F495481

General Info

Members Datasets Scaffolds Average Seq Length
1723 722 3446 161

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|3005710791|3005711609
Length 179
Sequence SRHNETKFFKMTDAAVQIPETNRRLDAIDRKILMVLQEDASLSVAEIGDRVGLSSTPCWKRIQRLEADGVILKRVALVDQNKIGLGISVFVSVESADHSDAWLKRFAEAVSAMPEVMEFYRMAGDVDYMLRVVVADMQAYDVFYKKLISAVPLKNVTSRFAMEKIKSVTTLPIPAVVAA

Samples

Sample ID Description Type Environment
1 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
2 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
3 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
7 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
8 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
9 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
10 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
11 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
12 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
13 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
14 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
15 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
16 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
17 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
18 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
19 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
20 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
21 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
22 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
23 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
24 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
25 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
26 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
27 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
28 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
29 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
30 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
31 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
32 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
33 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
34 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
35 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
36 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
37 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
38 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
39 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
40 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
41 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
42 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
43 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
44 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
45 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
46 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
47 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
48 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
49 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
50 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
51 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
52 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
53 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
54 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
55 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
56 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
57 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
58 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
59 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
60 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
61 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
62 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
63 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
64 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
65 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
66 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
67 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
68 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
69 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
70 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
71 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
72 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
73 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
74 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
75 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
76 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
77 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
78 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
79 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
80 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
81 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
82 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
83 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
84 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
85 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
86 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
87 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
88 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
89 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
90 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
91 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
92 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
93 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
94 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
95 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
96 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
97 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
98 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
99 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
100 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
101 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
102 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
103 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
104 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
105 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
106 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
107 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
108 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
109 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
110 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
111 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
112 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
113 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
114 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
115 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
116 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
117 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
118 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
119 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
120 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
121 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
122 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
123 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
124 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
125 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
126 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
127 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
128 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
129 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
130 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
131 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
132 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
133 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
134 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
135 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
136 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
137 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
138 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
139 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
140 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
141 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
142 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
143 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
144 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
145 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
146 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
147 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
148 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
149 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
150 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
151 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
152 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
153 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
154 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
155 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
156 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
157 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
158 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
159 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
160 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
161 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
162 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
163 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
164 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
165 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
166 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
167 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
168 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
169 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
170 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
171 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
172 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
173 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
174 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
175 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
176 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
177 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
178 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
179 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
180 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
181 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
182 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
183 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
234 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
238 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
239 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
240 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
241 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
242 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
243 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
245 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
246 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
247 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
248 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
249 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
250 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
251 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
252 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
253 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
254 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
255 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
256 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
257 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
258 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
259 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
260 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
261 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
262 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
263 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
264 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
265 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
266 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
267 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
268 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
269 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
270 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
271 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
272 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
273 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
274 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
275 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
276 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
277 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
278 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
279 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
280 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
281 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
282 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
283 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
284 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
285 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
286 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
287 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
288 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
289 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
290 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
291 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
292 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
293 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
294 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
295 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
296 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
297 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
298 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
299 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
300 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
301 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
302 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
303 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
304 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
305 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
306 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
307 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
308 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
309 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
310 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
311 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
312 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
313 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
314 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
315 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
316 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
317 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
318 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
319 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
320 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
321 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
322 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
323 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
324 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
325 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
326 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
327 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
328 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
329 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
330 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
331 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
332 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
333 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
334 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
335 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
336 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
337 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
338 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
339 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
340 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
341 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
342 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
343 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
344 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
345 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
346 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
347 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
348 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
349 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
350 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
351 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
352 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
353 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
354 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
355 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
356 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
357 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
358 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
359 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
360 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
361 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
362 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
363 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
364 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
365 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
366 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
367 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
368 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
369 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
370 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
371 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
372 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
373 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
374 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
375 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
376 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
377 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
378 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
379 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
380 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
381 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
382 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
383 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
384 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
385 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
386 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
387 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
388 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
389 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
390 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
391 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
392 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
393 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
394 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
395 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
396 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
397 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
398 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
399 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
400 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
401 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
402 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
403 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
404 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
405 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
406 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
407 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
408 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
409 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
410 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
411 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
412 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
413 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
414 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
415 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
416 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
417 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
418 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
419 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
420 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
421 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
422 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
423 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
424 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
425 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
426 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
427 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
428 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
429 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
430 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
431 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
432 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
433 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
434 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
435 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
436 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
437 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
438 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
439 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
440 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
441 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
442 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
443 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
444 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
445 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
446 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
447 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
448 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
449 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
450 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
451 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
452 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
453 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
454 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
455 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
456 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
457 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
458 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
459 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
460 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
461 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
462 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
463 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
464 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
465 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
466 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
467 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
468 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
469 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
470 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
471 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
472 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
473 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
474 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
475 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
476 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
477 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
478 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
479 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
480 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
481 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
482 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
483 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
484 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
485 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
486 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
487 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
488 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
489 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
490 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
491 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
492 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
493 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
494 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
495 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
496 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
497 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
498 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
499 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
500 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
501 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
502 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
503 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
504 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
505 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
506 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
507 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
508 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
509 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
510 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
511 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
512 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
513 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
514 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
515 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
516 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
517 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
518 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
519 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
520 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
521 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
522 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
523 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
524 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
525 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
526 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
527 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
528 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
529 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
530 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
531 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
532 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
533 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
534 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
535 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
536 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
537 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
538 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
539 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
540 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
541 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
542 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
543 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
544 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
545 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
546 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
547 3300053728 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 endosphere Metagenome Endosphere
548 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
549 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
550 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
551 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
552 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
553 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
554 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
555 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
556 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
557 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
558 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
559 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
560 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
561 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
562 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
563 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
564 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
565 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
566 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
567 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
568 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
569 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
570 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
571 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
572 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
573 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
574 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
575 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
576 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
577 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
578 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
579 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
580 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
581 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
582 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
583 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
584 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
585 2791355199
586 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
587 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
588 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
589 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
590 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
591 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
592 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
593 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
594 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
595 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
596 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
597 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
598 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
599 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
600 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
601 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
602 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
603 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
604 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
605 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
606 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
607 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
608 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
609 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
610 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
611 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
612 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
613 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
614 2842333319 Skermanella aerolata SEMIA 4010 Isolate Nodule
615 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
616 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
617 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
618 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
619 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
620 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
621 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
622 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
623 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
624 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
625 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
626 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
627 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
628 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
629 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
630 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
631 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
632 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
633 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
634 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
635 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
636 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
637 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
638 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
639 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
640 2904699407
641 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
642 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
643 2906610324
644 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
645 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
646 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
647 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
648 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
649 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
650 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
651 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
652 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
653 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
654 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
655 2922425934
656 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
657 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
658 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
659 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
660 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
661 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
662 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
663 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
664 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
665 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
666 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
667 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
668 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
669 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
670 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
671 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
672 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
673 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
674 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
675 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
676 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
677 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
678 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
679 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
680 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
681 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
682 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
683 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
684 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
685 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
686 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
687 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
688 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
689 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
690 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
691 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
692 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
693 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
694 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
695 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
696 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
697 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
698 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
699 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
700 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
701 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
702 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
703 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
704 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
705 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
706 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
707 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
708 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
709 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
710 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
711 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
712 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
713 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
714 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
715 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
716 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
717 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
718 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
719 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
720 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
721 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
722 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 89.76
Metatranscriptomes 0.35
Isolates 9.89

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.45
Nodule 7.72
Rhizoplane 5.8
Rhizosphere 68.25
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 CNAas_1007064 3300000532 Bacteria 728
2 CNAas_1016288 3300000532 Bacteria 528
3 JGI24752J21851_1014742 3300001976 Bacteria 1019
4 JGI24752J21851_1042018 3300001976 Bacteria 613
5 JGI24746J21847_1002860 3300001977 Bacteria 2715
6 JGI24739J22299_10011021 3300001989 Bacteria 3344
7 JGI24739J22299_10071708 3300001989 Bacteria 1077
8 JGI24737J22298_10008157 3300001990 Bacteria 3519
9 JGI24737J22298_10050504 3300001990 Bacteria 1264
10 JGI24743J22301_10024237 3300001991 Bacteria 1171
11 JGI24743J22301_10029493 3300001991 Bacteria 1077
12 JGI24735J21928_10031758 3300002067 Bacteria 1565
13 JGI24750J21931_1001747 3300002070 Bacteria 2654
14 JGI24750J21931_1003723 3300002070 Bacteria 1836
15 JGI24745J21846_1018492 3300002073 Bacteria 813
16 JGI24748J21848_1013455 3300002074 Bacteria 967
17 JGI24738J21930_10019399 3300002075 Bacteria 1417
18 JGI24744J21845_10004946 3300002077 Bacteria 2761
19 JGI24033J26618_1008262 3300002155 Bacteria 1195
20 JGI24034J26672_10026686 3300002239 Bacteria 927
21 JGI24742J22300_10014955 3300002244 Bacteria 1304
22 JGI24751J29686_10034545 3300002459 Bacteria 1049
23 JGI25153J46596_10001947 3300003215 Bacteria 12243
24 JGI25153J46596_10006672 3300003215 Bacteria 5805
25 JGI25153J46596_10011948 3300003215 Bacteria 3798
26 JGI25160J50197_1003445 3300003354 Bacteria 7078
27 JGI25160J50197_1021526 3300003354 Bacteria 1914
28 JGI25404J52841_10114818 3300003659 Bacteria 567
29 Ga0055542_1012564 3300003762 Bacteria 1460
30 Ga0055526_1017736 3300003771 Bacteria 2701
31 Ga0055524_1044957 3300003775 Bacteria 1068
32 Ga0055531_10005248 3300003794 Bacteria 7607
33 JGI25405J52794_10008372 3300003911 Bacteria 1930
34 Ga0065165_1002353 3300005262 Bacteria 16397
35 Ga0065165_1003437 3300005262 Bacteria 11130
36 Ga0065165_1020999 3300005262 Bacteria 2279
37 Ga0065704_10158960 3300005289 Bacteria 1369
38 Ga0070658_10650403 3300005327 Bacteria 914
39 Ga0070658_11243293 3300005327 Bacteria 647
40 Ga0070676_10256132 3300005328 Bacteria 1170
41 Ga0070683_100001565 3300005329 Bacteria 17682
42 Ga0070683_100030774 3300005329 Bacteria 4877
43 Ga0070690_100015243 3300005330 Bacteria 4581
44 Ga0070670_100008743 3300005331 Bacteria 8647
45 Ga0070670_100121742 3300005331 Bacteria 2251
46 Ga0068869_100063993 3300005334 Bacteria 2704
47 Ga0068869_100869605 3300005334 Bacteria 778
48 Ga0070666_10035271 3300005335 Bacteria 3317
49 Ga0070666_10077319 3300005335 Bacteria 2272
50 Ga0070680_100021428 3300005336 Bacteria 5137
51 Ga0070680_100036045 3300005336 Bacteria 3995
52 Ga0070680_100086516 3300005336 Bacteria 2591
53 Ga0070682_100083151 3300005337 Bacteria 2077
54 Ga0070682_100376278 3300005337 Bacteria 1067
55 Ga0070682_100527707 3300005337 Bacteria 920
56 Ga0068868_100041855 3300005338 Bacteria 3571
57 Ga0068868_100423390 3300005338 Bacteria 1153
58 Ga0070660_100399137 3300005339 Bacteria 1137
59 Ga0070660_100851486 3300005339 Bacteria 768
60 Ga0070689_100060091 3300005340 Bacteria 2954
61 Ga0070691_10091962 3300005341 Bacteria 1497
62 Ga0070691_10187112 3300005341 Bacteria 1081
63 Ga0070687_100341399 3300005343 Bacteria 963
64 Ga0070687_100465401 3300005343 Bacteria 844
65 Ga0070661_100048583 3300005344 Bacteria 3106
66 Ga0070661_100144999 3300005344 Bacteria 1792
67 Ga0070661_100414778 3300005344 Bacteria 1066
68 Ga0070692_10042076 3300005345 Bacteria 2344
69 Ga0070692_10392284 3300005345 Bacteria 874
70 Ga0070668_100039946 3300005347 Bacteria 3589
71 Ga0070668_100070709 3300005347 Bacteria 2717
72 Ga0070668_100286040 3300005347 Bacteria 1378
73 Ga0070668_100375762 3300005347 Bacteria 1208
74 Ga0070668_100668782 3300005347 Bacteria 914
75 Ga0070668_100710332 3300005347 Bacteria 887
76 Ga0070669_100011139 3300005353 Bacteria 6383
77 Ga0070675_100070988 3300005354 Bacteria 2888
78 Ga0070671_100006990 3300005355 Bacteria 9041
79 Ga0070671_100258320 3300005355 Bacteria 1480
80 Ga0070671_101422674 3300005355 Bacteria 613
81 Ga0070674_100044981 3300005356 Bacteria 3014
82 Ga0070674_100087726 3300005356 Bacteria 2238
83 Ga0070674_100370164 3300005356 Bacteria 1163
84 Ga0070674_100558687 3300005356 Bacteria 961
85 Ga0070673_100031845 3300005364 Bacteria 3962
86 Ga0070673_101187499 3300005364 Bacteria 715
87 Ga0070688_100052318 3300005365 Bacteria 2550
88 Ga0070659_100125139 3300005366 Bacteria 2085
89 Ga0070667_100030018 3300005367 Bacteria 4534
90 Ga0070667_101120646 3300005367 Bacteria 736
91 Ga0070703_10057915 3300005406 Bacteria 1259
92 Ga0070709_10159999 3300005434 Bacteria 1565
93 Ga0070709_10740061 3300005434 Bacteria 768
94 Ga0070709_11027051 3300005434 Bacteria 657
95 Ga0070714_100145457 3300005435 Bacteria 2132
96 Ga0070714_100185949 3300005435 Bacteria 1893
97 Ga0070714_100622138 3300005435 Bacteria 1038
98 Ga0070714_100787064 3300005435 Bacteria 921
99 Ga0070714_101523903 3300005435 Bacteria 653
100 Ga0070713_100041745 3300005436 Bacteria 3740
101 Ga0070713_100094501 3300005436 Bacteria 2578
102 Ga0070713_100410108 3300005436 Bacteria 1267
103 Ga0070713_100563342 3300005436 Bacteria 1080
104 Ga0070710_10006631 3300005437 Bacteria 5567
105 Ga0070710_10068125 3300005437 Bacteria 2044
106 Ga0070710_10562440 3300005437 Bacteria 789
107 Ga0070710_10881557 3300005437 Bacteria 645
108 Ga0070701_10092793 3300005438 Bacteria 1657
109 Ga0070711_100005768 3300005439 Bacteria 7431
110 Ga0070711_100010477 3300005439 Bacteria 5740
111 Ga0070711_100134144 3300005439 Bacteria 1848
112 Ga0070711_100608034 3300005439 Bacteria 913
113 Ga0070700_100046342 3300005441 Bacteria 2685
114 Ga0070700_100403356 3300005441 Bacteria 1028
115 Ga0070694_100660815 3300005444 Bacteria 847
116 Ga0070663_100003176 3300005455 Bacteria 9432
117 Ga0070663_100009537 3300005455 Bacteria 6014
118 Ga0070663_100026370 3300005455 Bacteria 3936
119 Ga0070663_100026462 3300005455 Bacteria 3930
120 Ga0070663_100068400 3300005455 Bacteria 2578
121 Ga0070663_100088275 3300005455 Bacteria 2293
122 Ga0070663_101222767 3300005455 Bacteria 661
123 Ga0070678_100033201 3300005456 Bacteria 3581
124 Ga0070678_100036936 3300005456 Bacteria 3424
125 Ga0070678_100136851 3300005456 Bacteria 1954
126 Ga0070678_100258846 3300005456 Bacteria 1462
127 Ga0070678_100670886 3300005456 Bacteria 931
128 Ga0070662_100002656 3300005457 Bacteria 11031
129 Ga0070662_100009910 3300005457 Bacteria 6242
130 Ga0070662_100069500 3300005457 Bacteria 2592
131 Ga0070681_10411229 3300005458 Bacteria 1264
132 Ga0070681_10871132 3300005458 Bacteria 819
133 Ga0068867_100014079 3300005459 Bacteria 5666
134 Ga0068867_100031702 3300005459 Bacteria 3818
135 Ga0068867_100421945 3300005459 Bacteria 1130
136 Ga0068867_100649420 3300005459 Bacteria 925
137 Ga0068867_100896653 3300005459 Bacteria 798
138 Ga0068867_101901825 3300005459 Bacteria 561
139 Ga0070685_10043293 3300005466 Bacteria 2573
140 Ga0070685_10229312 3300005466 Bacteria 1221
141 Ga0070707_100432434 3300005468 Bacteria 1277
142 Ga0070698_100402308 3300005471 Bacteria 1302
143 Ga0070699_100182152 3300005518 Bacteria 1864
144 Ga0070679_100010325 3300005530 Bacteria 8852
145 Ga0070679_100022659 3300005530 Bacteria 6141
146 Ga0070679_100095128 3300005530 Bacteria 2967
147 Ga0070679_100702860 3300005530 Bacteria 954
148 Ga0070684_100038357 3300005535 Bacteria 4115
149 Ga0070684_100044466 3300005535 Bacteria 3841
150 Ga0070697_101460792 3300005536 Bacteria 611
151 Ga0068853_100005156 3300005539 Bacteria 10211
152 Ga0068853_100067627 3300005539 Bacteria 3104
153 Ga0068853_100404177 3300005539 Bacteria 1279
154 Ga0070672_100014120 3300005543 Bacteria 5653
155 Ga0070672_100038206 3300005543 Bacteria 3666
156 Ga0070696_100129789 3300005546 Bacteria 1833
157 Ga0070696_100584535 3300005546 Bacteria 899
158 Ga0070693_100028312 3300005547 Bacteria 3045
159 Ga0070693_100072573 3300005547 Bacteria 2031
160 Ga0070693_100118543 3300005547 Bacteria 1638
161 Ga0070693_100403398 3300005547 Bacteria 948
162 Ga0070665_100046497 3300005548 Bacteria 4359
163 Ga0070665_100051999 3300005548 Bacteria 4109
164 Ga0070665_100068708 3300005548 Bacteria 3552
165 Ga0070665_100291457 3300005548 Bacteria 1634
166 Ga0070665_100324291 3300005548 Bacteria 1544
167 Ga0070665_100986298 3300005548 Bacteria 855
168 Ga0070704_100037230 3300005549 Bacteria 3322
169 Ga0068855_100019978 3300005563 Bacteria 8045
170 Ga0068855_100136155 3300005563 Bacteria 2803
171 Ga0068855_100165617 3300005563 Bacteria 2506
172 Ga0068855_100312920 3300005563 Bacteria 1737
173 Ga0068855_100362099 3300005563 Bacteria 1596
174 Ga0068855_100478450 3300005563 Bacteria 1356
175 Ga0068855_100516417 3300005563 Bacteria 1296
176 Ga0070664_100162609 3300005564 Bacteria 1976
177 Ga0068857_100126257 3300005577 Bacteria 2305
178 Ga0068857_101694345 3300005577 Bacteria 618
179 Ga0068854_100047503 3300005578 Bacteria 3059
180 Ga0068854_100058007 3300005578 Bacteria 2793
181 Ga0068854_100081599 3300005578 Bacteria 2389
182 Ga0068854_100356681 3300005578 Bacteria 1198
183 Ga0068854_100382956 3300005578 Bacteria 1159
184 Ga0068856_100053956 3300005614 Bacteria 3964
185 Ga0068856_100463353 3300005614 Bacteria 1288
186 Ga0068856_100692350 3300005614 Bacteria 1040
187 Ga0070702_100061895 3300005615 Bacteria 2180
188 Ga0068852_100147236 3300005616 Bacteria 2186
189 Ga0068852_100200033 3300005616 Bacteria 1890
190 Ga0068852_100201666 3300005616 Bacteria 1883
191 Ga0068852_100236521 3300005616 Bacteria 1744
192 Ga0068859_100101341 3300005617 Bacteria 2936
193 Ga0068859_100125588 3300005617 Bacteria 2634
194 Ga0068859_100563278 3300005617 Bacteria 1233
195 Ga0068859_101052294 3300005617 Bacteria 894
196 Ga0068859_101364972 3300005617 Bacteria 781
197 Ga0068864_100040306 3300005618 Bacteria 3995
198 Ga0068864_100292997 3300005618 Bacteria 1521
199 Ga0068864_100362652 3300005618 Bacteria 1370
200 Ga0068864_101066983 3300005618 Bacteria 803
201 Ga0068866_10002426 3300005718 Bacteria 7691
202 Ga0068866_10033495 3300005718 Bacteria 2493
203 Ga0068861_100077067 3300005719 Bacteria 2599
204 Ga0068861_100356152 3300005719 Bacteria 1285
205 Ga0068861_101131658 3300005719 Bacteria 754
206 Ga0068851_10049326 3300005834 Bacteria 2135
207 Ga0068851_10053457 3300005834 Bacteria 2056
208 Ga0068870_10021594 3300005840 Bacteria 3151
209 Ga0068870_10022666 3300005840 Bacteria 3088
210 Ga0068863_100022284 3300005841 Bacteria 6047
211 Ga0068863_100119182 3300005841 Bacteria 2516
212 Ga0068858_100505793 3300005842 Bacteria 1167
213 Ga0068860_100008962 3300005843 Bacteria 9967
214 Ga0068860_100009362 3300005843 Bacteria 9736
215 Ga0068860_100067553 3300005843 Bacteria 3396
216 Ga0068860_100535033 3300005843 Bacteria 1172
217 Ga0068860_100650756 3300005843 Bacteria 1062
218 Ga0068862_100031732 3300005844 Bacteria 4462
219 Ga0068862_100285275 3300005844 Bacteria 1514
220 Ga0068862_100438039 3300005844 Bacteria 1230
221 Ga0068862_100536366 3300005844 Bacteria 1115
222 Ga0068862_100934225 3300005844 Bacteria 854
223 Ga0081455_10003720 3300005937 Bacteria 17438
224 Ga0081455_10022574 3300005937 Bacteria 5878
225 Ga0081455_10025887 3300005937 Bacteria 5407
226 Ga0081455_10037014 3300005937 Bacteria 4337
227 Ga0081538_10032637 3300005981 Bacteria 3483
228 Ga0081538_10225715 3300005981 Bacteria 737
229 Ga0081540_1002390 3300005983 Bacteria 15316
230 Ga0081540_1013147 3300005983 Bacteria 5402
231 Ga0081540_1015337 3300005983 Bacteria 4855
232 Ga0081540_1017529 3300005983 Bacteria 4429
233 Ga0081540_1020352 3300005983 Bacteria 3995
234 Ga0081540_1029940 3300005983 Bacteria 3023
235 Ga0081540_1057036 3300005983 Bacteria 1891
236 Ga0081540_1078120 3300005983 Bacteria 1502
237 Ga0081540_1080661 3300005983 Bacteria 1466
238 Ga0081539_10057175 3300005985 Bacteria 2161
239 Ga0070717_10067804 3300006028 Bacteria 2969
240 Ga0070717_10125289 3300006028 Bacteria 2205
241 Ga0075365_10003009 3300006038 Bacteria 8539
242 Ga0075365_10042733 3300006038 Bacteria 2965
243 Ga0075365_10049499 3300006038 Bacteria 2769
244 Ga0075365_10051739 3300006038 Bacteria 2714
245 Ga0075365_10055538 3300006038 Bacteria 2629
246 Ga0075365_10169864 3300006038 Bacteria 1522
247 Ga0075365_10250500 3300006038 Bacteria 1244
248 Ga0075365_10315185 3300006038 Bacteria 1101
249 Ga0075365_10400501 3300006038 Bacteria 969
250 Ga0075365_10507378 3300006038 Bacteria 852
251 Ga0075368_10020688 3300006042 Bacteria 2493
252 Ga0075368_10048722 3300006042 Bacteria 1679
253 Ga0075368_10068298 3300006042 Bacteria 1432
254 Ga0075363_100134074 3300006048 Bacteria 1391
255 Ga0075363_100235982 3300006048 Bacteria 1051
256 Ga0075363_100476082 3300006048 Bacteria 740
257 Ga0075363_100564883 3300006048 Bacteria 680
258 Ga0075363_100574396 3300006048 Bacteria 674
259 Ga0075364_10082487 3300006051 Bacteria 2127
260 Ga0075364_10207456 3300006051 Bacteria 1328
261 Ga0075364_10342750 3300006051 Bacteria 1018
262 Ga0075432_10120583 3300006058 Bacteria 985
263 Ga0070715_10080047 3300006163 Bacteria 1481
264 Ga0070716_100034264 3300006173 Bacteria 2783
265 Ga0070716_100103296 3300006173 Bacteria 1752
266 Ga0070716_100104491 3300006173 Bacteria 1744
267 Ga0070716_100138237 3300006173 Bacteria 1550
268 Ga0070716_100266207 3300006173 Bacteria 1175
269 Ga0070712_100028396 3300006175 Bacteria 3742
270 Ga0070712_100680400 3300006175 Bacteria 876
271 Ga0070712_100893489 3300006175 Bacteria 766
272 Ga0075362_10079252 3300006177 Bacteria 1512
273 Ga0075362_10089156 3300006177 Bacteria 1430
274 Ga0075362_10197755 3300006177 Bacteria 978
275 Ga0075367_10024941 3300006178 Bacteria 3376
276 Ga0075367_10029951 3300006178 Bacteria 3117
277 Ga0075367_10104932 3300006178 Bacteria 1730
278 Ga0075367_10110463 3300006178 Bacteria 1687
279 Ga0075367_10240617 3300006178 Bacteria 1134
280 Ga0075369_10033272 3300006186 Bacteria 2184
281 Ga0075369_10047695 3300006186 Bacteria 1847
282 Ga0075369_10168023 3300006186 Bacteria 1006
283 Ga0075369_10231437 3300006186 Bacteria 856
284 Ga0075366_10055832 3300006195 Bacteria 2345
285 Ga0075366_10764718 3300006195 Bacteria 600
286 Ga0097621_100059211 3300006237 Bacteria 3135
287 Ga0097621_100156305 3300006237 Bacteria 1957
288 Ga0097621_100618265 3300006237 Bacteria 992
289 Ga0075370_10019347 3300006353 Bacteria 3708
290 Ga0075370_10035805 3300006353 Bacteria 2787
291 Ga0075370_10040301 3300006353 Bacteria 2634
292 Ga0075370_10477177 3300006353 Bacteria 752
293 Ga0075370_10683419 3300006353 Bacteria 624
294 Ga0068871_100007042 3300006358 Bacteria 8009
295 Ga0068871_100890450 3300006358 Bacteria 824
296 Ga0075428_100162297 3300006844 Bacteria 2425
297 Ga0075428_100170083 3300006844 Bacteria 2363
298 Ga0075428_100344851 3300006844 Bacteria 1599
299 Ga0075430_100000092 3300006846 Bacteria 52226
300 Ga0075430_100057037 3300006846 Bacteria 3285
301 Ga0075430_100122412 3300006846 Bacteria 2169
302 Ga0075431_100595866 3300006847 Bacteria 1089
303 Ga0075431_100815598 3300006847 Bacteria 906
304 Ga0075431_101146964 3300006847 Bacteria 741
305 Ga0075433_10056373 3300006852 Bacteria 3432
306 Ga0075434_100010423 3300006871 Bacteria 8711
307 Ga0075434_100030654 3300006871 Bacteria 5297
308 Ga0075434_100241358 3300006871 Bacteria 1827
309 Ga0068865_100172438 3300006881 Bacteria 1659
310 Ga0068865_100511837 3300006881 Bacteria 1002
311 Ga0068865_101343343 3300006881 Bacteria 637
312 Ga0075436_100006947 3300006914 Bacteria 7746
313 Ga0097620_100101354 3300006931 Bacteria 2936
314 Ga0097620_100125592 3300006931 Bacteria 2634
315 Ga0097620_100563295 3300006931 Bacteria 1233
316 Ga0097620_101052296 3300006931 Bacteria 894
317 Ga0097620_101364982 3300006931 Bacteria 781
318 Ga0097620_101586738 3300006931 Bacteria 723
319 Ga0099824_1005597 3300006942 Bacteria 17628
320 Ga0099822_1000135 3300006943 Bacteria 49135
321 Ga0075435_100114500 3300007076 Bacteria 2245
322 Ga0075435_100131793 3300007076 Bacteria 2092
323 Ga0075435_100766264 3300007076 Bacteria 840
324 Ga0099794_10021912 3300007265 Bacteria 2908
325 Ga0099794_10060044 3300007265 Bacteria 1846
326 Ga0099795_10035994 3300007788 Bacteria 1734
327 Ga0099795_10044832 3300007788 Bacteria 1588
328 Ga0099795_10048741 3300007788 Bacteria 1535
329 Ga0099795_10170855 3300007788 Bacteria 903
330 Ga0105251_10390400 3300009011 Bacteria 639
331 Ga0105244_10484345 3300009036 Bacteria 569
332 Ga0105250_10174340 3300009092 Bacteria 901
333 Ga0105240_10021688 3300009093 Bacteria 8539
334 Ga0105240_10025074 3300009093 Bacteria 7848
335 Ga0105240_10050477 3300009093 Bacteria 5244
336 Ga0105240_10825297 3300009093 Bacteria 1003
337 Ga0111539_10054794 3300009094 Bacteria 4743
338 Ga0111539_10060771 3300009094 Bacteria 4478
339 Ga0111539_10109696 3300009094 Bacteria 3238
340 Ga0111539_10110862 3300009094 Bacteria 3220
341 Ga0111539_10543708 3300009094 Bacteria 1353
342 Ga0111539_10849268 3300009094 Bacteria 1062
343 Ga0105245_10016805 3300009098 Bacteria 6389
344 Ga0105245_10024798 3300009098 Bacteria 5269
345 Ga0105245_10203823 3300009098 Bacteria 1901
346 Ga0105245_10821810 3300009098 Bacteria 968
347 Ga0105247_10009003 3300009101 Bacteria 6082
348 Ga0105247_10060745 3300009101 Bacteria 2342
349 Ga0105247_10066180 3300009101 Bacteria 2250
350 Ga0105247_10175907 3300009101 Bacteria 1425
351 Ga0105247_10180619 3300009101 Bacteria 1408
352 Ga0105247_10550669 3300009101 Bacteria 848
353 Ga0114129_10012565 3300009147 Bacteria 12056
354 Ga0114129_10099152 3300009147 Bacteria 4032
355 Ga0114129_10103012 3300009147 Bacteria 3947
356 Ga0114129_10164114 3300009147 Bacteria 3032
357 Ga0114129_10637713 3300009147 Bacteria 1376
358 Ga0114129_10639519 3300009147 Bacteria 1374
359 Ga0114129_10878100 3300009147 Bacteria 1138
360 Ga0105243_10022026 3300009148 Bacteria 4841
361 Ga0105243_10346140 3300009148 Bacteria 1363
362 Ga0105243_10356067 3300009148 Bacteria 1346
363 Ga0105241_10024174 3300009174 Bacteria 4512
364 Ga0105241_10048580 3300009174 Bacteria 3229
365 Ga0105241_10116858 3300009174 Bacteria 2143
366 Ga0105241_10368126 3300009174 Bacteria 1252
367 Ga0105241_10492911 3300009174 Bacteria 1091
368 Ga0105241_10658765 3300009174 Bacteria 952
369 Ga0105241_10846850 3300009174 Bacteria 845
370 Ga0105241_11211076 3300009174 Bacteria 716
371 Ga0105242_10101504 3300009176 Bacteria 2438
372 Ga0105248_10077052 3300009177 Bacteria 3748
373 Ga0105248_10512781 3300009177 Bacteria 1352
374 Ga0105237_10008878 3300009545 Bacteria 10833
375 Ga0105237_10015340 3300009545 Bacteria 7980
376 Ga0105237_10129706 3300009545 Bacteria 2516
377 Ga0105237_10133066 3300009545 Bacteria 2481
378 Ga0105237_10792988 3300009545 Bacteria 954
379 Ga0105238_10146676 3300009551 Bacteria 2336
380 Ga0105238_10148405 3300009551 Bacteria 2321
381 Ga0105238_10286075 3300009551 Bacteria 1630
382 Ga0105238_12207788 3300009551 Bacteria 585
383 Ga0105249_10012243 3300009553 Bacteria 7556
384 Ga0105249_10036785 3300009553 Bacteria 4441
385 Ga0105249_10204487 3300009553 Bacteria 1934
386 Ga0105249_10931613 3300009553 Bacteria 936
387 Ga0099796_10001500 3300010159 Bacteria 4728
388 Ga0099796_10021234 3300010159 Bacteria 1996
389 Ga0099796_10146526 3300010159 Bacteria 927
390 Ga0105239_10058078 3300010375 Bacteria 4245
391 Ga0105239_10075274 3300010375 Bacteria 3712
392 Ga0105239_10079699 3300010375 Bacteria 3603
393 Ga0105239_10082681 3300010375 Bacteria 3536
394 Ga0105239_10141126 3300010375 Bacteria 2684
395 Ga0105239_10162375 3300010375 Bacteria 2497
396 Ga0105239_10424858 3300010375 Bacteria 1506
397 Ga0105239_10609090 3300010375 Bacteria 1246
398 Ga0105239_11020883 3300010375 Bacteria 951
399 Ga0105239_11691636 3300010375 Bacteria 732
400 Ga0105246_10042475 3300011119 Bacteria 3079
401 Ga0105246_10105627 3300011119 Bacteria 2059
402 Ga0105246_10145260 3300011119 Bacteria 1789
403 Ga0105246_10484884 3300011119 Bacteria 1047
404 Ga0157373_10149571 3300013100 Bacteria 1642
405 Ga0157373_10736059 3300013100 Bacteria 724
406 Ga0157373_10821079 3300013100 Bacteria 686
407 Ga0157371_10191662 3300013102 Bacteria 1464
408 Ga0157370_10139150 3300013104 Bacteria 2262
409 Ga0157370_10238280 3300013104 Bacteria 1684
410 Ga0157370_10289018 3300013104 Bacteria 1514
411 Ga0157370_10622911 3300013104 Bacteria 987
412 Ga0157370_10665099 3300013104 Bacteria 952
413 Ga0157369_10006988 3300013105 Bacteria 13021
414 Ga0157369_10022714 3300013105 Bacteria 6996
415 Ga0157369_10074385 3300013105 Bacteria 3643
416 Ga0157369_10083984 3300013105 Bacteria 3405
417 Ga0157374_10037462 3300013296 Bacteria 4451
418 Ga0157378_10005022 3300013297 Bacteria 11616
419 Ga0157378_10061841 3300013297 Bacteria 3343
420 Ga0157378_10091824 3300013297 Bacteria 2761
421 Ga0163162_10074563 3300013306 Bacteria 3452
422 Ga0163162_10471223 3300013306 Bacteria 1387
423 Ga0163162_10700368 3300013306 Bacteria 1134
424 Ga0163162_11794836 3300013306 Bacteria 701
425 Ga0157372_10066194 3300013307 Bacteria 4059
426 Ga0157372_10082819 3300013307 Bacteria 3633
427 Ga0157372_10575715 3300013307 Bacteria 1312
428 Ga0157372_10640431 3300013307 Bacteria 1238
429 Ga0157372_11260609 3300013307 Bacteria 853
430 Ga0157375_10075347 3300013308 Bacteria 3398
431 Ga0157375_11213923 3300013308 Bacteria 885
432 Ga0157375_11856529 3300013308 Bacteria 715
433 Ga0163163_10006441 3300014325 Bacteria 10266
434 Ga0163163_10064789 3300014325 Bacteria 3626
435 Ga0163163_10084291 3300014325 Bacteria 3184
436 Ga0157380_10025556 3300014326 Bacteria 4478
437 Ga0157380_10157958 3300014326 Bacteria 1967
438 Ga0157380_10329859 3300014326 Bacteria 1419
439 Ga0157380_11266089 3300014326 Bacteria 784
440 Ga0157377_10072463 3300014745 Bacteria 1994
441 Ga0157377_10198181 3300014745 Bacteria 1273
442 Ga0157379_10135168 3300014968 Bacteria 2221
443 Ga0157379_10233368 3300014968 Bacteria 1668
444 Ga0157379_10269860 3300014968 Bacteria 1547
445 Ga0157379_11086241 3300014968 Bacteria 766
446 Ga0157376_10042914 3300014969 Bacteria 3709
447 Ga0157376_12733539 3300014969 Bacteria 533
448 Ga0163161_10013443 3300017792 Bacteria 5697
449 Ga0163161_10022945 3300017792 Bacteria 4397
450 Ga0163161_10334211 3300017792 Bacteria 1201
451 Ga0206356_10349572 3300020070 Bacteria 1227
452 Ga0206356_11053787 3300020070 Bacteria 815
453 Ga0206354_10934028 3300020081 Bacteria 1329
454 Ga0154015_1287332 3300020610 Bacteria 714
455 Ga0214544_1000007 3300021320 Bacteria 379989
456 Ga0214542_1000007 3300021321 Bacteria 291816
457 Ga0214545_1000006 3300021324 Bacteria 291693
458 Ga0214545_1023938 3300021324 Bacteria 3890
459 Ga0214543_1000009 3300021327 Bacteria 384302
460 Ga0214543_1032603 3300021327 Bacteria 1950
461 Ga0214543_1041664 3300021327 Bacteria 1177
462 Ga0213872_10054957 3300021361 Bacteria 1805
463 Ga0213871_10099441 3300021441 Bacteria 850
464 Ga0224712_10217562 3300022467 Bacteria 873
465 Ga0228598_1049778 3300024227 Bacteria 831
466 Ga0209148_1000526 3300025254 Bacteria 37777
467 Ga0209129_1050782 3300025258 Bacteria 634
468 Ga0209233_1001391 3300025261 Bacteria 9580
469 Ga0209233_1001927 3300025261 Bacteria 7935
470 Ga0209233_1002233 3300025261 Bacteria 7245
471 Ga0209455_1004411 3300025272 Bacteria 4619
472 Ga0209455_1004523 3300025272 Bacteria 4522
473 Ga0207673_1052412 3300025290 Bacteria 578
474 Ga0209564_1000842 3300025295 Bacteria 41342
475 Ga0209564_1023370 3300025295 Bacteria 2150
476 Ga0209758_1000015 3300025297 Bacteria 851943
477 Ga0209758_1001439 3300025297 Bacteria 28039
478 Ga0209758_1001478 3300025297 Bacteria 27491
479 Ga0209758_1011326 3300025297 Bacteria 5183
480 Ga0209758_1021699 3300025297 Bacteria 2982
481 Ga0209758_1048050 3300025297 Bacteria 1521
482 Ga0209256_1007010 3300025299 Bacteria 5723
483 Ga0209256_1072347 3300025299 Bacteria 772
484 Ga0207426_1000186 3300025302 Bacteria 154130
485 Ga0207426_1001603 3300025302 Bacteria 18018
486 Ga0207426_1051408 3300025302 Bacteria 1224
487 Ga0207426_1078886 3300025302 Bacteria 898
488 Ga0209257_1000983 3300025304 Bacteria 38689
489 Ga0207697_10094523 3300025315 Bacteria 1269
490 Ga0207656_10068588 3300025321 Bacteria 1571
491 Ga0207656_10125749 3300025321 Bacteria 1197
492 Ga0207696_1115447 3300025711 Bacteria 726
493 Ga0207692_10407875 3300025898 Bacteria 849
494 Ga0207642_10159591 3300025899 Bacteria 1209
495 Ga0207642_10397203 3300025899 Bacteria 824
496 Ga0207710_10019564 3300025900 Bacteria 2889
497 Ga0207710_10061501 3300025900 Bacteria 1704
498 Ga0207688_10021104 3300025901 Bacteria 3557
499 Ga0207688_10030330 3300025901 Bacteria 2981
500 Ga0207680_10030111 3300025903 Bacteria 3057
501 Ga0207647_10097648 3300025904 Bacteria 1746
502 Ga0207647_10251809 3300025904 Bacteria 1013
503 Ga0207647_10517307 3300025904 Bacteria 664
504 Ga0207699_10024964 3300025906 Bacteria 3275
505 Ga0207699_10172248 3300025906 Bacteria 1449
506 Ga0207699_10795567 3300025906 Bacteria 695
507 Ga0207643_10005803 3300025908 Bacteria 6599
508 Ga0207643_10181086 3300025908 Bacteria 1275
509 Ga0207654_10005282 3300025911 Bacteria 6520
510 Ga0207654_10019075 3300025911 Bacteria 3611
511 Ga0207654_10218768 3300025911 Bacteria 1262
512 Ga0207654_10584195 3300025911 Bacteria 796
513 Ga0207707_10000749 3300025912 Bacteria 31978
514 Ga0207707_10015886 3300025912 Bacteria 6566
515 Ga0207707_10038314 3300025912 Bacteria 4189
516 Ga0207707_10055348 3300025912 Bacteria 3451
517 Ga0207707_10419045 3300025912 Bacteria 1148
518 Ga0207707_10770523 3300025912 Bacteria 803
519 Ga0207695_10000006 3300025913 Bacteria 1135309
520 Ga0207695_10011353 3300025913 Bacteria 10797
521 Ga0207695_10338819 3300025913 Bacteria 1392
522 Ga0207695_10503838 3300025913 Bacteria 1093
523 Ga0207671_10001082 3300025914 Bacteria 33044
524 Ga0207671_10167317 3300025914 Bacteria 1705
525 Ga0207671_10237189 3300025914 Bacteria 1432
526 Ga0207671_10419199 3300025914 Bacteria 1065
527 Ga0207671_10646507 3300025914 Bacteria 842
528 Ga0207671_10954732 3300025914 Bacteria 677
529 Ga0207693_10012511 3300025915 Bacteria 6854
530 Ga0207693_10137700 3300025915 Bacteria 1920
531 Ga0207693_10566541 3300025915 Bacteria 885
532 Ga0207663_10068214 3300025916 Bacteria 2283
533 Ga0207663_10281585 3300025916 Bacteria 1235
534 Ga0207663_10373059 3300025916 Bacteria 1085
535 Ga0207663_10810940 3300025916 Bacteria 746
536 Ga0207663_10820053 3300025916 Bacteria 742
537 Ga0207660_10001899 3300025917 Bacteria 13916
538 Ga0207660_10374702 3300025917 Bacteria 1143
539 Ga0207660_10516037 3300025917 Bacteria 970
540 Ga0207660_10557944 3300025917 Bacteria 932
541 Ga0207662_10004262 3300025918 Bacteria 7505
542 Ga0207657_10058330 3300025919 Bacteria 3322
543 Ga0207649_10347305 3300025920 Bacteria 1097
544 Ga0207652_10006792 3300025921 Bacteria 9225
545 Ga0207652_10016701 3300025921 Bacteria 5998
546 Ga0207652_10114418 3300025921 Bacteria 2395
547 Ga0207652_10217268 3300025921 Bacteria 1722
548 Ga0207652_11138165 3300025921 Bacteria 681
549 Ga0207681_10043643 3300025923 Bacteria 3002
550 Ga0207681_10230628 3300025923 Bacteria 1437
551 Ga0207681_10594372 3300025923 Bacteria 914
552 Ga0207681_11240734 3300025923 Bacteria 626
553 Ga0207694_10382450 3300025924 Bacteria 1168
554 Ga0207694_11409509 3300025924 Bacteria 589
555 Ga0207650_10002601 3300025925 Bacteria 12490
556 Ga0207650_10070888 3300025925 Bacteria 2620
557 Ga0207659_10110718 3300025926 Bacteria 2087
558 Ga0207687_10018889 3300025927 Bacteria 4558
559 Ga0207687_10066193 3300025927 Bacteria 2568
560 Ga0207687_10137034 3300025927 Bacteria 1852
561 Ga0207687_10157973 3300025927 Bacteria 1737
562 Ga0207700_10125141 3300025928 Bacteria 2090
563 Ga0207700_10237546 3300025928 Bacteria 1552
564 Ga0207700_10241217 3300025928 Bacteria 1540
565 Ga0207700_10326804 3300025928 Bacteria 1330
566 Ga0207700_10362422 3300025928 Bacteria 1264
567 Ga0207664_10003797 3300025929 Bacteria 10140
568 Ga0207664_10745102 3300025929 Bacteria 881
569 Ga0207644_10122681 3300025931 Bacteria 1980
570 Ga0207644_10247582 3300025931 Bacteria 1421
571 Ga0207644_10438543 3300025931 Bacteria 1072
572 Ga0207644_10674083 3300025931 Bacteria 861
573 Ga0207644_11012418 3300025931 Bacteria 697
574 Ga0207690_10085492 3300025932 Bacteria 2214
575 Ga0207706_10011066 3300025933 Bacteria 8223
576 Ga0207706_10036752 3300025933 Bacteria 4350
577 Ga0207706_10054486 3300025933 Bacteria 3529
578 Ga0207706_11061708 3300025933 Bacteria 678
579 Ga0207686_10094152 3300025934 Bacteria 1985
580 Ga0207686_10204173 3300025934 Bacteria 1417
581 Ga0207709_10932500 3300025935 Bacteria 707
582 Ga0207670_10093638 3300025936 Bacteria 2129
583 Ga0207669_10043599 3300025937 Bacteria 2628
584 Ga0207669_11281898 3300025937 Bacteria 622
585 Ga0207704_10053388 3300025938 Bacteria 2456
586 Ga0207704_10960360 3300025938 Bacteria 721
587 Ga0207665_10013036 3300025939 Bacteria 5464
588 Ga0207665_10171960 3300025939 Bacteria 1565
589 Ga0207665_10360131 3300025939 Bacteria 1100
590 Ga0207691_10023624 3300025940 Bacteria 5789
591 Ga0207691_10042886 3300025940 Bacteria 4170
592 Ga0207691_10140532 3300025940 Bacteria 2128
593 Ga0207691_10184237 3300025940 Bacteria 1823
594 Ga0207711_10019696 3300025941 Bacteria 5618
595 Ga0207711_11095509 3300025941 Bacteria 737
596 Ga0207689_10013175 3300025942 Bacteria 7056
597 Ga0207661_10001882 3300025944 Bacteria 14372
598 Ga0207661_10007875 3300025944 Bacteria 7592
599 Ga0207661_10842557 3300025944 Bacteria 844
600 Ga0207661_11025764 3300025944 Bacteria 760
601 Ga0207679_10301313 3300025945 Bacteria 1382
602 Ga0207667_10011746 3300025949 Bacteria 10155
603 Ga0207667_10068809 3300025949 Bacteria 3685
604 Ga0207667_10233887 3300025949 Bacteria 1881
605 Ga0207667_10423865 3300025949 Bacteria 1354
606 Ga0207667_10618831 3300025949 Bacteria 1091
607 Ga0207651_10022434 3300025960 Bacteria 3860
608 Ga0207712_10013189 3300025961 Bacteria 5297
609 Ga0207712_10123899 3300025961 Bacteria 1960
610 Ga0207712_11409346 3300025961 Bacteria 624
611 Ga0207668_10023026 3300025972 Bacteria 3996
612 Ga0207668_10138499 3300025972 Bacteria 1868
613 Ga0207668_10179233 3300025972 Bacteria 1669
614 Ga0207668_10282630 3300025972 Bacteria 1361
615 Ga0207668_11365385 3300025972 Bacteria 638
616 Ga0207640_10102563 3300025981 Bacteria 2010
617 Ga0207640_10111010 3300025981 Bacteria 1944
618 Ga0207640_10555623 3300025981 Bacteria 965
619 Ga0207658_10254686 3300025986 Bacteria 1493
620 Ga0207658_10507851 3300025986 Bacteria 1074
621 Ga0207677_10129019 3300026023 Bacteria 1916
622 Ga0207703_10067309 3300026035 Bacteria 2947
623 Ga0207703_10170577 3300026035 Bacteria 1913
624 Ga0207703_11066605 3300026035 Bacteria 776
625 Ga0207703_11067001 3300026035 Bacteria 775
626 Ga0207639_10003831 3300026041 Bacteria 10137
627 Ga0207639_10043257 3300026041 Bacteria 3381
628 Ga0207639_10226608 3300026041 Bacteria 1617
629 Ga0207639_10246384 3300026041 Bacteria 1556
630 Ga0207639_10284636 3300026041 Bacteria 1455
631 Ga0207639_10328155 3300026041 Bacteria 1361
632 Ga0207639_10807629 3300026041 Bacteria 874
633 Ga0207678_10009212 3300026067 Bacteria 8688
634 Ga0207678_10010040 3300026067 Bacteria 8309
635 Ga0207678_10012549 3300026067 Bacteria 7443
636 Ga0207678_10056124 3300026067 Bacteria 3391
637 Ga0207678_10148960 3300026067 Bacteria 1998
638 Ga0207678_10247500 3300026067 Bacteria 1526
639 Ga0207678_10401991 3300026067 Bacteria 1186
640 Ga0207708_10001417 3300026075 Bacteria 17962
641 Ga0207708_10071060 3300026075 Bacteria 2665
642 Ga0207708_10074492 3300026075 Bacteria 2602
643 Ga0207702_10244911 3300026078 Bacteria 1681
644 Ga0207702_10514314 3300026078 Bacteria 1168
645 Ga0207641_10670621 3300026088 Bacteria 1019
646 Ga0207641_11274485 3300026088 Bacteria 735
647 Ga0207648_10003456 3300026089 Bacteria 16569
648 Ga0207648_10040258 3300026089 Bacteria 4107
649 Ga0207648_11376965 3300026089 Bacteria 663
650 Ga0207648_11499871 3300026089 Bacteria 634
651 Ga0207676_10048873 3300026095 Bacteria 3286
652 Ga0207676_10222358 3300026095 Bacteria 1682
653 Ga0207676_10277471 3300026095 Bacteria 1520
654 Ga0207676_11159217 3300026095 Bacteria 765
655 Ga0207674_10070098 3300026116 Bacteria 3524
656 Ga0207674_11069282 3300026116 Bacteria 776
657 Ga0207675_100006895 3300026118 Bacteria 10761
658 Ga0207675_100041152 3300026118 Bacteria 4315
659 Ga0207675_100044665 3300026118 Bacteria 4141
660 Ga0207675_100131130 3300026118 Bacteria 2377
661 Ga0207675_100576068 3300026118 Bacteria 1127
662 Ga0207675_101515866 3300026118 Bacteria 691
663 Ga0207683_10034607 3300026121 Bacteria 4390
664 Ga0207683_10035919 3300026121 Bacteria 4311
665 Ga0207683_10036573 3300026121 Bacteria 4277
666 Ga0207683_10098907 3300026121 Bacteria 2603
667 Ga0207683_10151805 3300026121 Bacteria 2091
668 Ga0207683_10277959 3300026121 Bacteria 1530
669 Ga0207683_10629619 3300026121 Bacteria 994
670 Ga0207698_10012596 3300026142 Bacteria 5541
671 Ga0207698_10178467 3300026142 Bacteria 1878
672 Ga0207698_10445823 3300026142 Bacteria 1248
673 Ga0207698_10561113 3300026142 Bacteria 1121
674 Ga0209389_1000076 3300027296 Bacteria 92447
675 Ga0209589_1000017 3300027357 Bacteria 215546
676 Ga0209489_100018 3300027361 Bacteria 215546
677 Ga0209489_108247 3300027361 Bacteria 14478
678 Ga0209700_100014 3300027363 Bacteria 299349
679 Ga0209700_100028 3300027363 Bacteria 215546
680 Ga0209179_1017211 3300027512 Bacteria 1367
681 Ga0209179_1036362 3300027512 Bacteria 1026
682 Ga0209588_1008658 3300027671 Bacteria 3021
683 Ga0209813_10003889 3300027866 Bacteria 3535
684 Ga0207428_10121533 3300027907 Bacteria 2002
685 Ga0207428_10138284 3300027907 Bacteria 1861
686 Ga0207428_10220298 3300027907 Bacteria 1422
687 Ga0207428_11298634 3300027907 Bacteria 504
688 Ga0268266_10001497 3300028379 Bacteria 27614
689 Ga0268266_10003206 3300028379 Bacteria 16549
690 Ga0268266_10144068 3300028379 Bacteria 2140
691 Ga0268266_10338655 3300028379 Bacteria 1411
692 Ga0268266_10750908 3300028379 Bacteria 941
693 Ga0268266_10810563 3300028379 Bacteria 904
694 Ga0268265_10049761 3300028380 Bacteria 3153
695 Ga0268265_10056708 3300028380 Bacteria 2982
696 Ga0268265_10324697 3300028380 Bacteria 1395
697 Ga0268265_10653716 3300028380 Bacteria 1011
698 Ga0268265_11242667 3300028380 Bacteria 743
699 Ga0268264_10000187 3300028381 Bacteria 129270
700 Ga0268264_10018605 3300028381 Bacteria 5679
701 Ga0307517_10000066 3300028786 Bacteria 141370
702 Ga0307517_10205126 3300028786 Bacteria 1225
703 Ga0307515_10028181 3300028794 Bacteria 9556
704 Ga0307515_10243883 3300028794 Bacteria 1562
705 Ga0265338_10245230 3300028800 Bacteria 1324
706 Ga0307511_10023569 3300030521 Bacteria 5733
707 Ga0307511_10153032 3300030521 Bacteria 1318
708 Ga0307512_10162610 3300030522 Bacteria 1303
709 Ga0265760_10057896 3300031090 Bacteria 1174
710 Ga0265332_10174372 3300031238 Bacteria 897
711 Ga0265325_10058474 3300031241 Bacteria 1963
712 Ga0265340_10024355 3300031247 Bacteria 3075
713 Ga0265340_10402465 3300031247 Bacteria 604
714 Ga0265339_10000069 3300031249 Bacteria 90219
715 Ga0307513_10183304 3300031456 Bacteria 1954
716 Ga0307513_10278109 3300031456 Bacteria 1453
717 Ga0307513_10297608 3300031456 Bacteria 1382
718 Ga0307509_10034527 3300031507 Bacteria 5556
719 Ga0307408_100042411 3300031548 Bacteria 3232
720 Ga0307408_100961785 3300031548 Bacteria 785
721 Ga0265313_10000386 3300031595 Bacteria 47422
722 Ga0307508_10175895 3300031616 Bacteria 1743
723 Ga0307508_10183351 3300031616 Bacteria 1696
724 Ga0307514_10427146 3300031649 Bacteria 663
725 Ga0265314_10000439 3300031711 Bacteria 55613
726 Ga0307516_10017467 3300031730 Bacteria 7479
727 Ga0307516_10039368 3300031730 Bacteria 4712
728 Ga0307516_10308489 3300031730 Bacteria 1256
729 Ga0307405_10598580 3300031731 Bacteria 899
730 Ga0307405_10826569 3300031731 Bacteria 778
731 Ga0307413_10024522 3300031824 Bacteria 3290
732 Ga0307410_10159378 3300031852 Bacteria 1689
733 Ga0307410_11689174 3300031852 Bacteria 561
734 Ga0307412_10057105 3300031911 Bacteria 2604
735 Ga0307412_10145624 3300031911 Bacteria 1741
736 Ga0307412_10341865 3300031911 Bacteria 1198
737 Ga0307416_100512478 3300032002 Bacteria 1266
738 Ga0307414_10656081 3300032004 Bacteria 946
739 Ga0307415_100182625 3300032126 Bacteria 1647
740 Ga0307507_10030087 3300033179 Bacteria 5736
741 Ga0307510_10023148 3300033180 Bacteria 7207
742 Ga0315911_1000033 3300033442 Bacteria 67159
743 Ga0373926_0174533 3300035083 Bacteria 823
744 Ga0373934_0084521 3300035086 Bacteria 1277
745 Ga0373934_0129219 3300035086 Bacteria 1030
746 Ga0373944_0116703 3300035089 Bacteria 916
747 Ga0373944_0155764 3300035089 Bacteria 808
748 Ga0373923_0014604 3300035111 Bacteria 2953
749 Ga0373923_0340621 3300035111 Bacteria 715
750 Ga0373936_0004895 3300035113 Bacteria 5049
751 Ga0373936_0032420 3300035113 Bacteria 2066
752 Ga0373939_0187585 3300035114 Bacteria 775
753 Ga0373945_0019587 3300035116 Bacteria 2312
754 Ga0373945_0037419 3300035116 Bacteria 1742
755 Ga0373945_0106158 3300035116 Bacteria 1104
756 Ga0373953_0001843 3300035117 Bacteria 6271
757 Ga0373953_0250299 3300035117 Bacteria 770
758 Ga0373954_0009761 3300035118 Bacteria 4227
759 Ga0373954_0070743 3300035118 Bacteria 1658
760 Ga0373954_0073176 3300035118 Bacteria 1630
761 Ga0373954_0187073 3300035118 Bacteria 1016
762 Ga0373954_0698591 3300035118 Bacteria 503
763 Ga0373956_0135575 3300035119 Bacteria 1154
764 Ga0373957_0020259 3300035120 Bacteria 2348
765 Ga0373943_0001873 3300035170 Bacteria 9516
766 Ga0373943_0009955 3300035170 Bacteria 4261
767 Ga0373946_0002579 3300035171 Bacteria 6409
768 Ga0373946_0035152 3300035171 Bacteria 2026
769 Ga0373946_0186651 3300035171 Bacteria 987
770 Ga0373955_0000087 3300035172 Bacteria 37402
771 Ga0373955_0009214 3300035172 Bacteria 4618
772 Ga0373955_0040125 3300035172 Bacteria 2501
773 Ga0373955_0348138 3300035172 Bacteria 897
774 Ga0373955_0724914 3300035172 Bacteria 610
775 Ga0373942_0056891 3300035207 Bacteria 1111
776 Ga0373961_0137895 3300035241 Bacteria 822
777 Ga0373961_0173131 3300035241 Bacteria 748
778 Ga0373924_0000324 3300035410 Bacteria 14673
779 Ga0373924_0022632 3300035410 Bacteria 2457
780 Ga0373931_0188606 3300035691 Bacteria 1225
781 Ga0373931_0285100 3300035691 Bacteria 1015
782 Ga0373931_0399189 3300035691 Bacteria 870
783 Ga0373931_0811535 3300035691 Bacteria 624
784 Ga0373935_0019260 3300035692 Bacteria 4162
785 Ga0373935_0081412 3300035692 Bacteria 2105
786 Ga0373935_0498432 3300035692 Bacteria 884
787 Ga0373927_0005233 3300035695 Bacteria 8979
788 Ga0373927_0012312 3300035695 Bacteria 5691
789 Ga0373927_0022113 3300035695 Bacteria 4167
790 Ga0373927_0034876 3300035695 Bacteria 3272
791 Ga0373927_0043078 3300035695 Bacteria 2923
792 Ga0373927_0046856 3300035695 Bacteria 2796
793 Ga0373927_0111907 3300035695 Bacteria 1779
794 Ga0373927_0418466 3300035695 Bacteria 884
795 Ga0373927_1018130 3300035695 Bacteria 546
796 Ga0373933_0007764 3300035724 Bacteria 5859
797 Ga0373933_0014573 3300035724 Bacteria 4374
798 Ga0373933_0388563 3300035724 Bacteria 909
799 Ga0373947_0013251 3300035725 Bacteria 4724
800 Ga0373947_0025730 3300035725 Bacteria 3432
801 Ga0373947_0032870 3300035725 Bacteria 3060
802 Ga0373947_0484254 3300035725 Bacteria 840
803 Ga0373937_0000006 3300036401 Bacteria 194781
804 Ga0373937_0019279 3300036401 Bacteria 6105
805 Ga0373937_0021048 3300036401 Bacteria 5851
806 Ga0373937_0344465 3300036401 Bacteria 1411
807 Ga0373937_0574558 3300036401 Bacteria 1070
808 Ga0373925_0000002 3300037068 Bacteria 368879
809 Ga0373925_0025105 3300037068 Bacteria 4352
810 Ga0373925_0079650 3300037068 Bacteria 2489
811 Ga0373925_0287582 3300037068 Bacteria 1325
812 Ga0373925_1480571 3300037068 Bacteria 556
813 Ga0395899_0095878 3300037312 Bacteria 2146
814 Ga0395900_0021672 3300037418 Bacteria 6569
815 Ga0395900_0029051 3300037418 Bacteria 5671
816 Ga0395900_1048587 3300037418 Bacteria 734
817 Ga0395898_0027664 3300037466 Bacteria 5688
818 Ga0395898_0220933 3300037466 Bacteria 1807
819 Ga0395898_0442651 3300037466 Bacteria 1238
820 Ga0395898_0865863 3300037466 Bacteria 842
821 Ga0395905_0007000 3300037471 Bacteria 11273
822 Ga0395905_0025550 3300037471 Bacteria 5569
823 Ga0395905_0067233 3300037471 Bacteria 3357
824 Ga0395905_0117155 3300037471 Bacteria 2503
825 Ga0395905_0862894 3300037471 Bacteria 808
826 Ga0436364_0037060 3300037853 Bacteria 1413
827 Ga0436364_1045430 3300037853 Bacteria 1073
828 Ga0436364_1133893 3300037853 Bacteria 3595
829 Ga0395901_0045375 3300038443 Bacteria 4561
830 Ga0395901_0121953 3300038443 Bacteria 2740
831 Ga0395901_0208490 3300038443 Bacteria 2046
832 Ga0395901_0544413 3300038443 Bacteria 1177
833 Ga0436365_1167627 3300039437 Bacteria 975
834 Ga0436365_1735497 3300039437 Bacteria 3540
835 Ga0436365_1749409 3300039437 Bacteria 687
836 Ga0436360_0863636 3300039438 Bacteria 1911
837 Ga0436360_0962184 3300039438 Bacteria 1226
838 Ga0436360_1149403 3300039438 Bacteria 911
839 Ga0436361_0295849 3300039447 Bacteria 1104
840 Ga0436361_0483823 3300039447 Bacteria 5857
841 Ga0436361_0722741 3300039447 Bacteria 570
842 Ga0436361_0934439 3300039447 Bacteria 1704
843 Ga0436363_0935857 3300039450 Bacteria 987
844 Ga0436363_1014075 3300039450 Bacteria 3887
845 Ga0436363_1035293 3300039450 Bacteria 14114
846 Ga0436363_1632085 3300039450 Bacteria 773
847 Ga0436362_1188241 3300039453 Bacteria 739
848 Ga0439465_0079935 3300041413 Bacteria 1107
849 Ga0451793_0264920 3300041452 Bacteria 1516
850 Ga0451793_0741245 3300041452 Bacteria 655
851 Ga0451798_0486087 3300041458 Bacteria 671
852 Ga0451802_0958539 3300041460 Bacteria 851
853 Ga0451802_2060284 3300041460 Bacteria 814
854 Ga0451835_0850209 3300041492 Bacteria 868
855 Ga0451853_0710420 3300041512 Bacteria 569
856 Ga0451853_1645550 3300041512 Bacteria 815
857 Ga0451853_1941107 3300041512 Bacteria 1083
858 Ga0439431_0009109 3300041997 Bacteria 2238
859 Ga0439441_124859 3300042001 Bacteria 593
860 Ga0450923_017676 3300042125 Bacteria 1357
861 Ga0439458_0008335 3300042157 Bacteria 2307
862 Ga0439459_0116366 3300042438 Bacteria 669
863 Ga0439464_0100755 3300042439 Bacteria 878
864 Ga0466969_0104606 3300044656 Bacteria 1330
865 Ga0466972_0000048 3300044658 Bacteria 119165
866 Ga0466965_0138547 3300044683 Bacteria 1265
867 Ga0466966_0001825 3300044684 Bacteria 13815
868 Ga0466961_0000010 3300044693 Bacteria 137550
869 Ga0466961_0061354 3300044693 Bacteria 2390
870 Ga0466961_0691196 3300044693 Bacteria 611
871 Ga0466963_0060666 3300044694 Bacteria 2526
872 Ga0466968_0015512 3300044735 Bacteria 3020
873 Ga0466968_0411037 3300044735 Bacteria 664
874 Ga0466968_0546284 3300044735 Bacteria 581
875 Ga0466970_0150202 3300044765 Bacteria 1286
876 Ga0466970_0174907 3300044765 Bacteria 1190
877 Ga0466970_0574375 3300044765 Bacteria 653
878 Ga0466960_0023636 3300044901 Bacteria 2761
879 Ga0466960_0094672 3300044901 Bacteria 1528
880 Ga0466959_0001429 3300045049 Bacteria 14620
881 Ga0466959_0018716 3300045049 Bacteria 5087
882 Ga0466959_1140802 3300045049 Bacteria 518
883 Ga0466958_0209756 3300045836 Bacteria 1241
884 Ga0466958_0453984 3300045836 Bacteria 830
885 Ga0466967_0084723 3300045976 Bacteria 2868
886 Ga0466967_0130651 3300045976 Bacteria 2331
887 Ga0466967_0173249 3300045976 Bacteria 2031
888 Ga0466967_0191337 3300045976 Bacteria 1934
889 Ga0466967_0587556 3300045976 Bacteria 1098
890 Ga0495617_022289 3300046452 Bacteria 2141
891 Ga0495592_0000039 3300046454 Bacteria 124471
892 Ga0495603_0051969 3300046455 Bacteria 2434
893 Ga0495603_0075019 3300046455 Bacteria 1986
894 Ga0495603_0157955 3300046455 Bacteria 1316
895 Ga0495603_0207689 3300046455 Bacteria 1131
896 Ga0495603_0560032 3300046455 Bacteria 654
897 Ga0495629_0003335 3300046459 Bacteria 12135
898 Ga0495629_0036410 3300046459 Bacteria 3473
899 Ga0495629_0158978 3300046459 Bacteria 1570
900 Ga0495638_0021343 3300046460 Bacteria 4270
901 Ga0495638_0163599 3300046460 Bacteria 1282
902 Ga0495638_0546485 3300046460 Bacteria 576
903 Ga0495641_0295703 3300046461 Bacteria 730
904 Ga0495651_0000420 3300046462 Bacteria 32886
905 Ga0495651_0366299 3300046462 Bacteria 948
906 Ga0495653_0000006 3300046463 Bacteria 363285
907 Ga0495653_0041475 3300046463 Bacteria 3592
908 Ga0495653_0407255 3300046463 Bacteria 863
909 Ga0495650_0068534 3300046471 Bacteria 1399
910 Ga0495580_0078460 3300046472 Bacteria 2303
911 Ga0495580_0153692 3300046472 Bacteria 1594
912 Ga0495580_0271641 3300046472 Bacteria 1158
913 Ga0495582_0027180 3300046473 Bacteria 3135
914 Ga0495605_0034235 3300046474 Bacteria 2573
915 Ga0495605_0092174 3300046474 Bacteria 1403
916 Ga0495605_0251872 3300046474 Bacteria 755
917 Ga0495639_0012056 3300046475 Bacteria 3727
918 Ga0495639_0025212 3300046475 Bacteria 2622
919 Ga0495639_0150935 3300046475 Bacteria 1121
920 Ga0495662_0000902 3300046476 Bacteria 14508
921 Ga0495662_0023798 3300046476 Bacteria 2958
922 Ga0495662_0070029 3300046476 Bacteria 1699
923 Ga0495664_0000002 3300046477 Bacteria 625183
924 Ga0495664_0008426 3300046477 Bacteria 5754
925 Ga0495584_0047627 3300046491 Bacteria 2162
926 Ga0495584_0074774 3300046491 Bacteria 1703
927 Ga0495584_0076532 3300046491 Bacteria 1683
928 Ga0495585_0279377 3300046492 Bacteria 826
929 Ga0495585_0415052 3300046492 Bacteria 647
930 Ga0495594_0228725 3300046499 Bacteria 1060
931 Ga0495594_0679336 3300046499 Bacteria 582
932 Ga0495607_0058480 3300046501 Bacteria 2203
933 Ga0495583_0085220 3300046506 Bacteria 1368
934 Ga0495606_0260689 3300046507 Bacteria 957
935 Ga0495608_0000009 3300046511 Bacteria 266614
936 Ga0495608_0144852 3300046511 Bacteria 1515
937 Ga0495608_0333098 3300046511 Bacteria 936
938 Ga0495608_0400685 3300046511 Bacteria 839
939 Ga0495610_0052428 3300046512 Bacteria 1980
940 Ga0495610_0150081 3300046512 Bacteria 995
941 Ga0495616_0026359 3300046513 Bacteria 3095
942 Ga0495616_0200356 3300046513 Bacteria 878
943 Ga0495618_0000005 3300046514 Bacteria 230421
944 Ga0495618_0204992 3300046514 Bacteria 1247
945 Ga0495618_0318103 3300046514 Bacteria 964
946 Ga0495618_0341197 3300046514 Bacteria 925
947 Ga0495618_0362495 3300046514 Bacteria 892
948 Ga0495620_0079093 3300046515 Bacteria 1332
949 Ga0495628_0000002 3300046516 Bacteria 589399
950 Ga0495628_0071172 3300046516 Bacteria 2711
951 Ga0495628_0162538 3300046516 Bacteria 1696
952 Ga0495630_0000865 3300046517 Bacteria 21326
953 Ga0495630_0051956 3300046517 Bacteria 3068
954 Ga0495630_0339656 3300046517 Bacteria 1149
955 Ga0495631_0013951 3300046518 Bacteria 3886
956 Ga0495631_0210660 3300046518 Bacteria 830
957 Ga0495631_0229205 3300046518 Bacteria 792
958 Ga0495632_0022096 3300046519 Bacteria 3416
959 Ga0495632_0189658 3300046519 Bacteria 939
960 Ga0495637_0121236 3300046520 Bacteria 1006
961 Ga0495643_0014364 3300046522 Bacteria 4712
962 Ga0495643_0222249 3300046522 Bacteria 895
963 Ga0495644_0009734 3300046523 Bacteria 3701
964 Ga0495648_0000581 3300046524 Bacteria 39115
965 Ga0495648_0056213 3300046524 Bacteria 2368
966 Ga0495666_0163386 3300046526 Bacteria 1032
967 Ga0495666_0202210 3300046526 Bacteria 913
968 Ga0495652_0000004 3300046529 Bacteria 588877
969 Ga0495652_0063438 3300046529 Bacteria 3110
970 Ga0495652_0116012 3300046529 Bacteria 2145
971 Ga0495652_1066318 3300046529 Bacteria 526
972 Ga0495654_0074136 3300046530 Bacteria 1608
973 Ga0495654_0128388 3300046530 Bacteria 1140
974 Ga0495665_0082870 3300046531 Bacteria 1686
975 Ga0495665_0134275 3300046531 Bacteria 1295
976 Ga0495665_0135993 3300046531 Bacteria 1285
977 Ga0495640_0000005 3300046533 Bacteria 318271
978 Ga0495640_0028545 3300046533 Bacteria 4016
979 Ga0495640_0323139 3300046533 Bacteria 955
980 Ga0495586_0601236 3300046535 Bacteria 635
981 Ga0495587_0000007 3300046536 Bacteria 290788
982 Ga0495598_0160184 3300046537 Bacteria 791
983 Ga0495609_0105005 3300046538 Bacteria 1222
984 Ga0495609_0167390 3300046538 Bacteria 929
985 Ga0495609_0330708 3300046538 Bacteria 617
986 Ga0495621_0043019 3300046539 Bacteria 1592
987 Ga0495645_0000003 3300046543 Bacteria 570133
988 Ga0495645_0314421 3300046543 Bacteria 1019
989 Ga0495622_0009840 3300046557 Bacteria 4422
990 Ga0495622_0044248 3300046557 Bacteria 2069
991 Ga0495633_0266823 3300046558 Bacteria 780
992 Ga0495667_0000002 3300046559 Bacteria 437535
993 Ga0495667_0041062 3300046559 Bacteria 3069
994 Ga0495667_0080819 3300046559 Bacteria 2113
995 Ga0495656_0064619 3300046615 Bacteria 1607
996 Ga0495668_0019526 3300046616 Bacteria 3905
997 Ga0495668_0153539 3300046616 Bacteria 1261
998 Ga0495668_0428804 3300046616 Bacteria 727
999 Ga0495668_0524465 3300046616 Bacteria 653
1000 Ga0495634_0000022 3300046642 Bacteria 118988
1001 Ga0495634_0027017 3300046642 Bacteria 3998
1002 Ga0495634_0106852 3300046642 Bacteria 1803
1003 Ga0495634_0295407 3300046642 Bacteria 981
1004 Ga0495611_0421801 3300046648 Bacteria 609
1005 Ga0495625_0214820 3300046660 Bacteria 1263
1006 Ga0495625_0669228 3300046660 Bacteria 616
1007 Ga0495635_0000020 3300046663 Bacteria 189698
1008 Ga0495635_0139403 3300046663 Bacteria 1652
1009 Ga0495635_0345915 3300046663 Bacteria 992
1010 Ga0495659_0089483 3300046664 Bacteria 1180
1011 Ga0495661_0046551 3300046665 Bacteria 2647
1012 Ga0495661_0071177 3300046665 Bacteria 2033
1013 Ga0495588_0001128 3300046674 Bacteria 11514
1014 Ga0495657_0005933 3300046675 Bacteria 9598
1015 Ga0495657_0151728 3300046675 Bacteria 1438
1016 Ga0495599_0000001 3300046678 Bacteria 537563
1017 Ga0495623_0000001 3300046679 Bacteria 313861
1018 Ga0495623_0279726 3300046679 Bacteria 929
1019 Ga0495646_0000013 3300046680 Bacteria 159700
1020 Ga0495646_0333880 3300046680 Bacteria 796
1021 Ga0495647_0057606 3300046681 Bacteria 1526
1022 Ga0495647_0066275 3300046681 Bacteria 1436
1023 Ga0495658_0006871 3300046683 Bacteria 5609
1024 Ga0495658_0099679 3300046683 Bacteria 1732
1025 Ga0495669_0010706 3300046684 Bacteria 3880
1026 Ga0495669_0134825 3300046684 Bacteria 1164
1027 Ga0495613_0008762 3300046689 Bacteria 7503
1028 Ga0495613_0164148 3300046689 Bacteria 1579
1029 Ga0495624_0027286 3300046690 Bacteria 3739
1030 Ga0495624_0104910 3300046690 Bacteria 1739
1031 Ga0495624_0119842 3300046690 Bacteria 1616
1032 Ga0495624_0246240 3300046690 Bacteria 1081
1033 Ga0495670_0174025 3300046691 Bacteria 1134
1034 Ga0495670_0208396 3300046691 Bacteria 1036
1035 Ga0495600_0000006 3300046809 Bacteria 151916
1036 Ga0495600_0050180 3300046809 Bacteria 2723
1037 Ga0495600_0545247 3300046809 Bacteria 709
1038 Ga0495581_0201426 3300047315 Bacteria 1164
1039 Ga0495581_0432674 3300047315 Bacteria 767
1040 Ga0495604_0000005 3300047317 Bacteria 424516
1041 Ga0495674_0000003 3300047319 Bacteria 562126
1042 Ga0495674_0026763 3300047319 Bacteria 5275
1043 Ga0495674_0029755 3300047319 Bacteria 4969
1044 Ga0495674_0301755 3300047319 Bacteria 1308
1045 Ga0495672_0073646 3300047320 Bacteria 1925
1046 Ga0495672_0120039 3300047320 Bacteria 1399
1047 Ga0495672_0142437 3300047320 Bacteria 1251
1048 Ga0495676_0043345 3300047321 Bacteria 3684
1049 Ga0495676_0196698 3300047321 Bacteria 1403
1050 Ga0495676_0234846 3300047321 Bacteria 1258
1051 Ga0495676_0316426 3300047321 Bacteria 1049
1052 Ga0495680_0000002 3300047322 Bacteria 197533
1053 Ga0495680_0020201 3300047322 Bacteria 5610
1054 Ga0495680_0763443 3300047322 Bacteria 634
1055 Ga0495675_0000010 3300047444 Bacteria 153375
1056 Ga0495685_160498 3300047447 Bacteria 728
1057 Ga0495673_0070442 3300047469 Bacteria 1472
1058 Ga0495681_0032111 3300047470 Bacteria 2647
1059 Ga0495681_0134698 3300047470 Bacteria 1049
1060 Ga0495684_0000028 3300047471 Bacteria 123549
1061 Ga0495684_0017374 3300047471 Bacteria 5537
1062 Ga0495684_0203669 3300047471 Bacteria 1458
1063 Ga0495686_0039649 3300047472 Bacteria 3007
1064 Ga0495686_0466041 3300047472 Bacteria 669
1065 Ga0495593_0002430 3300047673 Bacteria 11194
1066 Ga0495593_0099474 3300047673 Bacteria 1493
1067 Ga0495593_0110371 3300047673 Bacteria 1405
1068 Ga0495593_0141895 3300047673 Bacteria 1217
1069 Ga0495602_0000054 3300048088 Bacteria 111411
1070 Ga0495602_0037475 3300048088 Bacteria 4500
1071 Ga0495614_0161126 3300048089 Bacteria 1004
1072 Ga0496100_0044814 3300048903 Bacteria 2835
1073 Ga0496100_0106898 3300048903 Bacteria 1937
1074 Ga0496100_0209770 3300048903 Bacteria 1424
1075 Ga0496101_0005169 3300048904 Bacteria 8301
1076 Ga0496101_0015900 3300048904 Bacteria 5077
1077 Ga0496101_0080527 3300048904 Bacteria 2406
1078 Ga0496101_0194710 3300048904 Bacteria 1565
1079 Ga0496101_0623813 3300048904 Bacteria 852
1080 Ga0496101_0974203 3300048904 Bacteria 667
1081 Ga0496101_1073095 3300048904 Bacteria 633
1082 Ga0496102_0016269 3300048905 Bacteria 6499
1083 Ga0496102_0017625 3300048905 Bacteria 6258
1084 Ga0496102_0038023 3300048905 Bacteria 4341
1085 Ga0496102_0108889 3300048905 Bacteria 2581
1086 Ga0496102_0148571 3300048905 Bacteria 2200
1087 Ga0496102_0204221 3300048905 Bacteria 1863
1088 Ga0496102_0288805 3300048905 Bacteria 1546
1089 Ga0496102_0336023 3300048905 Bacteria 1423
1090 Ga0496102_0663230 3300048905 Bacteria 966
1091 Ga0496103_0008958 3300048906 Bacteria 5932
1092 Ga0496103_0038987 3300048906 Bacteria 2918
1093 Ga0496103_0241722 3300048906 Bacteria 1162
1094 Ga0496103_0557481 3300048906 Bacteria 731
1095 Ga0496103_0705397 3300048906 Bacteria 639
1096 Ga0496104_0000752 3300048907 Bacteria 27722
1097 Ga0496104_0001154 3300048907 Bacteria 22630
1098 Ga0496104_0014659 3300048907 Bacteria 7081
1099 Ga0496104_0087718 3300048907 Bacteria 2971
1100 Ga0496104_0093172 3300048907 Bacteria 2881
1101 Ga0496104_0482804 3300048907 Bacteria 1150
1102 Ga0496104_0488081 3300048907 Bacteria 1143
1103 Ga0496105_0002078 3300048908 Bacteria 14498
1104 Ga0496105_0021814 3300048908 Bacteria 5185
1105 Ga0496105_0036926 3300048908 Bacteria 4025
1106 Ga0496105_0057525 3300048908 Bacteria 3210
1107 Ga0496106_0004854 3300048909 Bacteria 9951
1108 Ga0496106_0012780 3300048909 Bacteria 6199
1109 Ga0496106_0014933 3300048909 Bacteria 5744
1110 Ga0496106_0018287 3300048909 Bacteria 5180
1111 Ga0496106_0033800 3300048909 Bacteria 3817
1112 Ga0496106_0079035 3300048909 Bacteria 2525
1113 Ga0496106_0251061 3300048909 Bacteria 1414
1114 Ga0496106_0380576 3300048909 Bacteria 1134
1115 Ga0496106_0802771 3300048909 Bacteria 746
1116 Ga0496107_0002063 3300048910 Bacteria 12844
1117 Ga0496107_0012286 3300048910 Bacteria 5976
1118 Ga0496107_0026111 3300048910 Bacteria 4140
1119 Ga0496107_0115169 3300048910 Bacteria 1978
1120 Ga0496107_0124807 3300048910 Bacteria 1898
1121 Ga0496107_0170103 3300048910 Bacteria 1617
1122 Ga0496107_0255689 3300048910 Bacteria 1303
1123 Ga0496107_0327407 3300048910 Bacteria 1140
1124 Ga0496107_0736800 3300048910 Bacteria 724
1125 Ga0496107_0989747 3300048910 Bacteria 610
1126 Ga0496108_0000847 3300048911 Bacteria 23809
1127 Ga0496108_0021993 3300048911 Bacteria 5242
1128 Ga0496108_0073171 3300048911 Bacteria 2894
1129 Ga0496108_0173275 3300048911 Bacteria 1867
1130 Ga0496108_0369280 3300048911 Bacteria 1252
1131 Ga0496108_0532210 3300048911 Bacteria 1026
1132 Ga0496108_1031379 3300048911 Bacteria 701
1133 Ga0496109_0007107 3300048912 Bacteria 9451
1134 Ga0496109_0113994 3300048912 Bacteria 2514
1135 Ga0496109_0123051 3300048912 Bacteria 2417
1136 Ga0496109_0302108 3300048912 Bacteria 1509
1137 Ga0496109_1612343 3300048912 Bacteria 583
1138 Ga0496110_0002115 3300048913 Bacteria 14831
1139 Ga0496110_0041272 3300048913 Bacteria 4025
1140 Ga0496110_0043021 3300048913 Bacteria 3943
1141 Ga0496110_0053050 3300048913 Bacteria 3563
1142 Ga0496110_0150948 3300048913 Bacteria 2104
1143 Ga0496111_0007131 3300048914 Bacteria 7302
1144 Ga0496111_0020057 3300048914 Bacteria 4649
1145 Ga0496112_0001693 3300048915 Bacteria 17188
1146 Ga0496112_0084820 3300048915 Bacteria 3133
1147 Ga0496112_0117488 3300048915 Bacteria 2630
1148 Ga0496112_0189517 3300048915 Bacteria 2019
1149 Ga0496112_0834535 3300048915 Bacteria 845
1150 Ga0496112_0869243 3300048915 Bacteria 824
1151 Ga0496113_0000309 3300048916 Bacteria 23203
1152 Ga0496113_0008991 3300048916 Bacteria 6540
1153 Ga0496113_0030517 3300048916 Bacteria 3903
1154 Ga0496113_0069199 3300048916 Bacteria 2680
1155 Ga0496113_0242764 3300048916 Bacteria 1437
1156 Ga0496113_0276843 3300048916 Bacteria 1341
1157 Ga0496114_0019710 3300048917 Bacteria 5467
1158 Ga0496114_0022294 3300048917 Bacteria 5160
1159 Ga0496114_0777175 3300048917 Bacteria 836
1160 Ga0496114_1245459 3300048917 Bacteria 630
1161 Ga0496115_0001756 3300048918 Bacteria 15546
1162 Ga0496115_0066765 3300048918 Bacteria 2907
1163 Ga0496115_0296817 3300048918 Bacteria 1324
1164 Ga0496115_0818717 3300048918 Bacteria 723
1165 Ga0496116_0012076 3300048919 Bacteria 7079
1166 Ga0496116_0225339 3300048919 Bacteria 956
1167 Ga0496117_0010737 3300048920 Bacteria 8281
1168 Ga0496117_0096648 3300048920 Bacteria 1884
1169 Ga0496117_0178790 3300048920 Bacteria 1222
1170 Ga0496118_0002489 3300048921 Bacteria 24727
1171 Ga0496118_0059097 3300048921 Bacteria 2858
1172 Ga0496118_0089003 3300048921 Bacteria 2133
1173 Ga0496118_0177019 3300048921 Bacteria 1294
1174 Ga0496118_0341886 3300048921 Bacteria 801
1175 Ga0496118_0515077 3300048921 Bacteria 591
1176 Ga0496119_0036141 3300048922 Bacteria 3228
1177 Ga0496119_0037643 3300048922 Bacteria 3139
1178 Ga0496120_0016036 3300048923 Bacteria 4912
1179 Ga0496121_0000144 3300048924 Bacteria 156856
1180 Ga0496121_0000596 3300048924 Bacteria 67893
1181 Ga0496121_0004090 3300048924 Bacteria 20025
1182 Ga0496121_0017154 3300048924 Bacteria 7416
1183 Ga0496121_0126534 3300048924 Bacteria 1919
1184 Ga0496121_0196510 3300048924 Bacteria 1441
1185 Ga0496121_0286923 3300048924 Bacteria 1123
1186 Ga0496121_0387643 3300048924 Bacteria 919
1187 Ga0496121_0463086 3300048924 Bacteria 814
1188 Ga0496121_0806264 3300048924 Bacteria 551
1189 Ga0496122_0027842 3300048925 Bacteria 4819
1190 Ga0496122_0063040 3300048925 Bacteria 2709
1191 Ga0496122_0427139 3300048925 Bacteria 664
1192 Ga0496123_0129758 3300048926 Bacteria 1399
1193 Ga0496123_0204426 3300048926 Bacteria 1009
1194 Ga0496124_0002408 3300048927 Bacteria 24540
1195 Ga0496124_0053794 3300048927 Bacteria 3410
1196 Ga0496124_0069113 3300048927 Bacteria 2933
1197 Ga0496124_0077908 3300048927 Bacteria 2733
1198 Ga0496124_0370832 3300048927 Bacteria 1005
1199 Ga0496125_0003506 3300048928 Bacteria 18947
1200 Ga0496125_0114942 3300048928 Bacteria 1937
1201 Ga0496125_0116128 3300048928 Bacteria 1923
1202 Ga0496125_0367578 3300048928 Bacteria 853
1203 Ga0496126_0007999 3300048929 Bacteria 11480
1204 Ga0496126_0011286 3300048929 Bacteria 9268
1205 Ga0496126_0012837 3300048929 Bacteria 8561
1206 Ga0496126_0021277 3300048929 Bacteria 6338
1207 Ga0496126_0034894 3300048929 Bacteria 4718
1208 Ga0496126_0124028 3300048929 Bacteria 2237
1209 Ga0496126_0135771 3300048929 Bacteria 2122
1210 Ga0496126_0577353 3300048929 Bacteria 889
1211 Ga0495678_164239 3300049459 Bacteria 707
1212 Ga0501031_0000377 3300049568 Bacteria 26157
1213 Ga0501031_0145879 3300049568 Bacteria 1546
1214 Ga0501031_0168619 3300049568 Bacteria 1430
1215 Ga0501031_0239138 3300049568 Bacteria 1180
1216 Ga0501032_0000040 3300049569 Bacteria 115662
1217 Ga0501032_0037362 3300049569 Bacteria 3312
1218 Ga0501032_0052204 3300049569 Bacteria 2755
1219 Ga0501032_0067661 3300049569 Bacteria 2385
1220 Ga0501032_0558656 3300049569 Bacteria 729
1221 Ga0501032_0877503 3300049569 Bacteria 565
1222 Ga0501033_0000128 3300049570 Bacteria 73419
1223 Ga0501033_0011352 3300049570 Bacteria 6816
1224 Ga0501033_0095825 3300049570 Bacteria 2169
1225 Ga0501033_0253887 3300049570 Bacteria 1245
1226 Ga0501033_0577417 3300049570 Bacteria 772
1227 Ga0501033_0599434 3300049570 Bacteria 755
1228 Ga0501033_0648245 3300049570 Bacteria 721
1229 Ga0501034_0000113 3300049571 Bacteria 149824
1230 Ga0501034_0013557 3300049571 Bacteria 8389
1231 Ga0501034_0040597 3300049571 Bacteria 4710
1232 Ga0501034_0053453 3300049571 Bacteria 4066
1233 Ga0501034_0158181 3300049571 Bacteria 2238
1234 Ga0501034_0167481 3300049571 Bacteria 2165
1235 Ga0501034_0217999 3300049571 Bacteria 1861
1236 Ga0501036_0001021 3300049572 Bacteria 21132
1237 Ga0501036_0020539 3300049572 Bacteria 5547
1238 Ga0501036_0098766 3300049572 Bacteria 2468
1239 Ga0501036_0110839 3300049572 Bacteria 2319
1240 Ga0501036_0173953 3300049572 Bacteria 1813
1241 Ga0501036_0211351 3300049572 Bacteria 1630
1242 Ga0501036_0535855 3300049572 Bacteria 973
1243 Ga0501036_0577196 3300049572 Bacteria 934
1244 Ga0501036_0997671 3300049572 Bacteria 685
1245 Ga0501037_0000041 3300049573 Bacteria 118457
1246 Ga0501037_0010332 3300049573 Bacteria 6849
1247 Ga0501037_0012130 3300049573 Bacteria 6345
1248 Ga0501037_0021227 3300049573 Bacteria 4798
1249 Ga0501037_0041461 3300049573 Bacteria 3386
1250 Ga0501037_0045962 3300049573 Bacteria 3203
1251 Ga0501037_0294816 3300049573 Bacteria 1127
1252 Ga0501037_0370454 3300049573 Bacteria 985
1253 Ga0501038_0003329 3300049574 Bacteria 14988
1254 Ga0501038_0039602 3300049574 Bacteria 4121
1255 Ga0501038_0055243 3300049574 Bacteria 3412
1256 Ga0501038_0427937 3300049574 Bacteria 1020
1257 Ga0501038_0680136 3300049574 Bacteria 772
1258 Ga0501038_1068171 3300049574 Bacteria 590
1259 Ga0501038_1216276 3300049574 Bacteria 546
1260 Ga0501039_0005709 3300049575 Bacteria 9425
1261 Ga0501039_0058373 3300049575 Bacteria 2989
1262 Ga0501039_0184580 3300049575 Bacteria 1640
1263 Ga0501039_0186564 3300049575 Bacteria 1631
1264 Ga0501039_0334713 3300049575 Bacteria 1189
1265 Ga0501039_0341601 3300049575 Bacteria 1176
1266 Ga0501039_0647325 3300049575 Bacteria 827
1267 Ga0501039_0717597 3300049575 Bacteria 781
1268 Ga0501040_0039032 3300049576 Bacteria 3229
1269 Ga0501040_0220767 3300049576 Bacteria 1348
1270 Ga0501040_1059685 3300049576 Bacteria 588
1271 Ga0501042_0011820 3300049578 Bacteria 5898
1272 Ga0501042_0020143 3300049578 Bacteria 4640
1273 Ga0501042_0318778 3300049578 Bacteria 1123
1274 Ga0501042_0715278 3300049578 Bacteria 728
1275 Ga0501042_1384036 3300049578 Bacteria 513
1276 Ga0501043_0001803 3300049579 Bacteria 18404
1277 Ga0501043_0005879 3300049579 Bacteria 9869
1278 Ga0501043_0014802 3300049579 Bacteria 6107
1279 Ga0501043_0168838 3300049579 Bacteria 1707
1280 Ga0501043_0194658 3300049579 Bacteria 1575
1281 Ga0501043_0268363 3300049579 Bacteria 1310
1282 Ga0501043_0269434 3300049579 Bacteria 1307
1283 Ga0501043_0341634 3300049579 Bacteria 1138
1284 Ga0501046_0002091 3300049580 Bacteria 18926
1285 Ga0501046_0004930 3300049580 Bacteria 12008
1286 Ga0501046_0272709 3300049580 Bacteria 1240
1287 Ga0501046_0564469 3300049580 Bacteria 810
1288 Ga0501046_0785793 3300049580 Bacteria 667
1289 Ga0501047_0000044 3300049581 Bacteria 174789
1290 Ga0501047_0014719 3300049581 Bacteria 7444
1291 Ga0501047_0017793 3300049581 Bacteria 6807
1292 Ga0501047_0043245 3300049581 Bacteria 4351
1293 Ga0501047_0113095 3300049581 Bacteria 2596
1294 Ga0501047_0285144 3300049581 Bacteria 1495
1295 Ga0501047_0515071 3300049581 Bacteria 1022
1296 Ga0501047_0584914 3300049581 Bacteria 939
1297 Ga0501048_0000117 3300049582 Bacteria 45344
1298 Ga0501048_0000150 3300049582 Bacteria 42721
1299 Ga0501048_0083845 3300049582 Bacteria 2247
1300 Ga0501067_0000938 3300049583 Bacteria 15626
1301 Ga0501067_0090031 3300049583 Bacteria 1703
1302 Ga0501067_0103699 3300049583 Bacteria 1580
1303 Ga0501067_0122932 3300049583 Bacteria 1444
1304 Ga0501068_0003225 3300049584 Bacteria 8738
1305 Ga0501068_0032603 3300049584 Bacteria 3098
1306 Ga0501068_0085489 3300049584 Bacteria 1941
1307 Ga0501068_0252510 3300049584 Bacteria 1124
1308 Ga0501069_0005145 3300049585 Bacteria 6791
1309 Ga0501069_0035152 3300049585 Bacteria 2759
1310 Ga0501070_0002301 3300049586 Bacteria 16761
1311 Ga0501070_0015142 3300049586 Bacteria 6490
1312 Ga0501070_0088235 3300049586 Bacteria 2567
1313 Ga0501070_0116891 3300049586 Bacteria 2202
1314 Ga0501070_0169158 3300049586 Bacteria 1800
1315 Ga0501070_0497528 3300049586 Bacteria 980
1316 Ga0501070_0970468 3300049586 Bacteria 660
1317 Ga0501071_0036255 3300049587 Bacteria 3516
1318 Ga0501071_0078945 3300049587 Bacteria 2406
1319 Ga0501071_0371878 3300049587 Bacteria 1089
1320 Ga0501072_0000156 3300049588 Bacteria 50717
1321 Ga0501072_0213597 3300049588 Bacteria 1537
1322 Ga0501072_0222416 3300049588 Bacteria 1504
1323 Ga0501072_0783783 3300049588 Bacteria 747
1324 Ga0501072_0987131 3300049588 Bacteria 657
1325 Ga0501073_0000669 3300049589 Bacteria 24040
1326 Ga0501073_0103805 3300049589 Bacteria 1973
1327 Ga0501073_0119862 3300049589 Bacteria 1823
1328 Ga0501073_0691925 3300049589 Bacteria 703
1329 Ga0501073_0747740 3300049589 Bacteria 674
1330 Ga0501074_0000035 3300049590 Bacteria 64770
1331 Ga0501074_0065786 3300049590 Bacteria 2608
1332 Ga0501074_0066337 3300049590 Bacteria 2596
1333 Ga0501074_0147158 3300049590 Bacteria 1684
1334 Ga0501074_1233886 3300049590 Bacteria 524
1335 Ga0501075_0085558 3300049591 Bacteria 2389
1336 Ga0501075_0155000 3300049591 Bacteria 1747
1337 Ga0501075_1065255 3300049591 Bacteria 614
1338 Ga0501075_1182861 3300049591 Bacteria 580
1339 Ga0501076_0057149 3300049592 Bacteria 3098
1340 Ga0501076_0088285 3300049592 Bacteria 2492
1341 Ga0501076_0092311 3300049592 Bacteria 2436
1342 Ga0501076_0327172 3300049592 Bacteria 1257
1343 Ga0501077_0456203 3300049593 Bacteria 819
1344 Ga0501077_0681213 3300049593 Bacteria 661
1345 Ga0501253_061590 3300049683 Bacteria 810
1346 Ga0501079_0198613 3300049741 Bacteria 1566
1347 Ga0501079_0751103 3300049741 Bacteria 768
1348 Ga0501079_1253174 3300049741 Bacteria 584
1349 Ga0501080_0001372 3300049742 Bacteria 20366
1350 Ga0501080_0003476 3300049742 Bacteria 13874
1351 Ga0501080_0008844 3300049742 Bacteria 9155
1352 Ga0501080_0034245 3300049742 Bacteria 4740
1353 Ga0501080_0139418 3300049742 Bacteria 2242
1354 Ga0501080_0189542 3300049742 Bacteria 1890
1355 Ga0501080_0932591 3300049742 Bacteria 755
1356 Ga0501080_1619056 3300049742 Bacteria 548
1357 Ga0501081_0224850 3300049743 Bacteria 1365
1358 Ga0501083_0001836 3300049744 Bacteria 14565
1359 Ga0501083_0009709 3300049744 Bacteria 6796
1360 Ga0501083_0015275 3300049744 Bacteria 5377
1361 Ga0501083_0042930 3300049744 Bacteria 3064
1362 Ga0501083_0591005 3300049744 Bacteria 722
1363 Ga0501035_0000128 3300049822 Bacteria 92297
1364 Ga0501035_0032494 3300049822 Bacteria 4746
1365 Ga0501035_0032953 3300049822 Bacteria 4712
1366 Ga0501035_0120217 3300049822 Bacteria 2297
1367 Ga0501035_0150940 3300049822 Bacteria 2016
1368 Ga0501035_0161475 3300049822 Bacteria 1939
1369 Ga0501035_0367334 3300049822 Bacteria 1201
1370 Ga0501044_0000108 3300049823 Bacteria 100968
1371 Ga0501044_0006423 3300049823 Bacteria 12992
1372 Ga0501044_0009883 3300049823 Bacteria 10367
1373 Ga0501044_0019459 3300049823 Bacteria 7262
1374 Ga0501044_0142723 3300049823 Bacteria 2382
1375 Ga0501044_0190215 3300049823 Bacteria 2015
1376 Ga0501044_0208322 3300049823 Bacteria 1910
1377 Ga0501044_0708604 3300049823 Bacteria 891
1378 Ga0501044_0982868 3300049823 Bacteria 716
1379 Ga0501045_0183885 3300049824 Bacteria 1557
1380 Ga0501045_0976428 3300049824 Bacteria 621
1381 nmdc:mga03683_2375_c1 3300050489 Bacteria 5835
1382 nmdc:mga03683_91139_c1 3300050489 Bacteria 1329
1383 nmdc:mga03n38_118081_c1 3300050490 Bacteria 1300
1384 nmdc:mga03n38_3257_c1 3300050490 Bacteria 5185
1385 nmdc:mga03n38_405748_c1 3300050490 Bacteria 751
1386 nmdc:mga03n38_529699_c1 3300050490 Bacteria 664
1387 nmdc:mga03n38_53519_c1 3300050490 Bacteria 1810
1388 nmdc:mga03n38_55853_c1 3300050490 Bacteria 1780
1389 nmdc:mga00v17_103636_c1 3300050491 Bacteria 1798
1390 nmdc:mga00v17_140810_c1 3300050491 Bacteria 1546
1391 nmdc:mga00v17_16449_c2 3300050491 Bacteria 3559
1392 nmdc:mga00v17_201674_c1 3300050491 Bacteria 1286
1393 nmdc:mga00v17_624641_c1 3300050491 Bacteria 694
1394 nmdc:mga0yw44_1343_c1 3300050492 Bacteria 9740
1395 nmdc:mga0yw44_16958_c1 3300050492 Bacteria 3949
1396 nmdc:mga0yw44_263007_c1 3300050492 Bacteria 1150
1397 nmdc:mga0yw44_332703_c1 3300050492 Bacteria 1021
1398 nmdc:mga0yw44_6896_c1 3300050492 Bacteria 5533
1399 nmdc:mga0yw44_73491_c1 3300050492 Bacteria 2127
1400 nmdc:mga0yw44_785498_c1 3300050492 Bacteria 647
1401 nmdc:mga0yw44_85195_c1 3300050492 Bacteria 1988
1402 nmdc:mga0yw44_87690_c1 3300050492 Bacteria 1962
1403 nmdc:mga0yw44_9699_c1 3300050492 Bacteria 4887
1404 nmdc:mga0k408_208507_c1 3300050493 Bacteria 1167
1405 nmdc:mga0k408_511580_c1 3300050493 Bacteria 711
1406 nmdc:mga06z11_15640_c1 3300050494 Bacteria 3392
1407 nmdc:mga06z11_23680_c1 3300050494 Bacteria 2888
1408 nmdc:mga06z11_321745_c1 3300050494 Bacteria 923
1409 nmdc:mga06z11_334846_c1 3300050494 Bacteria 904
1410 nmdc:mga04h51_3971_c1 3300050495 Bacteria 3641
1411 nmdc:mga07m45_224210_c1 3300050496 Bacteria 1094
1412 nmdc:mga07m45_264602_c1 3300050496 Bacteria 553
1413 nmdc:mga07m45_52848_c1 3300050496 Bacteria 2295
1414 nmdc:mga07m45_650099_c1 3300050496 Bacteria 608
1415 nmdc:mga07m45_693067_c1 3300050496 Bacteria 586
1416 nmdc:mga05p37_131206_c1 3300050507 Bacteria 3074
1417 nmdc:mga05p37_1810829_c1 3300050507 Bacteria 588
1418 nmdc:mga05p37_615640_c1 3300050507 Bacteria 1223
1419 nmdc:mga05p37_85477_c1 3300050507 Bacteria 3887
1420 nmdc:mga05p37_87002_c1 3300050507 Bacteria 3852
1421 nmdc:mga05p37_8728_c1 3300050507 Bacteria 11969
1422 nmdc:mga09592_528607_c1 3300050508 Bacteria 1014
1423 nmdc:mga09592_662231_c1 3300050508 Bacteria 891
1424 nmdc:mga0qj67_1283644_c1 3300050509 Bacteria 568
1425 nmdc:mga0qj67_184268_c1 3300050509 Bacteria 1696
1426 nmdc:mga0qj67_55_c1 3300050509 Bacteria 83015
1427 nmdc:mga06r32_1054100_c1 3300050510 Bacteria 764
1428 nmdc:mga06r32_147362_c1 3300050510 Bacteria 2331
1429 nmdc:mga06r32_155378_c1 3300050510 Bacteria 2269
1430 nmdc:mga06r32_428092_c1 3300050510 Bacteria 1304
1431 nmdc:mga06r32_51211_c1 3300050510 Bacteria 3951
1432 nmdc:mga06r32_75750_c1 3300050510 Bacteria 3266
1433 nmdc:mga06r32_88189_c1 3300050510 Bacteria 3028
1434 nmdc:mga08y16_1142763_c1 3300050511 Bacteria 752
1435 nmdc:mga08y16_134099_c1 3300050511 Bacteria 2574
1436 nmdc:mga08y16_135009_c1 3300050511 Bacteria 2564
1437 nmdc:mga08y16_139869_c1 3300050511 Bacteria 2516
1438 nmdc:mga08y16_184749_c1 3300050511 Bacteria 2164
1439 nmdc:mga08y16_319802_c1 3300050511 Bacteria 1598
1440 nmdc:mga0n895_10223_c1 3300050512 Bacteria 8267
1441 nmdc:mga0n895_105146_c1 3300050512 Bacteria 2835
1442 nmdc:mga0n895_1322_c1 3300050512 Bacteria 18328
1443 nmdc:mga0n895_53760_c1 3300050512 Bacteria 3958
1444 nmdc:mga0n895_55453_c1 3300050512 Bacteria 3900
1445 nmdc:mga0rr50_264029_c1 3300050513 Bacteria 1433
1446 nmdc:mga0rr50_388515_c1 3300050513 Bacteria 1177
1447 nmdc:mga0rr50_428656_c1 3300050513 Bacteria 1119
1448 nmdc:mga08x19_26607_c1 3300050514 Bacteria 3610
1449 nmdc:mga0a205_131847_c1 3300050515 Bacteria 2399
1450 nmdc:mga0a205_349472_c1 3300050515 Bacteria 1346
1451 nmdc:mga0a205_67193_c1 3300050515 Bacteria 3463
1452 nmdc:mga0sz30_119113_c1 3300050516 Bacteria 1160
1453 nmdc:mga0sz30_316245_c1 3300050516 Bacteria 697
1454 nmdc:mga0sz30_56993_c2 3300050516 Bacteria 1272
1455 Ga0495601_0000008 3300053077 Bacteria 362152
1456 Ga0495601_0056850 3300053077 Bacteria 2478
1457 Ga0495601_0066236 3300053077 Bacteria 2299
1458 Ga0495601_0236845 3300053077 Bacteria 1192
1459 Ga0495601_0247343 3300053077 Bacteria 1164
1460 Ga0495601_0971416 3300053077 Bacteria 535
1461 Ga0495612_0000002 3300053078 Bacteria 310466
1462 Ga0495612_0009839 3300053078 Bacteria 3871
1463 Ga0495612_0220273 3300053078 Bacteria 840
1464 Ga0495655_0008907 3300053083 Bacteria 1925
1465 Ga0495655_0011257 3300053083 Bacteria 1793
1466 Ga0495655_0058527 3300053083 Bacteria 1044
1467 Ga0495595_0000008 3300053084 Bacteria 196206
1468 Ga0495595_0089654 3300053084 Bacteria 1474
1469 Ga0495619_0000002 3300053085 Bacteria 530226
1470 Ga0495619_0056568 3300053085 Bacteria 2601
1471 Ga0495619_0182480 3300053085 Bacteria 1452
1472 Ga0495619_1070853 3300053085 Bacteria 537
1473 Ga0500578_0334058 3300053086 Bacteria 890
1474 Ga0500578_0462427 3300053086 Bacteria 720
1475 Ga0500644_0041434 3300053088 Bacteria 1529
1476 Ga0500583_0226366 3300053092 Bacteria 926
1477 Ga0500651_0051030 3300053093 Bacteria 2594
1478 Ga0500651_0055403 3300053093 Bacteria 2484
1479 Ga0500566_0002184 3300053094 Bacteria 11532
1480 Ga0500566_0008546 3300053094 Bacteria 6053
1481 Ga0500566_0075420 3300053094 Bacteria 1887
1482 Ga0500641_0005872 3300053096 Bacteria 4346
1483 Ga0500641_0096783 3300053096 Bacteria 1263
1484 Ga0500650_0010755 3300053098 Bacteria 3737
1485 Ga0500554_001065 3300053102 Bacteria 5334
1486 Ga0500554_057265 3300053102 Bacteria 1242
1487 Ga0500556_0000005 3300053104 Bacteria 581135
1488 Ga0500556_0031516 3300053104 Bacteria 1804
1489 Ga0500562_054520 3300053108 Bacteria 1071
1490 Ga0500569_029514 3300053109 Bacteria 1528
1491 Ga0500594_0117443 3300053118 Bacteria 833
1492 Ga0500595_005259 3300053119 Bacteria 5672
1493 Ga0500595_030385 3300053119 Bacteria 1820
1494 Ga0500607_115755 3300053121 Bacteria 1306
1495 Ga0500608_000330 3300053122 Bacteria 18247
1496 Ga0500608_078733 3300053122 Bacteria 1558
1497 Ga0500642_0000009 3300053130 Bacteria 286829
1498 Ga0500642_0000022 3300053130 Bacteria 135196
1499 Ga0500642_0282913 3300053130 Bacteria 753
1500 Ga0500652_003127 3300053131 Bacteria 4991
1501 Ga0500559_0000696 3300053136 Bacteria 22137
1502 Ga0500559_0379150 3300053136 Bacteria 659
1503 Ga0500568_0002658 3300053139 Bacteria 10374
1504 Ga0500568_0031049 3300053139 Bacteria 2208
1505 Ga0500577_0090796 3300053142 Bacteria 1234
1506 Ga0500586_006662 3300053145 Bacteria 3020
1507 Ga0500588_0035951 3300053146 Bacteria 1461
1508 Ga0500589_038036 3300053147 Bacteria 2246
1509 Ga0500590_172977 3300053148 Bacteria 947
1510 Ga0500603_274380 3300053150 Bacteria 544
1511 Ga0500604_0152582 3300053151 Bacteria 785
1512 Ga0500604_0333385 3300053151 Bacteria 527
1513 Ga0500616_0000035 3300053153 Bacteria 394242
1514 Ga0500616_0049669 3300053153 Bacteria 2218
1515 Ga0500622_0002093 3300053156 Bacteria 14867
1516 Ga0500622_0029103 3300053156 Bacteria 2906
1517 Ga0500622_0096805 3300053156 Bacteria 1458
1518 Ga0500627_0052630 3300053158 Bacteria 1777
1519 Ga0500627_0356800 3300053158 Bacteria 630
1520 Ga0500627_0472970 3300053158 Bacteria 525
1521 Ga0500633_0093090 3300053160 Bacteria 1103
1522 Ga0500633_0146363 3300053160 Bacteria 885
1523 Ga0500634_0086499 3300053161 Bacteria 1602
1524 Ga0500638_013277 3300053162 Bacteria 3718
1525 Ga0500638_231524 3300053162 Bacteria 758
1526 Ga0500639_098906 3300053163 Bacteria 1440
1527 Ga0500636_0074012 3300053177 Bacteria 1972
1528 Ga0500636_0169362 3300053177 Bacteria 1182
1529 Ga0500637_0000366 3300053178 Bacteria 17135
1530 Ga0500637_0037469 3300053178 Bacteria 2726
1531 Ga0500576_186502 3300053725 Bacteria 725
1532 Ga0500611_102005 3300053727 Bacteria 744
1533 Ga0500657_058763 3300053728 Bacteria 1726
1534 Ga0500645_013757 3300053730 Bacteria 2591
1535 Ga0500645_049443 3300053730 Bacteria 1229
1536 Ga0500645_054110 3300053730 Bacteria 1168
1537 Ga0500552_012778 3300053733 Bacteria 1079
1538 Ga0500596_000812 3300053735 Bacteria 6173
1539 Ga0501084_0002026 3300054114 Bacteria 16179
1540 Ga0501084_0640839 3300054114 Bacteria 897
1541 Ga0500661_000195 3300055283 Bacteria 10687
1542 Ga0501082_0057430 3300060353 Bacteria 3353
1543 Ga0501082_0077217 3300060353 Bacteria 2871
1544 Ga0501082_0159321 3300060353 Bacteria 1961
1545 Ga0501082_0257071 3300060353 Bacteria 1519
1546 Ga0501082_0666912 3300060353 Bacteria 910
1547 Ga0466962_0068880 3300061719 Bacteria 1690
1548 Ga0466962_0214048 3300061719 Bacteria 943
1549 Ga0530510_0233963 3300061734 Bacteria 1367
1550 3005711609 3005710791 Bacteria 7622528
1551 2513626998 2513237092 Bacteria 8341956
1552 2513638552 2513237094 Bacteria 8789602
1553 2513653099 2513237095 Bacteria 8976980
1554 2513658976 2513237096 Bacteria 8722461
1555 2513680226 2513237098 Bacteria 9902361
1556 2513698957 2513237101 Bacteria 7952346
1557 2513699159 2513237102 Bacteria 7703324
1558 2513714868 2513237104 Bacteria 10034502
1559 2513863885 2513237137 Bacteria 9558895
1560 2513875666 2513237139 Bacteria 8737671
1561 2513889639 2513237141 Bacteria 8496279
1562 2513921240 2513237145 Bacteria 8979722
1563 2514016334 2513237161 Bacteria 8871253
1564 2517105846 2517093001 Bacteria 9002274
1565 2517889329 2517572143 Bacteria 9484767
1566 2524438617 2524023205 Bacteria 8918781
1567 2524466170 2524023210 Bacteria 9029266
1568 2524540377 2524023228 Bacteria 10118060
1569 2528851492 2528768022 Bacteria 10457665
1570 2603857938 2602042107 Bacteria 6226103
1571 2617347479 2617270735 Bacteria 9163226
1572 2617377113 2617270741 Bacteria 8201522
1573 2671121386 2667528175 Bacteria 7532676
1574 2723849163 2721755755 Bacteria 8322773
1575 2728754271 2728368998 Bacteria 8720350
1576 2745077666 2744054633 Bacteria 8678936
1577 2793063257 2791355196 Bacteria 7323613
1578 2793070994 2791355197 Bacteria 8420563
1579 2793078480
1580 2805919342 2802429603 Bacteria 8777136
1581 2818243405 2816332527 Bacteria 8933356
1582 2824622529 2824617872 Bacteria 8814715
1583 2824633890 2824626560 Bacteria 8813858
1584 2824642893 2824635225 Bacteria 8785348
1585 2824651201 2824644064 Bacteria 8743947
1586 2824670937 2824661429 Bacteria 9877870
1587 2824674721 2824671348 Bacteria 8369588
1588 2824684134 2824679649 Bacteria 8248951
1589 2824692597 2824687955 Bacteria 8360029
1590 2824700966 2824696289 Bacteria 8335049
1591 2824713945 2824704595 Bacteria 9667483
1592 2824721159 2824714736 Bacteria 8717648
1593 2824731248 2824723954 Bacteria 8758240
1594 2824740592 2824732956 Bacteria 7810675
1595 2824752544 2824746037 Bacteria 7911610
1596 2824763337 2824753945 Bacteria 9787441
1597 2824770610 2824763712 Bacteria 9792355
1598 2824780158 2824773399 Bacteria 8360218
1599 2838130258 2838122688 Bacteria 8803140
1600 2841944299 2841941048 Bacteria 8688029
1601 2841954524 2841949485 Bacteria 8680857
1602 2841963427 2841957949 Bacteria 8652217
1603 2841969076 2841966195 Bacteria 8673214
1604 2841979850 2841974524 Bacteria 8931498
1605 2841989552 2841983080 Bacteria 8395090
1606 2842044057 2842038055 Bacteria 8002051
1607 2842051954 2842045827 Bacteria 8006841
1608 2842334500 2842333319 Bacteria 8899485
1609 2844316026 2844315083 Bacteria 8138177
1610 2847931513 2847930680 Bacteria 9342022
1611 2847941593 2847939898 Bacteria 8606328
1612 2857515794 2857509624 Bacteria 7472071
1613 2857527313 2857524615 Bacteria 6615449
1614 2874606899 2874604998 Bacteria 7834745
1615 2874619636 2874612657 Bacteria 8252029
1616 2874624276 2874620515 Bacteria 8290088
1617 2876763394 2876761206 Bacteria 10111113
1618 2876810697 2876808645 Bacteria 8824342
1619 2879091363 2879083081 Bacteria 8587928
1620 2879100211 2879099564 Bacteria 10442239
1621 2879112591 2879110137 Bacteria 8907982
1622 2881673191 2881665667 Bacteria 8175609
1623 2885368159 2885366525 Bacteria 8326213
1624 2885377763 2885374607 Bacteria 8927485
1625 2885392327 2885383462 Bacteria 9473874
1626 2888378838 2888378607 Bacteria 9652610
1627 2889036143 2889033259 Bacteria 9099371
1628 2893071853 2893066018 Bacteria 6158120
1629 2903729578 2903727486 Bacteria 8281579
1630 2903752977 2903748898 Bacteria 9972761
1631 2903776363 2903768456 Bacteria 9749579
1632 2904672385 2904666416 Bacteria 8226587
1633 2904692465 2904690495 Bacteria 9412302
1634 2904709204
1635 2904719856 2904711408 Bacteria 9771557
1636 2906606083 2906602504 Bacteria 8295279
1637 2906613191
1638 2906635079 2906626472 Bacteria 8826946
1639 2906635522 2906635258 Bacteria 8601019
1640 2906645633 2906643746 Bacteria 8722424
1641 2906668653 2906660503 Bacteria 8595048
1642 2908747938 2908739725 Bacteria 8628932
1643 2908764381 2908756301 Bacteria 8864324
1644 2908783025 2908775508 Bacteria 8092255
1645 2919078429 2919073203 Bacteria 6531949
1646 2922364521 2922361189 Bacteria 7436256
1647 2922389204 2922386360 Bacteria 7017218
1648 2922400940 2922393267 Bacteria 8285685
1649 2922433690
1650 2929623649 2929615660 Bacteria 9193770
1651 2929632857 2929624759 Bacteria 9339455
1652 2932786166 2932784394 Bacteria 9704911
1653 2932799719 2932794094 Bacteria 7915132
1654 2932816873 2932809354 Bacteria 9135765
1655 2932826013 2932818245 Bacteria 9955613
1656 2932829430 2932828146 Bacteria 9745859
1657 2933585552 2933577622 Bacteria 9116884
1658 2935617862 2935616580 Bacteria 9032984
1659 2935634734 2935630451 Bacteria 8169952
1660 2935647835 2935638405 Bacteria 10015038
1661 2935674752 2935665750 Bacteria 9571747
1662 2935678114 2935675223 Bacteria 9928132
1663 2935685649 2935684952 Bacteria 9590419
1664 2935692402 2935684952 Bacteria 9590419
1665 2935699380 2935694250 Bacteria 9291695
1666 2935707111 2935703347 Bacteria 10242284
1667 2935714202 2935713505 Bacteria 9608509
1668 2935721020 2935713505 Bacteria 9608509
1669 2935722845 2935722832 Bacteria 9608746
1670 2935724821 2935722832 Bacteria 9608746
1671 2935732821 2935732158 Bacteria 9706831
1672 2935739709 2935732158 Bacteria 9706831
1673 2935742200 2935741537 Bacteria 9707219
1674 2935748747 2935741537 Bacteria 9707219
1675 2935751614 2935750917 Bacteria 9590372
1676 2935758617 2935750917 Bacteria 9590372
1677 2935764597 2935760218 Bacteria 9817913
1678 2935806646 2935801545 Bacteria 9301974
1679 2935819092 2935810662 Bacteria 9401221
1680 2935837319 2935827899 Bacteria 10038562
1681 2935841994 2935837841 Bacteria 9454360
1682 2935856639 2935855204 Bacteria 9035059
1683 2935872927 2935864058 Bacteria 9784707
1684 2935874396 2935873716 Bacteria 9632195
1685 2935885619 2935883170 Bacteria 7964738
1686 2935967326 2935959822 Bacteria 7869783
1687 2936001110 2935992306 Bacteria 9802711
1688 2936010764 2936002035 Bacteria 9362176
1689 2936045757 2936037263 Bacteria 9446081
1690 2940557584 2940556831 Bacteria 9590747
1691 2940564793 2940556831 Bacteria 9590747
1692 2941511936 2941507105 Bacteria 8166816
1693 2941519638 2941515067 Bacteria 8166720
1694 2941527670 2941523033 Bacteria 8169134
1695 2941535887 2941531003 Bacteria 7653939
1696 2941547045 2941538514 Bacteria 9402094
1697 3005483345 3005474847 Bacteria 9259049
1698 3005490507 3005483717 Bacteria 7877331
1699 3005509704 3005506211 Bacteria 6943378
1700 3005591210 3005587118 Bacteria 7794411
1701 3005595618 3005594810 Bacteria 8716512
1702 3005718859 3005718088 Bacteria 8283608
1703 8006929609 8006926726 Bacteria 6749210
1704 8006935721 8006933436 Bacteria 10410654
1705 8006967703 8006964411 Bacteria 8966052
1706 8006975642 8006973647 Bacteria 10679141
1707 8006992642 8006984368 Bacteria 9651211
1708 8006998371 8006994254 Bacteria 8309700
1709 8016518806 8016511872 Bacteria 9921665
1710 8016587078 8016583857 Bacteria 10421953
1711 8017057872 8017057580 Bacteria 10023680
1712 8019563069 8019555841 Bacteria 9642137
1713 8019573151 8019565922 Bacteria 9639779
1714 8019577853 8019576017 Bacteria 10049540
1715 8019595955 8019586578 Bacteria 10212056
1716 8019605802 8019597564 Bacteria 10041141
1717 8019612733 8019608314 Bacteria 10042931
1718 8019653171 8019648815 Bacteria 10014479
1719 8055750844 8055742211 Bacteria 9226248
1720 8056678409 8056673599 Bacteria 7871253
1721 8056687785 8056681323 Bacteria 8472857
1722 8056694086 8056689827 Bacteria 6712655
1723 8056970665 8056967851 Bacteria 9038162
1724 CNAas_1007064
1725 CNAas_1016288
1726 JGI24752J21851_1014742
1727 JGI24752J21851_1042018
1728 JGI24746J21847_1002860
1729 JGI24739J22299_10011021
1730 JGI24739J22299_10071708
1731 JGI24737J22298_10008157
1732 JGI24737J22298_10050504
1733 JGI24743J22301_10024237
1734 JGI24743J22301_10029493
1735 JGI24735J21928_10031758
1736 JGI24750J21931_1001747
1737 JGI24750J21931_1003723
1738 JGI24745J21846_1018492
1739 JGI24748J21848_1013455
1740 JGI24738J21930_10019399
1741 JGI24744J21845_10004946
1742 JGI24033J26618_1008262
1743 JGI24034J26672_10026686
1744 JGI24742J22300_10014955
1745 JGI24751J29686_10034545
1746 JGI25153J46596_10001947
1747 JGI25153J46596_10006672
1748 JGI25153J46596_10011948
1749 JGI25160J50197_1003445
1750 JGI25160J50197_1021526
1751 JGI25404J52841_10114818
1752 Ga0055542_1012564
1753 Ga0055526_1017736
1754 Ga0055524_1044957
1755 Ga0055531_10005248
1756 JGI25405J52794_10008372
1757 Ga0065165_1002353
1758 Ga0065165_1003437
1759 Ga0065165_1020999
1760 Ga0065704_10158960
1761 Ga0070658_10650403
1762 Ga0070658_11243293
1763 Ga0070676_10256132
1764 Ga0070683_100001565
1765 Ga0070683_100030774
1766 Ga0070690_100015243
1767 Ga0070670_100008743
1768 Ga0070670_100121742
1769 Ga0068869_100063993
1770 Ga0068869_100869605
1771 Ga0070666_10035271
1772 Ga0070666_10077319
1773 Ga0070680_100021428
1774 Ga0070680_100036045
1775 Ga0070680_100086516
1776 Ga0070682_100083151
1777 Ga0070682_100376278
1778 Ga0070682_100527707
1779 Ga0068868_100041855
1780 Ga0068868_100423390
1781 Ga0070660_100399137
1782 Ga0070660_100851486
1783 Ga0070689_100060091
1784 Ga0070691_10091962
1785 Ga0070691_10187112
1786 Ga0070687_100341399
1787 Ga0070687_100465401
1788 Ga0070661_100048583
1789 Ga0070661_100144999
1790 Ga0070661_100414778
1791 Ga0070692_10042076
1792 Ga0070692_10392284
1793 Ga0070668_100039946
1794 Ga0070668_100070709
1795 Ga0070668_100286040
1796 Ga0070668_100375762
1797 Ga0070668_100668782
1798 Ga0070668_100710332
1799 Ga0070669_100011139
1800 Ga0070675_100070988
1801 Ga0070671_100006990
1802 Ga0070671_100258320
1803 Ga0070671_101422674
1804 Ga0070674_100044981
1805 Ga0070674_100087726
1806 Ga0070674_100370164
1807 Ga0070674_100558687
1808 Ga0070673_100031845
1809 Ga0070673_101187499
1810 Ga0070688_100052318
1811 Ga0070659_100125139
1812 Ga0070667_100030018
1813 Ga0070667_101120646
1814 Ga0070703_10057915
1815 Ga0070709_10159999
1816 Ga0070709_10740061
1817 Ga0070709_11027051
1818 Ga0070714_100145457
1819 Ga0070714_100185949
1820 Ga0070714_100622138
1821 Ga0070714_100787064
1822 Ga0070714_101523903
1823 Ga0070713_100041745
1824 Ga0070713_100094501
1825 Ga0070713_100410108
1826 Ga0070713_100563342
1827 Ga0070710_10006631
1828 Ga0070710_10068125
1829 Ga0070710_10562440
1830 Ga0070710_10881557
1831 Ga0070701_10092793
1832 Ga0070711_100005768
1833 Ga0070711_100010477
1834 Ga0070711_100134144
1835 Ga0070711_100608034
1836 Ga0070700_100046342
1837 Ga0070700_100403356
1838 Ga0070694_100660815
1839 Ga0070663_100003176
1840 Ga0070663_100009537
1841 Ga0070663_100026370
1842 Ga0070663_100026462
1843 Ga0070663_100068400
1844 Ga0070663_100088275
1845 Ga0070663_101222767
1846 Ga0070678_100033201
1847 Ga0070678_100036936
1848 Ga0070678_100136851
1849 Ga0070678_100258846
1850 Ga0070678_100670886
1851 Ga0070662_100002656
1852 Ga0070662_100009910
1853 Ga0070662_100069500
1854 Ga0070681_10411229
1855 Ga0070681_10871132
1856 Ga0068867_100014079
1857 Ga0068867_100031702
1858 Ga0068867_100421945
1859 Ga0068867_100649420
1860 Ga0068867_100896653
1861 Ga0068867_101901825
1862 Ga0070685_10043293
1863 Ga0070685_10229312
1864 Ga0070707_100432434
1865 Ga0070698_100402308
1866 Ga0070699_100182152
1867 Ga0070679_100010325
1868 Ga0070679_100022659
1869 Ga0070679_100095128
1870 Ga0070679_100702860
1871 Ga0070684_100038357
1872 Ga0070684_100044466
1873 Ga0070697_101460792
1874 Ga0068853_100005156
1875 Ga0068853_100067627
1876 Ga0068853_100404177
1877 Ga0070672_100014120
1878 Ga0070672_100038206
1879 Ga0070696_100129789
1880 Ga0070696_100584535
1881 Ga0070693_100028312
1882 Ga0070693_100072573
1883 Ga0070693_100118543
1884 Ga0070693_100403398
1885 Ga0070665_100046497
1886 Ga0070665_100051999
1887 Ga0070665_100068708
1888 Ga0070665_100291457
1889 Ga0070665_100324291
1890 Ga0070665_100986298
1891 Ga0070704_100037230
1892 Ga0068855_100019978
1893 Ga0068855_100136155
1894 Ga0068855_100165617
1895 Ga0068855_100312920
1896 Ga0068855_100362099
1897 Ga0068855_100478450
1898 Ga0068855_100516417
1899 Ga0070664_100162609
1900 Ga0068857_100126257
1901 Ga0068857_101694345
1902 Ga0068854_100047503
1903 Ga0068854_100058007
1904 Ga0068854_100081599
1905 Ga0068854_100356681
1906 Ga0068854_100382956
1907 Ga0068856_100053956
1908 Ga0068856_100463353
1909 Ga0068856_100692350
1910 Ga0070702_100061895
1911 Ga0068852_100147236
1912 Ga0068852_100200033
1913 Ga0068852_100201666
1914 Ga0068852_100236521
1915 Ga0068859_100101341
1916 Ga0068859_100125588
1917 Ga0068859_100563278
1918 Ga0068859_101052294
1919 Ga0068859_101364972
1920 Ga0068864_100040306
1921 Ga0068864_100292997
1922 Ga0068864_100362652
1923 Ga0068864_101066983
1924 Ga0068866_10002426
1925 Ga0068866_10033495
1926 Ga0068861_100077067
1927 Ga0068861_100356152
1928 Ga0068861_101131658
1929 Ga0068851_10049326
1930 Ga0068851_10053457
1931 Ga0068870_10021594
1932 Ga0068870_10022666
1933 Ga0068863_100022284
1934 Ga0068863_100119182
1935 Ga0068858_100505793
1936 Ga0068860_100008962
1937 Ga0068860_100009362
1938 Ga0068860_100067553
1939 Ga0068860_100535033
1940 Ga0068860_100650756
1941 Ga0068862_100031732
1942 Ga0068862_100285275
1943 Ga0068862_100438039
1944 Ga0068862_100536366
1945 Ga0068862_100934225
1946 Ga0081455_10003720
1947 Ga0081455_10022574
1948 Ga0081455_10025887
1949 Ga0081455_10037014
1950 Ga0081538_10032637
1951 Ga0081538_10225715
1952 Ga0081540_1002390
1953 Ga0081540_1013147
1954 Ga0081540_1015337
1955 Ga0081540_1017529
1956 Ga0081540_1020352
1957 Ga0081540_1029940
1958 Ga0081540_1057036
1959 Ga0081540_1078120
1960 Ga0081540_1080661
1961 Ga0081539_10057175
1962 Ga0070717_10067804
1963 Ga0070717_10125289
1964 Ga0075365_10003009
1965 Ga0075365_10042733
1966 Ga0075365_10049499
1967 Ga0075365_10051739
1968 Ga0075365_10055538
1969 Ga0075365_10169864
1970 Ga0075365_10250500
1971 Ga0075365_10315185
1972 Ga0075365_10400501
1973 Ga0075365_10507378
1974 Ga0075368_10020688
1975 Ga0075368_10048722
1976 Ga0075368_10068298
1977 Ga0075363_100134074
1978 Ga0075363_100235982
1979 Ga0075363_100476082
1980 Ga0075363_100564883
1981 Ga0075363_100574396
1982 Ga0075364_10082487
1983 Ga0075364_10207456
1984 Ga0075364_10342750
1985 Ga0075432_10120583
1986 Ga0070715_10080047
1987 Ga0070716_100034264
1988 Ga0070716_100103296
1989 Ga0070716_100104491
1990 Ga0070716_100138237
1991 Ga0070716_100266207
1992 Ga0070712_100028396
1993 Ga0070712_100680400
1994 Ga0070712_100893489
1995 Ga0075362_10079252
1996 Ga0075362_10089156
1997 Ga0075362_10197755
1998 Ga0075367_10024941
1999 Ga0075367_10029951
2000 Ga0075367_10104932
2001 Ga0075367_10110463
2002 Ga0075367_10240617
2003 Ga0075369_10033272
2004 Ga0075369_10047695
2005 Ga0075369_10168023
2006 Ga0075369_10231437
2007 Ga0075366_10055832
2008 Ga0075366_10764718
2009 Ga0097621_100059211
2010 Ga0097621_100156305
2011 Ga0097621_100618265
2012 Ga0075370_10019347
2013 Ga0075370_10035805
2014 Ga0075370_10040301
2015 Ga0075370_10477177
2016 Ga0075370_10683419
2017 Ga0068871_100007042
2018 Ga0068871_100890450
2019 Ga0075428_100162297
2020 Ga0075428_100170083
2021 Ga0075428_100344851
2022 Ga0075430_100000092
2023 Ga0075430_100057037
2024 Ga0075430_100122412
2025 Ga0075431_100595866
2026 Ga0075431_100815598
2027 Ga0075431_101146964
2028 Ga0075433_10056373
2029 Ga0075434_100010423
2030 Ga0075434_100030654
2031 Ga0075434_100241358
2032 Ga0068865_100172438
2033 Ga0068865_100511837
2034 Ga0068865_101343343
2035 Ga0075436_100006947
2036 Ga0097620_100101354
2037 Ga0097620_100125592
2038 Ga0097620_100563295
2039 Ga0097620_101052296
2040 Ga0097620_101364982
2041 Ga0097620_101586738
2042 Ga0099824_1005597
2043 Ga0099822_1000135
2044 Ga0075435_100114500
2045 Ga0075435_100131793
2046 Ga0075435_100766264
2047 Ga0099794_10021912
2048 Ga0099794_10060044
2049 Ga0099795_10035994
2050 Ga0099795_10044832
2051 Ga0099795_10048741
2052 Ga0099795_10170855
2053 Ga0105251_10390400
2054 Ga0105244_10484345
2055 Ga0105250_10174340
2056 Ga0105240_10021688
2057 Ga0105240_10025074
2058 Ga0105240_10050477
2059 Ga0105240_10825297
2060 Ga0111539_10054794
2061 Ga0111539_10060771
2062 Ga0111539_10109696
2063 Ga0111539_10110862
2064 Ga0111539_10543708
2065 Ga0111539_10849268
2066 Ga0105245_10016805
2067 Ga0105245_10024798
2068 Ga0105245_10203823
2069 Ga0105245_10821810
2070 Ga0105247_10009003
2071 Ga0105247_10060745
2072 Ga0105247_10066180
2073 Ga0105247_10175907
2074 Ga0105247_10180619
2075 Ga0105247_10550669
2076 Ga0114129_10012565
2077 Ga0114129_10099152
2078 Ga0114129_10103012
2079 Ga0114129_10164114
2080 Ga0114129_10637713
2081 Ga0114129_10639519
2082 Ga0114129_10878100
2083 Ga0105243_10022026
2084 Ga0105243_10346140
2085 Ga0105243_10356067
2086 Ga0105241_10024174
2087 Ga0105241_10048580
2088 Ga0105241_10116858
2089 Ga0105241_10368126
2090 Ga0105241_10492911
2091 Ga0105241_10658765
2092 Ga0105241_10846850
2093 Ga0105241_11211076
2094 Ga0105242_10101504
2095 Ga0105248_10077052
2096 Ga0105248_10512781
2097 Ga0105237_10008878
2098 Ga0105237_10015340
2099 Ga0105237_10129706
2100 Ga0105237_10133066
2101 Ga0105237_10792988
2102 Ga0105238_10146676
2103 Ga0105238_10148405
2104 Ga0105238_10286075
2105 Ga0105238_12207788
2106 Ga0105249_10012243
2107 Ga0105249_10036785
2108 Ga0105249_10204487
2109 Ga0105249_10931613
2110 Ga0099796_10001500
2111 Ga0099796_10021234
2112 Ga0099796_10146526
2113 Ga0105239_10058078
2114 Ga0105239_10075274
2115 Ga0105239_10079699
2116 Ga0105239_10082681
2117 Ga0105239_10141126
2118 Ga0105239_10162375
2119 Ga0105239_10424858
2120 Ga0105239_10609090
2121 Ga0105239_11020883
2122 Ga0105239_11691636
2123 Ga0105246_10042475
2124 Ga0105246_10105627
2125 Ga0105246_10145260
2126 Ga0105246_10484884
2127 Ga0157373_10149571
2128 Ga0157373_10736059
2129 Ga0157373_10821079
2130 Ga0157371_10191662
2131 Ga0157370_10139150
2132 Ga0157370_10238280
2133 Ga0157370_10289018
2134 Ga0157370_10622911
2135 Ga0157370_10665099
2136 Ga0157369_10006988
2137 Ga0157369_10022714
2138 Ga0157369_10074385
2139 Ga0157369_10083984
2140 Ga0157374_10037462
2141 Ga0157378_10005022
2142 Ga0157378_10061841
2143 Ga0157378_10091824
2144 Ga0163162_10074563
2145 Ga0163162_10471223
2146 Ga0163162_10700368
2147 Ga0163162_11794836
2148 Ga0157372_10066194
2149 Ga0157372_10082819
2150 Ga0157372_10575715
2151 Ga0157372_10640431
2152 Ga0157372_11260609
2153 Ga0157375_10075347
2154 Ga0157375_11213923
2155 Ga0157375_11856529
2156 Ga0163163_10006441
2157 Ga0163163_10064789
2158 Ga0163163_10084291
2159 Ga0157380_10025556
2160 Ga0157380_10157958
2161 Ga0157380_10329859
2162 Ga0157380_11266089
2163 Ga0157377_10072463
2164 Ga0157377_10198181
2165 Ga0157379_10135168
2166 Ga0157379_10233368
2167 Ga0157379_10269860
2168 Ga0157379_11086241
2169 Ga0157376_10042914
2170 Ga0157376_12733539
2171 Ga0163161_10013443
2172 Ga0163161_10022945
2173 Ga0163161_10334211
2174 Ga0206356_10349572
2175 Ga0206356_11053787
2176 Ga0206354_10934028
2177 Ga0154015_1287332
2178 Ga0214544_1000007
2179 Ga0214542_1000007
2180 Ga0214545_1000006
2181 Ga0214545_1023938
2182 Ga0214543_1000009
2183 Ga0214543_1032603
2184 Ga0214543_1041664
2185 Ga0213872_10054957
2186 Ga0213871_10099441
2187 Ga0224712_10217562
2188 Ga0228598_1049778
2189 Ga0209148_1000526
2190 Ga0209129_1050782
2191 Ga0209233_1001391
2192 Ga0209233_1001927
2193 Ga0209233_1002233
2194 Ga0209455_1004411
2195 Ga0209455_1004523
2196 Ga0207673_1052412
2197 Ga0209564_1000842
2198 Ga0209564_1023370
2199 Ga0209758_1000015
2200 Ga0209758_1001439
2201 Ga0209758_1001478
2202 Ga0209758_1011326
2203 Ga0209758_1021699
2204 Ga0209758_1048050
2205 Ga0209256_1007010
2206 Ga0209256_1072347
2207 Ga0207426_1000186
2208 Ga0207426_1001603
2209 Ga0207426_1051408
2210 Ga0207426_1078886
2211 Ga0209257_1000983
2212 Ga0207697_10094523
2213 Ga0207656_10068588
2214 Ga0207656_10125749
2215 Ga0207696_1115447
2216 Ga0207692_10407875
2217 Ga0207642_10159591
2218 Ga0207642_10397203
2219 Ga0207710_10019564
2220 Ga0207710_10061501
2221 Ga0207688_10021104
2222 Ga0207688_10030330
2223 Ga0207680_10030111
2224 Ga0207647_10097648
2225 Ga0207647_10251809
2226 Ga0207647_10517307
2227 Ga0207699_10024964
2228 Ga0207699_10172248
2229 Ga0207699_10795567
2230 Ga0207643_10005803
2231 Ga0207643_10181086
2232 Ga0207654_10005282
2233 Ga0207654_10019075
2234 Ga0207654_10218768
2235 Ga0207654_10584195
2236 Ga0207707_10000749
2237 Ga0207707_10015886
2238 Ga0207707_10038314
2239 Ga0207707_10055348
2240 Ga0207707_10419045
2241 Ga0207707_10770523
2242 Ga0207695_10000006
2243 Ga0207695_10011353
2244 Ga0207695_10338819
2245 Ga0207695_10503838
2246 Ga0207671_10001082
2247 Ga0207671_10167317
2248 Ga0207671_10237189
2249 Ga0207671_10419199
2250 Ga0207671_10646507
2251 Ga0207671_10954732
2252 Ga0207693_10012511
2253 Ga0207693_10137700
2254 Ga0207693_10566541
2255 Ga0207663_10068214
2256 Ga0207663_10281585
2257 Ga0207663_10373059
2258 Ga0207663_10810940
2259 Ga0207663_10820053
2260 Ga0207660_10001899
2261 Ga0207660_10374702
2262 Ga0207660_10516037
2263 Ga0207660_10557944
2264 Ga0207662_10004262
2265 Ga0207657_10058330
2266 Ga0207649_10347305
2267 Ga0207652_10006792
2268 Ga0207652_10016701
2269 Ga0207652_10114418
2270 Ga0207652_10217268
2271 Ga0207652_11138165
2272 Ga0207681_10043643
2273 Ga0207681_10230628
2274 Ga0207681_10594372
2275 Ga0207681_11240734
2276 Ga0207694_10382450
2277 Ga0207694_11409509
2278 Ga0207650_10002601
2279 Ga0207650_10070888
2280 Ga0207659_10110718
2281 Ga0207687_10018889
2282 Ga0207687_10066193
2283 Ga0207687_10137034
2284 Ga0207687_10157973
2285 Ga0207700_10125141
2286 Ga0207700_10237546
2287 Ga0207700_10241217
2288 Ga0207700_10326804
2289 Ga0207700_10362422
2290 Ga0207664_10003797
2291 Ga0207664_10745102
2292 Ga0207644_10122681
2293 Ga0207644_10247582
2294 Ga0207644_10438543
2295 Ga0207644_10674083
2296 Ga0207644_11012418
2297 Ga0207690_10085492
2298 Ga0207706_10011066
2299 Ga0207706_10036752
2300 Ga0207706_10054486
2301 Ga0207706_11061708
2302 Ga0207686_10094152
2303 Ga0207686_10204173
2304 Ga0207709_10932500
2305 Ga0207670_10093638
2306 Ga0207669_10043599
2307 Ga0207669_11281898
2308 Ga0207704_10053388
2309 Ga0207704_10960360
2310 Ga0207665_10013036
2311 Ga0207665_10171960
2312 Ga0207665_10360131
2313 Ga0207691_10023624
2314 Ga0207691_10042886
2315 Ga0207691_10140532
2316 Ga0207691_10184237
2317 Ga0207711_10019696
2318 Ga0207711_11095509
2319 Ga0207689_10013175
2320 Ga0207661_10001882
2321 Ga0207661_10007875
2322 Ga0207661_10842557
2323 Ga0207661_11025764
2324 Ga0207679_10301313
2325 Ga0207667_10011746
2326 Ga0207667_10068809
2327 Ga0207667_10233887
2328 Ga0207667_10423865
2329 Ga0207667_10618831
2330 Ga0207651_10022434
2331 Ga0207712_10013189
2332 Ga0207712_10123899
2333 Ga0207712_11409346
2334 Ga0207668_10023026
2335 Ga0207668_10138499
2336 Ga0207668_10179233
2337 Ga0207668_10282630
2338 Ga0207668_11365385
2339 Ga0207640_10102563
2340 Ga0207640_10111010
2341 Ga0207640_10555623
2342 Ga0207658_10254686
2343 Ga0207658_10507851
2344 Ga0207677_10129019
2345 Ga0207703_10067309
2346 Ga0207703_10170577
2347 Ga0207703_11066605
2348 Ga0207703_11067001
2349 Ga0207639_10003831
2350 Ga0207639_10043257
2351 Ga0207639_10226608
2352 Ga0207639_10246384
2353 Ga0207639_10284636
2354 Ga0207639_10328155
2355 Ga0207639_10807629
2356 Ga0207678_10009212
2357 Ga0207678_10010040
2358 Ga0207678_10012549
2359 Ga0207678_10056124
2360 Ga0207678_10148960
2361 Ga0207678_10247500
2362 Ga0207678_10401991
2363 Ga0207708_10001417
2364 Ga0207708_10071060
2365 Ga0207708_10074492
2366 Ga0207702_10244911
2367 Ga0207702_10514314
2368 Ga0207641_10670621
2369 Ga0207641_11274485
2370 Ga0207648_10003456
2371 Ga0207648_10040258
2372 Ga0207648_11376965
2373 Ga0207648_11499871
2374 Ga0207676_10048873
2375 Ga0207676_10222358
2376 Ga0207676_10277471
2377 Ga0207676_11159217
2378 Ga0207674_10070098
2379 Ga0207674_11069282
2380 Ga0207675_100006895
2381 Ga0207675_100041152
2382 Ga0207675_100044665
2383 Ga0207675_100131130
2384 Ga0207675_100576068
2385 Ga0207675_101515866
2386 Ga0207683_10034607
2387 Ga0207683_10035919
2388 Ga0207683_10036573
2389 Ga0207683_10098907
2390 Ga0207683_10151805
2391 Ga0207683_10277959
2392 Ga0207683_10629619
2393 Ga0207698_10012596
2394 Ga0207698_10178467
2395 Ga0207698_10445823
2396 Ga0207698_10561113
2397 Ga0209389_1000076
2398 Ga0209589_1000017
2399 Ga0209489_100018
2400 Ga0209489_108247
2401 Ga0209700_100014
2402 Ga0209700_100028
2403 Ga0209179_1017211
2404 Ga0209179_1036362
2405 Ga0209588_1008658
2406 Ga0209813_10003889
2407 Ga0207428_10121533
2408 Ga0207428_10138284
2409 Ga0207428_10220298
2410 Ga0207428_11298634
2411 Ga0268266_10001497
2412 Ga0268266_10003206
2413 Ga0268266_10144068
2414 Ga0268266_10338655
2415 Ga0268266_10750908
2416 Ga0268266_10810563
2417 Ga0268265_10049761
2418 Ga0268265_10056708
2419 Ga0268265_10324697
2420 Ga0268265_10653716
2421 Ga0268265_11242667
2422 Ga0268264_10000187
2423 Ga0268264_10018605
2424 Ga0307517_10000066
2425 Ga0307517_10205126
2426 Ga0307515_10028181
2427 Ga0307515_10243883
2428 Ga0265338_10245230
2429 Ga0307511_10023569
2430 Ga0307511_10153032
2431 Ga0307512_10162610
2432 Ga0265760_10057896
2433 Ga0265332_10174372
2434 Ga0265325_10058474
2435 Ga0265340_10024355
2436 Ga0265340_10402465
2437 Ga0265339_10000069
2438 Ga0307513_10183304
2439 Ga0307513_10278109
2440 Ga0307513_10297608
2441 Ga0307509_10034527
2442 Ga0307408_100042411
2443 Ga0307408_100961785
2444 Ga0265313_10000386
2445 Ga0307508_10175895
2446 Ga0307508_10183351
2447 Ga0307514_10427146
2448 Ga0265314_10000439
2449 Ga0307516_10017467
2450 Ga0307516_10039368
2451 Ga0307516_10308489
2452 Ga0307405_10598580
2453 Ga0307405_10826569
2454 Ga0307413_10024522
2455 Ga0307410_10159378
2456 Ga0307410_11689174
2457 Ga0307412_10057105
2458 Ga0307412_10145624
2459 Ga0307412_10341865
2460 Ga0307416_100512478
2461 Ga0307414_10656081
2462 Ga0307415_100182625
2463 Ga0307507_10030087
2464 Ga0307510_10023148
2465 Ga0315911_1000033
2466 Ga0373926_0174533
2467 Ga0373934_0084521
2468 Ga0373934_0129219
2469 Ga0373944_0116703
2470 Ga0373944_0155764
2471 Ga0373923_0014604
2472 Ga0373923_0340621
2473 Ga0373936_0004895
2474 Ga0373936_0032420
2475 Ga0373939_0187585
2476 Ga0373945_0019587
2477 Ga0373945_0037419
2478 Ga0373945_0106158
2479 Ga0373953_0001843
2480 Ga0373953_0250299
2481 Ga0373954_0009761
2482 Ga0373954_0070743
2483 Ga0373954_0073176
2484 Ga0373954_0187073
2485 Ga0373954_0698591
2486 Ga0373956_0135575
2487 Ga0373957_0020259
2488 Ga0373943_0001873
2489 Ga0373943_0009955
2490 Ga0373946_0002579
2491 Ga0373946_0035152
2492 Ga0373946_0186651
2493 Ga0373955_0000087
2494 Ga0373955_0009214
2495 Ga0373955_0040125
2496 Ga0373955_0348138
2497 Ga0373955_0724914
2498 Ga0373942_0056891
2499 Ga0373961_0137895
2500 Ga0373961_0173131
2501 Ga0373924_0000324
2502 Ga0373924_0022632
2503 Ga0373931_0188606
2504 Ga0373931_0285100
2505 Ga0373931_0399189
2506 Ga0373931_0811535
2507 Ga0373935_0019260
2508 Ga0373935_0081412
2509 Ga0373935_0498432
2510 Ga0373927_0005233
2511 Ga0373927_0012312
2512 Ga0373927_0022113
2513 Ga0373927_0034876
2514 Ga0373927_0043078
2515 Ga0373927_0046856
2516 Ga0373927_0111907
2517 Ga0373927_0418466
2518 Ga0373927_1018130
2519 Ga0373933_0007764
2520 Ga0373933_0014573
2521 Ga0373933_0388563
2522 Ga0373947_0013251
2523 Ga0373947_0025730
2524 Ga0373947_0032870
2525 Ga0373947_0484254
2526 Ga0373937_0000006
2527 Ga0373937_0019279
2528 Ga0373937_0021048
2529 Ga0373937_0344465
2530 Ga0373937_0574558
2531 Ga0373925_0000002
2532 Ga0373925_0025105
2533 Ga0373925_0079650
2534 Ga0373925_0287582
2535 Ga0373925_1480571
2536 Ga0395899_0095878
2537 Ga0395900_0021672
2538 Ga0395900_0029051
2539 Ga0395900_1048587
2540 Ga0395898_0027664
2541 Ga0395898_0220933
2542 Ga0395898_0442651
2543 Ga0395898_0865863
2544 Ga0395905_0007000
2545 Ga0395905_0025550
2546 Ga0395905_0067233
2547 Ga0395905_0117155
2548 Ga0395905_0862894
2549 Ga0436364_0037060
2550 Ga0436364_1045430
2551 Ga0436364_1133893
2552 Ga0395901_0045375
2553 Ga0395901_0121953
2554 Ga0395901_0208490
2555 Ga0395901_0544413
2556 Ga0436365_1167627
2557 Ga0436365_1735497
2558 Ga0436365_1749409
2559 Ga0436360_0863636
2560 Ga0436360_0962184
2561 Ga0436360_1149403
2562 Ga0436361_0295849
2563 Ga0436361_0483823
2564 Ga0436361_0722741
2565 Ga0436361_0934439
2566 Ga0436363_0935857
2567 Ga0436363_1014075
2568 Ga0436363_1035293
2569 Ga0436363_1632085
2570 Ga0436362_1188241
2571 Ga0439465_0079935
2572 Ga0451793_0264920
2573 Ga0451793_0741245
2574 Ga0451798_0486087
2575 Ga0451802_0958539
2576 Ga0451802_2060284
2577 Ga0451835_0850209
2578 Ga0451853_0710420
2579 Ga0451853_1645550
2580 Ga0451853_1941107
2581 Ga0439431_0009109
2582 Ga0439441_124859
2583 Ga0450923_017676
2584 Ga0439458_0008335
2585 Ga0439459_0116366
2586 Ga0439464_0100755
2587 Ga0466969_0104606
2588 Ga0466972_0000048
2589 Ga0466965_0138547
2590 Ga0466966_0001825
2591 Ga0466961_0000010
2592 Ga0466961_0061354
2593 Ga0466961_0691196
2594 Ga0466963_0060666
2595 Ga0466968_0015512
2596 Ga0466968_0411037
2597 Ga0466968_0546284
2598 Ga0466970_0150202
2599 Ga0466970_0174907
2600 Ga0466970_0574375
2601 Ga0466960_0023636
2602 Ga0466960_0094672
2603 Ga0466959_0001429
2604 Ga0466959_0018716
2605 Ga0466959_1140802
2606 Ga0466958_0209756
2607 Ga0466958_0453984
2608 Ga0466967_0084723
2609 Ga0466967_0130651
2610 Ga0466967_0173249
2611 Ga0466967_0191337
2612 Ga0466967_0587556
2613 Ga0495617_022289
2614 Ga0495592_0000039
2615 Ga0495603_0051969
2616 Ga0495603_0075019
2617 Ga0495603_0157955
2618 Ga0495603_0207689
2619 Ga0495603_0560032
2620 Ga0495629_0003335
2621 Ga0495629_0036410
2622 Ga0495629_0158978
2623 Ga0495638_0021343
2624 Ga0495638_0163599
2625 Ga0495638_0546485
2626 Ga0495641_0295703
2627 Ga0495651_0000420
2628 Ga0495651_0366299
2629 Ga0495653_0000006
2630 Ga0495653_0041475
2631 Ga0495653_0407255
2632 Ga0495650_0068534
2633 Ga0495580_0078460
2634 Ga0495580_0153692
2635 Ga0495580_0271641
2636 Ga0495582_0027180
2637 Ga0495605_0034235
2638 Ga0495605_0092174
2639 Ga0495605_0251872
2640 Ga0495639_0012056
2641 Ga0495639_0025212
2642 Ga0495639_0150935
2643 Ga0495662_0000902
2644 Ga0495662_0023798
2645 Ga0495662_0070029
2646 Ga0495664_0000002
2647 Ga0495664_0008426
2648 Ga0495584_0047627
2649 Ga0495584_0074774
2650 Ga0495584_0076532
2651 Ga0495585_0279377
2652 Ga0495585_0415052
2653 Ga0495594_0228725
2654 Ga0495594_0679336
2655 Ga0495607_0058480
2656 Ga0495583_0085220
2657 Ga0495606_0260689
2658 Ga0495608_0000009
2659 Ga0495608_0144852
2660 Ga0495608_0333098
2661 Ga0495608_0400685
2662 Ga0495610_0052428
2663 Ga0495610_0150081
2664 Ga0495616_0026359
2665 Ga0495616_0200356
2666 Ga0495618_0000005
2667 Ga0495618_0204992
2668 Ga0495618_0318103
2669 Ga0495618_0341197
2670 Ga0495618_0362495
2671 Ga0495620_0079093
2672 Ga0495628_0000002
2673 Ga0495628_0071172
2674 Ga0495628_0162538
2675 Ga0495630_0000865
2676 Ga0495630_0051956
2677 Ga0495630_0339656
2678 Ga0495631_0013951
2679 Ga0495631_0210660
2680 Ga0495631_0229205
2681 Ga0495632_0022096
2682 Ga0495632_0189658
2683 Ga0495637_0121236
2684 Ga0495643_0014364
2685 Ga0495643_0222249
2686 Ga0495644_0009734
2687 Ga0495648_0000581
2688 Ga0495648_0056213
2689 Ga0495666_0163386
2690 Ga0495666_0202210
2691 Ga0495652_0000004
2692 Ga0495652_0063438
2693 Ga0495652_0116012
2694 Ga0495652_1066318
2695 Ga0495654_0074136
2696 Ga0495654_0128388
2697 Ga0495665_0082870
2698 Ga0495665_0134275
2699 Ga0495665_0135993
2700 Ga0495640_0000005
2701 Ga0495640_0028545
2702 Ga0495640_0323139
2703 Ga0495586_0601236
2704 Ga0495587_0000007
2705 Ga0495598_0160184
2706 Ga0495609_0105005
2707 Ga0495609_0167390
2708 Ga0495609_0330708
2709 Ga0495621_0043019
2710 Ga0495645_0000003
2711 Ga0495645_0314421
2712 Ga0495622_0009840
2713 Ga0495622_0044248
2714 Ga0495633_0266823
2715 Ga0495667_0000002
2716 Ga0495667_0041062
2717 Ga0495667_0080819
2718 Ga0495656_0064619
2719 Ga0495668_0019526
2720 Ga0495668_0153539
2721 Ga0495668_0428804
2722 Ga0495668_0524465
2723 Ga0495634_0000022
2724 Ga0495634_0027017
2725 Ga0495634_0106852
2726 Ga0495634_0295407
2727 Ga0495611_0421801
2728 Ga0495625_0214820
2729 Ga0495625_0669228
2730 Ga0495635_0000020
2731 Ga0495635_0139403
2732 Ga0495635_0345915
2733 Ga0495659_0089483
2734 Ga0495661_0046551
2735 Ga0495661_0071177
2736 Ga0495588_0001128
2737 Ga0495657_0005933
2738 Ga0495657_0151728
2739 Ga0495599_0000001
2740 Ga0495623_0000001
2741 Ga0495623_0279726
2742 Ga0495646_0000013
2743 Ga0495646_0333880
2744 Ga0495647_0057606
2745 Ga0495647_0066275
2746 Ga0495658_0006871
2747 Ga0495658_0099679
2748 Ga0495669_0010706
2749 Ga0495669_0134825
2750 Ga0495613_0008762
2751 Ga0495613_0164148
2752 Ga0495624_0027286
2753 Ga0495624_0104910
2754 Ga0495624_0119842
2755 Ga0495624_0246240
2756 Ga0495670_0174025
2757 Ga0495670_0208396
2758 Ga0495600_0000006
2759 Ga0495600_0050180
2760 Ga0495600_0545247
2761 Ga0495581_0201426
2762 Ga0495581_0432674
2763 Ga0495604_0000005
2764 Ga0495674_0000003
2765 Ga0495674_0026763
2766 Ga0495674_0029755
2767 Ga0495674_0301755
2768 Ga0495672_0073646
2769 Ga0495672_0120039
2770 Ga0495672_0142437
2771 Ga0495676_0043345
2772 Ga0495676_0196698
2773 Ga0495676_0234846
2774 Ga0495676_0316426
2775 Ga0495680_0000002
2776 Ga0495680_0020201
2777 Ga0495680_0763443
2778 Ga0495675_0000010
2779 Ga0495685_160498
2780 Ga0495673_0070442
2781 Ga0495681_0032111
2782 Ga0495681_0134698
2783 Ga0495684_0000028
2784 Ga0495684_0017374
2785 Ga0495684_0203669
2786 Ga0495686_0039649
2787 Ga0495686_0466041
2788 Ga0495593_0002430
2789 Ga0495593_0099474
2790 Ga0495593_0110371
2791 Ga0495593_0141895
2792 Ga0495602_0000054
2793 Ga0495602_0037475
2794 Ga0495614_0161126
2795 Ga0496100_0044814
2796 Ga0496100_0106898
2797 Ga0496100_0209770
2798 Ga0496101_0005169
2799 Ga0496101_0015900
2800 Ga0496101_0080527
2801 Ga0496101_0194710
2802 Ga0496101_0623813
2803 Ga0496101_0974203
2804 Ga0496101_1073095
2805 Ga0496102_0016269
2806 Ga0496102_0017625
2807 Ga0496102_0038023
2808 Ga0496102_0108889
2809 Ga0496102_0148571
2810 Ga0496102_0204221
2811 Ga0496102_0288805
2812 Ga0496102_0336023
2813 Ga0496102_0663230
2814 Ga0496103_0008958
2815 Ga0496103_0038987
2816 Ga0496103_0241722
2817 Ga0496103_0557481
2818 Ga0496103_0705397
2819 Ga0496104_0000752
2820 Ga0496104_0001154
2821 Ga0496104_0014659
2822 Ga0496104_0087718
2823 Ga0496104_0093172
2824 Ga0496104_0482804
2825 Ga0496104_0488081
2826 Ga0496105_0002078
2827 Ga0496105_0021814
2828 Ga0496105_0036926
2829 Ga0496105_0057525
2830 Ga0496106_0004854
2831 Ga0496106_0012780
2832 Ga0496106_0014933
2833 Ga0496106_0018287
2834 Ga0496106_0033800
2835 Ga0496106_0079035
2836 Ga0496106_0251061
2837 Ga0496106_0380576
2838 Ga0496106_0802771
2839 Ga0496107_0002063
2840 Ga0496107_0012286
2841 Ga0496107_0026111
2842 Ga0496107_0115169
2843 Ga0496107_0124807
2844 Ga0496107_0170103
2845 Ga0496107_0255689
2846 Ga0496107_0327407
2847 Ga0496107_0736800
2848 Ga0496107_0989747
2849 Ga0496108_0000847
2850 Ga0496108_0021993
2851 Ga0496108_0073171
2852 Ga0496108_0173275
2853 Ga0496108_0369280
2854 Ga0496108_0532210
2855 Ga0496108_1031379
2856 Ga0496109_0007107
2857 Ga0496109_0113994
2858 Ga0496109_0123051
2859 Ga0496109_0302108
2860 Ga0496109_1612343
2861 Ga0496110_0002115
2862 Ga0496110_0041272
2863 Ga0496110_0043021
2864 Ga0496110_0053050
2865 Ga0496110_0150948
2866 Ga0496111_0007131
2867 Ga0496111_0020057
2868 Ga0496112_0001693
2869 Ga0496112_0084820
2870 Ga0496112_0117488
2871 Ga0496112_0189517
2872 Ga0496112_0834535
2873 Ga0496112_0869243
2874 Ga0496113_0000309
2875 Ga0496113_0008991
2876 Ga0496113_0030517
2877 Ga0496113_0069199
2878 Ga0496113_0242764
2879 Ga0496113_0276843
2880 Ga0496114_0019710
2881 Ga0496114_0022294
2882 Ga0496114_0777175
2883 Ga0496114_1245459
2884 Ga0496115_0001756
2885 Ga0496115_0066765
2886 Ga0496115_0296817
2887 Ga0496115_0818717
2888 Ga0496116_0012076
2889 Ga0496116_0225339
2890 Ga0496117_0010737
2891 Ga0496117_0096648
2892 Ga0496117_0178790
2893 Ga0496118_0002489
2894 Ga0496118_0059097
2895 Ga0496118_0089003
2896 Ga0496118_0177019
2897 Ga0496118_0341886
2898 Ga0496118_0515077
2899 Ga0496119_0036141
2900 Ga0496119_0037643
2901 Ga0496120_0016036
2902 Ga0496121_0000144
2903 Ga0496121_0000596
2904 Ga0496121_0004090
2905 Ga0496121_0017154
2906 Ga0496121_0126534
2907 Ga0496121_0196510
2908 Ga0496121_0286923
2909 Ga0496121_0387643
2910 Ga0496121_0463086
2911 Ga0496121_0806264
2912 Ga0496122_0027842
2913 Ga0496122_0063040
2914 Ga0496122_0427139
2915 Ga0496123_0129758
2916 Ga0496123_0204426
2917 Ga0496124_0002408
2918 Ga0496124_0053794
2919 Ga0496124_0069113
2920 Ga0496124_0077908
2921 Ga0496124_0370832
2922 Ga0496125_0003506
2923 Ga0496125_0114942
2924 Ga0496125_0116128
2925 Ga0496125_0367578
2926 Ga0496126_0007999
2927 Ga0496126_0011286
2928 Ga0496126_0012837
2929 Ga0496126_0021277
2930 Ga0496126_0034894
2931 Ga0496126_0124028
2932 Ga0496126_0135771
2933 Ga0496126_0577353
2934 Ga0495678_164239
2935 Ga0501031_0000377
2936 Ga0501031_0145879
2937 Ga0501031_0168619
2938 Ga0501031_0239138
2939 Ga0501032_0000040
2940 Ga0501032_0037362
2941 Ga0501032_0052204
2942 Ga0501032_0067661
2943 Ga0501032_0558656
2944 Ga0501032_0877503
2945 Ga0501033_0000128
2946 Ga0501033_0011352
2947 Ga0501033_0095825
2948 Ga0501033_0253887
2949 Ga0501033_0577417
2950 Ga0501033_0599434
2951 Ga0501033_0648245
2952 Ga0501034_0000113
2953 Ga0501034_0013557
2954 Ga0501034_0040597
2955 Ga0501034_0053453
2956 Ga0501034_0158181
2957 Ga0501034_0167481
2958 Ga0501034_0217999
2959 Ga0501036_0001021
2960 Ga0501036_0020539
2961 Ga0501036_0098766
2962 Ga0501036_0110839
2963 Ga0501036_0173953
2964 Ga0501036_0211351
2965 Ga0501036_0535855
2966 Ga0501036_0577196
2967 Ga0501036_0997671
2968 Ga0501037_0000041
2969 Ga0501037_0010332
2970 Ga0501037_0012130
2971 Ga0501037_0021227
2972 Ga0501037_0041461
2973 Ga0501037_0045962
2974 Ga0501037_0294816
2975 Ga0501037_0370454
2976 Ga0501038_0003329
2977 Ga0501038_0039602
2978 Ga0501038_0055243
2979 Ga0501038_0427937
2980 Ga0501038_0680136
2981 Ga0501038_1068171
2982 Ga0501038_1216276
2983 Ga0501039_0005709
2984 Ga0501039_0058373
2985 Ga0501039_0184580
2986 Ga0501039_0186564
2987 Ga0501039_0334713
2988 Ga0501039_0341601
2989 Ga0501039_0647325
2990 Ga0501039_0717597
2991 Ga0501040_0039032
2992 Ga0501040_0220767
2993 Ga0501040_1059685
2994 Ga0501042_0011820
2995 Ga0501042_0020143
2996 Ga0501042_0318778
2997 Ga0501042_0715278
2998 Ga0501042_1384036
2999 Ga0501043_0001803
3000 Ga0501043_0005879
3001 Ga0501043_0014802
3002 Ga0501043_0168838
3003 Ga0501043_0194658
3004 Ga0501043_0268363
3005 Ga0501043_0269434
3006 Ga0501043_0341634
3007 Ga0501046_0002091
3008 Ga0501046_0004930
3009 Ga0501046_0272709
3010 Ga0501046_0564469
3011 Ga0501046_0785793
3012 Ga0501047_0000044
3013 Ga0501047_0014719
3014 Ga0501047_0017793
3015 Ga0501047_0043245
3016 Ga0501047_0113095
3017 Ga0501047_0285144
3018 Ga0501047_0515071
3019 Ga0501047_0584914
3020 Ga0501048_0000117
3021 Ga0501048_0000150
3022 Ga0501048_0083845
3023 Ga0501067_0000938
3024 Ga0501067_0090031
3025 Ga0501067_0103699
3026 Ga0501067_0122932
3027 Ga0501068_0003225
3028 Ga0501068_0032603
3029 Ga0501068_0085489
3030 Ga0501068_0252510
3031 Ga0501069_0005145
3032 Ga0501069_0035152
3033 Ga0501070_0002301
3034 Ga0501070_0015142
3035 Ga0501070_0088235
3036 Ga0501070_0116891
3037 Ga0501070_0169158
3038 Ga0501070_0497528
3039 Ga0501070_0970468
3040 Ga0501071_0036255
3041 Ga0501071_0078945
3042 Ga0501071_0371878
3043 Ga0501072_0000156
3044 Ga0501072_0213597
3045 Ga0501072_0222416
3046 Ga0501072_0783783
3047 Ga0501072_0987131
3048 Ga0501073_0000669
3049 Ga0501073_0103805
3050 Ga0501073_0119862
3051 Ga0501073_0691925
3052 Ga0501073_0747740
3053 Ga0501074_0000035
3054 Ga0501074_0065786
3055 Ga0501074_0066337
3056 Ga0501074_0147158
3057 Ga0501074_1233886
3058 Ga0501075_0085558
3059 Ga0501075_0155000
3060 Ga0501075_1065255
3061 Ga0501075_1182861
3062 Ga0501076_0057149
3063 Ga0501076_0088285
3064 Ga0501076_0092311
3065 Ga0501076_0327172
3066 Ga0501077_0456203
3067 Ga0501077_0681213
3068 Ga0501253_061590
3069 Ga0501079_0198613
3070 Ga0501079_0751103
3071 Ga0501079_1253174
3072 Ga0501080_0001372
3073 Ga0501080_0003476
3074 Ga0501080_0008844
3075 Ga0501080_0034245
3076 Ga0501080_0139418
3077 Ga0501080_0189542
3078 Ga0501080_0932591
3079 Ga0501080_1619056
3080 Ga0501081_0224850
3081 Ga0501083_0001836
3082 Ga0501083_0009709
3083 Ga0501083_0015275
3084 Ga0501083_0042930
3085 Ga0501083_0591005
3086 Ga0501035_0000128
3087 Ga0501035_0032494
3088 Ga0501035_0032953
3089 Ga0501035_0120217
3090 Ga0501035_0150940
3091 Ga0501035_0161475
3092 Ga0501035_0367334
3093 Ga0501044_0000108
3094 Ga0501044_0006423
3095 Ga0501044_0009883
3096 Ga0501044_0019459
3097 Ga0501044_0142723
3098 Ga0501044_0190215
3099 Ga0501044_0208322
3100 Ga0501044_0708604
3101 Ga0501044_0982868
3102 Ga0501045_0183885
3103 Ga0501045_0976428
3104 nmdc:mga03683_2375_c1
3105 nmdc:mga03683_91139_c1
3106 nmdc:mga03n38_118081_c1
3107 nmdc:mga03n38_3257_c1
3108 nmdc:mga03n38_405748_c1
3109 nmdc:mga03n38_529699_c1
3110 nmdc:mga03n38_53519_c1
3111 nmdc:mga03n38_55853_c1
3112 nmdc:mga00v17_103636_c1
3113 nmdc:mga00v17_140810_c1
3114 nmdc:mga00v17_16449_c2
3115 nmdc:mga00v17_201674_c1
3116 nmdc:mga00v17_624641_c1
3117 nmdc:mga0yw44_1343_c1
3118 nmdc:mga0yw44_16958_c1
3119 nmdc:mga0yw44_263007_c1
3120 nmdc:mga0yw44_332703_c1
3121 nmdc:mga0yw44_6896_c1
3122 nmdc:mga0yw44_73491_c1
3123 nmdc:mga0yw44_785498_c1
3124 nmdc:mga0yw44_85195_c1
3125 nmdc:mga0yw44_87690_c1
3126 nmdc:mga0yw44_9699_c1
3127 nmdc:mga0k408_208507_c1
3128 nmdc:mga0k408_511580_c1
3129 nmdc:mga06z11_15640_c1
3130 nmdc:mga06z11_23680_c1
3131 nmdc:mga06z11_321745_c1
3132 nmdc:mga06z11_334846_c1
3133 nmdc:mga04h51_3971_c1
3134 nmdc:mga07m45_224210_c1
3135 nmdc:mga07m45_264602_c1
3136 nmdc:mga07m45_52848_c1
3137 nmdc:mga07m45_650099_c1
3138 nmdc:mga07m45_693067_c1
3139 nmdc:mga05p37_131206_c1
3140 nmdc:mga05p37_1810829_c1
3141 nmdc:mga05p37_615640_c1
3142 nmdc:mga05p37_85477_c1
3143 nmdc:mga05p37_87002_c1
3144 nmdc:mga05p37_8728_c1
3145 nmdc:mga09592_528607_c1
3146 nmdc:mga09592_662231_c1
3147 nmdc:mga0qj67_1283644_c1
3148 nmdc:mga0qj67_184268_c1
3149 nmdc:mga0qj67_55_c1
3150 nmdc:mga06r32_1054100_c1
3151 nmdc:mga06r32_147362_c1
3152 nmdc:mga06r32_155378_c1
3153 nmdc:mga06r32_428092_c1
3154 nmdc:mga06r32_51211_c1
3155 nmdc:mga06r32_75750_c1
3156 nmdc:mga06r32_88189_c1
3157 nmdc:mga08y16_1142763_c1
3158 nmdc:mga08y16_134099_c1
3159 nmdc:mga08y16_135009_c1
3160 nmdc:mga08y16_139869_c1
3161 nmdc:mga08y16_184749_c1
3162 nmdc:mga08y16_319802_c1
3163 nmdc:mga0n895_10223_c1
3164 nmdc:mga0n895_105146_c1
3165 nmdc:mga0n895_1322_c1
3166 nmdc:mga0n895_53760_c1
3167 nmdc:mga0n895_55453_c1
3168 nmdc:mga0rr50_264029_c1
3169 nmdc:mga0rr50_388515_c1
3170 nmdc:mga0rr50_428656_c1
3171 nmdc:mga08x19_26607_c1
3172 nmdc:mga0a205_131847_c1
3173 nmdc:mga0a205_349472_c1
3174 nmdc:mga0a205_67193_c1
3175 nmdc:mga0sz30_119113_c1
3176 nmdc:mga0sz30_316245_c1
3177 nmdc:mga0sz30_56993_c2
3178 Ga0495601_0000008
3179 Ga0495601_0056850
3180 Ga0495601_0066236
3181 Ga0495601_0236845
3182 Ga0495601_0247343
3183 Ga0495601_0971416
3184 Ga0495612_0000002
3185 Ga0495612_0009839
3186 Ga0495612_0220273
3187 Ga0495655_0008907
3188 Ga0495655_0011257
3189 Ga0495655_0058527
3190 Ga0495595_0000008
3191 Ga0495595_0089654
3192 Ga0495619_0000002
3193 Ga0495619_0056568
3194 Ga0495619_0182480
3195 Ga0495619_1070853
3196 Ga0500578_0334058
3197 Ga0500578_0462427
3198 Ga0500644_0041434
3199 Ga0500583_0226366
3200 Ga0500651_0051030
3201 Ga0500651_0055403
3202 Ga0500566_0002184
3203 Ga0500566_0008546
3204 Ga0500566_0075420
3205 Ga0500641_0005872
3206 Ga0500641_0096783
3207 Ga0500650_0010755
3208 Ga0500554_001065
3209 Ga0500554_057265
3210 Ga0500556_0000005
3211 Ga0500556_0031516
3212 Ga0500562_054520
3213 Ga0500569_029514
3214 Ga0500594_0117443
3215 Ga0500595_005259
3216 Ga0500595_030385
3217 Ga0500607_115755
3218 Ga0500608_000330
3219 Ga0500608_078733
3220 Ga0500642_0000009
3221 Ga0500642_0000022
3222 Ga0500642_0282913
3223 Ga0500652_003127
3224 Ga0500559_0000696
3225 Ga0500559_0379150
3226 Ga0500568_0002658
3227 Ga0500568_0031049
3228 Ga0500577_0090796
3229 Ga0500586_006662
3230 Ga0500588_0035951
3231 Ga0500589_038036
3232 Ga0500590_172977
3233 Ga0500603_274380
3234 Ga0500604_0152582
3235 Ga0500604_0333385
3236 Ga0500616_0000035
3237 Ga0500616_0049669
3238 Ga0500622_0002093
3239 Ga0500622_0029103
3240 Ga0500622_0096805
3241 Ga0500627_0052630
3242 Ga0500627_0356800
3243 Ga0500627_0472970
3244 Ga0500633_0093090
3245 Ga0500633_0146363
3246 Ga0500634_0086499
3247 Ga0500638_013277
3248 Ga0500638_231524
3249 Ga0500639_098906
3250 Ga0500636_0074012
3251 Ga0500636_0169362
3252 Ga0500637_0000366
3253 Ga0500637_0037469
3254 Ga0500576_186502
3255 Ga0500611_102005
3256 Ga0500657_058763
3257 Ga0500645_013757
3258 Ga0500645_049443
3259 Ga0500645_054110
3260 Ga0500552_012778
3261 Ga0500596_000812
3262 Ga0501084_0002026
3263 Ga0501084_0640839
3264 Ga0500661_000195
3265 Ga0501082_0057430
3266 Ga0501082_0077217
3267 Ga0501082_0159321
3268 Ga0501082_0257071
3269 Ga0501082_0666912
3270 Ga0466962_0068880
3271 Ga0466962_0214048
3272 Ga0530510_0233963
3273 3005711609
3274 2513626998
3275 2513638552
3276 2513653099
3277 2513658976
3278 2513680226
3279 2513698957
3280 2513699159
3281 2513714868
3282 2513863885
3283 2513875666
3284 2513889639
3285 2513921240
3286 2514016334
3287 2517105846
3288 2517889329
3289 2524438617
3290 2524466170
3291 2524540377
3292 2528851492
3293 2603857938
3294 2617347479
3295 2617377113
3296 2671121386
3297 2723849163
3298 2728754271
3299 2745077666
3300 2793063257
3301 2793070994
3302 2793078480
3303 2805919342
3304 2818243405
3305 2824622529
3306 2824633890
3307 2824642893
3308 2824651201
3309 2824670937
3310 2824674721
3311 2824684134
3312 2824692597
3313 2824700966
3314 2824713945
3315 2824721159
3316 2824731248
3317 2824740592
3318 2824752544
3319 2824763337
3320 2824770610
3321 2824780158
3322 2838130258
3323 2841944299
3324 2841954524
3325 2841963427
3326 2841969076
3327 2841979850
3328 2841989552
3329 2842044057
3330 2842051954
3331 2842334500
3332 2844316026
3333 2847931513
3334 2847941593
3335 2857515794
3336 2857527313
3337 2874606899
3338 2874619636
3339 2874624276
3340 2876763394
3341 2876810697
3342 2879091363
3343 2879100211
3344 2879112591
3345 2881673191
3346 2885368159
3347 2885377763
3348 2885392327
3349 2888378838
3350 2889036143
3351 2893071853
3352 2903729578
3353 2903752977
3354 2903776363
3355 2904672385
3356 2904692465
3357 2904709204
3358 2904719856
3359 2906606083
3360 2906613191
3361 2906635079
3362 2906635522
3363 2906645633
3364 2906668653
3365 2908747938
3366 2908764381
3367 2908783025
3368 2919078429
3369 2922364521
3370 2922389204
3371 2922400940
3372 2922433690
3373 2929623649
3374 2929632857
3375 2932786166
3376 2932799719
3377 2932816873
3378 2932826013
3379 2932829430
3380 2933585552
3381 2935617862
3382 2935634734
3383 2935647835
3384 2935674752
3385 2935678114
3386 2935685649
3387 2935692402
3388 2935699380
3389 2935707111
3390 2935714202
3391 2935721020
3392 2935722845
3393 2935724821
3394 2935732821
3395 2935739709
3396 2935742200
3397 2935748747
3398 2935751614
3399 2935758617
3400 2935764597
3401 2935806646
3402 2935819092
3403 2935837319
3404 2935841994
3405 2935856639
3406 2935872927
3407 2935874396
3408 2935885619
3409 2935967326
3410 2936001110
3411 2936010764
3412 2936045757
3413 2940557584
3414 2940564793
3415 2941511936
3416 2941519638
3417 2941527670
3418 2941535887
3419 2941547045
3420 3005483345
3421 3005490507
3422 3005509704
3423 3005591210
3424 3005595618
3425 3005718859
3426 8006929609
3427 8006935721
3428 8006967703
3429 8006975642
3430 8006992642
3431 8006998371
3432 8016518806
3433 8016587078
3434 8017057872
3435 8019563069
3436 8019573151
3437 8019577853
3438 8019595955
3439 8019605802
3440 8019612733
3441 8019653171
3442 8055750844
3443 8056678409
3444 8056687785
3445 8056694086
3446 8056970665

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13404

HTH_AsnC-type

AsnC-type helix-turn-helix domain

25

66

0.99

PF13412

HTH_24

Winged helix-turn-helix DNA-binding

25

71

0.99

PF01037

AsnC_trans_reg

Lrp/AsnC ligand binding domain

89

164

0.9

Map