000450053 320
961 3300006048 Ga0075363_100158317 Ga0075363_1001583171 320
962 3300006178 Ga0075367_10026637 Ga0075367_100266371 320
963 3300006178 Ga0075367_10062247 Ga0075367_100622472 320
964 3300006178 Ga0075367_10155238 Ga0075367_101552382 320
965 3300006844 Ga0075428_100009268 Ga0075428_1000092687 320
966 3300006844 Ga0075428_100231309 Ga0075428_1002313092 320
967 3300006846 Ga0075430_100003793 Ga0075430_1000037937 320
968 3300006846 Ga0075430_100105716 Ga0075430_1001057162 320
969 3300009147 Ga0114129_10039868 Ga0114129_100398683 320
970 3300026075 Ga0207708_10382026 Ga0207708_103820261 320
971 3300026118 Ga0207675_100029061 Ga0207675_1000290611 320
972 3300027866 Ga0209813_10015877 Ga0209813_100158772 320
973 3300027866 Ga0209813_10083591 Ga0209813_100835911 320
974 3300028379 Ga0268266_10006297 Ga0268266_100062977 320
975 3300028380 Ga0268265_10151298 Ga0268265_101512982 320
976 3300031456 Ga0307513_10027677 Ga0307513_100276774 320
977 3300035398 Ga0316574_0006300 Ga0316574_0006300_5334_6317 320
978 3300037853 Ga0436364_0332886 Ga0436364_0332886_146_1108 320
979 3300039437 Ga0436365_0373092 Ga0436365_0373092_88_1050 320
980 3300039437 Ga0436365_1873205 Ga0436365_1873205_34076_35041 320
981 3300047471 Ga0495684_0370833 Ga0495684_0370833_23_985 320
982 3300048908 Ga0496105_0036063 Ga0496105_0036063_1573_2538 320
983 3300048912 Ga0496109_0001205 Ga0496109_0001205_209_1174 320
984 3300048913 Ga0496110_0001225 Ga0496110_0001225_3343_4308 320
985 3300048914 Ga0496111_0031629 Ga0496111_0031629_2687_3652 320
986 3300048920 Ga0496117_0000181 Ga0496117_0000181_102403_103371 320
987 3300048921 Ga0496118_0000188 Ga0496118_0000188_24082_25050 320
988 3300048922 Ga0496119_0000132 Ga0496119_0000132_15440_16408 320
989 3300048923 Ga0496120_0000134 Ga0496120_0000134_88255_89223 320
990 3300048923 Ga0496120_0055365 Ga0496120_0055365_35_997 320
991 3300048925 Ga0496122_0000183 Ga0496122_0000183_88275_89243 320
992 3300048926 Ga0496123_0000184 Ga0496123_0000184_88275_89243 320
993 3300048927 Ga0496124_0001712 Ga0496124_0001712_27633_28601 320
994 3300048928 Ga0496125_0001059 Ga0496125_0001059_11894_12862 320
995 3300048929 Ga0496126_0000731 Ga0496126_0000731_17212_18180 320
996 3300049571 Ga0501034_0150452 Ga0501034_0150452_793_1755 320
997 3300049581 Ga0501047_0067919 Ga0501047_0067919_1599_2579 320
998 3300049583 Ga0501067_0057288 Ga0501067_0057288_1102_2064 320
999 3300049584 Ga0501068_0037779 Ga0501068_0037779_880_1893 320
1000 3300049585 Ga0501069_0108479 Ga0501069_0108479_391_1404 320
1001 3300049586 Ga0501070_0101042 Ga0501070_0101042_375_1388 320
1002 3300049588 Ga0501072_0265287 Ga0501072_0265287_205_1272 320
1003 3300049823 Ga0501044_0093205 Ga0501044_0093205_1227_2240 320
1004 3300050491 nmdc:mga00v17_244037_c1 nmdc:mga00v17_244037_c1_37_1002 320
1005 3300050494 nmdc:mga06z11_1878_c2 nmdc:mga06z11_1878_c2_2540_3505 320
1006 3300050494 nmdc:mga06z11_223703_c1 nmdc:mga06z11_223703_c1_86_1051 320
1007 3300050494 nmdc:mga06z11_7550_c1 nmdc:mga06z11_7550_c1_2608_3573 320
1008 3300050495 nmdc:mga04h51_23128_c1 nmdc:mga04h51_23128_c1_169_1134 320
1009 3300050495 nmdc:mga04h51_99319_c1 nmdc:mga04h51_99319_c1_27_992 320
1010 3300050507 nmdc:mga05p37_46906_c1 nmdc:mga05p37_46906_c1_2207_3169 320
1011 3300050508 nmdc:mga09592_216541_c1 nmdc:mga09592_216541_c1_572_1537 320
1012 3300050508 nmdc:mga09592_31291_c1 nmdc:mga09592_31291_c1_1839_2801 320
1013 3300050509 nmdc:mga0qj67_2705_c1 nmdc:mga0qj67_2705_c1_6296_7261 320
1014 3300053119 Ga0500595_000062 Ga0500595_000062_68479_69444 320
1015 3300053136 Ga0500559_0000066 Ga0500559_0000066_83512_84474 320
1016 iso_pu_bacteria 2904504865 2904509169 320
1017 3300005262 Ga0065165_1002156 Ga0065165_100215614 321
1018 3300005288 Ga0065714_10087552 Ga0065714_100875522 321
1019 3300005290 Ga0065712_10077700 Ga0065712_100777003 321
1020 3300005290 Ga0065712_10124474 Ga0065712_101244742 321
1021 3300005293 Ga0065715_10190426 Ga0065715_101904262 321
1022 3300005330 Ga0070690_100031364 Ga0070690_1000313643 321
1023 3300005340 Ga0070689_100108554 Ga0070689_1001085541 321
1024 3300005347 Ga0070668_100420711 Ga0070668_1004207111 321
1025 3300005354 Ga0070675_100024111 Ga0070675_1000241112 321
1026 3300005354 Ga0070675_100036688 Ga0070675_1000366884 321
1027 3300005354 Ga0070675_100138658 Ga0070675_1001386582 321
1028 3300005364 Ga0070673_100010819 Ga0070673_1000108192 321
1029 3300005364 Ga0070673_100016264 Ga0070673_1000162642 321
1030 3300005364 Ga0070673_100134286 Ga0070673_1001342862 321
1031 3300005365 Ga0070688_100056573 Ga0070688_1000565733 321
1032 3300005365 Ga0070688_100174067 Ga0070688_1001740671 321
1033 3300005406 Ga0070703_10001433 Ga0070703_100014336 321
1034 3300005435 Ga0070714_100391365 Ga0070714_1003913652 321
1035 3300005438 Ga0070701_10039009 Ga0070701_100390092 321
1036 3300005440 Ga0070705_100000669 Ga0070705_1000006696 321
1037 3300005440 Ga0070705_100010431 Ga0070705_1000104313 321
1038 3300005441 Ga0070700_100005764 Ga0070700_1000057647 321
1039 3300005441 Ga0070700_100119040 Ga0070700_1001190401 321
1040 3300005441 Ga0070700_100211505 Ga0070700_1002115052 321
1041 3300005457 Ga0070662_100035666 Ga0070662_1000356663 321
1042 3300005458 Ga0070681_10020468 Ga0070681_100204682 321
1043 3300005459 Ga0068867_100233593 Ga0068867_1002335931 321
1044 3300005471 Ga0070698_100058814 Ga0070698_1000588143 321
1045 3300005471 Ga0070698_100095814 Ga0070698_1000958142 321
1046 3300005518 Ga0070699_100002092 Ga0070699_10000209215 321
1047 3300005518 Ga0070699_100070950 Ga0070699_1000709503 321
1048 3300005518 Ga0070699_100187693 Ga0070699_1001876932 321
1049 3300005530 Ga0070679_100087010 Ga0070679_1000870103 321
1050 3300005536 Ga0070697_100126985 Ga0070697_1001269852 321
1051 3300005543 Ga0070672_100010592 Ga0070672_1000105922 321
1052 3300005545 Ga0070695_100001854 Ga0070695_10000185411 321
1053 3300005545 Ga0070695_100006971 Ga0070695_1000069711 321
1054 3300005545 Ga0070695_100027466 Ga0070695_1000274661 321
1055 3300005546 Ga0070696_100000152 Ga0070696_10000015215 321
1056 3300005546 Ga0070696_100052288 Ga0070696_1000522883 321
1057 3300005564 Ga0070664_100058923 Ga0070664_1000589233 321
1058 3300005564 Ga0070664_100077578 Ga0070664_1000775782 321
1059 3300005577 Ga0068857_100011760 Ga0068857_1000117603 321
1060 3300005578 Ga0068854_100064089 Ga0068854_1000640891 321
1061 3300005617 Ga0068859_100004116 Ga0068859_1000041169 321
1062 3300005617 Ga0068859_100355007 Ga0068859_1003550072 321
1063 3300005618 Ga0068864_100303716 Ga0068864_1003037162 321
1064 3300005718 Ga0068866_10110876 Ga0068866_101108762 321
1065 3300005719 Ga0068861_100124129 Ga0068861_1001241292 321
1066 3300005719 Ga0068861_100291950 Ga0068861_1002919502 321
1067 3300005843 Ga0068860_100034482 Ga0068860_1000344826 321
1068 3300005844 Ga0068862_100003721 Ga0068862_10000372115 321
1069 3300005844 Ga0068862_100164261 Ga0068862_1001642613 321
1070 3300005937 Ga0081455_10000052 Ga0081455_1000005265 321
1071 3300005937 Ga0081455_10037106 Ga0081455_100371063 321
1072 3300005983 Ga0081540_1000413 Ga0081540_100041333 321
1073 3300005983 Ga0081540_1001108 Ga0081540_10011086 321
1074 3300005985 Ga0081539_10000074 Ga0081539_1000007473 321
1075 3300005985 Ga0081539_10001407 Ga0081539_1000140742 321
1076 3300005985 Ga0081539_10003527 Ga0081539_100035278 321
1077 3300005985 Ga0081539_10003710 Ga0081539_1000371017 321
1078 3300005985 Ga0081539_10049992 Ga0081539_100499922 321
1079 3300006844 Ga0075428_100017074 Ga0075428_1000170746 321
1080 3300006844 Ga0075428_100038731 Ga0075428_1000387316 321
1081 3300006844 Ga0075428_100049703 Ga0075428_1000497032 321
1082 3300006846 Ga0075430_100013634 Ga0075430_1000136345 321
1083 3300006846 Ga0075430_100018911 Ga0075430_1000189114 321
1084 3300006847 Ga0075431_100277703 Ga0075431_1002777032 321
1085 3300006852 Ga0075433_10000461 Ga0075433_1000046115 321
1086 3300006852 Ga0075433_10018233 Ga0075433_100182333 321
1087 3300006852 Ga0075433_10081604 Ga0075433_100816044 321
1088 3300006871 Ga0075434_100000022 Ga0075434_10000002228 321
1089 3300006871 Ga0075434_100005354 Ga0075434_1000053543 321
1090 3300006871 Ga0075434_100006016 Ga0075434_1000060169 321
1091 3300006871 Ga0075434_100021666 Ga0075434_1000216665 321
1092 3300006871 Ga0075434_100037997 Ga0075434_1000379974 321
1093 3300006871 Ga0075434_100048888 Ga0075434_1000488882 321
1094 3300006871 Ga0075434_100083949 Ga0075434_1000839493 321
1095 3300006880 Ga0075429_100024553 Ga0075429_1000245535 321
1096 3300006880 Ga0075429_100026775 Ga0075429_1000267753 321
1097 3300006880 Ga0075429_100035041 Ga0075429_1000350414 321
1098 3300006880 Ga0075429_100081922 Ga0075429_1000819223 321
1099 3300006914 Ga0075436_100017867 Ga0075436_1000178675 321
1100 3300006914 Ga0075436_100057646 Ga0075436_1000576462 321
1101 3300006931 Ga0097620_100004116 Ga0097620_1000041169 321
1102 3300006931 Ga0097620_100354971 Ga0097620_1003549712 321
1103 3300007076 Ga0075435_100000010 Ga0075435_10000001032 321
1104 3300007076 Ga0075435_100002387 Ga0075435_10000238710 321
1105 3300007076 Ga0075435_100016178 Ga0075435_1000161785 321
1106 3300007076 Ga0075435_100023068 Ga0075435_1000230683 321
1107 3300007076 Ga0075435_100035148 Ga0075435_1000351482 321
1108 3300007076 Ga0075435_100037657 Ga0075435_1000376573 321
1109 3300007076 Ga0075435_100047761 Ga0075435_1000477612 321
1110 3300009092 Ga0105250_10000007 Ga0105250_1000000762 321
1111 3300009094 Ga0111539_10000422 Ga0111539_1000042226 321
1112 3300009094 Ga0111539_10001890 Ga0111539_1000189010 321
1113 3300009094 Ga0111539_10004985 Ga0111539_1000498510 321
1114 3300009094 Ga0111539_10008576 Ga0111539_100085766 321
1115 3300009094 Ga0111539_10026841 Ga0111539_100268414 321
1116 3300009094 Ga0111539_10027691 Ga0111539_100276913 321
1117 3300009094 Ga0111539_10054645 Ga0111539_100546456 321
1118 3300009094 Ga0111539_10087413 Ga0111539_100874132 321
1119 3300009094 Ga0111539_10281415 Ga0111539_102814152 321
1120 3300009094 Ga0111539_10320066 Ga0111539_103200662 321
1121 3300009101 Ga0105247_10033309 Ga0105247_100333093 321
1122 3300009147 Ga0114129_10015168 Ga0114129_100151688 321
1123 3300009147 Ga0114129_10025222 Ga0114129_100252226 321
1124 3300009147 Ga0114129_10026135 Ga0114129_100261353 321
1125 3300009147 Ga0114129_10059053 Ga0114129_100590533 321
1126 3300009147 Ga0114129_10071739 Ga0114129_100717394 321
1127 3300009147 Ga0114129_10077640 Ga0114129_100776403 321
1128 3300009147 Ga0114129_10204778 Ga0114129_102047782 321
1129 3300009147 Ga0114129_10251470 Ga0114129_102514702 321
1130 3300009147 Ga0114129_10288986 Ga0114129_102889862 321
1131 3300009147 Ga0114129_10526894 Ga0114129_105268941 321
1132 3300009148 Ga0105243_10286668 Ga0105243_102866682 321
1133 3300009176 Ga0105242_10031769 Ga0105242_100317692 321
1134 3300009177 Ga0105248_10022852 Ga0105248_100228522 321
1135 3300014325 Ga0163163_10020481 Ga0163163_100204812 321
1136 3300014325 Ga0163163_10205367 Ga0163163_102053671 321
1137 3300014326 Ga0157380_10116806 Ga0157380_101168062 321
1138 3300014326 Ga0157380_10306919 Ga0157380_103069192 321
1139 3300014745 Ga0157377_10123939 Ga0157377_101239391 321
1140 3300021441 Ga0213871_10001009 Ga0213871_100010095 321
1141 3300025297 Ga0209758_1002091 Ga0209758_10020913 321
1142 3300025711 Ga0207696_1000029 Ga0207696_100002998 321
1143 3300025899 Ga0207642_10018421 Ga0207642_100184212 321
1144 3300025907 Ga0207645_10154927 Ga0207645_101549272 321
1145 3300025907 Ga0207645_10292678 Ga0207645_102926781 321
1146 3300025910 Ga0207684_10269682 Ga0207684_102696822 321
1147 3300025912 Ga0207707_10058115 Ga0207707_100581152 321
1148 3300025917 Ga0207660_10120479 Ga0207660_101204792 321
1149 3300025918 Ga0207662_10045145 Ga0207662_100451452 321
1150 3300025926 Ga0207659_10017723 Ga0207659_100177233 321
1151 3300025926 Ga0207659_10024836 Ga0207659_100248364 321
1152 3300025926 Ga0207659_10077989 Ga0207659_100779892 321
1153 3300025928 Ga0207700_10023915 Ga0207700_100239154 321
1154 3300025934 Ga0207686_10063066 Ga0207686_100630663 321
1155 3300025935 Ga0207709_10319752 Ga0207709_103197521 321
1156 3300025940 Ga0207691_10035421 Ga0207691_100354213 321
1157 3300025941 Ga0207711_10040298 Ga0207711_100402982 321
1158 3300025942 Ga0207689_10168121 Ga0207689_101681212 321
1159 3300025945 Ga0207679_10153241 Ga0207679_101532412 321
1160 3300025945 Ga0207679_10174312 Ga0207679_101743122 321
1161 3300025960 Ga0207651_10008552 Ga0207651_100085526 321
1162 3300025960 Ga0207651_10391362 Ga0207651_103913622 321
1163 3300025961 Ga0207712_10001793 Ga0207712_1000179312 321
1164 3300025961 Ga0207712_10230050 Ga0207712_102300501 321
1165 3300025972 Ga0207668_10156750 Ga0207668_101567501 321
1166 3300026023 Ga0207677_10168050 Ga0207677_101680502 321
1167 3300026035 Ga0207703_10077556 Ga0207703_100775562 321
1168 3300026067 Ga0207678_10052618 Ga0207678_100526184 321
1169 3300026075 Ga0207708_10001164 Ga0207708_1000116414 321
1170 3300026075 Ga0207708_10222277 Ga0207708_102222772 321
1171 3300026075 Ga0207708_10378358 Ga0207708_103783582 321
1172 3300026089 Ga0207648_10018192 Ga0207648_100181922 321
1173 3300026089 Ga0207648_10148275 Ga0207648_101482752 321
1174 3300026089 Ga0207648_10207178 Ga0207648_102071782 321
1175 3300026095 Ga0207676_10009243 Ga0207676_100092432 321
1176 3300026095 Ga0207676_10433158 Ga0207676_104331581 321
1177 3300026095 Ga0207676_10553666 Ga0207676_105536661 321
1178 3300026116 Ga0207674_10013237 Ga0207674_100132379 321
1179 3300026116 Ga0207674_10328343 Ga0207674_103283432 321
1180 3300026118 Ga0207675_100159592 Ga0207675_1001595922 321
1181 3300026118 Ga0207675_100547934 Ga0207675_1005479342 321
1182 3300027665 Ga0209983_1008474 Ga0209983_10084742 321
1183 3300027876 Ga0209974_10022041 Ga0209974_100220412 321
1184 3300027907 Ga0207428_10000975 Ga0207428_1000097525 321
1185 3300027907 Ga0207428_10001481 Ga0207428_1000148116 321
1186 3300027907 Ga0207428_10008324 Ga0207428_100083242 321
1187 3300027907 Ga0207428_10015544 Ga0207428_100155444 321
1188 3300027907 Ga0207428_10050454 Ga0207428_100504542 321
1189 3300027907 Ga0207428_10074044 Ga0207428_100740441 321
1190 3300028380 Ga0268265_10011379 Ga0268265_100113795 321
1191 3300028380 Ga0268265_10156832 Ga0268265_101568322 321
1192 3300028380 Ga0268265_10243968 Ga0268265_102439682 321
1193 3300028381 Ga0268264_10002929 Ga0268264_100029295 321
1194 3300028381 Ga0268264_10040245 Ga0268264_100402453 321
1195 3300031238 Ga0265332_10000501 Ga0265332_100005019 321
1196 3300031247 Ga0265340_10006462 Ga0265340_100064622 321
1197 3300031249 Ga0265339_10030057 Ga0265339_100300572 321
1198 3300031344 Ga0265316_10213248 Ga0265316_102132481 321
1199 3300031548 Ga0307408_100085622 Ga0307408_1000856222 321
1200 3300031711 Ga0265314_10038987 Ga0265314_100389872 321
1201 3300031712 Ga0265342_10000026 Ga0265342_10000026117 321
1202 3300031824 Ga0307413_10110428 Ga0307413_101104282 321
1203 3300031852 Ga0307410_10000769 Ga0307410_100007694 321
1204 3300031852 Ga0307410_10050355 Ga0307410_100503553 321
1205 3300031852 Ga0307410_10092721 Ga0307410_100927212 321
1206 3300031903 Ga0307407_10044508 Ga0307407_100445083 321
1207 3300031911 Ga0307412_10088400 Ga0307412_100884002 321
1208 3300031995 Ga0307409_100066238 Ga0307409_1000662382 321
1209 3300032002 Ga0307416_100005151 Ga0307416_1000051515 321
1210 3300032002 Ga0307416_100101398 Ga0307416_1001013982 321
1211 3300032004 Ga0307414_10088337 Ga0307414_100883372 321
1212 3300032005 Ga0307411_10023299 Ga0307411_100232993 321
1213 3300032126 Ga0307415_100168617 Ga0307415_1001686172 321
1214 3300035114 Ga0373939_0005631 Ga0373939_0005631_134_1132 321
1215 3300035118 Ga0373954_0037996 Ga0373954_0037996_173_1141 321
1216 3300035691 Ga0373931_0002685 Ga0373931_0002685_5256_6350 321
1217 3300035691 Ga0373931_0010435 Ga0373931_0010435_3259_4257 321
1218 3300035691 Ga0373931_0084162 Ga0373931_0084162_266_1246 321
1219 3300036401 Ga0373937_0167701 Ga0373937_0167701_949_1917 321
1220 3300036401 Ga0373937_0171885 Ga0373937_0171885_451_1434 321
1221 3300036401 Ga0373937_0286505 Ga0373937_0286505_473_1453 321
1222 3300039438 Ga0436360_0005552 Ga0436360_0005552_1850_2815 321
1223 3300039450 Ga0436363_0061042 Ga0436363_0061042_836_1840 321
1224 3300039453 Ga0436362_0814308 Ga0436362_0814308_1364_2329 321
1225 3300042461 Ga0439460_0014163 Ga0439460_0014163_317_1297 321
1226 3300044656 Ga0466969_0001806 Ga0466969_0001806_9960_10961 321
1227 3300044658 Ga0466972_0000122 Ga0466972_0000122_235_1245 321
1228 3300044684 Ga0466966_0064475 Ga0466966_0064475_756_1757 321
1229 3300044693 Ga0466961_0000038 Ga0466961_0000038_73666_74631 321
1230 3300044693 Ga0466961_0003784 Ga0466961_0003784_87_1088 321
1231 3300044719 Ga0466971_0001023 Ga0466971_0001023_10043_11044 321
1232 3300045049 Ga0466959_0032699 Ga0466959_0032699_1053_2018 321
1233 3300045049 Ga0466959_0040592 Ga0466959_0040592_709_1710 321
1234 3300045836 Ga0466958_0027541 Ga0466958_0027541_2287_3288 321
1235 3300046491 Ga0495584_0094171 Ga0495584_0094171_429_1445 321
1236 3300046537 Ga0495598_0007673 Ga0495598_0007673_1427_2407 321
1237 3300046559 Ga0495667_0063156 Ga0495667_0063156_370_1338 321
1238 3300046615 Ga0495656_0022549 Ga0495656_0022549_1396_2373 321
1239 3300046642 Ga0495634_0085724 Ga0495634_0085724_228_1208 321
1240 3300046664 Ga0495659_0059796 Ga0495659_0059796_241_1218 321
1241 3300046675 Ga0495657_0150878 Ga0495657_0150878_351_1319 321
1242 3300046684 Ga0495669_0126986 Ga0495669_0126986_208_1185 321
1243 3300047320 Ga0495672_0019817 Ga0495672_0019817_2048_3013 321
1244 3300047444 Ga0495675_0197503 Ga0495675_0197503_152_1198 321
1245 3300048906 Ga0496103_0021841 Ga0496103_0021841_2224_3204 321
1246 3300048907 Ga0496104_0003213 Ga0496104_0003213_9313_10293 321
1247 3300048907 Ga0496104_0011152 Ga0496104_0011152_3472_4452 321
1248 3300048909 Ga0496106_0002717 Ga0496106_0002717_6916_7896 321
1249 3300048911 Ga0496108_0020337 Ga0496108_0020337_2634_3614 321
1250 3300048912 Ga0496109_0013765 Ga0496109_0013765_2894_3874 321
1251 3300048913 Ga0496110_0083715 Ga0496110_0083715_760_1740 321
1252 3300048914 Ga0496111_0081843 Ga0496111_0081843_426_1406 321
1253 3300048915 Ga0496112_0095272 Ga0496112_0095272_639_1619 321
1254 3300048915 Ga0496112_0443835 Ga0496112_0443835_216_1181 321
1255 3300048917 Ga0496114_0187509 Ga0496114_0187509_755_1735 321
1256 3300048918 Ga0496115_0008662 Ga0496115_0008662_5305_6285 321
1257 3300048918 Ga0496115_0046219 Ga0496115_0046219_693_1673 321
1258 3300048924 Ga0496121_0000594 Ga0496121_0000594_34158_35123 321
1259 3300049568 Ga0501031_0199887 Ga0501031_0199887_159_1136 321
1260 3300049570 Ga0501033_0114869 Ga0501033_0114869_280_1245 321
1261 3300049570 Ga0501033_0140771 Ga0501033_0140771_279_1292 321
1262 3300049570 Ga0501033_0198400 Ga0501033_0198400_124_1104 321
1263 3300049571 Ga0501034_0011504 Ga0501034_0011504_6127_7101 321
1264 3300049571 Ga0501034_0160487 Ga0501034_0160487_556_1521 321
1265 3300049572 Ga0501036_0000067 Ga0501036_0000067_7021_7995 321
1266 3300049572 Ga0501036_0071806 Ga0501036_0071806_1157_2122 321
1267 3300049572 Ga0501036_0107880 Ga0501036_0107880_740_1720 321
1268 3300049573 Ga0501037_0008457 Ga0501037_0008457_5005_5979 321
1269 3300049574 Ga0501038_0045248 Ga0501038_0045248_82_1047 321
1270 3300049574 Ga0501038_0101713 Ga0501038_0101713_941_1915 321
1271 3300049574 Ga0501038_0318575 Ga0501038_0318575_18_995 321
1272 3300049575 Ga0501039_0070467 Ga0501039_0070467_1023_1988 321
1273 3300049575 Ga0501039_0128118 Ga0501039_0128118_211_1191 321
1274 3300049576 Ga0501040_0008056 Ga0501040_0008056_5360_6340 321
1275 3300049576 Ga0501040_0028568 Ga0501040_0028568_334_1425 321
1276 3300049576 Ga0501040_0216099 Ga0501040_0216099_56_1033 321
1277 3300049577 Ga0501041_0045183 Ga0501041_0045183_660_1637 321
1278 3300049578 Ga0501042_0001632 Ga0501042_0001632_8498_9478 321
1279 3300049579 Ga0501043_0007369 Ga0501043_0007369_398_1372 321
1280 3300049580 Ga0501046_0003917 Ga0501046_0003917_10326_11306 321
1281 3300049580 Ga0501046_0080108 Ga0501046_0080108_1421_2395 321
1282 3300049581 Ga0501047_0000901 Ga0501047_0000901_25457_26431 321
1283 3300049582 Ga0501048_0130404 Ga0501048_0130404_154_1128 321
1284 3300049584 Ga0501068_0149580 Ga0501068_0149580_369_1346 321
1285 3300049586 Ga0501070_0040423 Ga0501070_0040423_2601_3575 321
1286 3300049587 Ga0501071_0132791 Ga0501071_0132791_633_1613 321
1287 3300049588 Ga0501072_0251758 Ga0501072_0251758_231_1208 321
1288 3300049589 Ga0501073_0149747 Ga0501073_0149747_106_1080 321
1289 3300049590 Ga0501074_0009395 Ga0501074_0009395_5284_6258 321
1290 3300049590 Ga0501074_0014088 Ga0501074_0014088_4403_5368 321
1291 3300049590 Ga0501074_0102499 Ga0501074_0102499_406_1383 321
1292 3300049590 Ga0501074_0229627 Ga0501074_0229627_162_1142 321
1293 3300049591 Ga0501075_0136993 Ga0501075_0136993_843_1823 321
1294 3300049592 Ga0501076_0047771 Ga0501076_0047771_848_1825 321
1295 3300049593 Ga0501077_0029809 Ga0501077_0029809_2419_3399 321
1296 3300049593 Ga0501077_0041052 Ga0501077_0041052_1582_2562 321
1297 3300049682 Ga0501252_008995 Ga0501252_008995_95_1081 321
1298 3300049741 Ga0501079_0003178 Ga0501079_0003178_3415_4395 321
1299 3300049741 Ga0501079_0027398 Ga0501079_0027398_900_1877 321
1300 3300049741 Ga0501079_0085369 Ga0501079_0085369_1291_2271 321
1301 3300049741 Ga0501079_0153775 Ga0501079_0153775_619_1599 321
1302 3300049742 Ga0501080_0000209 Ga0501080_0000209_5060_6034 321
1303 3300049743 Ga0501081_0000257 Ga0501081_0000257_13365_14345 321
1304 3300049743 Ga0501081_0118112 Ga0501081_0118112_71_1051 321
1305 3300049743 Ga0501081_0303169 Ga0501081_0303169_57_1034 321
1306 3300049744 Ga0501083_0001378 Ga0501083_0001378_5239_6213 321
1307 3300049765 Ga0501268_004850 Ga0501268_004850_163_1149 321
1308 3300049779 Ga0501283_002244 Ga0501283_002244_429_1415 321
1309 3300049822 Ga0501035_0029223 Ga0501035_0029223_3238_4203 321
1310 3300049822 Ga0501035_0251260 Ga0501035_0251260_285_1265 321
1311 3300049823 Ga0501044_0004948 Ga0501044_0004948_7802_8776 321
1312 3300049823 Ga0501044_0030190 Ga0501044_0030190_710_1675 321
1313 3300049824 Ga0501045_0030529 Ga0501045_0030529_2247_3227 321
1314 3300049824 Ga0501045_0148823 Ga0501045_0148823_593_1570 321
1315 3300050493 nmdc:mga0k408_159055_c1 nmdc:mga0k408_159055_c1_56_1021 321
1316 3300050507 nmdc:mga05p37_112398_c1 nmdc:mga05p37_112398_c1_2334_3314 321
1317 3300050507 nmdc:mga05p37_14606_c1 nmdc:mga05p37_14606_c1_2379_3359 321
1318 3300050507 nmdc:mga05p37_2371_c1 nmdc:mga05p37_2371_c1_11028_12107 321
1319 3300050507 nmdc:mga05p37_284136_c1 nmdc:mga05p37_284136_c1_537_1553 321
1320 3300050507 nmdc:mga05p37_332899_c1 nmdc:mga05p37_332899_c1_110_1114 321
1321 3300050507 nmdc:mga05p37_346856_c1 nmdc:mga05p37_346856_c1_161_1138 321
1322 3300050507 nmdc:mga05p37_37371_c2 nmdc:mga05p37_37371_c2_605_1585 321
1323 3300050507 nmdc:mga05p37_57709_c1 nmdc:mga05p37_57709_c1_1438_2418 321
1324 3300050508 nmdc:mga09592_59754_c1 nmdc:mga09592_59754_c1_78_1055 321
1325 3300050509 nmdc:mga0qj67_173157_c1 nmdc:mga0qj67_173157_c1_717_1694 321
1326 3300050509 nmdc:mga0qj67_94901_c1 nmdc:mga0qj67_94901_c1_580_1557 321
1327 3300050509 nmdc:mga0qj67_9586_c1 nmdc:mga0qj67_9586_c1_3483_4463 321
1328 3300050510 nmdc:mga06r32_210164_c1 nmdc:mga06r32_210164_c1_398_1375 321
1329 3300050511 nmdc:mga08y16_14581_c1 nmdc:mga08y16_14581_c1_6794_7774 321
1330 3300050511 nmdc:mga08y16_15806_c1 nmdc:mga08y16_15806_c1_517_1497 321
1331 3300050511 nmdc:mga08y16_259804_c1 nmdc:mga08y16_259804_c1_721_1701 321
1332 3300050511 nmdc:mga08y16_2822_c1 nmdc:mga08y16_2822_c1_11449_12426 321
1333 3300050511 nmdc:mga08y16_41809_c1 nmdc:mga08y16_41809_c1_2935_3930 321
1334 3300050511 nmdc:mga08y16_498387_c1 nmdc:mga08y16_498387_c1_207_1184 321
1335 3300050511 nmdc:mga08y16_718_c1 nmdc:mga08y16_718_c1_22360_23337 321
1336 3300050512 nmdc:mga0n895_11949_c1 nmdc:mga0n895_11949_c1_5928_6908 321
1337 3300050512 nmdc:mga0n895_23867_c1 nmdc:mga0n895_23867_c1_2685_3665 321
1338 3300050512 nmdc:mga0n895_27184_c1 nmdc:mga0n895_27184_c1_2253_3233 321
1339 3300050512 nmdc:mga0n895_364630_c1 nmdc:mga0n895_364630_c1_35_1015 321
1340 3300050512 nmdc:mga0n895_48_c1 nmdc:mga0n895_48_c1_35863_36843 321
1341 3300050512 nmdc:mga0n895_5346_c1 nmdc:mga0n895_5346_c1_2539_3537 321
1342 3300050512 nmdc:mga0n895_62545_c1 nmdc:mga0n895_62545_c1_2449_3429 321
1343 3300050512 nmdc:mga0n895_80547_c1 nmdc:mga0n895_80547_c1_353_1333 321
1344 3300050513 nmdc:mga0rr50_18_c1 nmdc:mga0rr50_18_c1_84905_85885 321
1345 3300050513 nmdc:mga0rr50_19346_c1 nmdc:mga0rr50_19346_c1_264_1268 321
1346 3300050513 nmdc:mga0rr50_24003_c1 nmdc:mga0rr50_24003_c1_1591_2571 321
1347 3300050513 nmdc:mga0rr50_26786_c1 nmdc:mga0rr50_26786_c1_2169_3167 321
1348 3300050513 nmdc:mga0rr50_37466_c1 nmdc:mga0rr50_37466_c1_1895_2875 321
1349 3300050513 nmdc:mga0rr50_80697_c1 nmdc:mga0rr50_80697_c1_1294_2274 321
1350 3300050514 nmdc:mga08x19_12824_c1 nmdc:mga08x19_12824_c1_1575_2555 321
1351 3300050514 nmdc:mga08x19_143_c1 nmdc:mga08x19_143_c1_19383_20363 321
1352 3300050514 nmdc:mga08x19_15312_c1 nmdc:mga08x19_15312_c1_679_1659 321
1353 3300050515 nmdc:mga0a205_2040_c1 nmdc:mga0a205_2040_c1_10448_11428 321
1354 3300050515 nmdc:mga0a205_239948_c1 nmdc:mga0a205_239948_c1_524_1504 321
1355 3300050515 nmdc:mga0a205_29327_c1 nmdc:mga0a205_29327_c1_2706_3692 321
1356 3300050515 nmdc:mga0a205_3340_c1 nmdc:mga0a205_3340_c1_10826_11806 321
1357 3300050515 nmdc:mga0a205_49854_c1 nmdc:mga0a205_49854_c1_797_1777 321
1358 3300050515 nmdc:mga0a205_80154_c1 nmdc:mga0a205_80154_c1_461_1540 321
1359 3300053078 Ga0495612_0022715 Ga0495612_0022715_12_995 321
1360 3300053084 Ga0495595_0042699 Ga0495595_0042699_21_1004 321
1361 3300053093 Ga0500651_0001970 Ga0500651_0001970_7492_8457 321
1362 3300053119 Ga0500595_000662 Ga0500595_000662_13514_14479 321
1363 3300053119 Ga0500595_001510 Ga0500595_001510_9395_10360 321
1364 3300053139 Ga0500568_0011491 Ga0500568_0011491_1457_2443 321
1365 3300053153 Ga0500616_0004316 Ga0500616_0004316_1017_1982 321
1366 3300054114 Ga0501084_0001746 Ga0501084_0001746_10078_11058 321
1367 3300054114 Ga0501084_0098511 Ga0501084_0098511_160_1140 321
1368 3300060353 Ga0501082_0007494 Ga0501082_0007494_6079_7059 321
1369 3300060353 Ga0501082_0148717 Ga0501082_0148717_399_1376 321
1370 3300061719 Ga0466962_0001520 Ga0466962_0001520_4325_5326 321
1371 3300061734 Ga0530510_0034022 Ga0530510_0034022_2091_3071 321
1372 3300001989 JGI24739J22299_10040402 JGI24739J22299_100404021 322
1373 3300003214 JGI25165J46597_1004128 JGI25165J46597_10041282 322
1374 3300003215 JGI25153J46596_10000613 JGI25153J46596_100006137 322
1375 3300003215 JGI25153J46596_10004034 JGI25153J46596_100040346 322
1376 3300003354 JGI25160J50197_1000921 JGI25160J50197_10009212 322
1377 3300003354 JGI25160J50197_1011234 JGI25160J50197_10112342 322
1378 3300003794 Ga0055531_10021273 Ga0055531_100212732 322
1379 3300004625 Ga0055543_1006477 Ga0055543_10064771 322
1380 3300005262 Ga0065165_1002034 Ga0065165_100203415 322
1381 3300005327 Ga0070658_10110642 Ga0070658_101106422 322
1382 3300005328 Ga0070676_10087046 Ga0070676_100870462 322
1383 3300005329 Ga0070683_100003379 Ga0070683_1000033797 322
1384 3300005329 Ga0070683_100016094 Ga0070683_1000160944 322
1385 3300005329 Ga0070683_100048946 Ga0070683_1000489463 322
1386 3300005329 Ga0070683_100250262 Ga0070683_1002502622 322
1387 3300005330 Ga0070690_100018459 Ga0070690_1000184591 322
1388 3300005331 Ga0070670_100009760 Ga0070670_1000097607 322
1389 3300005334 Ga0068869_100027508 Ga0068869_1000275083 322
1390 3300005337 Ga0070682_100311399 Ga0070682_1003113991 322
1391 3300005338 Ga0068868_100107240 Ga0068868_1001072401 322
1392 3300005339 Ga0070660_100045469 Ga0070660_1000454694 322
1393 3300005340 Ga0070689_100227197 Ga0070689_1002271971 322
1394 3300005341 Ga0070691_10001349 Ga0070691_1000134910 322
1395 3300005343 Ga0070687_100198558 Ga0070687_1001985582 322
1396 3300005344 Ga0070661_100053057 Ga0070661_1000530572 322
1397 3300005344 Ga0070661_100102961 Ga0070661_1001029612 322
1398 3300005353 Ga0070669_100059894 Ga0070669_1000598943 322
1399 3300005353 Ga0070669_100073634 Ga0070669_1000736341 322
1400 3300005354 Ga0070675_100004522 Ga0070675_1000045223 322
1401 3300005354 Ga0070675_100077652 Ga0070675_1000776522 322
1402 3300005354 Ga0070675_100165269 Ga0070675_1001652692 322
1403 3300005355 Ga0070671_100049765 Ga0070671_1000497652 322
1404 3300005355 Ga0070671_100318682 Ga0070671_1003186821 322
1405 3300005356 Ga0070674_100068569 Ga0070674_1000685692 322
1406 3300005364 Ga0070673_100007974 Ga0070673_1000079744 322
1407 3300005364 Ga0070673_100026894 Ga0070673_1000268943 322
1408 3300005366 Ga0070659_100017692 Ga0070659_1000176922 322
1409 3300005367 Ga0070667_100106442 Ga0070667_1001064422 322
1410 3300005434 Ga0070709_10115580 Ga0070709_101155803 322
1411 3300005436 Ga0070713_100387884 Ga0070713_1003878842 322
1412 3300005438 Ga0070701_10046898 Ga0070701_100468982 322
1413 3300005441 Ga0070700_100081418 Ga0070700_1000814182 322
1414 3300005455 Ga0070663_100031364 Ga0070663_1000313642 322
1415 3300005455 Ga0070663_100114185 Ga0070663_1001141852 322
1416 3300005456 Ga0070678_100275582 Ga0070678_1002755822 322
1417 3300005458 Ga0070681_10001512 Ga0070681_100015128 322
1418 3300005458 Ga0070681_10196840 Ga0070681_101968402 322
1419 3300005459 Ga0068867_100171300 Ga0068867_1001713002 322
1420 3300005466 Ga0070685_10028593 Ga0070685_100285932 322
1421 3300005530 Ga0070679_100001481 Ga0070679_1000014815 322
1422 3300005535 Ga0070684_100000195 Ga0070684_10000019511 322
1423 3300005535 Ga0070684_100025533 Ga0070684_1000255335 322
1424 3300005535 Ga0070684_100070862 Ga0070684_1000708622 322
1425 3300005535 Ga0070684_100201132 Ga0070684_1002011322 322
1426 3300005539 Ga0068853_100023195 Ga0068853_1000231953 322
1427 3300005539 Ga0068853_100408035 Ga0068853_1004080351 322
1428 3300005543 Ga0070672_100029624 Ga0070672_1000296243 322
1429 3300005548 Ga0070665_100036959 Ga0070665_1000369592 322
1430 3300005563 Ga0068855_100004931 Ga0068855_1000049312 322
1431 3300005563 Ga0068855_100021749 Ga0068855_1000217496 322
1432 3300005563 Ga0068855_100044490 Ga0068855_1000444903 322
1433 3300005564 Ga0070664_100005311 Ga0070664_1000053117 322
1434 3300005564 Ga0070664_100020607 Ga0070664_1000206072 322
1435 3300005577 Ga0068857_100002134 Ga0068857_1000021347 322
1436 3300005577 Ga0068857_100009442 Ga0068857_1000094424 322
1437 3300005578 Ga0068854_100279804 Ga0068854_1002798041 322
1438 3300005614 Ga0068856_100000020 Ga0068856_100000020108 322
1439 3300005614 Ga0068856_100046098 Ga0068856_1000460983 322
1440 3300005614 Ga0068856_100090861 Ga0068856_1000908614 322
1441 3300005614 Ga0068856_100216491 Ga0068856_1002164913 322
1442 3300005616 Ga0068852_100072755 Ga0068852_1000727551 322
1443 3300005617 Ga0068859_100016330 Ga0068859_1000163305 322
1444 3300005618 Ga0068864_100262706 Ga0068864_1002627062 322
1445 3300005718 Ga0068866_10012011 Ga0068866_100120114 322
1446 3300005718 Ga0068866_10038218 Ga0068866_100382182 322
1447 3300005719 Ga0068861_100148512 Ga0068861_1001485122 322
1448 3300005834 Ga0068851_10064105 Ga0068851_100641052 322
1449 3300005840 Ga0068870_10033317 Ga0068870_100333172 322
1450 3300005841 Ga0068863_100198158 Ga0068863_1001981582 322
1451 3300005842 Ga0068858_100059754 Ga0068858_1000597543 322
1452 3300005843 Ga0068860_100041013 Ga0068860_1000410132 322
1453 3300005844 Ga0068862_100124093 Ga0068862_1001240932 322
1454 3300006038 Ga0075365_10190749 Ga0075365_101907491 322
1455 3300006042 Ga0075368_10002426 Ga0075368_100024266 322
1456 3300006048 Ga0075363_100022143 Ga0075363_1000221431 322
1457 3300006051 Ga0075364_10080132 Ga0075364_100801321 322
1458 3300006177 Ga0075362_10098213 Ga0075362_100982132 322
1459 3300006186 Ga0075369_10011766 Ga0075369_100117663 322
1460 3300006237 Ga0097621_100032276 Ga0097621_1000322763 322
1461 3300006237 Ga0097621_100081299 Ga0097621_1000812992 322
1462 3300006237 Ga0097621_100202310 Ga0097621_1002023102 322
1463 3300006353 Ga0075370_10131105 Ga0075370_101311051 322
1464 3300006358 Ga0068871_100043283 Ga0068871_1000432833 322
1465 3300006871 Ga0075434_100228416 Ga0075434_1002284162 322
1466 3300006931 Ga0097620_100016330 Ga0097620_1000163305 322
1467 3300006942 Ga0099824_1029573 Ga0099824_10295732 322
1468 3300009093 Ga0105240_10000902 Ga0105240_1000090243 322
1469 3300009093 Ga0105240_10006904 Ga0105240_1000690418 322
1470 3300009093 Ga0105240_10011564 Ga0105240_1001156412 322
1471 3300009093 Ga0105240_10236800 Ga0105240_102368003 322
1472 3300009098 Ga0105245_10001847 Ga0105245_1000184710 322
1473 3300009098 Ga0105245_10003047 Ga0105245_100030474 322
1474 3300009098 Ga0105245_10038373 Ga0105245_100383731 322
1475 3300009098 Ga0105245_10200714 Ga0105245_102007143 322
1476 3300009098 Ga0105245_10290505 Ga0105245_102905052 322
1477 3300009101 Ga0105247_10038361 Ga0105247_100383615 322
1478 3300009148 Ga0105243_10014896 Ga0105243_100148963 322
1479 3300009148 Ga0105243_10301626 Ga0105243_103016262 322
1480 3300009174 Ga0105241_10035110 Ga0105241_100351102 322
1481 3300009174 Ga0105241_10317976 Ga0105241_103179762 322
1482 3300009176 Ga0105242_10050983 Ga0105242_100509833 322
1483 3300009176 Ga0105242_10138954 Ga0105242_101389542 322
1484 3300009176 Ga0105242_10295817 Ga0105242_102958171 322
1485 3300009176 Ga0105242_10454668 Ga0105242_104546681 322
1486 3300009177 Ga0105248_10008703 Ga0105248_100087039 322
1487 3300009177 Ga0105248_10016786 Ga0105248_100167866 322
1488 3300009177 Ga0105248_10382733 Ga0105248_103827332 322
1489 3300009177 Ga0105248_10580746 Ga0105248_105807461 322
1490 3300009545 Ga0105237_10003966 Ga0105237_1000396614 322
1491 3300009545 Ga0105237_10004278 Ga0105237_1000427811 322
1492 3300009545 Ga0105237_10005103 Ga0105237_100051037 322
1493 3300009545 Ga0105237_10044091 Ga0105237_100440912 322
1494 3300009551 Ga0105238_10003029 Ga0105238_100030299 322
1495 3300009551 Ga0105238_10006597 Ga0105238_100065978 322
1496 3300009551 Ga0105238_10018653 Ga0105238_100186537 322
1497 3300009551 Ga0105238_10074830 Ga0105238_100748302 322
1498 3300009553 Ga0105249_10008780 Ga0105249_100087802 322
1499 3300010375 Ga0105239_10002707 Ga0105239_100027076 322
1500 3300010375 Ga0105239_10006453 Ga0105239_1000645311 322
1501 3300010375 Ga0105239_10110545 Ga0105239_101105454 322
1502 3300010375 Ga0105239_10271018 Ga0105239_102710181 322
1503 3300011119 Ga0105246_10076413 Ga0105246_100764132 322
1504 3300013102 Ga0157371_10079089 Ga0157371_100790892 322
1505 3300013104 Ga0157370_10003480 Ga0157370_1000348016 322
1506 3300013104 Ga0157370_10005340 Ga0157370_1000534012 322
1507 3300013105 Ga0157369_10007409 Ga0157369_1000740912 322
1508 3300013105 Ga0157369_10018316 Ga0157369_100183164 322
1509 3300013296 Ga0157374_10031793 Ga0157374_100317932 322
1510 3300013296 Ga0157374_10037660 Ga0157374_100376602 322
1511 3300013296 Ga0157374_10045379 Ga0157374_100453794 322
1512 3300013296 Ga0157374_10249791 Ga0157374_102497913 322
1513 3300013297 Ga0157378_10050879 Ga0157378_100508792 322
1514 3300013306 Ga0163162_10084245 Ga0163162_100842454 322
1515 3300013307 Ga0157372_10015165 Ga0157372_100151655 322
1516 3300013307 Ga0157372_10015355 Ga0157372_100153558 322
1517 3300013307 Ga0157372_10018641 Ga0157372_100186413 322
1518 3300013307 Ga0157372_10037708 Ga0157372_100377084 322
1519 3300013308 Ga0157375_10006056 Ga0157375_100060566 322
1520 3300014326 Ga0157380_10003657 Ga0157380_100036574 322
1521 3300014968 Ga0157379_10068648 Ga0157379_100686482 322
1522 3300014968 Ga0157379_10118819 Ga0157379_101188192 322
1523 3300014969 Ga0157376_10033493 Ga0157376_100334934 322
1524 3300014969 Ga0157376_10048158 Ga0157376_100481585 322
1525 3300014969 Ga0157376_10099021 Ga0157376_100990213 322
1526 3300014969 Ga0157376_10115361 Ga0157376_101153612 322
1527 3300021320 Ga0214544_1000002 Ga0214544_100000287 322
1528 3300021321 Ga0214542_1000001 Ga0214542_1000001437 322
1529 3300021324 Ga0214545_1000001 Ga0214545_1000001503 322
1530 3300021327 Ga0214543_1000001 Ga0214543_1000001693 322
1531 3300025230 Ga0209563_101383 Ga0209563_1013832 322
1532 3300025253 Ga0209677_101906 Ga0209677_1019062 322
1533 3300025254 Ga0209148_1000500 Ga0209148_100050031 322
1534 3300025272 Ga0209455_1001381 Ga0209455_10013812 322
1535 3300025273 Ga0209673_1026004 Ga0209673_10260041 322
1536 3300025295 Ga0209564_1007411 Ga0209564_10074113 322
1537 3300025297 Ga0209758_1000024 Ga0209758_100002489 322
1538 3300025297 Ga0209758_1000068 Ga0209758_100006848 322
1539 3300025297 Ga0209758_1006039 Ga0209758_10060398 322
1540 3300025302 Ga0207426_1000238 Ga0207426_100023822 322
1541 3300025302 Ga0207426_1009267 Ga0207426_10092672 322
1542 3300025302 Ga0207426_1023488 Ga0207426_10234882 322
1543 3300025304 Ga0209257_1001699 Ga0209257_100169913 322
1544 3300025304 Ga0209257_1024430 Ga0209257_10244302 322
1545 3300025899 Ga0207642_10021409 Ga0207642_100214093 322
1546 3300025901 Ga0207688_10180969 Ga0207688_101809691 322
1547 3300025904 Ga0207647_10138886 Ga0207647_101388861 322
1548 3300025906 Ga0207699_10102865 Ga0207699_101028653 322
1549 3300025908 Ga0207643_10082667 Ga0207643_100826673 322
1550 3300025909 Ga0207705_10133689 Ga0207705_101336892 322
1551 3300025911 Ga0207654_10015792 Ga0207654_100157922 322
1552 3300025911 Ga0207654_10054538 Ga0207654_100545383 322
1553 3300025911 Ga0207654_10060985 Ga0207654_100609852 322
1554 3300025911 Ga0207654_10092243 Ga0207654_100922432 322
1555 3300025911 Ga0207654_10137138 Ga0207654_101371382 322
1556 3300025911 Ga0207654_10145798 Ga0207654_101457981 322
1557 3300025912 Ga0207707_10000744 Ga0207707_100007442 322
1558 3300025913 Ga0207695_10000008 Ga0207695_10000008163 322
1559 3300025913 Ga0207695_10009469 Ga0207695_1000946911 322
1560 3300025914 Ga0207671_10009082 Ga0207671_100090825 322
1561 3300025914 Ga0207671_10010012 Ga0207671_100100123 322
1562 3300025914 Ga0207671_10021692 Ga0207671_100216922 322
1563 3300025916 Ga0207663_10142780 Ga0207663_101427802 322
1564 3300025917 Ga0207660_10009094 Ga0207660_100090942 322
1565 3300025918 Ga0207662_10044124 Ga0207662_100441243 322
1566 3300025919 Ga0207657_10056793 Ga0207657_100567932 322
1567 3300025920 Ga0207649_10024543 Ga0207649_100245432 322
1568 3300025921 Ga0207652_10003187 Ga0207652_100031878 322
1569 3300025922 Ga0207646_10232810 Ga0207646_102328101 322
1570 3300025923 Ga0207681_10052102 Ga0207681_100521021 322
1571 3300025924 Ga0207694_10003357 Ga0207694_1000335711 322
1572 3300025924 Ga0207694_10005094 Ga0207694_100050948 322
1573 3300025924 Ga0207694_10008286 Ga0207694_100082868 322
1574 3300025924 Ga0207694_10031243 Ga0207694_100312432 322
1575 3300025924 Ga0207694_10086697 Ga0207694_100866972 322
1576 3300025925 Ga0207650_10041006 Ga0207650_100410064 322
1577 3300025926 Ga0207659_10136054 Ga0207659_101360542 322
1578 3300025927 Ga0207687_10004549 Ga0207687_100045497 322
1579 3300025927 Ga0207687_10021887 Ga0207687_100218871 322
1580 3300025927 Ga0207687_10087730 Ga0207687_100877302 322
1581 3300025931 Ga0207644_10266496 Ga0207644_102664961 322
1582 3300025934 Ga0207686_10005968 Ga0207686_100059688 322
1583 3300025934 Ga0207686_10046220 Ga0207686_100462202 322
1584 3300025934 Ga0207686_10111461 Ga0207686_101114612 322
1585 3300025934 Ga0207686_10280571 Ga0207686_102805711 322
1586 3300025935 Ga0207709_10006551 Ga0207709_100065513 322
1587 3300025937 Ga0207669_10015325 Ga0207669_100153252 322
1588 3300025937 Ga0207669_10070247 Ga0207669_100702472 322
1589 3300025938 Ga0207704_10019548 Ga0207704_100195484 322
1590 3300025940 Ga0207691_10012642 Ga0207691_100126425 322
1591 3300025940 Ga0207691_10079395 Ga0207691_100793952 322
1592 3300025941 Ga0207711_10002212 Ga0207711_1000221211 322
1593 3300025942 Ga0207689_10002436 Ga0207689_100024363 322
1594 3300025944 Ga0207661_10007740 Ga0207661_100077403 322
1595 3300025944 Ga0207661_10041643 Ga0207661_100416434 322
1596 3300025944 Ga0207661_10138075 Ga0207661_101380752 322
1597 3300025945 Ga0207679_10320197 Ga0207679_103201972 322
1598 3300025949 Ga0207667_10002299 Ga0207667_1000229912 322
1599 3300025949 Ga0207667_10036213 Ga0207667_100362132 322
1600 3300025949 Ga0207667_10509157 Ga0207667_105091571 322
1601 3300025961 Ga0207712_10038519 Ga0207712_100385192 322
1602 3300025961 Ga0207712_10258713 Ga0207712_102587132 322
1603 3300025986 Ga0207658_10382881 Ga0207658_103828811 322
1604 3300026035 Ga0207703_10009471 Ga0207703_100094712 322
1605 3300026035 Ga0207703_10013613 Ga0207703_100136134 322
1606 3300026035 Ga0207703_10078444 Ga0207703_100784443 322
1607 3300026035 Ga0207703_10241263 Ga0207703_102412632 322
1608 3300026041 Ga0207639_10314785 Ga0207639_103147851 322
1609 3300026075 Ga0207708_10023160 Ga0207708_100231602 322
1610 3300026078 Ga0207702_10000126 Ga0207702_1000012640 322
1611 3300026078 Ga0207702_10028749 Ga0207702_100287493 322
1612 3300026078 Ga0207702_10227416 Ga0207702_102274161 322
1613 3300026089 Ga0207648_10001001 Ga0207648_100010012 322
1614 3300026095 Ga0207676_10155269 Ga0207676_101552692 322
1615 3300026095 Ga0207676_10426234 Ga0207676_104262341 322
1616 3300026116 Ga0207674_10006609 Ga0207674_100066098 322
1617 3300026118 Ga0207675_100124679 Ga0207675_1001246793 322
1618 3300026121 Ga0207683_10088288 Ga0207683_100882883 322
1619 3300026142 Ga0207698_10055975 Ga0207698_100559752 322
1620 3300027296 Ga0209389_1000107 Ga0209389_100010754 322
1621 3300027357 Ga0209589_1000092 Ga0209589_10000921 322
1622 3300027361 Ga0209489_100006 Ga0209489_100006458 322
1623 3300027361 Ga0209489_107740 Ga0209489_10774016 322
1624 3300027363 Ga0209700_100005 Ga0209700_100005325 322
1625 3300028381 Ga0268264_10024662 Ga0268264_100246624 322
1626 3300031595 Ga0265313_10009269 Ga0265313_100092695 322
1627 3300031711 Ga0265314_10000679 Ga0265314_1000067910 322
1628 3300035086 Ga0373934_0000809 Ga0373934_0000809_5214_6191 322
1629 3300035118 Ga0373954_0004460 Ga0373954_0004460_2666_3643 322
1630 3300035118 Ga0373954_0025998 Ga0373954_0025998_1399_2376 322
1631 3300035172 Ga0373955_0000579 Ga0373955_0000579_11187_12164 322
1632 3300035172 Ga0373955_0016866 Ga0373955_0016866_261_1238 322
1633 3300035724 Ga0373933_0100512 Ga0373933_0100512_780_1757 322
1634 3300035724 Ga0373933_0117121 Ga0373933_0117121_288_1265 322
1635 3300036401 Ga0373937_0003611 Ga0373937_0003611_4353_5330 322
1636 3300036401 Ga0373937_0009848 Ga0373937_0009848_2216_3193 322
1637 3300036401 Ga0373937_0044106 Ga0373937_0044106_3081_4058 322
1638 3300036401 Ga0373937_0072242 Ga0373937_0072242_1465_2442 322
1639 3300037068 Ga0373925_0019045 Ga0373925_0019045_956_1933 322
1640 3300037471 Ga0395905_0014248 Ga0395905_0014248_5057_6040 322
1641 3300037853 Ga0436364_1263634 Ga0436364_1263634_1006_2025 322
1642 3300039453 Ga0436362_0425310 Ga0436362_0425310_3471_4508 322
1643 3300041443 Ga0451789_0334473 Ga0451789_0334473_300_1268 322
1644 3300044658 Ga0466972_0021579 Ga0466972_0021579_2172_3140 322
1645 3300044683 Ga0466965_0048068 Ga0466965_0048068_1093_2061 322
1646 3300044735 Ga0466968_0009822 Ga0466968_0009822_2338_3306 322
1647 3300044842 Ga0466957_0080037 Ga0466957_0080037_409_1485 322
1648 3300044901 Ga0466960_0007498 Ga0466960_0007498_448_1416 322
1649 3300045976 Ga0466967_0090124 Ga0466967_0090124_1588_2664 322
1650 3300046459 Ga0495629_0003217 Ga0495629_0003217_6786_7754 322
1651 3300046460 Ga0495638_0006201 Ga0495638_0006201_4646_5680 322
1652 3300046462 Ga0495651_0001733 Ga0495651_0001733_15597_16565 322
1653 3300046462 Ga0495651_0015996 Ga0495651_0015996_2712_3680 322
1654 3300046472 Ga0495580_0091349 Ga0495580_0091349_715_1701 322
1655 3300046507 Ga0495606_0111298 Ga0495606_0111298_435_1403 322
1656 3300046512 Ga0495610_0042360 Ga0495610_0042360_1267_2235 322
1657 3300046516 Ga0495628_0144481 Ga0495628_0144481_297_1265 322
1658 3300046522 Ga0495643_0021747 Ga0495643_0021747_2517_3533 322
1659 3300046529 Ga0495652_0015532 Ga0495652_0015532_4820_5788 322
1660 3300046529 Ga0495652_0017033 Ga0495652_0017033_2208_3185 322
1661 3300046529 Ga0495652_0257214 Ga0495652_0257214_137_1114 322
1662 3300046533 Ga0495640_0017386 Ga0495640_0017386_2200_3168 322
1663 3300046536 Ga0495587_0001909 Ga0495587_0001909_586_1563 322
1664 3300046536 Ga0495587_0076489 Ga0495587_0076489_247_1215 322
1665 3300046543 Ga0495645_0040500 Ga0495645_0040500_1109_2086 322
1666 3300046543 Ga0495645_0059590 Ga0495645_0059590_555_1523 322
1667 3300046557 Ga0495622_0012510 Ga0495622_0012510_2239_3207 322
1668 3300046559 Ga0495667_0006122 Ga0495667_0006122_953_1921 322
1669 3300046642 Ga0495634_0092836 Ga0495634_0092836_256_1224 322
1670 3300046663 Ga0495635_0024964 Ga0495635_0024964_1013_1981 322
1671 3300046675 Ga0495657_0034816 Ga0495657_0034816_1957_2925 322
1672 3300046679 Ga0495623_0019287 Ga0495623_0019287_987_1955 322
1673 3300046680 Ga0495646_0013106 Ga0495646_0013106_4233_5201 322
1674 3300046689 Ga0495613_0078948 Ga0495613_0078948_1165_2142 322
1675 3300046694 Ga0495649_0044550 Ga0495649_0044550_454_1422 322
1676 3300046809 Ga0495600_0019438 Ga0495600_0019438_1180_2148 322
1677 3300046809 Ga0495600_0069899 Ga0495600_0069899_1088_2056 322
1678 3300047317 Ga0495604_0013959 Ga0495604_0013959_3584_4552 322
1679 3300047317 Ga0495604_0021611 Ga0495604_0021611_3114_4082 322
1680 3300047322 Ga0495680_0009840 Ga0495680_0009840_4445_5413 322
1681 3300047323 Ga0495683_0111410 Ga0495683_0111410_49_1065 322
1682 3300047443 Ga0495687_014000 Ga0495687_014000_2370_3413 322
1683 3300047444 Ga0495675_0028265 Ga0495675_0028265_2386_3354 322
1684 3300047471 Ga0495684_0073996 Ga0495684_0073996_1340_2308 322
1685 3300047673 Ga0495593_0017893 Ga0495593_0017893_1442_2410 322
1686 3300048088 Ga0495602_0029423 Ga0495602_0029423_3130_4107 322
1687 3300048088 Ga0495602_0061523 Ga0495602_0061523_460_1428 322
1688 3300048904 Ga0496101_0020482 Ga0496101_0020482_777_1745 322
1689 3300048907 Ga0496104_0006629 Ga0496104_0006629_1985_2953 322
1690 3300048907 Ga0496104_0386429 Ga0496104_0386429_290_1258 322
1691 3300048907 Ga0496104_0535274 Ga0496104_0535274_77_1045 322
1692 3300048908 Ga0496105_0017354 Ga0496105_0017354_2515_3483 322
1693 3300048909 Ga0496106_0138299 Ga0496106_0138299_930_1898 322
1694 3300048911 Ga0496108_0144347 Ga0496108_0144347_332_1327 322
1695 3300048913 Ga0496110_0387115 Ga0496110_0387115_112_1128 322
1696 3300048915 Ga0496112_0057106 Ga0496112_0057106_1063_2079 322
1697 3300048915 Ga0496112_0600891 Ga0496112_0600891_30_1013 322
1698 3300048920 Ga0496117_0041085 Ga0496117_0041085_1876_2844 322
1699 3300048921 Ga0496118_0061710 Ga0496118_0061710_394_1410 322
1700 3300048921 Ga0496118_0079546 Ga0496118_0079546_495_1511 322
1701 3300048922 Ga0496119_0014102 Ga0496119_0014102_1631_2599 322
1702 3300048922 Ga0496119_0023757 Ga0496119_0023757_697_1713 322
1703 3300048923 Ga0496120_0002412 Ga0496120_0002412_5306_6322 322
1704 3300048923 Ga0496120_0017393 Ga0496120_0017393_1758_2726 322
1705 3300048924 Ga0496121_0028476 Ga0496121_0028476_2895_3863 322
1706 3300048925 Ga0496122_0000071 Ga0496122_0000071_151546_152562 322
1707 3300048925 Ga0496122_0098611 Ga0496122_0098611_117_1085 322
1708 3300048926 Ga0496123_0000006 Ga0496123_0000006_576270_577286 322
1709 3300048928 Ga0496125_0111936 Ga0496125_0111936_161_1177 322
1710 3300048928 Ga0496125_0202850 Ga0496125_0202850_54_1022 322
1711 3300048929 Ga0496126_0007487 Ga0496126_0007487_1580_2548 322
1712 3300050491 nmdc:mga00v17_62489_c1 nmdc:mga00v17_62489_c1_88_1149 322
1713 3300050492 nmdc:mga0yw44_23562_c2 nmdc:mga0yw44_23562_c2_442_1410 322
1714 3300050493 nmdc:mga0k408_14459_c1 nmdc:mga0k408_14459_c1_1668_2684 322
1715 3300050493 nmdc:mga0k408_22966_c1 nmdc:mga0k408_22966_c1_1353_2336 322
1716 3300050495 nmdc:mga04h51_48203_c1 nmdc:mga04h51_48203_c1_353_1369 322
1717 3300050515 nmdc:mga0a205_86016_c1 nmdc:mga0a205_86016_c1_759_1727 322
1718 3300050516 nmdc:mga0sz30_138188_c1 nmdc:mga0sz30_138188_c1_38_1051 322
1719 3300053077 Ga0495601_0024080 Ga0495601_0024080_548_1525 322
1720 3300053087 Ga0500643_000007 Ga0500643_000007_12635_13651 322
1721 3300053091 Ga0500647_0014787 Ga0500647_0014787_1385_2461 322
1722 3300053092 Ga0500583_0021347 Ga0500583_0021347_20_1036 322
1723 3300053094 Ga0500566_0001155 Ga0500566_0001155_8543_9598 322
1724 3300053104 Ga0500556_0004146 Ga0500556_0004146_2609_3625 322
1725 3300053105 Ga0500557_000052 Ga0500557_000052_20704_21672 322
1726 3300053108 Ga0500562_036076 Ga0500562_036076_31_1065 322
1727 3300053119 Ga0500595_017250 Ga0500595_017250_1149_2117 322
1728 3300053130 Ga0500642_0000306 Ga0500642_0000306_8501_9469 322
1729 3300053136 Ga0500559_0004531 Ga0500559_0004531_1576_2544 322
1730 3300053153 Ga0500616_0050298 Ga0500616_0050298_90_1106 322
1731 3300053162 Ga0500638_034681 Ga0500638_034681_307_1275 322
1732 3300053177 Ga0500636_0000042 Ga0500636_0000042_49592_50560 322
1733 3300053729 Ga0500625_018538 Ga0500625_018538_991_1959 322
1734 3300053736 Ga0500599_001085 Ga0500599_001085_1913_2947 322
1735 3300055283 Ga0500661_004435 Ga0500661_004435_670_1638 322

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

226

344

0.98

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

84

193

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
7q2a-assembly1.cif.gz_D crystal structure of aphc in complex with 4-ethylcatechol 0.9647 7 314
7q2a-assembly1.cif.gz_A crystal structure of aphc in complex with 4-ethylcatechol 0.9646 7 314
3lm4-assembly1.cif.gz_B crystal structure of 2,3-dihydroxy biphenyl dioxygenase from rhodococcus sp. (strain rha1) 0.9643 7 314
7q2a-assembly1.cif.gz_C crystal structure of aphc in complex with 4-ethylcatechol 0.9626 7 314
7q2a-assembly1.cif.gz_D crystal structure of aphc in complex with 4-ethylcatechol 0.9208 7 314
ID Description Score Start End Superfamily
3lm4B01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.973 8 143 3.10.180.10
3lm4B01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9659 8 143 3.10.180.10
3lm4D02 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9164 152 314 3.10.180.10
1f1yA02 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9004 153 293 3.10.180.10
5zszA02 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8965 154 292 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A501W3D9-F1-model_v4 Catechol 2,3-dioxygenase 0.9955 2 77 GO:0051213
AF-A0A2T5VH14-F1-model_v4 Catechol 2,3-dioxygenase 0.9849 2 317 GO:0008198
GO:0009056
GO:0018577
AF-A0A1J1EEM9-F1-model_v4 deleted 0.9841 4 226
AF-A0A501W3D9-F1-model_v4 Catechol 2,3-dioxygenase 0.9826 2 77 GO:0051213
AF-A0A2M8Q7B3-F1-model_v4 Catechol 2,3-dioxygenase 0.9772 92 237 GO:0051213

Feature Viewer

pLDDT pTM Quality
92.78 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map