F495481
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1723 | 722 | 3446 | 161 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|3005710791|3005711609 |
| Length | 179 |
| Sequence | SRHNETKFFKMTDAAVQIPETNRRLDAIDRKILMVLQEDASLSVAEIGDRVGLSSTPCWKRIQRLEADGVILKRVALVDQNKIGLGISVFVSVESADHSDAWLKRFAEAVSAMPEVMEFYRMAGDVDYMLRVVVADMQAYDVFYKKLISAVPLKNVTSRFAMEKIKSVTTLPIPAVVAA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300000532 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled | Metagenome | Rhizosphere |
| 2 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 3 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 4 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 5 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 6 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 7 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 8 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 9 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 10 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 11 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 12 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 13 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 14 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 15 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 16 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 17 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 18 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 19 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 20 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 21 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 22 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 23 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 24 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 25 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 26 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 27 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 31 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 33 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 37 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 39 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 50 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 60 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 61 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 65 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 66 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 67 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 68 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 69 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 71 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 72 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 73 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 74 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 79 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 80 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 82 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 83 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 84 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 86 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 87 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 88 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 89 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 90 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 91 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 92 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 93 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 94 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 95 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 96 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 97 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 98 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 99 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 100 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 101 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 102 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 103 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 104 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 105 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 106 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 107 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 108 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 109 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 110 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 111 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 112 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 113 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 115 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 116 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 117 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 118 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 119 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 120 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 121 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 122 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 123 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 125 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 126 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 127 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 128 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 129 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 133 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 138 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 139 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 140 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 141 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 142 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 143 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 144 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 145 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 146 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 147 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 153 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 155 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 156 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 157 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 158 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 159 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 160 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 161 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 162 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 163 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 164 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 165 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 166 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 167 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 168 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 169 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 170 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 171 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 172 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 173 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 174 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 175 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 176 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 177 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 179 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 180 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 181 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 182 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 183 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 246 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 247 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 248 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 249 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 252 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 253 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 257 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 258 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 259 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 260 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 261 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 262 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 263 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 264 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 265 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 266 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 267 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 268 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 269 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 270 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 271 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 272 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 273 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 274 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 275 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 276 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 277 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 278 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 279 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 280 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 281 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 282 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 283 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 284 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 285 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 286 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 287 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 288 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 289 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 290 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 291 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 292 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 293 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 294 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 295 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 296 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 297 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 298 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 299 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 300 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 301 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 302 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 303 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 304 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 305 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 306 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 307 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 308 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 309 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 310 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 311 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 312 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 313 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 314 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 315 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 316 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 317 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 318 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 319 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 320 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 321 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 322 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 323 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 324 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 325 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 326 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 327 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 328 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 329 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 330 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 331 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 332 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 333 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 334 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 335 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 336 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 337 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 338 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 339 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 340 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 341 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 342 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 343 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 400 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 401 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 402 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 411 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 412 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 415 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 416 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 420 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 421 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 422 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 423 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 424 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 425 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 426 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 427 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 428 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 429 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 430 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 431 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 432 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 433 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 434 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 435 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 436 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 437 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 438 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 439 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 440 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 441 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 442 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 443 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 444 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 445 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 446 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 447 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 448 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 449 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 450 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 451 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 452 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 453 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 454 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 455 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 456 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 457 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 458 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 459 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 460 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 461 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 462 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 463 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 464 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 465 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 466 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 467 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 468 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 469 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 470 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 471 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 472 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 473 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 474 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 475 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 476 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 477 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 478 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 479 | 3300049683 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control | Metagenome | Rhizosphere |
| 480 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 481 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 482 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 483 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 484 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 485 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 486 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 487 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 488 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 489 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 490 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 491 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 492 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 493 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 494 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 495 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 496 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 497 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 498 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 499 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 500 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 501 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 502 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 503 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 504 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 505 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 506 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 507 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 508 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 509 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 510 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 511 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 512 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 513 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 514 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 515 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 516 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 517 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 518 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 519 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 520 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 521 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 522 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 523 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 524 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 525 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 526 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 527 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 528 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 529 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 530 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 531 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 532 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 533 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 534 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 535 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 536 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 537 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 538 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 539 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 540 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 541 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 542 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 543 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 544 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 545 | 3300053725 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere | Metagenome | Endosphere |
| 546 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 547 | 3300053728 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 endosphere | Metagenome | Endosphere |
| 548 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 549 | 3300053733 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere | Metagenome | Endosphere |
| 550 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 551 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 552 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 553 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 554 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 555 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 556 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 557 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 558 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 559 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 560 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 561 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 562 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 563 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 564 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 565 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 566 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 567 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 568 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 569 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 570 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 571 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 572 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 573 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 574 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 575 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 576 | 2602042107 | Bradyrhizobium sp. NFR13 | Isolate | Rhizoplane |
| 577 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 578 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 579 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 580 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 581 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 582 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 583 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 584 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 585 | 2791355199 | |||
| 586 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 587 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 588 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 589 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 590 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 591 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 592 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 593 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 594 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 595 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 596 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 597 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 598 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 599 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 600 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 601 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 602 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 603 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 604 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 605 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 606 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 607 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 608 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 609 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 610 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 611 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 612 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 613 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 614 | 2842333319 | Skermanella aerolata SEMIA 4010 | Isolate | Nodule |
| 615 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 616 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 617 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 618 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 619 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 620 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 621 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 622 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 623 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 624 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 625 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 626 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 627 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 628 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 629 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 630 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 631 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 632 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 633 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 634 | 2893066018 | Tardiphaga sp. P9-11 | Isolate | Unclassified |
| 635 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 636 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 637 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 638 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 639 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 640 | 2904699407 | |||
| 641 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 642 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 643 | 2906610324 | |||
| 644 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 645 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 646 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 647 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 648 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 649 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 650 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 651 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 652 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 653 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 654 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 655 | 2922425934 | |||
| 656 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 657 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 658 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 659 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 660 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 661 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 662 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 663 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 664 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 665 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 666 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 667 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 668 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 669 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 670 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 671 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 672 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 673 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 674 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 675 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 676 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 677 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 678 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 679 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 680 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 681 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 682 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 683 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 684 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 685 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 686 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 687 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 688 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 689 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 690 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 691 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 692 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 693 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 694 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 695 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 696 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 697 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 698 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 699 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 700 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 701 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 702 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 703 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 704 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 705 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 706 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 707 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 708 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 709 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 710 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 711 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 712 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 713 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 714 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 715 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 716 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 717 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 718 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 719 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 720 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
| 721 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
| 722 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 89.76 |
| Metatranscriptomes | 0.35 |
| Isolates | 9.89 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 10.45 |
| Nodule | 7.72 |
| Rhizoplane | 5.8 |
| Rhizosphere | 68.25 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | CNAas_1007064 | 3300000532 | Bacteria | 728 |
| 2 | CNAas_1016288 | 3300000532 | Bacteria | 528 |
| 3 | JGI24752J21851_1014742 | 3300001976 | Bacteria | 1019 |
| 4 | JGI24752J21851_1042018 | 3300001976 | Bacteria | 613 |
| 5 | JGI24746J21847_1002860 | 3300001977 | Bacteria | 2715 |
| 6 | JGI24739J22299_10011021 | 3300001989 | Bacteria | 3344 |
| 7 | JGI24739J22299_10071708 | 3300001989 | Bacteria | 1077 |
| 8 | JGI24737J22298_10008157 | 3300001990 | Bacteria | 3519 |
| 9 | JGI24737J22298_10050504 | 3300001990 | Bacteria | 1264 |
| 10 | JGI24743J22301_10024237 | 3300001991 | Bacteria | 1171 |
| 11 | JGI24743J22301_10029493 | 3300001991 | Bacteria | 1077 |
| 12 | JGI24735J21928_10031758 | 3300002067 | Bacteria | 1565 |
| 13 | JGI24750J21931_1001747 | 3300002070 | Bacteria | 2654 |
| 14 | JGI24750J21931_1003723 | 3300002070 | Bacteria | 1836 |
| 15 | JGI24745J21846_1018492 | 3300002073 | Bacteria | 813 |
| 16 | JGI24748J21848_1013455 | 3300002074 | Bacteria | 967 |
| 17 | JGI24738J21930_10019399 | 3300002075 | Bacteria | 1417 |
| 18 | JGI24744J21845_10004946 | 3300002077 | Bacteria | 2761 |
| 19 | JGI24033J26618_1008262 | 3300002155 | Bacteria | 1195 |
| 20 | JGI24034J26672_10026686 | 3300002239 | Bacteria | 927 |
| 21 | JGI24742J22300_10014955 | 3300002244 | Bacteria | 1304 |
| 22 | JGI24751J29686_10034545 | 3300002459 | Bacteria | 1049 |
| 23 | JGI25153J46596_10001947 | 3300003215 | Bacteria | 12243 |
| 24 | JGI25153J46596_10006672 | 3300003215 | Bacteria | 5805 |
| 25 | JGI25153J46596_10011948 | 3300003215 | Bacteria | 3798 |
| 26 | JGI25160J50197_1003445 | 3300003354 | Bacteria | 7078 |
| 27 | JGI25160J50197_1021526 | 3300003354 | Bacteria | 1914 |
| 28 | JGI25404J52841_10114818 | 3300003659 | Bacteria | 567 |
| 29 | Ga0055542_1012564 | 3300003762 | Bacteria | 1460 |
| 30 | Ga0055526_1017736 | 3300003771 | Bacteria | 2701 |
| 31 | Ga0055524_1044957 | 3300003775 | Bacteria | 1068 |
| 32 | Ga0055531_10005248 | 3300003794 | Bacteria | 7607 |
| 33 | JGI25405J52794_10008372 | 3300003911 | Bacteria | 1930 |
| 34 | Ga0065165_1002353 | 3300005262 | Bacteria | 16397 |
| 35 | Ga0065165_1003437 | 3300005262 | Bacteria | 11130 |
| 36 | Ga0065165_1020999 | 3300005262 | Bacteria | 2279 |
| 37 | Ga0065704_10158960 | 3300005289 | Bacteria | 1369 |
| 38 | Ga0070658_10650403 | 3300005327 | Bacteria | 914 |
| 39 | Ga0070658_11243293 | 3300005327 | Bacteria | 647 |
| 40 | Ga0070676_10256132 | 3300005328 | Bacteria | 1170 |
| 41 | Ga0070683_100001565 | 3300005329 | Bacteria | 17682 |
| 42 | Ga0070683_100030774 | 3300005329 | Bacteria | 4877 |
| 43 | Ga0070690_100015243 | 3300005330 | Bacteria | 4581 |
| 44 | Ga0070670_100008743 | 3300005331 | Bacteria | 8647 |
| 45 | Ga0070670_100121742 | 3300005331 | Bacteria | 2251 |
| 46 | Ga0068869_100063993 | 3300005334 | Bacteria | 2704 |
| 47 | Ga0068869_100869605 | 3300005334 | Bacteria | 778 |
| 48 | Ga0070666_10035271 | 3300005335 | Bacteria | 3317 |
| 49 | Ga0070666_10077319 | 3300005335 | Bacteria | 2272 |
| 50 | Ga0070680_100021428 | 3300005336 | Bacteria | 5137 |
| 51 | Ga0070680_100036045 | 3300005336 | Bacteria | 3995 |
| 52 | Ga0070680_100086516 | 3300005336 | Bacteria | 2591 |
| 53 | Ga0070682_100083151 | 3300005337 | Bacteria | 2077 |
| 54 | Ga0070682_100376278 | 3300005337 | Bacteria | 1067 |
| 55 | Ga0070682_100527707 | 3300005337 | Bacteria | 920 |
| 56 | Ga0068868_100041855 | 3300005338 | Bacteria | 3571 |
| 57 | Ga0068868_100423390 | 3300005338 | Bacteria | 1153 |
| 58 | Ga0070660_100399137 | 3300005339 | Bacteria | 1137 |
| 59 | Ga0070660_100851486 | 3300005339 | Bacteria | 768 |
| 60 | Ga0070689_100060091 | 3300005340 | Bacteria | 2954 |
| 61 | Ga0070691_10091962 | 3300005341 | Bacteria | 1497 |
| 62 | Ga0070691_10187112 | 3300005341 | Bacteria | 1081 |
| 63 | Ga0070687_100341399 | 3300005343 | Bacteria | 963 |
| 64 | Ga0070687_100465401 | 3300005343 | Bacteria | 844 |
| 65 | Ga0070661_100048583 | 3300005344 | Bacteria | 3106 |
| 66 | Ga0070661_100144999 | 3300005344 | Bacteria | 1792 |
| 67 | Ga0070661_100414778 | 3300005344 | Bacteria | 1066 |
| 68 | Ga0070692_10042076 | 3300005345 | Bacteria | 2344 |
| 69 | Ga0070692_10392284 | 3300005345 | Bacteria | 874 |
| 70 | Ga0070668_100039946 | 3300005347 | Bacteria | 3589 |
| 71 | Ga0070668_100070709 | 3300005347 | Bacteria | 2717 |
| 72 | Ga0070668_100286040 | 3300005347 | Bacteria | 1378 |
| 73 | Ga0070668_100375762 | 3300005347 | Bacteria | 1208 |
| 74 | Ga0070668_100668782 | 3300005347 | Bacteria | 914 |
| 75 | Ga0070668_100710332 | 3300005347 | Bacteria | 887 |
| 76 | Ga0070669_100011139 | 3300005353 | Bacteria | 6383 |
| 77 | Ga0070675_100070988 | 3300005354 | Bacteria | 2888 |
| 78 | Ga0070671_100006990 | 3300005355 | Bacteria | 9041 |
| 79 | Ga0070671_100258320 | 3300005355 | Bacteria | 1480 |
| 80 | Ga0070671_101422674 | 3300005355 | Bacteria | 613 |
| 81 | Ga0070674_100044981 | 3300005356 | Bacteria | 3014 |
| 82 | Ga0070674_100087726 | 3300005356 | Bacteria | 2238 |
| 83 | Ga0070674_100370164 | 3300005356 | Bacteria | 1163 |
| 84 | Ga0070674_100558687 | 3300005356 | Bacteria | 961 |
| 85 | Ga0070673_100031845 | 3300005364 | Bacteria | 3962 |
| 86 | Ga0070673_101187499 | 3300005364 | Bacteria | 715 |
| 87 | Ga0070688_100052318 | 3300005365 | Bacteria | 2550 |
| 88 | Ga0070659_100125139 | 3300005366 | Bacteria | 2085 |
| 89 | Ga0070667_100030018 | 3300005367 | Bacteria | 4534 |
| 90 | Ga0070667_101120646 | 3300005367 | Bacteria | 736 |
| 91 | Ga0070703_10057915 | 3300005406 | Bacteria | 1259 |
| 92 | Ga0070709_10159999 | 3300005434 | Bacteria | 1565 |
| 93 | Ga0070709_10740061 | 3300005434 | Bacteria | 768 |
| 94 | Ga0070709_11027051 | 3300005434 | Bacteria | 657 |
| 95 | Ga0070714_100145457 | 3300005435 | Bacteria | 2132 |
| 96 | Ga0070714_100185949 | 3300005435 | Bacteria | 1893 |
| 97 | Ga0070714_100622138 | 3300005435 | Bacteria | 1038 |
| 98 | Ga0070714_100787064 | 3300005435 | Bacteria | 921 |
| 99 | Ga0070714_101523903 | 3300005435 | Bacteria | 653 |
| 100 | Ga0070713_100041745 | 3300005436 | Bacteria | 3740 |
| 101 | Ga0070713_100094501 | 3300005436 | Bacteria | 2578 |
| 102 | Ga0070713_100410108 | 3300005436 | Bacteria | 1267 |
| 103 | Ga0070713_100563342 | 3300005436 | Bacteria | 1080 |
| 104 | Ga0070710_10006631 | 3300005437 | Bacteria | 5567 |
| 105 | Ga0070710_10068125 | 3300005437 | Bacteria | 2044 |
| 106 | Ga0070710_10562440 | 3300005437 | Bacteria | 789 |
| 107 | Ga0070710_10881557 | 3300005437 | Bacteria | 645 |
| 108 | Ga0070701_10092793 | 3300005438 | Bacteria | 1657 |
| 109 | Ga0070711_100005768 | 3300005439 | Bacteria | 7431 |
| 110 | Ga0070711_100010477 | 3300005439 | Bacteria | 5740 |
| 111 | Ga0070711_100134144 | 3300005439 | Bacteria | 1848 |
| 112 | Ga0070711_100608034 | 3300005439 | Bacteria | 913 |
| 113 | Ga0070700_100046342 | 3300005441 | Bacteria | 2685 |
| 114 | Ga0070700_100403356 | 3300005441 | Bacteria | 1028 |
| 115 | Ga0070694_100660815 | 3300005444 | Bacteria | 847 |
| 116 | Ga0070663_100003176 | 3300005455 | Bacteria | 9432 |
| 117 | Ga0070663_100009537 | 3300005455 | Bacteria | 6014 |
| 118 | Ga0070663_100026370 | 3300005455 | Bacteria | 3936 |
| 119 | Ga0070663_100026462 | 3300005455 | Bacteria | 3930 |
| 120 | Ga0070663_100068400 | 3300005455 | Bacteria | 2578 |
| 121 | Ga0070663_100088275 | 3300005455 | Bacteria | 2293 |
| 122 | Ga0070663_101222767 | 3300005455 | Bacteria | 661 |
| 123 | Ga0070678_100033201 | 3300005456 | Bacteria | 3581 |
| 124 | Ga0070678_100036936 | 3300005456 | Bacteria | 3424 |
| 125 | Ga0070678_100136851 | 3300005456 | Bacteria | 1954 |
| 126 | Ga0070678_100258846 | 3300005456 | Bacteria | 1462 |
| 127 | Ga0070678_100670886 | 3300005456 | Bacteria | 931 |
| 128 | Ga0070662_100002656 | 3300005457 | Bacteria | 11031 |
| 129 | Ga0070662_100009910 | 3300005457 | Bacteria | 6242 |
| 130 | Ga0070662_100069500 | 3300005457 | Bacteria | 2592 |
| 131 | Ga0070681_10411229 | 3300005458 | Bacteria | 1264 |
| 132 | Ga0070681_10871132 | 3300005458 | Bacteria | 819 |
| 133 | Ga0068867_100014079 | 3300005459 | Bacteria | 5666 |
| 134 | Ga0068867_100031702 | 3300005459 | Bacteria | 3818 |
| 135 | Ga0068867_100421945 | 3300005459 | Bacteria | 1130 |
| 136 | Ga0068867_100649420 | 3300005459 | Bacteria | 925 |
| 137 | Ga0068867_100896653 | 3300005459 | Bacteria | 798 |
| 138 | Ga0068867_101901825 | 3300005459 | Bacteria | 561 |
| 139 | Ga0070685_10043293 | 3300005466 | Bacteria | 2573 |
| 140 | Ga0070685_10229312 | 3300005466 | Bacteria | 1221 |
| 141 | Ga0070707_100432434 | 3300005468 | Bacteria | 1277 |
| 142 | Ga0070698_100402308 | 3300005471 | Bacteria | 1302 |
| 143 | Ga0070699_100182152 | 3300005518 | Bacteria | 1864 |
| 144 | Ga0070679_100010325 | 3300005530 | Bacteria | 8852 |
| 145 | Ga0070679_100022659 | 3300005530 | Bacteria | 6141 |
| 146 | Ga0070679_100095128 | 3300005530 | Bacteria | 2967 |
| 147 | Ga0070679_100702860 | 3300005530 | Bacteria | 954 |
| 148 | Ga0070684_100038357 | 3300005535 | Bacteria | 4115 |
| 149 | Ga0070684_100044466 | 3300005535 | Bacteria | 3841 |
| 150 | Ga0070697_101460792 | 3300005536 | Bacteria | 611 |
| 151 | Ga0068853_100005156 | 3300005539 | Bacteria | 10211 |
| 152 | Ga0068853_100067627 | 3300005539 | Bacteria | 3104 |
| 153 | Ga0068853_100404177 | 3300005539 | Bacteria | 1279 |
| 154 | Ga0070672_100014120 | 3300005543 | Bacteria | 5653 |
| 155 | Ga0070672_100038206 | 3300005543 | Bacteria | 3666 |
| 156 | Ga0070696_100129789 | 3300005546 | Bacteria | 1833 |
| 157 | Ga0070696_100584535 | 3300005546 | Bacteria | 899 |
| 158 | Ga0070693_100028312 | 3300005547 | Bacteria | 3045 |
| 159 | Ga0070693_100072573 | 3300005547 | Bacteria | 2031 |
| 160 | Ga0070693_100118543 | 3300005547 | Bacteria | 1638 |
| 161 | Ga0070693_100403398 | 3300005547 | Bacteria | 948 |
| 162 | Ga0070665_100046497 | 3300005548 | Bacteria | 4359 |
| 163 | Ga0070665_100051999 | 3300005548 | Bacteria | 4109 |
| 164 | Ga0070665_100068708 | 3300005548 | Bacteria | 3552 |
| 165 | Ga0070665_100291457 | 3300005548 | Bacteria | 1634 |
| 166 | Ga0070665_100324291 | 3300005548 | Bacteria | 1544 |
| 167 | Ga0070665_100986298 | 3300005548 | Bacteria | 855 |
| 168 | Ga0070704_100037230 | 3300005549 | Bacteria | 3322 |
| 169 | Ga0068855_100019978 | 3300005563 | Bacteria | 8045 |
| 170 | Ga0068855_100136155 | 3300005563 | Bacteria | 2803 |
| 171 | Ga0068855_100165617 | 3300005563 | Bacteria | 2506 |
| 172 | Ga0068855_100312920 | 3300005563 | Bacteria | 1737 |
| 173 | Ga0068855_100362099 | 3300005563 | Bacteria | 1596 |
| 174 | Ga0068855_100478450 | 3300005563 | Bacteria | 1356 |
| 175 | Ga0068855_100516417 | 3300005563 | Bacteria | 1296 |
| 176 | Ga0070664_100162609 | 3300005564 | Bacteria | 1976 |
| 177 | Ga0068857_100126257 | 3300005577 | Bacteria | 2305 |
| 178 | Ga0068857_101694345 | 3300005577 | Bacteria | 618 |
| 179 | Ga0068854_100047503 | 3300005578 | Bacteria | 3059 |
| 180 | Ga0068854_100058007 | 3300005578 | Bacteria | 2793 |
| 181 | Ga0068854_100081599 | 3300005578 | Bacteria | 2389 |
| 182 | Ga0068854_100356681 | 3300005578 | Bacteria | 1198 |
| 183 | Ga0068854_100382956 | 3300005578 | Bacteria | 1159 |
| 184 | Ga0068856_100053956 | 3300005614 | Bacteria | 3964 |
| 185 | Ga0068856_100463353 | 3300005614 | Bacteria | 1288 |
| 186 | Ga0068856_100692350 | 3300005614 | Bacteria | 1040 |
| 187 | Ga0070702_100061895 | 3300005615 | Bacteria | 2180 |
| 188 | Ga0068852_100147236 | 3300005616 | Bacteria | 2186 |
| 189 | Ga0068852_100200033 | 3300005616 | Bacteria | 1890 |
| 190 | Ga0068852_100201666 | 3300005616 | Bacteria | 1883 |
| 191 | Ga0068852_100236521 | 3300005616 | Bacteria | 1744 |
| 192 | Ga0068859_100101341 | 3300005617 | Bacteria | 2936 |
| 193 | Ga0068859_100125588 | 3300005617 | Bacteria | 2634 |
| 194 | Ga0068859_100563278 | 3300005617 | Bacteria | 1233 |
| 195 | Ga0068859_101052294 | 3300005617 | Bacteria | 894 |
| 196 | Ga0068859_101364972 | 3300005617 | Bacteria | 781 |
| 197 | Ga0068864_100040306 | 3300005618 | Bacteria | 3995 |
| 198 | Ga0068864_100292997 | 3300005618 | Bacteria | 1521 |
| 199 | Ga0068864_100362652 | 3300005618 | Bacteria | 1370 |
| 200 | Ga0068864_101066983 | 3300005618 | Bacteria | 803 |
| 201 | Ga0068866_10002426 | 3300005718 | Bacteria | 7691 |
| 202 | Ga0068866_10033495 | 3300005718 | Bacteria | 2493 |
| 203 | Ga0068861_100077067 | 3300005719 | Bacteria | 2599 |
| 204 | Ga0068861_100356152 | 3300005719 | Bacteria | 1285 |
| 205 | Ga0068861_101131658 | 3300005719 | Bacteria | 754 |
| 206 | Ga0068851_10049326 | 3300005834 | Bacteria | 2135 |
| 207 | Ga0068851_10053457 | 3300005834 | Bacteria | 2056 |
| 208 | Ga0068870_10021594 | 3300005840 | Bacteria | 3151 |
| 209 | Ga0068870_10022666 | 3300005840 | Bacteria | 3088 |
| 210 | Ga0068863_100022284 | 3300005841 | Bacteria | 6047 |
| 211 | Ga0068863_100119182 | 3300005841 | Bacteria | 2516 |
| 212 | Ga0068858_100505793 | 3300005842 | Bacteria | 1167 |
| 213 | Ga0068860_100008962 | 3300005843 | Bacteria | 9967 |
| 214 | Ga0068860_100009362 | 3300005843 | Bacteria | 9736 |
| 215 | Ga0068860_100067553 | 3300005843 | Bacteria | 3396 |
| 216 | Ga0068860_100535033 | 3300005843 | Bacteria | 1172 |
| 217 | Ga0068860_100650756 | 3300005843 | Bacteria | 1062 |
| 218 | Ga0068862_100031732 | 3300005844 | Bacteria | 4462 |
| 219 | Ga0068862_100285275 | 3300005844 | Bacteria | 1514 |
| 220 | Ga0068862_100438039 | 3300005844 | Bacteria | 1230 |
| 221 | Ga0068862_100536366 | 3300005844 | Bacteria | 1115 |
| 222 | Ga0068862_100934225 | 3300005844 | Bacteria | 854 |
| 223 | Ga0081455_10003720 | 3300005937 | Bacteria | 17438 |
| 224 | Ga0081455_10022574 | 3300005937 | Bacteria | 5878 |
| 225 | Ga0081455_10025887 | 3300005937 | Bacteria | 5407 |
| 226 | Ga0081455_10037014 | 3300005937 | Bacteria | 4337 |
| 227 | Ga0081538_10032637 | 3300005981 | Bacteria | 3483 |
| 228 | Ga0081538_10225715 | 3300005981 | Bacteria | 737 |
| 229 | Ga0081540_1002390 | 3300005983 | Bacteria | 15316 |
| 230 | Ga0081540_1013147 | 3300005983 | Bacteria | 5402 |
| 231 | Ga0081540_1015337 | 3300005983 | Bacteria | 4855 |
| 232 | Ga0081540_1017529 | 3300005983 | Bacteria | 4429 |
| 233 | Ga0081540_1020352 | 3300005983 | Bacteria | 3995 |
| 234 | Ga0081540_1029940 | 3300005983 | Bacteria | 3023 |
| 235 | Ga0081540_1057036 | 3300005983 | Bacteria | 1891 |
| 236 | Ga0081540_1078120 | 3300005983 | Bacteria | 1502 |
| 237 | Ga0081540_1080661 | 3300005983 | Bacteria | 1466 |
| 238 | Ga0081539_10057175 | 3300005985 | Bacteria | 2161 |
| 239 | Ga0070717_10067804 | 3300006028 | Bacteria | 2969 |
| 240 | Ga0070717_10125289 | 3300006028 | Bacteria | 2205 |
| 241 | Ga0075365_10003009 | 3300006038 | Bacteria | 8539 |
| 242 | Ga0075365_10042733 | 3300006038 | Bacteria | 2965 |
| 243 | Ga0075365_10049499 | 3300006038 | Bacteria | 2769 |
| 244 | Ga0075365_10051739 | 3300006038 | Bacteria | 2714 |
| 245 | Ga0075365_10055538 | 3300006038 | Bacteria | 2629 |
| 246 | Ga0075365_10169864 | 3300006038 | Bacteria | 1522 |
| 247 | Ga0075365_10250500 | 3300006038 | Bacteria | 1244 |
| 248 | Ga0075365_10315185 | 3300006038 | Bacteria | 1101 |
| 249 | Ga0075365_10400501 | 3300006038 | Bacteria | 969 |
| 250 | Ga0075365_10507378 | 3300006038 | Bacteria | 852 |
| 251 | Ga0075368_10020688 | 3300006042 | Bacteria | 2493 |
| 252 | Ga0075368_10048722 | 3300006042 | Bacteria | 1679 |
| 253 | Ga0075368_10068298 | 3300006042 | Bacteria | 1432 |
| 254 | Ga0075363_100134074 | 3300006048 | Bacteria | 1391 |
| 255 | Ga0075363_100235982 | 3300006048 | Bacteria | 1051 |
| 256 | Ga0075363_100476082 | 3300006048 | Bacteria | 740 |
| 257 | Ga0075363_100564883 | 3300006048 | Bacteria | 680 |
| 258 | Ga0075363_100574396 | 3300006048 | Bacteria | 674 |
| 259 | Ga0075364_10082487 | 3300006051 | Bacteria | 2127 |
| 260 | Ga0075364_10207456 | 3300006051 | Bacteria | 1328 |
| 261 | Ga0075364_10342750 | 3300006051 | Bacteria | 1018 |
| 262 | Ga0075432_10120583 | 3300006058 | Bacteria | 985 |
| 263 | Ga0070715_10080047 | 3300006163 | Bacteria | 1481 |
| 264 | Ga0070716_100034264 | 3300006173 | Bacteria | 2783 |
| 265 | Ga0070716_100103296 | 3300006173 | Bacteria | 1752 |
| 266 | Ga0070716_100104491 | 3300006173 | Bacteria | 1744 |
| 267 | Ga0070716_100138237 | 3300006173 | Bacteria | 1550 |
| 268 | Ga0070716_100266207 | 3300006173 | Bacteria | 1175 |
| 269 | Ga0070712_100028396 | 3300006175 | Bacteria | 3742 |
| 270 | Ga0070712_100680400 | 3300006175 | Bacteria | 876 |
| 271 | Ga0070712_100893489 | 3300006175 | Bacteria | 766 |
| 272 | Ga0075362_10079252 | 3300006177 | Bacteria | 1512 |
| 273 | Ga0075362_10089156 | 3300006177 | Bacteria | 1430 |
| 274 | Ga0075362_10197755 | 3300006177 | Bacteria | 978 |
| 275 | Ga0075367_10024941 | 3300006178 | Bacteria | 3376 |
| 276 | Ga0075367_10029951 | 3300006178 | Bacteria | 3117 |
| 277 | Ga0075367_10104932 | 3300006178 | Bacteria | 1730 |
| 278 | Ga0075367_10110463 | 3300006178 | Bacteria | 1687 |
| 279 | Ga0075367_10240617 | 3300006178 | Bacteria | 1134 |
| 280 | Ga0075369_10033272 | 3300006186 | Bacteria | 2184 |
| 281 | Ga0075369_10047695 | 3300006186 | Bacteria | 1847 |
| 282 | Ga0075369_10168023 | 3300006186 | Bacteria | 1006 |
| 283 | Ga0075369_10231437 | 3300006186 | Bacteria | 856 |
| 284 | Ga0075366_10055832 | 3300006195 | Bacteria | 2345 |
| 285 | Ga0075366_10764718 | 3300006195 | Bacteria | 600 |
| 286 | Ga0097621_100059211 | 3300006237 | Bacteria | 3135 |
| 287 | Ga0097621_100156305 | 3300006237 | Bacteria | 1957 |
| 288 | Ga0097621_100618265 | 3300006237 | Bacteria | 992 |
| 289 | Ga0075370_10019347 | 3300006353 | Bacteria | 3708 |
| 290 | Ga0075370_10035805 | 3300006353 | Bacteria | 2787 |
| 291 | Ga0075370_10040301 | 3300006353 | Bacteria | 2634 |
| 292 | Ga0075370_10477177 | 3300006353 | Bacteria | 752 |
| 293 | Ga0075370_10683419 | 3300006353 | Bacteria | 624 |
| 294 | Ga0068871_100007042 | 3300006358 | Bacteria | 8009 |
| 295 | Ga0068871_100890450 | 3300006358 | Bacteria | 824 |
| 296 | Ga0075428_100162297 | 3300006844 | Bacteria | 2425 |
| 297 | Ga0075428_100170083 | 3300006844 | Bacteria | 2363 |
| 298 | Ga0075428_100344851 | 3300006844 | Bacteria | 1599 |
| 299 | Ga0075430_100000092 | 3300006846 | Bacteria | 52226 |
| 300 | Ga0075430_100057037 | 3300006846 | Bacteria | 3285 |
| 301 | Ga0075430_100122412 | 3300006846 | Bacteria | 2169 |
| 302 | Ga0075431_100595866 | 3300006847 | Bacteria | 1089 |
| 303 | Ga0075431_100815598 | 3300006847 | Bacteria | 906 |
| 304 | Ga0075431_101146964 | 3300006847 | Bacteria | 741 |
| 305 | Ga0075433_10056373 | 3300006852 | Bacteria | 3432 |
| 306 | Ga0075434_100010423 | 3300006871 | Bacteria | 8711 |
| 307 | Ga0075434_100030654 | 3300006871 | Bacteria | 5297 |
| 308 | Ga0075434_100241358 | 3300006871 | Bacteria | 1827 |
| 309 | Ga0068865_100172438 | 3300006881 | Bacteria | 1659 |
| 310 | Ga0068865_100511837 | 3300006881 | Bacteria | 1002 |
| 311 | Ga0068865_101343343 | 3300006881 | Bacteria | 637 |
| 312 | Ga0075436_100006947 | 3300006914 | Bacteria | 7746 |
| 313 | Ga0097620_100101354 | 3300006931 | Bacteria | 2936 |
| 314 | Ga0097620_100125592 | 3300006931 | Bacteria | 2634 |
| 315 | Ga0097620_100563295 | 3300006931 | Bacteria | 1233 |
| 316 | Ga0097620_101052296 | 3300006931 | Bacteria | 894 |
| 317 | Ga0097620_101364982 | 3300006931 | Bacteria | 781 |
| 318 | Ga0097620_101586738 | 3300006931 | Bacteria | 723 |
| 319 | Ga0099824_1005597 | 3300006942 | Bacteria | 17628 |
| 320 | Ga0099822_1000135 | 3300006943 | Bacteria | 49135 |
| 321 | Ga0075435_100114500 | 3300007076 | Bacteria | 2245 |
| 322 | Ga0075435_100131793 | 3300007076 | Bacteria | 2092 |
| 323 | Ga0075435_100766264 | 3300007076 | Bacteria | 840 |
| 324 | Ga0099794_10021912 | 3300007265 | Bacteria | 2908 |
| 325 | Ga0099794_10060044 | 3300007265 | Bacteria | 1846 |
| 326 | Ga0099795_10035994 | 3300007788 | Bacteria | 1734 |
| 327 | Ga0099795_10044832 | 3300007788 | Bacteria | 1588 |
| 328 | Ga0099795_10048741 | 3300007788 | Bacteria | 1535 |
| 329 | Ga0099795_10170855 | 3300007788 | Bacteria | 903 |
| 330 | Ga0105251_10390400 | 3300009011 | Bacteria | 639 |
| 331 | Ga0105244_10484345 | 3300009036 | Bacteria | 569 |
| 332 | Ga0105250_10174340 | 3300009092 | Bacteria | 901 |
| 333 | Ga0105240_10021688 | 3300009093 | Bacteria | 8539 |
| 334 | Ga0105240_10025074 | 3300009093 | Bacteria | 7848 |
| 335 | Ga0105240_10050477 | 3300009093 | Bacteria | 5244 |
| 336 | Ga0105240_10825297 | 3300009093 | Bacteria | 1003 |
| 337 | Ga0111539_10054794 | 3300009094 | Bacteria | 4743 |
| 338 | Ga0111539_10060771 | 3300009094 | Bacteria | 4478 |
| 339 | Ga0111539_10109696 | 3300009094 | Bacteria | 3238 |
| 340 | Ga0111539_10110862 | 3300009094 | Bacteria | 3220 |
| 341 | Ga0111539_10543708 | 3300009094 | Bacteria | 1353 |
| 342 | Ga0111539_10849268 | 3300009094 | Bacteria | 1062 |
| 343 | Ga0105245_10016805 | 3300009098 | Bacteria | 6389 |
| 344 | Ga0105245_10024798 | 3300009098 | Bacteria | 5269 |
| 345 | Ga0105245_10203823 | 3300009098 | Bacteria | 1901 |
| 346 | Ga0105245_10821810 | 3300009098 | Bacteria | 968 |
| 347 | Ga0105247_10009003 | 3300009101 | Bacteria | 6082 |
| 348 | Ga0105247_10060745 | 3300009101 | Bacteria | 2342 |
| 349 | Ga0105247_10066180 | 3300009101 | Bacteria | 2250 |
| 350 | Ga0105247_10175907 | 3300009101 | Bacteria | 1425 |
| 351 | Ga0105247_10180619 | 3300009101 | Bacteria | 1408 |
| 352 | Ga0105247_10550669 | 3300009101 | Bacteria | 848 |
| 353 | Ga0114129_10012565 | 3300009147 | Bacteria | 12056 |
| 354 | Ga0114129_10099152 | 3300009147 | Bacteria | 4032 |
| 355 | Ga0114129_10103012 | 3300009147 | Bacteria | 3947 |
| 356 | Ga0114129_10164114 | 3300009147 | Bacteria | 3032 |
| 357 | Ga0114129_10637713 | 3300009147 | Bacteria | 1376 |
| 358 | Ga0114129_10639519 | 3300009147 | Bacteria | 1374 |
| 359 | Ga0114129_10878100 | 3300009147 | Bacteria | 1138 |
| 360 | Ga0105243_10022026 | 3300009148 | Bacteria | 4841 |
| 361 | Ga0105243_10346140 | 3300009148 | Bacteria | 1363 |
| 362 | Ga0105243_10356067 | 3300009148 | Bacteria | 1346 |
| 363 | Ga0105241_10024174 | 3300009174 | Bacteria | 4512 |
| 364 | Ga0105241_10048580 | 3300009174 | Bacteria | 3229 |
| 365 | Ga0105241_10116858 | 3300009174 | Bacteria | 2143 |
| 366 | Ga0105241_10368126 | 3300009174 | Bacteria | 1252 |
| 367 | Ga0105241_10492911 | 3300009174 | Bacteria | 1091 |
| 368 | Ga0105241_10658765 | 3300009174 | Bacteria | 952 |
| 369 | Ga0105241_10846850 | 3300009174 | Bacteria | 845 |
| 370 | Ga0105241_11211076 | 3300009174 | Bacteria | 716 |
| 371 | Ga0105242_10101504 | 3300009176 | Bacteria | 2438 |
| 372 | Ga0105248_10077052 | 3300009177 | Bacteria | 3748 |
| 373 | Ga0105248_10512781 | 3300009177 | Bacteria | 1352 |
| 374 | Ga0105237_10008878 | 3300009545 | Bacteria | 10833 |
| 375 | Ga0105237_10015340 | 3300009545 | Bacteria | 7980 |
| 376 | Ga0105237_10129706 | 3300009545 | Bacteria | 2516 |
| 377 | Ga0105237_10133066 | 3300009545 | Bacteria | 2481 |
| 378 | Ga0105237_10792988 | 3300009545 | Bacteria | 954 |
| 379 | Ga0105238_10146676 | 3300009551 | Bacteria | 2336 |
| 380 | Ga0105238_10148405 | 3300009551 | Bacteria | 2321 |
| 381 | Ga0105238_10286075 | 3300009551 | Bacteria | 1630 |
| 382 | Ga0105238_12207788 | 3300009551 | Bacteria | 585 |
| 383 | Ga0105249_10012243 | 3300009553 | Bacteria | 7556 |
| 384 | Ga0105249_10036785 | 3300009553 | Bacteria | 4441 |
| 385 | Ga0105249_10204487 | 3300009553 | Bacteria | 1934 |
| 386 | Ga0105249_10931613 | 3300009553 | Bacteria | 936 |
| 387 | Ga0099796_10001500 | 3300010159 | Bacteria | 4728 |
| 388 | Ga0099796_10021234 | 3300010159 | Bacteria | 1996 |
| 389 | Ga0099796_10146526 | 3300010159 | Bacteria | 927 |
| 390 | Ga0105239_10058078 | 3300010375 | Bacteria | 4245 |
| 391 | Ga0105239_10075274 | 3300010375 | Bacteria | 3712 |
| 392 | Ga0105239_10079699 | 3300010375 | Bacteria | 3603 |
| 393 | Ga0105239_10082681 | 3300010375 | Bacteria | 3536 |
| 394 | Ga0105239_10141126 | 3300010375 | Bacteria | 2684 |
| 395 | Ga0105239_10162375 | 3300010375 | Bacteria | 2497 |
| 396 | Ga0105239_10424858 | 3300010375 | Bacteria | 1506 |
| 397 | Ga0105239_10609090 | 3300010375 | Bacteria | 1246 |
| 398 | Ga0105239_11020883 | 3300010375 | Bacteria | 951 |
| 399 | Ga0105239_11691636 | 3300010375 | Bacteria | 732 |
| 400 | Ga0105246_10042475 | 3300011119 | Bacteria | 3079 |
| 401 | Ga0105246_10105627 | 3300011119 | Bacteria | 2059 |
| 402 | Ga0105246_10145260 | 3300011119 | Bacteria | 1789 |
| 403 | Ga0105246_10484884 | 3300011119 | Bacteria | 1047 |
| 404 | Ga0157373_10149571 | 3300013100 | Bacteria | 1642 |
| 405 | Ga0157373_10736059 | 3300013100 | Bacteria | 724 |
| 406 | Ga0157373_10821079 | 3300013100 | Bacteria | 686 |
| 407 | Ga0157371_10191662 | 3300013102 | Bacteria | 1464 |
| 408 | Ga0157370_10139150 | 3300013104 | Bacteria | 2262 |
| 409 | Ga0157370_10238280 | 3300013104 | Bacteria | 1684 |
| 410 | Ga0157370_10289018 | 3300013104 | Bacteria | 1514 |
| 411 | Ga0157370_10622911 | 3300013104 | Bacteria | 987 |
| 412 | Ga0157370_10665099 | 3300013104 | Bacteria | 952 |
| 413 | Ga0157369_10006988 | 3300013105 | Bacteria | 13021 |
| 414 | Ga0157369_10022714 | 3300013105 | Bacteria | 6996 |
| 415 | Ga0157369_10074385 | 3300013105 | Bacteria | 3643 |
| 416 | Ga0157369_10083984 | 3300013105 | Bacteria | 3405 |
| 417 | Ga0157374_10037462 | 3300013296 | Bacteria | 4451 |
| 418 | Ga0157378_10005022 | 3300013297 | Bacteria | 11616 |
| 419 | Ga0157378_10061841 | 3300013297 | Bacteria | 3343 |
| 420 | Ga0157378_10091824 | 3300013297 | Bacteria | 2761 |
| 421 | Ga0163162_10074563 | 3300013306 | Bacteria | 3452 |
| 422 | Ga0163162_10471223 | 3300013306 | Bacteria | 1387 |
| 423 | Ga0163162_10700368 | 3300013306 | Bacteria | 1134 |
| 424 | Ga0163162_11794836 | 3300013306 | Bacteria | 701 |
| 425 | Ga0157372_10066194 | 3300013307 | Bacteria | 4059 |
| 426 | Ga0157372_10082819 | 3300013307 | Bacteria | 3633 |
| 427 | Ga0157372_10575715 | 3300013307 | Bacteria | 1312 |
| 428 | Ga0157372_10640431 | 3300013307 | Bacteria | 1238 |
| 429 | Ga0157372_11260609 | 3300013307 | Bacteria | 853 |
| 430 | Ga0157375_10075347 | 3300013308 | Bacteria | 3398 |
| 431 | Ga0157375_11213923 | 3300013308 | Bacteria | 885 |
| 432 | Ga0157375_11856529 | 3300013308 | Bacteria | 715 |
| 433 | Ga0163163_10006441 | 3300014325 | Bacteria | 10266 |
| 434 | Ga0163163_10064789 | 3300014325 | Bacteria | 3626 |
| 435 | Ga0163163_10084291 | 3300014325 | Bacteria | 3184 |
| 436 | Ga0157380_10025556 | 3300014326 | Bacteria | 4478 |
| 437 | Ga0157380_10157958 | 3300014326 | Bacteria | 1967 |
| 438 | Ga0157380_10329859 | 3300014326 | Bacteria | 1419 |
| 439 | Ga0157380_11266089 | 3300014326 | Bacteria | 784 |
| 440 | Ga0157377_10072463 | 3300014745 | Bacteria | 1994 |
| 441 | Ga0157377_10198181 | 3300014745 | Bacteria | 1273 |
| 442 | Ga0157379_10135168 | 3300014968 | Bacteria | 2221 |
| 443 | Ga0157379_10233368 | 3300014968 | Bacteria | 1668 |
| 444 | Ga0157379_10269860 | 3300014968 | Bacteria | 1547 |
| 445 | Ga0157379_11086241 | 3300014968 | Bacteria | 766 |
| 446 | Ga0157376_10042914 | 3300014969 | Bacteria | 3709 |
| 447 | Ga0157376_12733539 | 3300014969 | Bacteria | 533 |
| 448 | Ga0163161_10013443 | 3300017792 | Bacteria | 5697 |
| 449 | Ga0163161_10022945 | 3300017792 | Bacteria | 4397 |
| 450 | Ga0163161_10334211 | 3300017792 | Bacteria | 1201 |
| 451 | Ga0206356_10349572 | 3300020070 | Bacteria | 1227 |
| 452 | Ga0206356_11053787 | 3300020070 | Bacteria | 815 |
| 453 | Ga0206354_10934028 | 3300020081 | Bacteria | 1329 |
| 454 | Ga0154015_1287332 | 3300020610 | Bacteria | 714 |
| 455 | Ga0214544_1000007 | 3300021320 | Bacteria | 379989 |
| 456 | Ga0214542_1000007 | 3300021321 | Bacteria | 291816 |
| 457 | Ga0214545_1000006 | 3300021324 | Bacteria | 291693 |
| 458 | Ga0214545_1023938 | 3300021324 | Bacteria | 3890 |
| 459 | Ga0214543_1000009 | 3300021327 | Bacteria | 384302 |
| 460 | Ga0214543_1032603 | 3300021327 | Bacteria | 1950 |
| 461 | Ga0214543_1041664 | 3300021327 | Bacteria | 1177 |
| 462 | Ga0213872_10054957 | 3300021361 | Bacteria | 1805 |
| 463 | Ga0213871_10099441 | 3300021441 | Bacteria | 850 |
| 464 | Ga0224712_10217562 | 3300022467 | Bacteria | 873 |
| 465 | Ga0228598_1049778 | 3300024227 | Bacteria | 831 |
| 466 | Ga0209148_1000526 | 3300025254 | Bacteria | 37777 |
| 467 | Ga0209129_1050782 | 3300025258 | Bacteria | 634 |
| 468 | Ga0209233_1001391 | 3300025261 | Bacteria | 9580 |
| 469 | Ga0209233_1001927 | 3300025261 | Bacteria | 7935 |
| 470 | Ga0209233_1002233 | 3300025261 | Bacteria | 7245 |
| 471 | Ga0209455_1004411 | 3300025272 | Bacteria | 4619 |
| 472 | Ga0209455_1004523 | 3300025272 | Bacteria | 4522 |
| 473 | Ga0207673_1052412 | 3300025290 | Bacteria | 578 |
| 474 | Ga0209564_1000842 | 3300025295 | Bacteria | 41342 |
| 475 | Ga0209564_1023370 | 3300025295 | Bacteria | 2150 |
| 476 | Ga0209758_1000015 | 3300025297 | Bacteria | 851943 |
| 477 | Ga0209758_1001439 | 3300025297 | Bacteria | 28039 |
| 478 | Ga0209758_1001478 | 3300025297 | Bacteria | 27491 |
| 479 | Ga0209758_1011326 | 3300025297 | Bacteria | 5183 |
| 480 | Ga0209758_1021699 | 3300025297 | Bacteria | 2982 |
| 481 | Ga0209758_1048050 | 3300025297 | Bacteria | 1521 |
| 482 | Ga0209256_1007010 | 3300025299 | Bacteria | 5723 |
| 483 | Ga0209256_1072347 | 3300025299 | Bacteria | 772 |
| 484 | Ga0207426_1000186 | 3300025302 | Bacteria | 154130 |
| 485 | Ga0207426_1001603 | 3300025302 | Bacteria | 18018 |
| 486 | Ga0207426_1051408 | 3300025302 | Bacteria | 1224 |
| 487 | Ga0207426_1078886 | 3300025302 | Bacteria | 898 |
| 488 | Ga0209257_1000983 | 3300025304 | Bacteria | 38689 |
| 489 | Ga0207697_10094523 | 3300025315 | Bacteria | 1269 |
| 490 | Ga0207656_10068588 | 3300025321 | Bacteria | 1571 |
| 491 | Ga0207656_10125749 | 3300025321 | Bacteria | 1197 |
| 492 | Ga0207696_1115447 | 3300025711 | Bacteria | 726 |
| 493 | Ga0207692_10407875 | 3300025898 | Bacteria | 849 |
| 494 | Ga0207642_10159591 | 3300025899 | Bacteria | 1209 |
| 495 | Ga0207642_10397203 | 3300025899 | Bacteria | 824 |
| 496 | Ga0207710_10019564 | 3300025900 | Bacteria | 2889 |
| 497 | Ga0207710_10061501 | 3300025900 | Bacteria | 1704 |
| 498 | Ga0207688_10021104 | 3300025901 | Bacteria | 3557 |
| 499 | Ga0207688_10030330 | 3300025901 | Bacteria | 2981 |
| 500 | Ga0207680_10030111 | 3300025903 | Bacteria | 3057 |
| 501 | Ga0207647_10097648 | 3300025904 | Bacteria | 1746 |
| 502 | Ga0207647_10251809 | 3300025904 | Bacteria | 1013 |
| 503 | Ga0207647_10517307 | 3300025904 | Bacteria | 664 |
| 504 | Ga0207699_10024964 | 3300025906 | Bacteria | 3275 |
| 505 | Ga0207699_10172248 | 3300025906 | Bacteria | 1449 |
| 506 | Ga0207699_10795567 | 3300025906 | Bacteria | 695 |
| 507 | Ga0207643_10005803 | 3300025908 | Bacteria | 6599 |
| 508 | Ga0207643_10181086 | 3300025908 | Bacteria | 1275 |
| 509 | Ga0207654_10005282 | 3300025911 | Bacteria | 6520 |
| 510 | Ga0207654_10019075 | 3300025911 | Bacteria | 3611 |
| 511 | Ga0207654_10218768 | 3300025911 | Bacteria | 1262 |
| 512 | Ga0207654_10584195 | 3300025911 | Bacteria | 796 |
| 513 | Ga0207707_10000749 | 3300025912 | Bacteria | 31978 |
| 514 | Ga0207707_10015886 | 3300025912 | Bacteria | 6566 |
| 515 | Ga0207707_10038314 | 3300025912 | Bacteria | 4189 |
| 516 | Ga0207707_10055348 | 3300025912 | Bacteria | 3451 |
| 517 | Ga0207707_10419045 | 3300025912 | Bacteria | 1148 |
| 518 | Ga0207707_10770523 | 3300025912 | Bacteria | 803 |
| 519 | Ga0207695_10000006 | 3300025913 | Bacteria | 1135309 |
| 520 | Ga0207695_10011353 | 3300025913 | Bacteria | 10797 |
| 521 | Ga0207695_10338819 | 3300025913 | Bacteria | 1392 |
| 522 | Ga0207695_10503838 | 3300025913 | Bacteria | 1093 |
| 523 | Ga0207671_10001082 | 3300025914 | Bacteria | 33044 |
| 524 | Ga0207671_10167317 | 3300025914 | Bacteria | 1705 |
| 525 | Ga0207671_10237189 | 3300025914 | Bacteria | 1432 |
| 526 | Ga0207671_10419199 | 3300025914 | Bacteria | 1065 |
| 527 | Ga0207671_10646507 | 3300025914 | Bacteria | 842 |
| 528 | Ga0207671_10954732 | 3300025914 | Bacteria | 677 |
| 529 | Ga0207693_10012511 | 3300025915 | Bacteria | 6854 |
| 530 | Ga0207693_10137700 | 3300025915 | Bacteria | 1920 |
| 531 | Ga0207693_10566541 | 3300025915 | Bacteria | 885 |
| 532 | Ga0207663_10068214 | 3300025916 | Bacteria | 2283 |
| 533 | Ga0207663_10281585 | 3300025916 | Bacteria | 1235 |
| 534 | Ga0207663_10373059 | 3300025916 | Bacteria | 1085 |
| 535 | Ga0207663_10810940 | 3300025916 | Bacteria | 746 |
| 536 | Ga0207663_10820053 | 3300025916 | Bacteria | 742 |
| 537 | Ga0207660_10001899 | 3300025917 | Bacteria | 13916 |
| 538 | Ga0207660_10374702 | 3300025917 | Bacteria | 1143 |
| 539 | Ga0207660_10516037 | 3300025917 | Bacteria | 970 |
| 540 | Ga0207660_10557944 | 3300025917 | Bacteria | 932 |
| 541 | Ga0207662_10004262 | 3300025918 | Bacteria | 7505 |
| 542 | Ga0207657_10058330 | 3300025919 | Bacteria | 3322 |
| 543 | Ga0207649_10347305 | 3300025920 | Bacteria | 1097 |
| 544 | Ga0207652_10006792 | 3300025921 | Bacteria | 9225 |
| 545 | Ga0207652_10016701 | 3300025921 | Bacteria | 5998 |
| 546 | Ga0207652_10114418 | 3300025921 | Bacteria | 2395 |
| 547 | Ga0207652_10217268 | 3300025921 | Bacteria | 1722 |
| 548 | Ga0207652_11138165 | 3300025921 | Bacteria | 681 |
| 549 | Ga0207681_10043643 | 3300025923 | Bacteria | 3002 |
| 550 | Ga0207681_10230628 | 3300025923 | Bacteria | 1437 |
| 551 | Ga0207681_10594372 | 3300025923 | Bacteria | 914 |
| 552 | Ga0207681_11240734 | 3300025923 | Bacteria | 626 |
| 553 | Ga0207694_10382450 | 3300025924 | Bacteria | 1168 |
| 554 | Ga0207694_11409509 | 3300025924 | Bacteria | 589 |
| 555 | Ga0207650_10002601 | 3300025925 | Bacteria | 12490 |
| 556 | Ga0207650_10070888 | 3300025925 | Bacteria | 2620 |
| 557 | Ga0207659_10110718 | 3300025926 | Bacteria | 2087 |
| 558 | Ga0207687_10018889 | 3300025927 | Bacteria | 4558 |
| 559 | Ga0207687_10066193 | 3300025927 | Bacteria | 2568 |
| 560 | Ga0207687_10137034 | 3300025927 | Bacteria | 1852 |
| 561 | Ga0207687_10157973 | 3300025927 | Bacteria | 1737 |
| 562 | Ga0207700_10125141 | 3300025928 | Bacteria | 2090 |
| 563 | Ga0207700_10237546 | 3300025928 | Bacteria | 1552 |
| 564 | Ga0207700_10241217 | 3300025928 | Bacteria | 1540 |
| 565 | Ga0207700_10326804 | 3300025928 | Bacteria | 1330 |
| 566 | Ga0207700_10362422 | 3300025928 | Bacteria | 1264 |
| 567 | Ga0207664_10003797 | 3300025929 | Bacteria | 10140 |
| 568 | Ga0207664_10745102 | 3300025929 | Bacteria | 881 |
| 569 | Ga0207644_10122681 | 3300025931 | Bacteria | 1980 |
| 570 | Ga0207644_10247582 | 3300025931 | Bacteria | 1421 |
| 571 | Ga0207644_10438543 | 3300025931 | Bacteria | 1072 |
| 572 | Ga0207644_10674083 | 3300025931 | Bacteria | 861 |
| 573 | Ga0207644_11012418 | 3300025931 | Bacteria | 697 |
| 574 | Ga0207690_10085492 | 3300025932 | Bacteria | 2214 |
| 575 | Ga0207706_10011066 | 3300025933 | Bacteria | 8223 |
| 576 | Ga0207706_10036752 | 3300025933 | Bacteria | 4350 |
| 577 | Ga0207706_10054486 | 3300025933 | Bacteria | 3529 |
| 578 | Ga0207706_11061708 | 3300025933 | Bacteria | 678 |
| 579 | Ga0207686_10094152 | 3300025934 | Bacteria | 1985 |
| 580 | Ga0207686_10204173 | 3300025934 | Bacteria | 1417 |
| 581 | Ga0207709_10932500 | 3300025935 | Bacteria | 707 |
| 582 | Ga0207670_10093638 | 3300025936 | Bacteria | 2129 |
| 583 | Ga0207669_10043599 | 3300025937 | Bacteria | 2628 |
| 584 | Ga0207669_11281898 | 3300025937 | Bacteria | 622 |
| 585 | Ga0207704_10053388 | 3300025938 | Bacteria | 2456 |
| 586 | Ga0207704_10960360 | 3300025938 | Bacteria | 721 |
| 587 | Ga0207665_10013036 | 3300025939 | Bacteria | 5464 |
| 588 | Ga0207665_10171960 | 3300025939 | Bacteria | 1565 |
| 589 | Ga0207665_10360131 | 3300025939 | Bacteria | 1100 |
| 590 | Ga0207691_10023624 | 3300025940 | Bacteria | 5789 |
| 591 | Ga0207691_10042886 | 3300025940 | Bacteria | 4170 |
| 592 | Ga0207691_10140532 | 3300025940 | Bacteria | 2128 |
| 593 | Ga0207691_10184237 | 3300025940 | Bacteria | 1823 |
| 594 | Ga0207711_10019696 | 3300025941 | Bacteria | 5618 |
| 595 | Ga0207711_11095509 | 3300025941 | Bacteria | 737 |
| 596 | Ga0207689_10013175 | 3300025942 | Bacteria | 7056 |
| 597 | Ga0207661_10001882 | 3300025944 | Bacteria | 14372 |
| 598 | Ga0207661_10007875 | 3300025944 | Bacteria | 7592 |
| 599 | Ga0207661_10842557 | 3300025944 | Bacteria | 844 |
| 600 | Ga0207661_11025764 | 3300025944 | Bacteria | 760 |
| 601 | Ga0207679_10301313 | 3300025945 | Bacteria | 1382 |
| 602 | Ga0207667_10011746 | 3300025949 | Bacteria | 10155 |
| 603 | Ga0207667_10068809 | 3300025949 | Bacteria | 3685 |
| 604 | Ga0207667_10233887 | 3300025949 | Bacteria | 1881 |
| 605 | Ga0207667_10423865 | 3300025949 | Bacteria | 1354 |
| 606 | Ga0207667_10618831 | 3300025949 | Bacteria | 1091 |
| 607 | Ga0207651_10022434 | 3300025960 | Bacteria | 3860 |
| 608 | Ga0207712_10013189 | 3300025961 | Bacteria | 5297 |
| 609 | Ga0207712_10123899 | 3300025961 | Bacteria | 1960 |
| 610 | Ga0207712_11409346 | 3300025961 | Bacteria | 624 |
| 611 | Ga0207668_10023026 | 3300025972 | Bacteria | 3996 |
| 612 | Ga0207668_10138499 | 3300025972 | Bacteria | 1868 |
| 613 | Ga0207668_10179233 | 3300025972 | Bacteria | 1669 |
| 614 | Ga0207668_10282630 | 3300025972 | Bacteria | 1361 |
| 615 | Ga0207668_11365385 | 3300025972 | Bacteria | 638 |
| 616 | Ga0207640_10102563 | 3300025981 | Bacteria | 2010 |
| 617 | Ga0207640_10111010 | 3300025981 | Bacteria | 1944 |
| 618 | Ga0207640_10555623 | 3300025981 | Bacteria | 965 |
| 619 | Ga0207658_10254686 | 3300025986 | Bacteria | 1493 |
| 620 | Ga0207658_10507851 | 3300025986 | Bacteria | 1074 |
| 621 | Ga0207677_10129019 | 3300026023 | Bacteria | 1916 |
| 622 | Ga0207703_10067309 | 3300026035 | Bacteria | 2947 |
| 623 | Ga0207703_10170577 | 3300026035 | Bacteria | 1913 |
| 624 | Ga0207703_11066605 | 3300026035 | Bacteria | 776 |
| 625 | Ga0207703_11067001 | 3300026035 | Bacteria | 775 |
| 626 | Ga0207639_10003831 | 3300026041 | Bacteria | 10137 |
| 627 | Ga0207639_10043257 | 3300026041 | Bacteria | 3381 |
| 628 | Ga0207639_10226608 | 3300026041 | Bacteria | 1617 |
| 629 | Ga0207639_10246384 | 3300026041 | Bacteria | 1556 |
| 630 | Ga0207639_10284636 | 3300026041 | Bacteria | 1455 |
| 631 | Ga0207639_10328155 | 3300026041 | Bacteria | 1361 |
| 632 | Ga0207639_10807629 | 3300026041 | Bacteria | 874 |
| 633 | Ga0207678_10009212 | 3300026067 | Bacteria | 8688 |
| 634 | Ga0207678_10010040 | 3300026067 | Bacteria | 8309 |
| 635 | Ga0207678_10012549 | 3300026067 | Bacteria | 7443 |
| 636 | Ga0207678_10056124 | 3300026067 | Bacteria | 3391 |
| 637 | Ga0207678_10148960 | 3300026067 | Bacteria | 1998 |
| 638 | Ga0207678_10247500 | 3300026067 | Bacteria | 1526 |
| 639 | Ga0207678_10401991 | 3300026067 | Bacteria | 1186 |
| 640 | Ga0207708_10001417 | 3300026075 | Bacteria | 17962 |
| 641 | Ga0207708_10071060 | 3300026075 | Bacteria | 2665 |
| 642 | Ga0207708_10074492 | 3300026075 | Bacteria | 2602 |
| 643 | Ga0207702_10244911 | 3300026078 | Bacteria | 1681 |
| 644 | Ga0207702_10514314 | 3300026078 | Bacteria | 1168 |
| 645 | Ga0207641_10670621 | 3300026088 | Bacteria | 1019 |
| 646 | Ga0207641_11274485 | 3300026088 | Bacteria | 735 |
| 647 | Ga0207648_10003456 | 3300026089 | Bacteria | 16569 |
| 648 | Ga0207648_10040258 | 3300026089 | Bacteria | 4107 |
| 649 | Ga0207648_11376965 | 3300026089 | Bacteria | 663 |
| 650 | Ga0207648_11499871 | 3300026089 | Bacteria | 634 |
| 651 | Ga0207676_10048873 | 3300026095 | Bacteria | 3286 |
| 652 | Ga0207676_10222358 | 3300026095 | Bacteria | 1682 |
| 653 | Ga0207676_10277471 | 3300026095 | Bacteria | 1520 |
| 654 | Ga0207676_11159217 | 3300026095 | Bacteria | 765 |
| 655 | Ga0207674_10070098 | 3300026116 | Bacteria | 3524 |
| 656 | Ga0207674_11069282 | 3300026116 | Bacteria | 776 |
| 657 | Ga0207675_100006895 | 3300026118 | Bacteria | 10761 |
| 658 | Ga0207675_100041152 | 3300026118 | Bacteria | 4315 |
| 659 | Ga0207675_100044665 | 3300026118 | Bacteria | 4141 |
| 660 | Ga0207675_100131130 | 3300026118 | Bacteria | 2377 |
| 661 | Ga0207675_100576068 | 3300026118 | Bacteria | 1127 |
| 662 | Ga0207675_101515866 | 3300026118 | Bacteria | 691 |
| 663 | Ga0207683_10034607 | 3300026121 | Bacteria | 4390 |
| 664 | Ga0207683_10035919 | 3300026121 | Bacteria | 4311 |
| 665 | Ga0207683_10036573 | 3300026121 | Bacteria | 4277 |
| 666 | Ga0207683_10098907 | 3300026121 | Bacteria | 2603 |
| 667 | Ga0207683_10151805 | 3300026121 | Bacteria | 2091 |
| 668 | Ga0207683_10277959 | 3300026121 | Bacteria | 1530 |
| 669 | Ga0207683_10629619 | 3300026121 | Bacteria | 994 |
| 670 | Ga0207698_10012596 | 3300026142 | Bacteria | 5541 |
| 671 | Ga0207698_10178467 | 3300026142 | Bacteria | 1878 |
| 672 | Ga0207698_10445823 | 3300026142 | Bacteria | 1248 |
| 673 | Ga0207698_10561113 | 3300026142 | Bacteria | 1121 |
| 674 | Ga0209389_1000076 | 3300027296 | Bacteria | 92447 |
| 675 | Ga0209589_1000017 | 3300027357 | Bacteria | 215546 |
| 676 | Ga0209489_100018 | 3300027361 | Bacteria | 215546 |
| 677 | Ga0209489_108247 | 3300027361 | Bacteria | 14478 |
| 678 | Ga0209700_100014 | 3300027363 | Bacteria | 299349 |
| 679 | Ga0209700_100028 | 3300027363 | Bacteria | 215546 |
| 680 | Ga0209179_1017211 | 3300027512 | Bacteria | 1367 |
| 681 | Ga0209179_1036362 | 3300027512 | Bacteria | 1026 |
| 682 | Ga0209588_1008658 | 3300027671 | Bacteria | 3021 |
| 683 | Ga0209813_10003889 | 3300027866 | Bacteria | 3535 |
| 684 | Ga0207428_10121533 | 3300027907 | Bacteria | 2002 |
| 685 | Ga0207428_10138284 | 3300027907 | Bacteria | 1861 |
| 686 | Ga0207428_10220298 | 3300027907 | Bacteria | 1422 |
| 687 | Ga0207428_11298634 | 3300027907 | Bacteria | 504 |
| 688 | Ga0268266_10001497 | 3300028379 | Bacteria | 27614 |
| 689 | Ga0268266_10003206 | 3300028379 | Bacteria | 16549 |
| 690 | Ga0268266_10144068 | 3300028379 | Bacteria | 2140 |
| 691 | Ga0268266_10338655 | 3300028379 | Bacteria | 1411 |
| 692 | Ga0268266_10750908 | 3300028379 | Bacteria | 941 |
| 693 | Ga0268266_10810563 | 3300028379 | Bacteria | 904 |
| 694 | Ga0268265_10049761 | 3300028380 | Bacteria | 3153 |
| 695 | Ga0268265_10056708 | 3300028380 | Bacteria | 2982 |
| 696 | Ga0268265_10324697 | 3300028380 | Bacteria | 1395 |
| 697 | Ga0268265_10653716 | 3300028380 | Bacteria | 1011 |
| 698 | Ga0268265_11242667 | 3300028380 | Bacteria | 743 |
| 699 | Ga0268264_10000187 | 3300028381 | Bacteria | 129270 |
| 700 | Ga0268264_10018605 | 3300028381 | Bacteria | 5679 |
| 701 | Ga0307517_10000066 | 3300028786 | Bacteria | 141370 |
| 702 | Ga0307517_10205126 | 3300028786 | Bacteria | 1225 |
| 703 | Ga0307515_10028181 | 3300028794 | Bacteria | 9556 |
| 704 | Ga0307515_10243883 | 3300028794 | Bacteria | 1562 |
| 705 | Ga0265338_10245230 | 3300028800 | Bacteria | 1324 |
| 706 | Ga0307511_10023569 | 3300030521 | Bacteria | 5733 |
| 707 | Ga0307511_10153032 | 3300030521 | Bacteria | 1318 |
| 708 | Ga0307512_10162610 | 3300030522 | Bacteria | 1303 |
| 709 | Ga0265760_10057896 | 3300031090 | Bacteria | 1174 |
| 710 | Ga0265332_10174372 | 3300031238 | Bacteria | 897 |
| 711 | Ga0265325_10058474 | 3300031241 | Bacteria | 1963 |
| 712 | Ga0265340_10024355 | 3300031247 | Bacteria | 3075 |
| 713 | Ga0265340_10402465 | 3300031247 | Bacteria | 604 |
| 714 | Ga0265339_10000069 | 3300031249 | Bacteria | 90219 |
| 715 | Ga0307513_10183304 | 3300031456 | Bacteria | 1954 |
| 716 | Ga0307513_10278109 | 3300031456 | Bacteria | 1453 |
| 717 | Ga0307513_10297608 | 3300031456 | Bacteria | 1382 |
| 718 | Ga0307509_10034527 | 3300031507 | Bacteria | 5556 |
| 719 | Ga0307408_100042411 | 3300031548 | Bacteria | 3232 |
| 720 | Ga0307408_100961785 | 3300031548 | Bacteria | 785 |
| 721 | Ga0265313_10000386 | 3300031595 | Bacteria | 47422 |
| 722 | Ga0307508_10175895 | 3300031616 | Bacteria | 1743 |
| 723 | Ga0307508_10183351 | 3300031616 | Bacteria | 1696 |
| 724 | Ga0307514_10427146 | 3300031649 | Bacteria | 663 |
| 725 | Ga0265314_10000439 | 3300031711 | Bacteria | 55613 |
| 726 | Ga0307516_10017467 | 3300031730 | Bacteria | 7479 |
| 727 | Ga0307516_10039368 | 3300031730 | Bacteria | 4712 |
| 728 | Ga0307516_10308489 | 3300031730 | Bacteria | 1256 |
| 729 | Ga0307405_10598580 | 3300031731 | Bacteria | 899 |
| 730 | Ga0307405_10826569 | 3300031731 | Bacteria | 778 |
| 731 | Ga0307413_10024522 | 3300031824 | Bacteria | 3290 |
| 732 | Ga0307410_10159378 | 3300031852 | Bacteria | 1689 |
| 733 | Ga0307410_11689174 | 3300031852 | Bacteria | 561 |
| 734 | Ga0307412_10057105 | 3300031911 | Bacteria | 2604 |
| 735 | Ga0307412_10145624 | 3300031911 | Bacteria | 1741 |
| 736 | Ga0307412_10341865 | 3300031911 | Bacteria | 1198 |
| 737 | Ga0307416_100512478 | 3300032002 | Bacteria | 1266 |
| 738 | Ga0307414_10656081 | 3300032004 | Bacteria | 946 |
| 739 | Ga0307415_100182625 | 3300032126 | Bacteria | 1647 |
| 740 | Ga0307507_10030087 | 3300033179 | Bacteria | 5736 |
| 741 | Ga0307510_10023148 | 3300033180 | Bacteria | 7207 |
| 742 | Ga0315911_1000033 | 3300033442 | Bacteria | 67159 |
| 743 | Ga0373926_0174533 | 3300035083 | Bacteria | 823 |
| 744 | Ga0373934_0084521 | 3300035086 | Bacteria | 1277 |
| 745 | Ga0373934_0129219 | 3300035086 | Bacteria | 1030 |
| 746 | Ga0373944_0116703 | 3300035089 | Bacteria | 916 |
| 747 | Ga0373944_0155764 | 3300035089 | Bacteria | 808 |
| 748 | Ga0373923_0014604 | 3300035111 | Bacteria | 2953 |
| 749 | Ga0373923_0340621 | 3300035111 | Bacteria | 715 |
| 750 | Ga0373936_0004895 | 3300035113 | Bacteria | 5049 |
| 751 | Ga0373936_0032420 | 3300035113 | Bacteria | 2066 |
| 752 | Ga0373939_0187585 | 3300035114 | Bacteria | 775 |
| 753 | Ga0373945_0019587 | 3300035116 | Bacteria | 2312 |
| 754 | Ga0373945_0037419 | 3300035116 | Bacteria | 1742 |
| 755 | Ga0373945_0106158 | 3300035116 | Bacteria | 1104 |
| 756 | Ga0373953_0001843 | 3300035117 | Bacteria | 6271 |
| 757 | Ga0373953_0250299 | 3300035117 | Bacteria | 770 |
| 758 | Ga0373954_0009761 | 3300035118 | Bacteria | 4227 |
| 759 | Ga0373954_0070743 | 3300035118 | Bacteria | 1658 |
| 760 | Ga0373954_0073176 | 3300035118 | Bacteria | 1630 |
| 761 | Ga0373954_0187073 | 3300035118 | Bacteria | 1016 |
| 762 | Ga0373954_0698591 | 3300035118 | Bacteria | 503 |
| 763 | Ga0373956_0135575 | 3300035119 | Bacteria | 1154 |
| 764 | Ga0373957_0020259 | 3300035120 | Bacteria | 2348 |
| 765 | Ga0373943_0001873 | 3300035170 | Bacteria | 9516 |
| 766 | Ga0373943_0009955 | 3300035170 | Bacteria | 4261 |
| 767 | Ga0373946_0002579 | 3300035171 | Bacteria | 6409 |
| 768 | Ga0373946_0035152 | 3300035171 | Bacteria | 2026 |
| 769 | Ga0373946_0186651 | 3300035171 | Bacteria | 987 |
| 770 | Ga0373955_0000087 | 3300035172 | Bacteria | 37402 |
| 771 | Ga0373955_0009214 | 3300035172 | Bacteria | 4618 |
| 772 | Ga0373955_0040125 | 3300035172 | Bacteria | 2501 |
| 773 | Ga0373955_0348138 | 3300035172 | Bacteria | 897 |
| 774 | Ga0373955_0724914 | 3300035172 | Bacteria | 610 |
| 775 | Ga0373942_0056891 | 3300035207 | Bacteria | 1111 |
| 776 | Ga0373961_0137895 | 3300035241 | Bacteria | 822 |
| 777 | Ga0373961_0173131 | 3300035241 | Bacteria | 748 |
| 778 | Ga0373924_0000324 | 3300035410 | Bacteria | 14673 |
| 779 | Ga0373924_0022632 | 3300035410 | Bacteria | 2457 |
| 780 | Ga0373931_0188606 | 3300035691 | Bacteria | 1225 |
| 781 | Ga0373931_0285100 | 3300035691 | Bacteria | 1015 |
| 782 | Ga0373931_0399189 | 3300035691 | Bacteria | 870 |
| 783 | Ga0373931_0811535 | 3300035691 | Bacteria | 624 |
| 784 | Ga0373935_0019260 | 3300035692 | Bacteria | 4162 |
| 785 | Ga0373935_0081412 | 3300035692 | Bacteria | 2105 |
| 786 | Ga0373935_0498432 | 3300035692 | Bacteria | 884 |
| 787 | Ga0373927_0005233 | 3300035695 | Bacteria | 8979 |
| 788 | Ga0373927_0012312 | 3300035695 | Bacteria | 5691 |
| 789 | Ga0373927_0022113 | 3300035695 | Bacteria | 4167 |
| 790 | Ga0373927_0034876 | 3300035695 | Bacteria | 3272 |
| 791 | Ga0373927_0043078 | 3300035695 | Bacteria | 2923 |
| 792 | Ga0373927_0046856 | 3300035695 | Bacteria | 2796 |
| 793 | Ga0373927_0111907 | 3300035695 | Bacteria | 1779 |
| 794 | Ga0373927_0418466 | 3300035695 | Bacteria | 884 |
| 795 | Ga0373927_1018130 | 3300035695 | Bacteria | 546 |
| 796 | Ga0373933_0007764 | 3300035724 | Bacteria | 5859 |
| 797 | Ga0373933_0014573 | 3300035724 | Bacteria | 4374 |
| 798 | Ga0373933_0388563 | 3300035724 | Bacteria | 909 |
| 799 | Ga0373947_0013251 | 3300035725 | Bacteria | 4724 |
| 800 | Ga0373947_0025730 | 3300035725 | Bacteria | 3432 |
| 801 | Ga0373947_0032870 | 3300035725 | Bacteria | 3060 |
| 802 | Ga0373947_0484254 | 3300035725 | Bacteria | 840 |
| 803 | Ga0373937_0000006 | 3300036401 | Bacteria | 194781 |
| 804 | Ga0373937_0019279 | 3300036401 | Bacteria | 6105 |
| 805 | Ga0373937_0021048 | 3300036401 | Bacteria | 5851 |
| 806 | Ga0373937_0344465 | 3300036401 | Bacteria | 1411 |
| 807 | Ga0373937_0574558 | 3300036401 | Bacteria | 1070 |
| 808 | Ga0373925_0000002 | 3300037068 | Bacteria | 368879 |
| 809 | Ga0373925_0025105 | 3300037068 | Bacteria | 4352 |
| 810 | Ga0373925_0079650 | 3300037068 | Bacteria | 2489 |
| 811 | Ga0373925_0287582 | 3300037068 | Bacteria | 1325 |
| 812 | Ga0373925_1480571 | 3300037068 | Bacteria | 556 |
| 813 | Ga0395899_0095878 | 3300037312 | Bacteria | 2146 |
| 814 | Ga0395900_0021672 | 3300037418 | Bacteria | 6569 |
| 815 | Ga0395900_0029051 | 3300037418 | Bacteria | 5671 |
| 816 | Ga0395900_1048587 | 3300037418 | Bacteria | 734 |
| 817 | Ga0395898_0027664 | 3300037466 | Bacteria | 5688 |
| 818 | Ga0395898_0220933 | 3300037466 | Bacteria | 1807 |
| 819 | Ga0395898_0442651 | 3300037466 | Bacteria | 1238 |
| 820 | Ga0395898_0865863 | 3300037466 | Bacteria | 842 |
| 821 | Ga0395905_0007000 | 3300037471 | Bacteria | 11273 |
| 822 | Ga0395905_0025550 | 3300037471 | Bacteria | 5569 |
| 823 | Ga0395905_0067233 | 3300037471 | Bacteria | 3357 |
| 824 | Ga0395905_0117155 | 3300037471 | Bacteria | 2503 |
| 825 | Ga0395905_0862894 | 3300037471 | Bacteria | 808 |
| 826 | Ga0436364_0037060 | 3300037853 | Bacteria | 1413 |
| 827 | Ga0436364_1045430 | 3300037853 | Bacteria | 1073 |
| 828 | Ga0436364_1133893 | 3300037853 | Bacteria | 3595 |
| 829 | Ga0395901_0045375 | 3300038443 | Bacteria | 4561 |
| 830 | Ga0395901_0121953 | 3300038443 | Bacteria | 2740 |
| 831 | Ga0395901_0208490 | 3300038443 | Bacteria | 2046 |
| 832 | Ga0395901_0544413 | 3300038443 | Bacteria | 1177 |
| 833 | Ga0436365_1167627 | 3300039437 | Bacteria | 975 |
| 834 | Ga0436365_1735497 | 3300039437 | Bacteria | 3540 |
| 835 | Ga0436365_1749409 | 3300039437 | Bacteria | 687 |
| 836 | Ga0436360_0863636 | 3300039438 | Bacteria | 1911 |
| 837 | Ga0436360_0962184 | 3300039438 | Bacteria | 1226 |
| 838 | Ga0436360_1149403 | 3300039438 | Bacteria | 911 |
| 839 | Ga0436361_0295849 | 3300039447 | Bacteria | 1104 |
| 840 | Ga0436361_0483823 | 3300039447 | Bacteria | 5857 |
| 841 | Ga0436361_0722741 | 3300039447 | Bacteria | 570 |
| 842 | Ga0436361_0934439 | 3300039447 | Bacteria | 1704 |
| 843 | Ga0436363_0935857 | 3300039450 | Bacteria | 987 |
| 844 | Ga0436363_1014075 | 3300039450 | Bacteria | 3887 |
| 845 | Ga0436363_1035293 | 3300039450 | Bacteria | 14114 |
| 846 | Ga0436363_1632085 | 3300039450 | Bacteria | 773 |
| 847 | Ga0436362_1188241 | 3300039453 | Bacteria | 739 |
| 848 | Ga0439465_0079935 | 3300041413 | Bacteria | 1107 |
| 849 | Ga0451793_0264920 | 3300041452 | Bacteria | 1516 |
| 850 | Ga0451793_0741245 | 3300041452 | Bacteria | 655 |
| 851 | Ga0451798_0486087 | 3300041458 | Bacteria | 671 |
| 852 | Ga0451802_0958539 | 3300041460 | Bacteria | 851 |
| 853 | Ga0451802_2060284 | 3300041460 | Bacteria | 814 |
| 854 | Ga0451835_0850209 | 3300041492 | Bacteria | 868 |
| 855 | Ga0451853_0710420 | 3300041512 | Bacteria | 569 |
| 856 | Ga0451853_1645550 | 3300041512 | Bacteria | 815 |
| 857 | Ga0451853_1941107 | 3300041512 | Bacteria | 1083 |
| 858 | Ga0439431_0009109 | 3300041997 | Bacteria | 2238 |
| 859 | Ga0439441_124859 | 3300042001 | Bacteria | 593 |
| 860 | Ga0450923_017676 | 3300042125 | Bacteria | 1357 |
| 861 | Ga0439458_0008335 | 3300042157 | Bacteria | 2307 |
| 862 | Ga0439459_0116366 | 3300042438 | Bacteria | 669 |
| 863 | Ga0439464_0100755 | 3300042439 | Bacteria | 878 |
| 864 | Ga0466969_0104606 | 3300044656 | Bacteria | 1330 |
| 865 | Ga0466972_0000048 | 3300044658 | Bacteria | 119165 |
| 866 | Ga0466965_0138547 | 3300044683 | Bacteria | 1265 |
| 867 | Ga0466966_0001825 | 3300044684 | Bacteria | 13815 |
| 868 | Ga0466961_0000010 | 3300044693 | Bacteria | 137550 |
| 869 | Ga0466961_0061354 | 3300044693 | Bacteria | 2390 |
| 870 | Ga0466961_0691196 | 3300044693 | Bacteria | 611 |
| 871 | Ga0466963_0060666 | 3300044694 | Bacteria | 2526 |
| 872 | Ga0466968_0015512 | 3300044735 | Bacteria | 3020 |
| 873 | Ga0466968_0411037 | 3300044735 | Bacteria | 664 |
| 874 | Ga0466968_0546284 | 3300044735 | Bacteria | 581 |
| 875 | Ga0466970_0150202 | 3300044765 | Bacteria | 1286 |
| 876 | Ga0466970_0174907 | 3300044765 | Bacteria | 1190 |
| 877 | Ga0466970_0574375 | 3300044765 | Bacteria | 653 |
| 878 | Ga0466960_0023636 | 3300044901 | Bacteria | 2761 |
| 879 | Ga0466960_0094672 | 3300044901 | Bacteria | 1528 |
| 880 | Ga0466959_0001429 | 3300045049 | Bacteria | 14620 |
| 881 | Ga0466959_0018716 | 3300045049 | Bacteria | 5087 |
| 882 | Ga0466959_1140802 | 3300045049 | Bacteria | 518 |
| 883 | Ga0466958_0209756 | 3300045836 | Bacteria | 1241 |
| 884 | Ga0466958_0453984 | 3300045836 | Bacteria | 830 |
| 885 | Ga0466967_0084723 | 3300045976 | Bacteria | 2868 |
| 886 | Ga0466967_0130651 | 3300045976 | Bacteria | 2331 |
| 887 | Ga0466967_0173249 | 3300045976 | Bacteria | 2031 |
| 888 | Ga0466967_0191337 | 3300045976 | Bacteria | 1934 |
| 889 | Ga0466967_0587556 | 3300045976 | Bacteria | 1098 |
| 890 | Ga0495617_022289 | 3300046452 | Bacteria | 2141 |
| 891 | Ga0495592_0000039 | 3300046454 | Bacteria | 124471 |
| 892 | Ga0495603_0051969 | 3300046455 | Bacteria | 2434 |
| 893 | Ga0495603_0075019 | 3300046455 | Bacteria | 1986 |
| 894 | Ga0495603_0157955 | 3300046455 | Bacteria | 1316 |
| 895 | Ga0495603_0207689 | 3300046455 | Bacteria | 1131 |
| 896 | Ga0495603_0560032 | 3300046455 | Bacteria | 654 |
| 897 | Ga0495629_0003335 | 3300046459 | Bacteria | 12135 |
| 898 | Ga0495629_0036410 | 3300046459 | Bacteria | 3473 |
| 899 | Ga0495629_0158978 | 3300046459 | Bacteria | 1570 |
| 900 | Ga0495638_0021343 | 3300046460 | Bacteria | 4270 |
| 901 | Ga0495638_0163599 | 3300046460 | Bacteria | 1282 |
| 902 | Ga0495638_0546485 | 3300046460 | Bacteria | 576 |
| 903 | Ga0495641_0295703 | 3300046461 | Bacteria | 730 |
| 904 | Ga0495651_0000420 | 3300046462 | Bacteria | 32886 |
| 905 | Ga0495651_0366299 | 3300046462 | Bacteria | 948 |
| 906 | Ga0495653_0000006 | 3300046463 | Bacteria | 363285 |
| 907 | Ga0495653_0041475 | 3300046463 | Bacteria | 3592 |
| 908 | Ga0495653_0407255 | 3300046463 | Bacteria | 863 |
| 909 | Ga0495650_0068534 | 3300046471 | Bacteria | 1399 |
| 910 | Ga0495580_0078460 | 3300046472 | Bacteria | 2303 |
| 911 | Ga0495580_0153692 | 3300046472 | Bacteria | 1594 |
| 912 | Ga0495580_0271641 | 3300046472 | Bacteria | 1158 |
| 913 | Ga0495582_0027180 | 3300046473 | Bacteria | 3135 |
| 914 | Ga0495605_0034235 | 3300046474 | Bacteria | 2573 |
| 915 | Ga0495605_0092174 | 3300046474 | Bacteria | 1403 |
| 916 | Ga0495605_0251872 | 3300046474 | Bacteria | 755 |
| 917 | Ga0495639_0012056 | 3300046475 | Bacteria | 3727 |
| 918 | Ga0495639_0025212 | 3300046475 | Bacteria | 2622 |
| 919 | Ga0495639_0150935 | 3300046475 | Bacteria | 1121 |
| 920 | Ga0495662_0000902 | 3300046476 | Bacteria | 14508 |
| 921 | Ga0495662_0023798 | 3300046476 | Bacteria | 2958 |
| 922 | Ga0495662_0070029 | 3300046476 | Bacteria | 1699 |
| 923 | Ga0495664_0000002 | 3300046477 | Bacteria | 625183 |
| 924 | Ga0495664_0008426 | 3300046477 | Bacteria | 5754 |
| 925 | Ga0495584_0047627 | 3300046491 | Bacteria | 2162 |
| 926 | Ga0495584_0074774 | 3300046491 | Bacteria | 1703 |
| 927 | Ga0495584_0076532 | 3300046491 | Bacteria | 1683 |
| 928 | Ga0495585_0279377 | 3300046492 | Bacteria | 826 |
| 929 | Ga0495585_0415052 | 3300046492 | Bacteria | 647 |
| 930 | Ga0495594_0228725 | 3300046499 | Bacteria | 1060 |
| 931 | Ga0495594_0679336 | 3300046499 | Bacteria | 582 |
| 932 | Ga0495607_0058480 | 3300046501 | Bacteria | 2203 |
| 933 | Ga0495583_0085220 | 3300046506 | Bacteria | 1368 |
| 934 | Ga0495606_0260689 | 3300046507 | Bacteria | 957 |
| 935 | Ga0495608_0000009 | 3300046511 | Bacteria | 266614 |
| 936 | Ga0495608_0144852 | 3300046511 | Bacteria | 1515 |
| 937 | Ga0495608_0333098 | 3300046511 | Bacteria | 936 |
| 938 | Ga0495608_0400685 | 3300046511 | Bacteria | 839 |
| 939 | Ga0495610_0052428 | 3300046512 | Bacteria | 1980 |
| 940 | Ga0495610_0150081 | 3300046512 | Bacteria | 995 |
| 941 | Ga0495616_0026359 | 3300046513 | Bacteria | 3095 |
| 942 | Ga0495616_0200356 | 3300046513 | Bacteria | 878 |
| 943 | Ga0495618_0000005 | 3300046514 | Bacteria | 230421 |
| 944 | Ga0495618_0204992 | 3300046514 | Bacteria | 1247 |
| 945 | Ga0495618_0318103 | 3300046514 | Bacteria | 964 |
| 946 | Ga0495618_0341197 | 3300046514 | Bacteria | 925 |
| 947 | Ga0495618_0362495 | 3300046514 | Bacteria | 892 |
| 948 | Ga0495620_0079093 | 3300046515 | Bacteria | 1332 |
| 949 | Ga0495628_0000002 | 3300046516 | Bacteria | 589399 |
| 950 | Ga0495628_0071172 | 3300046516 | Bacteria | 2711 |
| 951 | Ga0495628_0162538 | 3300046516 | Bacteria | 1696 |
| 952 | Ga0495630_0000865 | 3300046517 | Bacteria | 21326 |
| 953 | Ga0495630_0051956 | 3300046517 | Bacteria | 3068 |
| 954 | Ga0495630_0339656 | 3300046517 | Bacteria | 1149 |
| 955 | Ga0495631_0013951 | 3300046518 | Bacteria | 3886 |
| 956 | Ga0495631_0210660 | 3300046518 | Bacteria | 830 |
| 957 | Ga0495631_0229205 | 3300046518 | Bacteria | 792 |
| 958 | Ga0495632_0022096 | 3300046519 | Bacteria | 3416 |
| 959 | Ga0495632_0189658 | 3300046519 | Bacteria | 939 |
| 960 | Ga0495637_0121236 | 3300046520 | Bacteria | 1006 |
| 961 | Ga0495643_0014364 | 3300046522 | Bacteria | 4712 |
| 962 | Ga0495643_0222249 | 3300046522 | Bacteria | 895 |
| 963 | Ga0495644_0009734 | 3300046523 | Bacteria | 3701 |
| 964 | Ga0495648_0000581 | 3300046524 | Bacteria | 39115 |
| 965 | Ga0495648_0056213 | 3300046524 | Bacteria | 2368 |
| 966 | Ga0495666_0163386 | 3300046526 | Bacteria | 1032 |
| 967 | Ga0495666_0202210 | 3300046526 | Bacteria | 913 |
| 968 | Ga0495652_0000004 | 3300046529 | Bacteria | 588877 |
| 969 | Ga0495652_0063438 | 3300046529 | Bacteria | 3110 |
| 970 | Ga0495652_0116012 | 3300046529 | Bacteria | 2145 |
| 971 | Ga0495652_1066318 | 3300046529 | Bacteria | 526 |
| 972 | Ga0495654_0074136 | 3300046530 | Bacteria | 1608 |
| 973 | Ga0495654_0128388 | 3300046530 | Bacteria | 1140 |
| 974 | Ga0495665_0082870 | 3300046531 | Bacteria | 1686 |
| 975 | Ga0495665_0134275 | 3300046531 | Bacteria | 1295 |
| 976 | Ga0495665_0135993 | 3300046531 | Bacteria | 1285 |
| 977 | Ga0495640_0000005 | 3300046533 | Bacteria | 318271 |
| 978 | Ga0495640_0028545 | 3300046533 | Bacteria | 4016 |
| 979 | Ga0495640_0323139 | 3300046533 | Bacteria | 955 |
| 980 | Ga0495586_0601236 | 3300046535 | Bacteria | 635 |
| 981 | Ga0495587_0000007 | 3300046536 | Bacteria | 290788 |
| 982 | Ga0495598_0160184 | 3300046537 | Bacteria | 791 |
| 983 | Ga0495609_0105005 | 3300046538 | Bacteria | 1222 |
| 984 | Ga0495609_0167390 | 3300046538 | Bacteria | 929 |
| 985 | Ga0495609_0330708 | 3300046538 | Bacteria | 617 |
| 986 | Ga0495621_0043019 | 3300046539 | Bacteria | 1592 |
| 987 | Ga0495645_0000003 | 3300046543 | Bacteria | 570133 |
| 988 | Ga0495645_0314421 | 3300046543 | Bacteria | 1019 |
| 989 | Ga0495622_0009840 | 3300046557 | Bacteria | 4422 |
| 990 | Ga0495622_0044248 | 3300046557 | Bacteria | 2069 |
| 991 | Ga0495633_0266823 | 3300046558 | Bacteria | 780 |
| 992 | Ga0495667_0000002 | 3300046559 | Bacteria | 437535 |
| 993 | Ga0495667_0041062 | 3300046559 | Bacteria | 3069 |
| 994 | Ga0495667_0080819 | 3300046559 | Bacteria | 2113 |
| 995 | Ga0495656_0064619 | 3300046615 | Bacteria | 1607 |
| 996 | Ga0495668_0019526 | 3300046616 | Bacteria | 3905 |
| 997 | Ga0495668_0153539 | 3300046616 | Bacteria | 1261 |
| 998 | Ga0495668_0428804 | 3300046616 | Bacteria | 727 |
| 999 | Ga0495668_0524465 | 3300046616 | Bacteria | 653 |
| 1000 | Ga0495634_0000022 | 3300046642 | Bacteria | 118988 |
| 1001 | Ga0495634_0027017 | 3300046642 | Bacteria | 3998 |
| 1002 | Ga0495634_0106852 | 3300046642 | Bacteria | 1803 |
| 1003 | Ga0495634_0295407 | 3300046642 | Bacteria | 981 |
| 1004 | Ga0495611_0421801 | 3300046648 | Bacteria | 609 |
| 1005 | Ga0495625_0214820 | 3300046660 | Bacteria | 1263 |
| 1006 | Ga0495625_0669228 | 3300046660 | Bacteria | 616 |
| 1007 | Ga0495635_0000020 | 3300046663 | Bacteria | 189698 |
| 1008 | Ga0495635_0139403 | 3300046663 | Bacteria | 1652 |
| 1009 | Ga0495635_0345915 | 3300046663 | Bacteria | 992 |
| 1010 | Ga0495659_0089483 | 3300046664 | Bacteria | 1180 |
| 1011 | Ga0495661_0046551 | 3300046665 | Bacteria | 2647 |
| 1012 | Ga0495661_0071177 | 3300046665 | Bacteria | 2033 |
| 1013 | Ga0495588_0001128 | 3300046674 | Bacteria | 11514 |
| 1014 | Ga0495657_0005933 | 3300046675 | Bacteria | 9598 |
| 1015 | Ga0495657_0151728 | 3300046675 | Bacteria | 1438 |
| 1016 | Ga0495599_0000001 | 3300046678 | Bacteria | 537563 |
| 1017 | Ga0495623_0000001 | 3300046679 | Bacteria | 313861 |
| 1018 | Ga0495623_0279726 | 3300046679 | Bacteria | 929 |
| 1019 | Ga0495646_0000013 | 3300046680 | Bacteria | 159700 |
| 1020 | Ga0495646_0333880 | 3300046680 | Bacteria | 796 |
| 1021 | Ga0495647_0057606 | 3300046681 | Bacteria | 1526 |
| 1022 | Ga0495647_0066275 | 3300046681 | Bacteria | 1436 |
| 1023 | Ga0495658_0006871 | 3300046683 | Bacteria | 5609 |
| 1024 | Ga0495658_0099679 | 3300046683 | Bacteria | 1732 |
| 1025 | Ga0495669_0010706 | 3300046684 | Bacteria | 3880 |
| 1026 | Ga0495669_0134825 | 3300046684 | Bacteria | 1164 |
| 1027 | Ga0495613_0008762 | 3300046689 | Bacteria | 7503 |
| 1028 | Ga0495613_0164148 | 3300046689 | Bacteria | 1579 |
| 1029 | Ga0495624_0027286 | 3300046690 | Bacteria | 3739 |
| 1030 | Ga0495624_0104910 | 3300046690 | Bacteria | 1739 |
| 1031 | Ga0495624_0119842 | 3300046690 | Bacteria | 1616 |
| 1032 | Ga0495624_0246240 | 3300046690 | Bacteria | 1081 |
| 1033 | Ga0495670_0174025 | 3300046691 | Bacteria | 1134 |
| 1034 | Ga0495670_0208396 | 3300046691 | Bacteria | 1036 |
| 1035 | Ga0495600_0000006 | 3300046809 | Bacteria | 151916 |
| 1036 | Ga0495600_0050180 | 3300046809 | Bacteria | 2723 |
| 1037 | Ga0495600_0545247 | 3300046809 | Bacteria | 709 |
| 1038 | Ga0495581_0201426 | 3300047315 | Bacteria | 1164 |
| 1039 | Ga0495581_0432674 | 3300047315 | Bacteria | 767 |
| 1040 | Ga0495604_0000005 | 3300047317 | Bacteria | 424516 |
| 1041 | Ga0495674_0000003 | 3300047319 | Bacteria | 562126 |
| 1042 | Ga0495674_0026763 | 3300047319 | Bacteria | 5275 |
| 1043 | Ga0495674_0029755 | 3300047319 | Bacteria | 4969 |
| 1044 | Ga0495674_0301755 | 3300047319 | Bacteria | 1308 |
| 1045 | Ga0495672_0073646 | 3300047320 | Bacteria | 1925 |
| 1046 | Ga0495672_0120039 | 3300047320 | Bacteria | 1399 |
| 1047 | Ga0495672_0142437 | 3300047320 | Bacteria | 1251 |
| 1048 | Ga0495676_0043345 | 3300047321 | Bacteria | 3684 |
| 1049 | Ga0495676_0196698 | 3300047321 | Bacteria | 1403 |
| 1050 | Ga0495676_0234846 | 3300047321 | Bacteria | 1258 |
| 1051 | Ga0495676_0316426 | 3300047321 | Bacteria | 1049 |
| 1052 | Ga0495680_0000002 | 3300047322 | Bacteria | 197533 |
| 1053 | Ga0495680_0020201 | 3300047322 | Bacteria | 5610 |
| 1054 | Ga0495680_0763443 | 3300047322 | Bacteria | 634 |
| 1055 | Ga0495675_0000010 | 3300047444 | Bacteria | 153375 |
| 1056 | Ga0495685_160498 | 3300047447 | Bacteria | 728 |
| 1057 | Ga0495673_0070442 | 3300047469 | Bacteria | 1472 |
| 1058 | Ga0495681_0032111 | 3300047470 | Bacteria | 2647 |
| 1059 | Ga0495681_0134698 | 3300047470 | Bacteria | 1049 |
| 1060 | Ga0495684_0000028 | 3300047471 | Bacteria | 123549 |
| 1061 | Ga0495684_0017374 | 3300047471 | Bacteria | 5537 |
| 1062 | Ga0495684_0203669 | 3300047471 | Bacteria | 1458 |
| 1063 | Ga0495686_0039649 | 3300047472 | Bacteria | 3007 |
| 1064 | Ga0495686_0466041 | 3300047472 | Bacteria | 669 |
| 1065 | Ga0495593_0002430 | 3300047673 | Bacteria | 11194 |
| 1066 | Ga0495593_0099474 | 3300047673 | Bacteria | 1493 |
| 1067 | Ga0495593_0110371 | 3300047673 | Bacteria | 1405 |
| 1068 | Ga0495593_0141895 | 3300047673 | Bacteria | 1217 |
| 1069 | Ga0495602_0000054 | 3300048088 | Bacteria | 111411 |
| 1070 | Ga0495602_0037475 | 3300048088 | Bacteria | 4500 |
| 1071 | Ga0495614_0161126 | 3300048089 | Bacteria | 1004 |
| 1072 | Ga0496100_0044814 | 3300048903 | Bacteria | 2835 |
| 1073 | Ga0496100_0106898 | 3300048903 | Bacteria | 1937 |
| 1074 | Ga0496100_0209770 | 3300048903 | Bacteria | 1424 |
| 1075 | Ga0496101_0005169 | 3300048904 | Bacteria | 8301 |
| 1076 | Ga0496101_0015900 | 3300048904 | Bacteria | 5077 |
| 1077 | Ga0496101_0080527 | 3300048904 | Bacteria | 2406 |
| 1078 | Ga0496101_0194710 | 3300048904 | Bacteria | 1565 |
| 1079 | Ga0496101_0623813 | 3300048904 | Bacteria | 852 |
| 1080 | Ga0496101_0974203 | 3300048904 | Bacteria | 667 |
| 1081 | Ga0496101_1073095 | 3300048904 | Bacteria | 633 |
| 1082 | Ga0496102_0016269 | 3300048905 | Bacteria | 6499 |
| 1083 | Ga0496102_0017625 | 3300048905 | Bacteria | 6258 |
| 1084 | Ga0496102_0038023 | 3300048905 | Bacteria | 4341 |
| 1085 | Ga0496102_0108889 | 3300048905 | Bacteria | 2581 |
| 1086 | Ga0496102_0148571 | 3300048905 | Bacteria | 2200 |
| 1087 | Ga0496102_0204221 | 3300048905 | Bacteria | 1863 |
| 1088 | Ga0496102_0288805 | 3300048905 | Bacteria | 1546 |
| 1089 | Ga0496102_0336023 | 3300048905 | Bacteria | 1423 |
| 1090 | Ga0496102_0663230 | 3300048905 | Bacteria | 966 |
| 1091 | Ga0496103_0008958 | 3300048906 | Bacteria | 5932 |
| 1092 | Ga0496103_0038987 | 3300048906 | Bacteria | 2918 |
| 1093 | Ga0496103_0241722 | 3300048906 | Bacteria | 1162 |
| 1094 | Ga0496103_0557481 | 3300048906 | Bacteria | 731 |
| 1095 | Ga0496103_0705397 | 3300048906 | Bacteria | 639 |
| 1096 | Ga0496104_0000752 | 3300048907 | Bacteria | 27722 |
| 1097 | Ga0496104_0001154 | 3300048907 | Bacteria | 22630 |
| 1098 | Ga0496104_0014659 | 3300048907 | Bacteria | 7081 |
| 1099 | Ga0496104_0087718 | 3300048907 | Bacteria | 2971 |
| 1100 | Ga0496104_0093172 | 3300048907 | Bacteria | 2881 |
| 1101 | Ga0496104_0482804 | 3300048907 | Bacteria | 1150 |
| 1102 | Ga0496104_0488081 | 3300048907 | Bacteria | 1143 |
| 1103 | Ga0496105_0002078 | 3300048908 | Bacteria | 14498 |
| 1104 | Ga0496105_0021814 | 3300048908 | Bacteria | 5185 |
| 1105 | Ga0496105_0036926 | 3300048908 | Bacteria | 4025 |
| 1106 | Ga0496105_0057525 | 3300048908 | Bacteria | 3210 |
| 1107 | Ga0496106_0004854 | 3300048909 | Bacteria | 9951 |
| 1108 | Ga0496106_0012780 | 3300048909 | Bacteria | 6199 |
| 1109 | Ga0496106_0014933 | 3300048909 | Bacteria | 5744 |
| 1110 | Ga0496106_0018287 | 3300048909 | Bacteria | 5180 |
| 1111 | Ga0496106_0033800 | 3300048909 | Bacteria | 3817 |
| 1112 | Ga0496106_0079035 | 3300048909 | Bacteria | 2525 |
| 1113 | Ga0496106_0251061 | 3300048909 | Bacteria | 1414 |
| 1114 | Ga0496106_0380576 | 3300048909 | Bacteria | 1134 |
| 1115 | Ga0496106_0802771 | 3300048909 | Bacteria | 746 |
| 1116 | Ga0496107_0002063 | 3300048910 | Bacteria | 12844 |
| 1117 | Ga0496107_0012286 | 3300048910 | Bacteria | 5976 |
| 1118 | Ga0496107_0026111 | 3300048910 | Bacteria | 4140 |
| 1119 | Ga0496107_0115169 | 3300048910 | Bacteria | 1978 |
| 1120 | Ga0496107_0124807 | 3300048910 | Bacteria | 1898 |
| 1121 | Ga0496107_0170103 | 3300048910 | Bacteria | 1617 |
| 1122 | Ga0496107_0255689 | 3300048910 | Bacteria | 1303 |
| 1123 | Ga0496107_0327407 | 3300048910 | Bacteria | 1140 |
| 1124 | Ga0496107_0736800 | 3300048910 | Bacteria | 724 |
| 1125 | Ga0496107_0989747 | 3300048910 | Bacteria | 610 |
| 1126 | Ga0496108_0000847 | 3300048911 | Bacteria | 23809 |
| 1127 | Ga0496108_0021993 | 3300048911 | Bacteria | 5242 |
| 1128 | Ga0496108_0073171 | 3300048911 | Bacteria | 2894 |
| 1129 | Ga0496108_0173275 | 3300048911 | Bacteria | 1867 |
| 1130 | Ga0496108_0369280 | 3300048911 | Bacteria | 1252 |
| 1131 | Ga0496108_0532210 | 3300048911 | Bacteria | 1026 |
| 1132 | Ga0496108_1031379 | 3300048911 | Bacteria | 701 |
| 1133 | Ga0496109_0007107 | 3300048912 | Bacteria | 9451 |
| 1134 | Ga0496109_0113994 | 3300048912 | Bacteria | 2514 |
| 1135 | Ga0496109_0123051 | 3300048912 | Bacteria | 2417 |
| 1136 | Ga0496109_0302108 | 3300048912 | Bacteria | 1509 |
| 1137 | Ga0496109_1612343 | 3300048912 | Bacteria | 583 |
| 1138 | Ga0496110_0002115 | 3300048913 | Bacteria | 14831 |
| 1139 | Ga0496110_0041272 | 3300048913 | Bacteria | 4025 |
| 1140 | Ga0496110_0043021 | 3300048913 | Bacteria | 3943 |
| 1141 | Ga0496110_0053050 | 3300048913 | Bacteria | 3563 |
| 1142 | Ga0496110_0150948 | 3300048913 | Bacteria | 2104 |
| 1143 | Ga0496111_0007131 | 3300048914 | Bacteria | 7302 |
| 1144 | Ga0496111_0020057 | 3300048914 | Bacteria | 4649 |
| 1145 | Ga0496112_0001693 | 3300048915 | Bacteria | 17188 |
| 1146 | Ga0496112_0084820 | 3300048915 | Bacteria | 3133 |
| 1147 | Ga0496112_0117488 | 3300048915 | Bacteria | 2630 |
| 1148 | Ga0496112_0189517 | 3300048915 | Bacteria | 2019 |
| 1149 | Ga0496112_0834535 | 3300048915 | Bacteria | 845 |
| 1150 | Ga0496112_0869243 | 3300048915 | Bacteria | 824 |
| 1151 | Ga0496113_0000309 | 3300048916 | Bacteria | 23203 |
| 1152 | Ga0496113_0008991 | 3300048916 | Bacteria | 6540 |
| 1153 | Ga0496113_0030517 | 3300048916 | Bacteria | 3903 |
| 1154 | Ga0496113_0069199 | 3300048916 | Bacteria | 2680 |
| 1155 | Ga0496113_0242764 | 3300048916 | Bacteria | 1437 |
| 1156 | Ga0496113_0276843 | 3300048916 | Bacteria | 1341 |
| 1157 | Ga0496114_0019710 | 3300048917 | Bacteria | 5467 |
| 1158 | Ga0496114_0022294 | 3300048917 | Bacteria | 5160 |
| 1159 | Ga0496114_0777175 | 3300048917 | Bacteria | 836 |
| 1160 | Ga0496114_1245459 | 3300048917 | Bacteria | 630 |
| 1161 | Ga0496115_0001756 | 3300048918 | Bacteria | 15546 |
| 1162 | Ga0496115_0066765 | 3300048918 | Bacteria | 2907 |
| 1163 | Ga0496115_0296817 | 3300048918 | Bacteria | 1324 |
| 1164 | Ga0496115_0818717 | 3300048918 | Bacteria | 723 |
| 1165 | Ga0496116_0012076 | 3300048919 | Bacteria | 7079 |
| 1166 | Ga0496116_0225339 | 3300048919 | Bacteria | 956 |
| 1167 | Ga0496117_0010737 | 3300048920 | Bacteria | 8281 |
| 1168 | Ga0496117_0096648 | 3300048920 | Bacteria | 1884 |
| 1169 | Ga0496117_0178790 | 3300048920 | Bacteria | 1222 |
| 1170 | Ga0496118_0002489 | 3300048921 | Bacteria | 24727 |
| 1171 | Ga0496118_0059097 | 3300048921 | Bacteria | 2858 |
| 1172 | Ga0496118_0089003 | 3300048921 | Bacteria | 2133 |
| 1173 | Ga0496118_0177019 | 3300048921 | Bacteria | 1294 |
| 1174 | Ga0496118_0341886 | 3300048921 | Bacteria | 801 |
| 1175 | Ga0496118_0515077 | 3300048921 | Bacteria | 591 |
| 1176 | Ga0496119_0036141 | 3300048922 | Bacteria | 3228 |
| 1177 | Ga0496119_0037643 | 3300048922 | Bacteria | 3139 |
| 1178 | Ga0496120_0016036 | 3300048923 | Bacteria | 4912 |
| 1179 | Ga0496121_0000144 | 3300048924 | Bacteria | 156856 |
| 1180 | Ga0496121_0000596 | 3300048924 | Bacteria | 67893 |
| 1181 | Ga0496121_0004090 | 3300048924 | Bacteria | 20025 |
| 1182 | Ga0496121_0017154 | 3300048924 | Bacteria | 7416 |
| 1183 | Ga0496121_0126534 | 3300048924 | Bacteria | 1919 |
| 1184 | Ga0496121_0196510 | 3300048924 | Bacteria | 1441 |
| 1185 | Ga0496121_0286923 | 3300048924 | Bacteria | 1123 |
| 1186 | Ga0496121_0387643 | 3300048924 | Bacteria | 919 |
| 1187 | Ga0496121_0463086 | 3300048924 | Bacteria | 814 |
| 1188 | Ga0496121_0806264 | 3300048924 | Bacteria | 551 |
| 1189 | Ga0496122_0027842 | 3300048925 | Bacteria | 4819 |
| 1190 | Ga0496122_0063040 | 3300048925 | Bacteria | 2709 |
| 1191 | Ga0496122_0427139 | 3300048925 | Bacteria | 664 |
| 1192 | Ga0496123_0129758 | 3300048926 | Bacteria | 1399 |
| 1193 | Ga0496123_0204426 | 3300048926 | Bacteria | 1009 |
| 1194 | Ga0496124_0002408 | 3300048927 | Bacteria | 24540 |
| 1195 | Ga0496124_0053794 | 3300048927 | Bacteria | 3410 |
| 1196 | Ga0496124_0069113 | 3300048927 | Bacteria | 2933 |
| 1197 | Ga0496124_0077908 | 3300048927 | Bacteria | 2733 |
| 1198 | Ga0496124_0370832 | 3300048927 | Bacteria | 1005 |
| 1199 | Ga0496125_0003506 | 3300048928 | Bacteria | 18947 |
| 1200 | Ga0496125_0114942 | 3300048928 | Bacteria | 1937 |
| 1201 | Ga0496125_0116128 | 3300048928 | Bacteria | 1923 |
| 1202 | Ga0496125_0367578 | 3300048928 | Bacteria | 853 |
| 1203 | Ga0496126_0007999 | 3300048929 | Bacteria | 11480 |
| 1204 | Ga0496126_0011286 | 3300048929 | Bacteria | 9268 |
| 1205 | Ga0496126_0012837 | 3300048929 | Bacteria | 8561 |
| 1206 | Ga0496126_0021277 | 3300048929 | Bacteria | 6338 |
| 1207 | Ga0496126_0034894 | 3300048929 | Bacteria | 4718 |
| 1208 | Ga0496126_0124028 | 3300048929 | Bacteria | 2237 |
| 1209 | Ga0496126_0135771 | 3300048929 | Bacteria | 2122 |
| 1210 | Ga0496126_0577353 | 3300048929 | Bacteria | 889 |
| 1211 | Ga0495678_164239 | 3300049459 | Bacteria | 707 |
| 1212 | Ga0501031_0000377 | 3300049568 | Bacteria | 26157 |
| 1213 | Ga0501031_0145879 | 3300049568 | Bacteria | 1546 |
| 1214 | Ga0501031_0168619 | 3300049568 | Bacteria | 1430 |
| 1215 | Ga0501031_0239138 | 3300049568 | Bacteria | 1180 |
| 1216 | Ga0501032_0000040 | 3300049569 | Bacteria | 115662 |
| 1217 | Ga0501032_0037362 | 3300049569 | Bacteria | 3312 |
| 1218 | Ga0501032_0052204 | 3300049569 | Bacteria | 2755 |
| 1219 | Ga0501032_0067661 | 3300049569 | Bacteria | 2385 |
| 1220 | Ga0501032_0558656 | 3300049569 | Bacteria | 729 |
| 1221 | Ga0501032_0877503 | 3300049569 | Bacteria | 565 |
| 1222 | Ga0501033_0000128 | 3300049570 | Bacteria | 73419 |
| 1223 | Ga0501033_0011352 | 3300049570 | Bacteria | 6816 |
| 1224 | Ga0501033_0095825 | 3300049570 | Bacteria | 2169 |
| 1225 | Ga0501033_0253887 | 3300049570 | Bacteria | 1245 |
| 1226 | Ga0501033_0577417 | 3300049570 | Bacteria | 772 |
| 1227 | Ga0501033_0599434 | 3300049570 | Bacteria | 755 |
| 1228 | Ga0501033_0648245 | 3300049570 | Bacteria | 721 |
| 1229 | Ga0501034_0000113 | 3300049571 | Bacteria | 149824 |
| 1230 | Ga0501034_0013557 | 3300049571 | Bacteria | 8389 |
| 1231 | Ga0501034_0040597 | 3300049571 | Bacteria | 4710 |
| 1232 | Ga0501034_0053453 | 3300049571 | Bacteria | 4066 |
| 1233 | Ga0501034_0158181 | 3300049571 | Bacteria | 2238 |
| 1234 | Ga0501034_0167481 | 3300049571 | Bacteria | 2165 |
| 1235 | Ga0501034_0217999 | 3300049571 | Bacteria | 1861 |
| 1236 | Ga0501036_0001021 | 3300049572 | Bacteria | 21132 |
| 1237 | Ga0501036_0020539 | 3300049572 | Bacteria | 5547 |
| 1238 | Ga0501036_0098766 | 3300049572 | Bacteria | 2468 |
| 1239 | Ga0501036_0110839 | 3300049572 | Bacteria | 2319 |
| 1240 | Ga0501036_0173953 | 3300049572 | Bacteria | 1813 |
| 1241 | Ga0501036_0211351 | 3300049572 | Bacteria | 1630 |
| 1242 | Ga0501036_0535855 | 3300049572 | Bacteria | 973 |
| 1243 | Ga0501036_0577196 | 3300049572 | Bacteria | 934 |
| 1244 | Ga0501036_0997671 | 3300049572 | Bacteria | 685 |
| 1245 | Ga0501037_0000041 | 3300049573 | Bacteria | 118457 |
| 1246 | Ga0501037_0010332 | 3300049573 | Bacteria | 6849 |
| 1247 | Ga0501037_0012130 | 3300049573 | Bacteria | 6345 |
| 1248 | Ga0501037_0021227 | 3300049573 | Bacteria | 4798 |
| 1249 | Ga0501037_0041461 | 3300049573 | Bacteria | 3386 |
| 1250 | Ga0501037_0045962 | 3300049573 | Bacteria | 3203 |
| 1251 | Ga0501037_0294816 | 3300049573 | Bacteria | 1127 |
| 1252 | Ga0501037_0370454 | 3300049573 | Bacteria | 985 |
| 1253 | Ga0501038_0003329 | 3300049574 | Bacteria | 14988 |
| 1254 | Ga0501038_0039602 | 3300049574 | Bacteria | 4121 |
| 1255 | Ga0501038_0055243 | 3300049574 | Bacteria | 3412 |
| 1256 | Ga0501038_0427937 | 3300049574 | Bacteria | 1020 |
| 1257 | Ga0501038_0680136 | 3300049574 | Bacteria | 772 |
| 1258 | Ga0501038_1068171 | 3300049574 | Bacteria | 590 |
| 1259 | Ga0501038_1216276 | 3300049574 | Bacteria | 546 |
| 1260 | Ga0501039_0005709 | 3300049575 | Bacteria | 9425 |
| 1261 | Ga0501039_0058373 | 3300049575 | Bacteria | 2989 |
| 1262 | Ga0501039_0184580 | 3300049575 | Bacteria | 1640 |
| 1263 | Ga0501039_0186564 | 3300049575 | Bacteria | 1631 |
| 1264 | Ga0501039_0334713 | 3300049575 | Bacteria | 1189 |
| 1265 | Ga0501039_0341601 | 3300049575 | Bacteria | 1176 |
| 1266 | Ga0501039_0647325 | 3300049575 | Bacteria | 827 |
| 1267 | Ga0501039_0717597 | 3300049575 | Bacteria | 781 |
| 1268 | Ga0501040_0039032 | 3300049576 | Bacteria | 3229 |
| 1269 | Ga0501040_0220767 | 3300049576 | Bacteria | 1348 |
| 1270 | Ga0501040_1059685 | 3300049576 | Bacteria | 588 |
| 1271 | Ga0501042_0011820 | 3300049578 | Bacteria | 5898 |
| 1272 | Ga0501042_0020143 | 3300049578 | Bacteria | 4640 |
| 1273 | Ga0501042_0318778 | 3300049578 | Bacteria | 1123 |
| 1274 | Ga0501042_0715278 | 3300049578 | Bacteria | 728 |
| 1275 | Ga0501042_1384036 | 3300049578 | Bacteria | 513 |
| 1276 | Ga0501043_0001803 | 3300049579 | Bacteria | 18404 |
| 1277 | Ga0501043_0005879 | 3300049579 | Bacteria | 9869 |
| 1278 | Ga0501043_0014802 | 3300049579 | Bacteria | 6107 |
| 1279 | Ga0501043_0168838 | 3300049579 | Bacteria | 1707 |
| 1280 | Ga0501043_0194658 | 3300049579 | Bacteria | 1575 |
| 1281 | Ga0501043_0268363 | 3300049579 | Bacteria | 1310 |
| 1282 | Ga0501043_0269434 | 3300049579 | Bacteria | 1307 |
| 1283 | Ga0501043_0341634 | 3300049579 | Bacteria | 1138 |
| 1284 | Ga0501046_0002091 | 3300049580 | Bacteria | 18926 |
| 1285 | Ga0501046_0004930 | 3300049580 | Bacteria | 12008 |
| 1286 | Ga0501046_0272709 | 3300049580 | Bacteria | 1240 |
| 1287 | Ga0501046_0564469 | 3300049580 | Bacteria | 810 |
| 1288 | Ga0501046_0785793 | 3300049580 | Bacteria | 667 |
| 1289 | Ga0501047_0000044 | 3300049581 | Bacteria | 174789 |
| 1290 | Ga0501047_0014719 | 3300049581 | Bacteria | 7444 |
| 1291 | Ga0501047_0017793 | 3300049581 | Bacteria | 6807 |
| 1292 | Ga0501047_0043245 | 3300049581 | Bacteria | 4351 |
| 1293 | Ga0501047_0113095 | 3300049581 | Bacteria | 2596 |
| 1294 | Ga0501047_0285144 | 3300049581 | Bacteria | 1495 |
| 1295 | Ga0501047_0515071 | 3300049581 | Bacteria | 1022 |
| 1296 | Ga0501047_0584914 | 3300049581 | Bacteria | 939 |
| 1297 | Ga0501048_0000117 | 3300049582 | Bacteria | 45344 |
| 1298 | Ga0501048_0000150 | 3300049582 | Bacteria | 42721 |
| 1299 | Ga0501048_0083845 | 3300049582 | Bacteria | 2247 |
| 1300 | Ga0501067_0000938 | 3300049583 | Bacteria | 15626 |
| 1301 | Ga0501067_0090031 | 3300049583 | Bacteria | 1703 |
| 1302 | Ga0501067_0103699 | 3300049583 | Bacteria | 1580 |
| 1303 | Ga0501067_0122932 | 3300049583 | Bacteria | 1444 |
| 1304 | Ga0501068_0003225 | 3300049584 | Bacteria | 8738 |
| 1305 | Ga0501068_0032603 | 3300049584 | Bacteria | 3098 |
| 1306 | Ga0501068_0085489 | 3300049584 | Bacteria | 1941 |
| 1307 | Ga0501068_0252510 | 3300049584 | Bacteria | 1124 |
| 1308 | Ga0501069_0005145 | 3300049585 | Bacteria | 6791 |
| 1309 | Ga0501069_0035152 | 3300049585 | Bacteria | 2759 |
| 1310 | Ga0501070_0002301 | 3300049586 | Bacteria | 16761 |
| 1311 | Ga0501070_0015142 | 3300049586 | Bacteria | 6490 |
| 1312 | Ga0501070_0088235 | 3300049586 | Bacteria | 2567 |
| 1313 | Ga0501070_0116891 | 3300049586 | Bacteria | 2202 |
| 1314 | Ga0501070_0169158 | 3300049586 | Bacteria | 1800 |
| 1315 | Ga0501070_0497528 | 3300049586 | Bacteria | 980 |
| 1316 | Ga0501070_0970468 | 3300049586 | Bacteria | 660 |
| 1317 | Ga0501071_0036255 | 3300049587 | Bacteria | 3516 |
| 1318 | Ga0501071_0078945 | 3300049587 | Bacteria | 2406 |
| 1319 | Ga0501071_0371878 | 3300049587 | Bacteria | 1089 |
| 1320 | Ga0501072_0000156 | 3300049588 | Bacteria | 50717 |
| 1321 | Ga0501072_0213597 | 3300049588 | Bacteria | 1537 |
| 1322 | Ga0501072_0222416 | 3300049588 | Bacteria | 1504 |
| 1323 | Ga0501072_0783783 | 3300049588 | Bacteria | 747 |
| 1324 | Ga0501072_0987131 | 3300049588 | Bacteria | 657 |
| 1325 | Ga0501073_0000669 | 3300049589 | Bacteria | 24040 |
| 1326 | Ga0501073_0103805 | 3300049589 | Bacteria | 1973 |
| 1327 | Ga0501073_0119862 | 3300049589 | Bacteria | 1823 |
| 1328 | Ga0501073_0691925 | 3300049589 | Bacteria | 703 |
| 1329 | Ga0501073_0747740 | 3300049589 | Bacteria | 674 |
| 1330 | Ga0501074_0000035 | 3300049590 | Bacteria | 64770 |
| 1331 | Ga0501074_0065786 | 3300049590 | Bacteria | 2608 |
| 1332 | Ga0501074_0066337 | 3300049590 | Bacteria | 2596 |
| 1333 | Ga0501074_0147158 | 3300049590 | Bacteria | 1684 |
| 1334 | Ga0501074_1233886 | 3300049590 | Bacteria | 524 |
| 1335 | Ga0501075_0085558 | 3300049591 | Bacteria | 2389 |
| 1336 | Ga0501075_0155000 | 3300049591 | Bacteria | 1747 |
| 1337 | Ga0501075_1065255 | 3300049591 | Bacteria | 614 |
| 1338 | Ga0501075_1182861 | 3300049591 | Bacteria | 580 |
| 1339 | Ga0501076_0057149 | 3300049592 | Bacteria | 3098 |
| 1340 | Ga0501076_0088285 | 3300049592 | Bacteria | 2492 |
| 1341 | Ga0501076_0092311 | 3300049592 | Bacteria | 2436 |
| 1342 | Ga0501076_0327172 | 3300049592 | Bacteria | 1257 |
| 1343 | Ga0501077_0456203 | 3300049593 | Bacteria | 819 |
| 1344 | Ga0501077_0681213 | 3300049593 | Bacteria | 661 |
| 1345 | Ga0501253_061590 | 3300049683 | Bacteria | 810 |
| 1346 | Ga0501079_0198613 | 3300049741 | Bacteria | 1566 |
| 1347 | Ga0501079_0751103 | 3300049741 | Bacteria | 768 |
| 1348 | Ga0501079_1253174 | 3300049741 | Bacteria | 584 |
| 1349 | Ga0501080_0001372 | 3300049742 | Bacteria | 20366 |
| 1350 | Ga0501080_0003476 | 3300049742 | Bacteria | 13874 |
| 1351 | Ga0501080_0008844 | 3300049742 | Bacteria | 9155 |
| 1352 | Ga0501080_0034245 | 3300049742 | Bacteria | 4740 |
| 1353 | Ga0501080_0139418 | 3300049742 | Bacteria | 2242 |
| 1354 | Ga0501080_0189542 | 3300049742 | Bacteria | 1890 |
| 1355 | Ga0501080_0932591 | 3300049742 | Bacteria | 755 |
| 1356 | Ga0501080_1619056 | 3300049742 | Bacteria | 548 |
| 1357 | Ga0501081_0224850 | 3300049743 | Bacteria | 1365 |
| 1358 | Ga0501083_0001836 | 3300049744 | Bacteria | 14565 |
| 1359 | Ga0501083_0009709 | 3300049744 | Bacteria | 6796 |
| 1360 | Ga0501083_0015275 | 3300049744 | Bacteria | 5377 |
| 1361 | Ga0501083_0042930 | 3300049744 | Bacteria | 3064 |
| 1362 | Ga0501083_0591005 | 3300049744 | Bacteria | 722 |
| 1363 | Ga0501035_0000128 | 3300049822 | Bacteria | 92297 |
| 1364 | Ga0501035_0032494 | 3300049822 | Bacteria | 4746 |
| 1365 | Ga0501035_0032953 | 3300049822 | Bacteria | 4712 |
| 1366 | Ga0501035_0120217 | 3300049822 | Bacteria | 2297 |
| 1367 | Ga0501035_0150940 | 3300049822 | Bacteria | 2016 |
| 1368 | Ga0501035_0161475 | 3300049822 | Bacteria | 1939 |
| 1369 | Ga0501035_0367334 | 3300049822 | Bacteria | 1201 |
| 1370 | Ga0501044_0000108 | 3300049823 | Bacteria | 100968 |
| 1371 | Ga0501044_0006423 | 3300049823 | Bacteria | 12992 |
| 1372 | Ga0501044_0009883 | 3300049823 | Bacteria | 10367 |
| 1373 | Ga0501044_0019459 | 3300049823 | Bacteria | 7262 |
| 1374 | Ga0501044_0142723 | 3300049823 | Bacteria | 2382 |
| 1375 | Ga0501044_0190215 | 3300049823 | Bacteria | 2015 |
| 1376 | Ga0501044_0208322 | 3300049823 | Bacteria | 1910 |
| 1377 | Ga0501044_0708604 | 3300049823 | Bacteria | 891 |
| 1378 | Ga0501044_0982868 | 3300049823 | Bacteria | 716 |
| 1379 | Ga0501045_0183885 | 3300049824 | Bacteria | 1557 |
| 1380 | Ga0501045_0976428 | 3300049824 | Bacteria | 621 |
| 1381 | nmdc:mga03683_2375_c1 | 3300050489 | Bacteria | 5835 |
| 1382 | nmdc:mga03683_91139_c1 | 3300050489 | Bacteria | 1329 |
| 1383 | nmdc:mga03n38_118081_c1 | 3300050490 | Bacteria | 1300 |
| 1384 | nmdc:mga03n38_3257_c1 | 3300050490 | Bacteria | 5185 |
| 1385 | nmdc:mga03n38_405748_c1 | 3300050490 | Bacteria | 751 |
| 1386 | nmdc:mga03n38_529699_c1 | 3300050490 | Bacteria | 664 |
| 1387 | nmdc:mga03n38_53519_c1 | 3300050490 | Bacteria | 1810 |
| 1388 | nmdc:mga03n38_55853_c1 | 3300050490 | Bacteria | 1780 |
| 1389 | nmdc:mga00v17_103636_c1 | 3300050491 | Bacteria | 1798 |
| 1390 | nmdc:mga00v17_140810_c1 | 3300050491 | Bacteria | 1546 |
| 1391 | nmdc:mga00v17_16449_c2 | 3300050491 | Bacteria | 3559 |
| 1392 | nmdc:mga00v17_201674_c1 | 3300050491 | Bacteria | 1286 |
| 1393 | nmdc:mga00v17_624641_c1 | 3300050491 | Bacteria | 694 |
| 1394 | nmdc:mga0yw44_1343_c1 | 3300050492 | Bacteria | 9740 |
| 1395 | nmdc:mga0yw44_16958_c1 | 3300050492 | Bacteria | 3949 |
| 1396 | nmdc:mga0yw44_263007_c1 | 3300050492 | Bacteria | 1150 |
| 1397 | nmdc:mga0yw44_332703_c1 | 3300050492 | Bacteria | 1021 |
| 1398 | nmdc:mga0yw44_6896_c1 | 3300050492 | Bacteria | 5533 |
| 1399 | nmdc:mga0yw44_73491_c1 | 3300050492 | Bacteria | 2127 |
| 1400 | nmdc:mga0yw44_785498_c1 | 3300050492 | Bacteria | 647 |
| 1401 | nmdc:mga0yw44_85195_c1 | 3300050492 | Bacteria | 1988 |
| 1402 | nmdc:mga0yw44_87690_c1 | 3300050492 | Bacteria | 1962 |
| 1403 | nmdc:mga0yw44_9699_c1 | 3300050492 | Bacteria | 4887 |
| 1404 | nmdc:mga0k408_208507_c1 | 3300050493 | Bacteria | 1167 |
| 1405 | nmdc:mga0k408_511580_c1 | 3300050493 | Bacteria | 711 |
| 1406 | nmdc:mga06z11_15640_c1 | 3300050494 | Bacteria | 3392 |
| 1407 | nmdc:mga06z11_23680_c1 | 3300050494 | Bacteria | 2888 |
| 1408 | nmdc:mga06z11_321745_c1 | 3300050494 | Bacteria | 923 |
| 1409 | nmdc:mga06z11_334846_c1 | 3300050494 | Bacteria | 904 |
| 1410 | nmdc:mga04h51_3971_c1 | 3300050495 | Bacteria | 3641 |
| 1411 | nmdc:mga07m45_224210_c1 | 3300050496 | Bacteria | 1094 |
| 1412 | nmdc:mga07m45_264602_c1 | 3300050496 | Bacteria | 553 |
| 1413 | nmdc:mga07m45_52848_c1 | 3300050496 | Bacteria | 2295 |
| 1414 | nmdc:mga07m45_650099_c1 | 3300050496 | Bacteria | 608 |
| 1415 | nmdc:mga07m45_693067_c1 | 3300050496 | Bacteria | 586 |
| 1416 | nmdc:mga05p37_131206_c1 | 3300050507 | Bacteria | 3074 |
| 1417 | nmdc:mga05p37_1810829_c1 | 3300050507 | Bacteria | 588 |
| 1418 | nmdc:mga05p37_615640_c1 | 3300050507 | Bacteria | 1223 |
| 1419 | nmdc:mga05p37_85477_c1 | 3300050507 | Bacteria | 3887 |
| 1420 | nmdc:mga05p37_87002_c1 | 3300050507 | Bacteria | 3852 |
| 1421 | nmdc:mga05p37_8728_c1 | 3300050507 | Bacteria | 11969 |
| 1422 | nmdc:mga09592_528607_c1 | 3300050508 | Bacteria | 1014 |
| 1423 | nmdc:mga09592_662231_c1 | 3300050508 | Bacteria | 891 |
| 1424 | nmdc:mga0qj67_1283644_c1 | 3300050509 | Bacteria | 568 |
| 1425 | nmdc:mga0qj67_184268_c1 | 3300050509 | Bacteria | 1696 |
| 1426 | nmdc:mga0qj67_55_c1 | 3300050509 | Bacteria | 83015 |
| 1427 | nmdc:mga06r32_1054100_c1 | 3300050510 | Bacteria | 764 |
| 1428 | nmdc:mga06r32_147362_c1 | 3300050510 | Bacteria | 2331 |
| 1429 | nmdc:mga06r32_155378_c1 | 3300050510 | Bacteria | 2269 |
| 1430 | nmdc:mga06r32_428092_c1 | 3300050510 | Bacteria | 1304 |
| 1431 | nmdc:mga06r32_51211_c1 | 3300050510 | Bacteria | 3951 |
| 1432 | nmdc:mga06r32_75750_c1 | 3300050510 | Bacteria | 3266 |
| 1433 | nmdc:mga06r32_88189_c1 | 3300050510 | Bacteria | 3028 |
| 1434 | nmdc:mga08y16_1142763_c1 | 3300050511 | Bacteria | 752 |
| 1435 | nmdc:mga08y16_134099_c1 | 3300050511 | Bacteria | 2574 |
| 1436 | nmdc:mga08y16_135009_c1 | 3300050511 | Bacteria | 2564 |
| 1437 | nmdc:mga08y16_139869_c1 | 3300050511 | Bacteria | 2516 |
| 1438 | nmdc:mga08y16_184749_c1 | 3300050511 | Bacteria | 2164 |
| 1439 | nmdc:mga08y16_319802_c1 | 3300050511 | Bacteria | 1598 |
| 1440 | nmdc:mga0n895_10223_c1 | 3300050512 | Bacteria | 8267 |
| 1441 | nmdc:mga0n895_105146_c1 | 3300050512 | Bacteria | 2835 |
| 1442 | nmdc:mga0n895_1322_c1 | 3300050512 | Bacteria | 18328 |
| 1443 | nmdc:mga0n895_53760_c1 | 3300050512 | Bacteria | 3958 |
| 1444 | nmdc:mga0n895_55453_c1 | 3300050512 | Bacteria | 3900 |
| 1445 | nmdc:mga0rr50_264029_c1 | 3300050513 | Bacteria | 1433 |
| 1446 | nmdc:mga0rr50_388515_c1 | 3300050513 | Bacteria | 1177 |
| 1447 | nmdc:mga0rr50_428656_c1 | 3300050513 | Bacteria | 1119 |
| 1448 | nmdc:mga08x19_26607_c1 | 3300050514 | Bacteria | 3610 |
| 1449 | nmdc:mga0a205_131847_c1 | 3300050515 | Bacteria | 2399 |
| 1450 | nmdc:mga0a205_349472_c1 | 3300050515 | Bacteria | 1346 |
| 1451 | nmdc:mga0a205_67193_c1 | 3300050515 | Bacteria | 3463 |
| 1452 | nmdc:mga0sz30_119113_c1 | 3300050516 | Bacteria | 1160 |
| 1453 | nmdc:mga0sz30_316245_c1 | 3300050516 | Bacteria | 697 |
| 1454 | nmdc:mga0sz30_56993_c2 | 3300050516 | Bacteria | 1272 |
| 1455 | Ga0495601_0000008 | 3300053077 | Bacteria | 362152 |
| 1456 | Ga0495601_0056850 | 3300053077 | Bacteria | 2478 |
| 1457 | Ga0495601_0066236 | 3300053077 | Bacteria | 2299 |
| 1458 | Ga0495601_0236845 | 3300053077 | Bacteria | 1192 |
| 1459 | Ga0495601_0247343 | 3300053077 | Bacteria | 1164 |
| 1460 | Ga0495601_0971416 | 3300053077 | Bacteria | 535 |
| 1461 | Ga0495612_0000002 | 3300053078 | Bacteria | 310466 |
| 1462 | Ga0495612_0009839 | 3300053078 | Bacteria | 3871 |
| 1463 | Ga0495612_0220273 | 3300053078 | Bacteria | 840 |
| 1464 | Ga0495655_0008907 | 3300053083 | Bacteria | 1925 |
| 1465 | Ga0495655_0011257 | 3300053083 | Bacteria | 1793 |
| 1466 | Ga0495655_0058527 | 3300053083 | Bacteria | 1044 |
| 1467 | Ga0495595_0000008 | 3300053084 | Bacteria | 196206 |
| 1468 | Ga0495595_0089654 | 3300053084 | Bacteria | 1474 |
| 1469 | Ga0495619_0000002 | 3300053085 | Bacteria | 530226 |
| 1470 | Ga0495619_0056568 | 3300053085 | Bacteria | 2601 |
| 1471 | Ga0495619_0182480 | 3300053085 | Bacteria | 1452 |
| 1472 | Ga0495619_1070853 | 3300053085 | Bacteria | 537 |
| 1473 | Ga0500578_0334058 | 3300053086 | Bacteria | 890 |
| 1474 | Ga0500578_0462427 | 3300053086 | Bacteria | 720 |
| 1475 | Ga0500644_0041434 | 3300053088 | Bacteria | 1529 |
| 1476 | Ga0500583_0226366 | 3300053092 | Bacteria | 926 |
| 1477 | Ga0500651_0051030 | 3300053093 | Bacteria | 2594 |
| 1478 | Ga0500651_0055403 | 3300053093 | Bacteria | 2484 |
| 1479 | Ga0500566_0002184 | 3300053094 | Bacteria | 11532 |
| 1480 | Ga0500566_0008546 | 3300053094 | Bacteria | 6053 |
| 1481 | Ga0500566_0075420 | 3300053094 | Bacteria | 1887 |
| 1482 | Ga0500641_0005872 | 3300053096 | Bacteria | 4346 |
| 1483 | Ga0500641_0096783 | 3300053096 | Bacteria | 1263 |
| 1484 | Ga0500650_0010755 | 3300053098 | Bacteria | 3737 |
| 1485 | Ga0500554_001065 | 3300053102 | Bacteria | 5334 |
| 1486 | Ga0500554_057265 | 3300053102 | Bacteria | 1242 |
| 1487 | Ga0500556_0000005 | 3300053104 | Bacteria | 581135 |
| 1488 | Ga0500556_0031516 | 3300053104 | Bacteria | 1804 |
| 1489 | Ga0500562_054520 | 3300053108 | Bacteria | 1071 |
| 1490 | Ga0500569_029514 | 3300053109 | Bacteria | 1528 |
| 1491 | Ga0500594_0117443 | 3300053118 | Bacteria | 833 |
| 1492 | Ga0500595_005259 | 3300053119 | Bacteria | 5672 |
| 1493 | Ga0500595_030385 | 3300053119 | Bacteria | 1820 |
| 1494 | Ga0500607_115755 | 3300053121 | Bacteria | 1306 |
| 1495 | Ga0500608_000330 | 3300053122 | Bacteria | 18247 |
| 1496 | Ga0500608_078733 | 3300053122 | Bacteria | 1558 |
| 1497 | Ga0500642_0000009 | 3300053130 | Bacteria | 286829 |
| 1498 | Ga0500642_0000022 | 3300053130 | Bacteria | 135196 |
| 1499 | Ga0500642_0282913 | 3300053130 | Bacteria | 753 |
| 1500 | Ga0500652_003127 | 3300053131 | Bacteria | 4991 |
| 1501 | Ga0500559_0000696 | 3300053136 | Bacteria | 22137 |
| 1502 | Ga0500559_0379150 | 3300053136 | Bacteria | 659 |
| 1503 | Ga0500568_0002658 | 3300053139 | Bacteria | 10374 |
| 1504 | Ga0500568_0031049 | 3300053139 | Bacteria | 2208 |
| 1505 | Ga0500577_0090796 | 3300053142 | Bacteria | 1234 |
| 1506 | Ga0500586_006662 | 3300053145 | Bacteria | 3020 |
| 1507 | Ga0500588_0035951 | 3300053146 | Bacteria | 1461 |
| 1508 | Ga0500589_038036 | 3300053147 | Bacteria | 2246 |
| 1509 | Ga0500590_172977 | 3300053148 | Bacteria | 947 |
| 1510 | Ga0500603_274380 | 3300053150 | Bacteria | 544 |
| 1511 | Ga0500604_0152582 | 3300053151 | Bacteria | 785 |
| 1512 | Ga0500604_0333385 | 3300053151 | Bacteria | 527 |
| 1513 | Ga0500616_0000035 | 3300053153 | Bacteria | 394242 |
| 1514 | Ga0500616_0049669 | 3300053153 | Bacteria | 2218 |
| 1515 | Ga0500622_0002093 | 3300053156 | Bacteria | 14867 |
| 1516 | Ga0500622_0029103 | 3300053156 | Bacteria | 2906 |
| 1517 | Ga0500622_0096805 | 3300053156 | Bacteria | 1458 |
| 1518 | Ga0500627_0052630 | 3300053158 | Bacteria | 1777 |
| 1519 | Ga0500627_0356800 | 3300053158 | Bacteria | 630 |
| 1520 | Ga0500627_0472970 | 3300053158 | Bacteria | 525 |
| 1521 | Ga0500633_0093090 | 3300053160 | Bacteria | 1103 |
| 1522 | Ga0500633_0146363 | 3300053160 | Bacteria | 885 |
| 1523 | Ga0500634_0086499 | 3300053161 | Bacteria | 1602 |
| 1524 | Ga0500638_013277 | 3300053162 | Bacteria | 3718 |
| 1525 | Ga0500638_231524 | 3300053162 | Bacteria | 758 |
| 1526 | Ga0500639_098906 | 3300053163 | Bacteria | 1440 |
| 1527 | Ga0500636_0074012 | 3300053177 | Bacteria | 1972 |
| 1528 | Ga0500636_0169362 | 3300053177 | Bacteria | 1182 |
| 1529 | Ga0500637_0000366 | 3300053178 | Bacteria | 17135 |
| 1530 | Ga0500637_0037469 | 3300053178 | Bacteria | 2726 |
| 1531 | Ga0500576_186502 | 3300053725 | Bacteria | 725 |
| 1532 | Ga0500611_102005 | 3300053727 | Bacteria | 744 |
| 1533 | Ga0500657_058763 | 3300053728 | Bacteria | 1726 |
| 1534 | Ga0500645_013757 | 3300053730 | Bacteria | 2591 |
| 1535 | Ga0500645_049443 | 3300053730 | Bacteria | 1229 |
| 1536 | Ga0500645_054110 | 3300053730 | Bacteria | 1168 |
| 1537 | Ga0500552_012778 | 3300053733 | Bacteria | 1079 |
| 1538 | Ga0500596_000812 | 3300053735 | Bacteria | 6173 |
| 1539 | Ga0501084_0002026 | 3300054114 | Bacteria | 16179 |
| 1540 | Ga0501084_0640839 | 3300054114 | Bacteria | 897 |
| 1541 | Ga0500661_000195 | 3300055283 | Bacteria | 10687 |
| 1542 | Ga0501082_0057430 | 3300060353 | Bacteria | 3353 |
| 1543 | Ga0501082_0077217 | 3300060353 | Bacteria | 2871 |
| 1544 | Ga0501082_0159321 | 3300060353 | Bacteria | 1961 |
| 1545 | Ga0501082_0257071 | 3300060353 | Bacteria | 1519 |
| 1546 | Ga0501082_0666912 | 3300060353 | Bacteria | 910 |
| 1547 | Ga0466962_0068880 | 3300061719 | Bacteria | 1690 |
| 1548 | Ga0466962_0214048 | 3300061719 | Bacteria | 943 |
| 1549 | Ga0530510_0233963 | 3300061734 | Bacteria | 1367 |
| 1550 | 3005711609 | 3005710791 | Bacteria | 7622528 |
| 1551 | 2513626998 | 2513237092 | Bacteria | 8341956 |
| 1552 | 2513638552 | 2513237094 | Bacteria | 8789602 |
| 1553 | 2513653099 | 2513237095 | Bacteria | 8976980 |
| 1554 | 2513658976 | 2513237096 | Bacteria | 8722461 |
| 1555 | 2513680226 | 2513237098 | Bacteria | 9902361 |
| 1556 | 2513698957 | 2513237101 | Bacteria | 7952346 |
| 1557 | 2513699159 | 2513237102 | Bacteria | 7703324 |
| 1558 | 2513714868 | 2513237104 | Bacteria | 10034502 |
| 1559 | 2513863885 | 2513237137 | Bacteria | 9558895 |
| 1560 | 2513875666 | 2513237139 | Bacteria | 8737671 |
| 1561 | 2513889639 | 2513237141 | Bacteria | 8496279 |
| 1562 | 2513921240 | 2513237145 | Bacteria | 8979722 |
| 1563 | 2514016334 | 2513237161 | Bacteria | 8871253 |
| 1564 | 2517105846 | 2517093001 | Bacteria | 9002274 |
| 1565 | 2517889329 | 2517572143 | Bacteria | 9484767 |
| 1566 | 2524438617 | 2524023205 | Bacteria | 8918781 |
| 1567 | 2524466170 | 2524023210 | Bacteria | 9029266 |
| 1568 | 2524540377 | 2524023228 | Bacteria | 10118060 |
| 1569 | 2528851492 | 2528768022 | Bacteria | 10457665 |
| 1570 | 2603857938 | 2602042107 | Bacteria | 6226103 |
| 1571 | 2617347479 | 2617270735 | Bacteria | 9163226 |
| 1572 | 2617377113 | 2617270741 | Bacteria | 8201522 |
| 1573 | 2671121386 | 2667528175 | Bacteria | 7532676 |
| 1574 | 2723849163 | 2721755755 | Bacteria | 8322773 |
| 1575 | 2728754271 | 2728368998 | Bacteria | 8720350 |
| 1576 | 2745077666 | 2744054633 | Bacteria | 8678936 |
| 1577 | 2793063257 | 2791355196 | Bacteria | 7323613 |
| 1578 | 2793070994 | 2791355197 | Bacteria | 8420563 |
| 1579 | 2793078480 | |||
| 1580 | 2805919342 | 2802429603 | Bacteria | 8777136 |
| 1581 | 2818243405 | 2816332527 | Bacteria | 8933356 |
| 1582 | 2824622529 | 2824617872 | Bacteria | 8814715 |
| 1583 | 2824633890 | 2824626560 | Bacteria | 8813858 |
| 1584 | 2824642893 | 2824635225 | Bacteria | 8785348 |
| 1585 | 2824651201 | 2824644064 | Bacteria | 8743947 |
| 1586 | 2824670937 | 2824661429 | Bacteria | 9877870 |
| 1587 | 2824674721 | 2824671348 | Bacteria | 8369588 |
| 1588 | 2824684134 | 2824679649 | Bacteria | 8248951 |
| 1589 | 2824692597 | 2824687955 | Bacteria | 8360029 |
| 1590 | 2824700966 | 2824696289 | Bacteria | 8335049 |
| 1591 | 2824713945 | 2824704595 | Bacteria | 9667483 |
| 1592 | 2824721159 | 2824714736 | Bacteria | 8717648 |
| 1593 | 2824731248 | 2824723954 | Bacteria | 8758240 |
| 1594 | 2824740592 | 2824732956 | Bacteria | 7810675 |
| 1595 | 2824752544 | 2824746037 | Bacteria | 7911610 |
| 1596 | 2824763337 | 2824753945 | Bacteria | 9787441 |
| 1597 | 2824770610 | 2824763712 | Bacteria | 9792355 |
| 1598 | 2824780158 | 2824773399 | Bacteria | 8360218 |
| 1599 | 2838130258 | 2838122688 | Bacteria | 8803140 |
| 1600 | 2841944299 | 2841941048 | Bacteria | 8688029 |
| 1601 | 2841954524 | 2841949485 | Bacteria | 8680857 |
| 1602 | 2841963427 | 2841957949 | Bacteria | 8652217 |
| 1603 | 2841969076 | 2841966195 | Bacteria | 8673214 |
| 1604 | 2841979850 | 2841974524 | Bacteria | 8931498 |
| 1605 | 2841989552 | 2841983080 | Bacteria | 8395090 |
| 1606 | 2842044057 | 2842038055 | Bacteria | 8002051 |
| 1607 | 2842051954 | 2842045827 | Bacteria | 8006841 |
| 1608 | 2842334500 | 2842333319 | Bacteria | 8899485 |
| 1609 | 2844316026 | 2844315083 | Bacteria | 8138177 |
| 1610 | 2847931513 | 2847930680 | Bacteria | 9342022 |
| 1611 | 2847941593 | 2847939898 | Bacteria | 8606328 |
| 1612 | 2857515794 | 2857509624 | Bacteria | 7472071 |
| 1613 | 2857527313 | 2857524615 | Bacteria | 6615449 |
| 1614 | 2874606899 | 2874604998 | Bacteria | 7834745 |
| 1615 | 2874619636 | 2874612657 | Bacteria | 8252029 |
| 1616 | 2874624276 | 2874620515 | Bacteria | 8290088 |
| 1617 | 2876763394 | 2876761206 | Bacteria | 10111113 |
| 1618 | 2876810697 | 2876808645 | Bacteria | 8824342 |
| 1619 | 2879091363 | 2879083081 | Bacteria | 8587928 |
| 1620 | 2879100211 | 2879099564 | Bacteria | 10442239 |
| 1621 | 2879112591 | 2879110137 | Bacteria | 8907982 |
| 1622 | 2881673191 | 2881665667 | Bacteria | 8175609 |
| 1623 | 2885368159 | 2885366525 | Bacteria | 8326213 |
| 1624 | 2885377763 | 2885374607 | Bacteria | 8927485 |
| 1625 | 2885392327 | 2885383462 | Bacteria | 9473874 |
| 1626 | 2888378838 | 2888378607 | Bacteria | 9652610 |
| 1627 | 2889036143 | 2889033259 | Bacteria | 9099371 |
| 1628 | 2893071853 | 2893066018 | Bacteria | 6158120 |
| 1629 | 2903729578 | 2903727486 | Bacteria | 8281579 |
| 1630 | 2903752977 | 2903748898 | Bacteria | 9972761 |
| 1631 | 2903776363 | 2903768456 | Bacteria | 9749579 |
| 1632 | 2904672385 | 2904666416 | Bacteria | 8226587 |
| 1633 | 2904692465 | 2904690495 | Bacteria | 9412302 |
| 1634 | 2904709204 | |||
| 1635 | 2904719856 | 2904711408 | Bacteria | 9771557 |
| 1636 | 2906606083 | 2906602504 | Bacteria | 8295279 |
| 1637 | 2906613191 | |||
| 1638 | 2906635079 | 2906626472 | Bacteria | 8826946 |
| 1639 | 2906635522 | 2906635258 | Bacteria | 8601019 |
| 1640 | 2906645633 | 2906643746 | Bacteria | 8722424 |
| 1641 | 2906668653 | 2906660503 | Bacteria | 8595048 |
| 1642 | 2908747938 | 2908739725 | Bacteria | 8628932 |
| 1643 | 2908764381 | 2908756301 | Bacteria | 8864324 |
| 1644 | 2908783025 | 2908775508 | Bacteria | 8092255 |
| 1645 | 2919078429 | 2919073203 | Bacteria | 6531949 |
| 1646 | 2922364521 | 2922361189 | Bacteria | 7436256 |
| 1647 | 2922389204 | 2922386360 | Bacteria | 7017218 |
| 1648 | 2922400940 | 2922393267 | Bacteria | 8285685 |
| 1649 | 2922433690 | |||
| 1650 | 2929623649 | 2929615660 | Bacteria | 9193770 |
| 1651 | 2929632857 | 2929624759 | Bacteria | 9339455 |
| 1652 | 2932786166 | 2932784394 | Bacteria | 9704911 |
| 1653 | 2932799719 | 2932794094 | Bacteria | 7915132 |
| 1654 | 2932816873 | 2932809354 | Bacteria | 9135765 |
| 1655 | 2932826013 | 2932818245 | Bacteria | 9955613 |
| 1656 | 2932829430 | 2932828146 | Bacteria | 9745859 |
| 1657 | 2933585552 | 2933577622 | Bacteria | 9116884 |
| 1658 | 2935617862 | 2935616580 | Bacteria | 9032984 |
| 1659 | 2935634734 | 2935630451 | Bacteria | 8169952 |
| 1660 | 2935647835 | 2935638405 | Bacteria | 10015038 |
| 1661 | 2935674752 | 2935665750 | Bacteria | 9571747 |
| 1662 | 2935678114 | 2935675223 | Bacteria | 9928132 |
| 1663 | 2935685649 | 2935684952 | Bacteria | 9590419 |
| 1664 | 2935692402 | 2935684952 | Bacteria | 9590419 |
| 1665 | 2935699380 | 2935694250 | Bacteria | 9291695 |
| 1666 | 2935707111 | 2935703347 | Bacteria | 10242284 |
| 1667 | 2935714202 | 2935713505 | Bacteria | 9608509 |
| 1668 | 2935721020 | 2935713505 | Bacteria | 9608509 |
| 1669 | 2935722845 | 2935722832 | Bacteria | 9608746 |
| 1670 | 2935724821 | 2935722832 | Bacteria | 9608746 |
| 1671 | 2935732821 | 2935732158 | Bacteria | 9706831 |
| 1672 | 2935739709 | 2935732158 | Bacteria | 9706831 |
| 1673 | 2935742200 | 2935741537 | Bacteria | 9707219 |
| 1674 | 2935748747 | 2935741537 | Bacteria | 9707219 |
| 1675 | 2935751614 | 2935750917 | Bacteria | 9590372 |
| 1676 | 2935758617 | 2935750917 | Bacteria | 9590372 |
| 1677 | 2935764597 | 2935760218 | Bacteria | 9817913 |
| 1678 | 2935806646 | 2935801545 | Bacteria | 9301974 |
| 1679 | 2935819092 | 2935810662 | Bacteria | 9401221 |
| 1680 | 2935837319 | 2935827899 | Bacteria | 10038562 |
| 1681 | 2935841994 | 2935837841 | Bacteria | 9454360 |
| 1682 | 2935856639 | 2935855204 | Bacteria | 9035059 |
| 1683 | 2935872927 | 2935864058 | Bacteria | 9784707 |
| 1684 | 2935874396 | 2935873716 | Bacteria | 9632195 |
| 1685 | 2935885619 | 2935883170 | Bacteria | 7964738 |
| 1686 | 2935967326 | 2935959822 | Bacteria | 7869783 |
| 1687 | 2936001110 | 2935992306 | Bacteria | 9802711 |
| 1688 | 2936010764 | 2936002035 | Bacteria | 9362176 |
| 1689 | 2936045757 | 2936037263 | Bacteria | 9446081 |
| 1690 | 2940557584 | 2940556831 | Bacteria | 9590747 |
| 1691 | 2940564793 | 2940556831 | Bacteria | 9590747 |
| 1692 | 2941511936 | 2941507105 | Bacteria | 8166816 |
| 1693 | 2941519638 | 2941515067 | Bacteria | 8166720 |
| 1694 | 2941527670 | 2941523033 | Bacteria | 8169134 |
| 1695 | 2941535887 | 2941531003 | Bacteria | 7653939 |
| 1696 | 2941547045 | 2941538514 | Bacteria | 9402094 |
| 1697 | 3005483345 | 3005474847 | Bacteria | 9259049 |
| 1698 | 3005490507 | 3005483717 | Bacteria | 7877331 |
| 1699 | 3005509704 | 3005506211 | Bacteria | 6943378 |
| 1700 | 3005591210 | 3005587118 | Bacteria | 7794411 |
| 1701 | 3005595618 | 3005594810 | Bacteria | 8716512 |
| 1702 | 3005718859 | 3005718088 | Bacteria | 8283608 |
| 1703 | 8006929609 | 8006926726 | Bacteria | 6749210 |
| 1704 | 8006935721 | 8006933436 | Bacteria | 10410654 |
| 1705 | 8006967703 | 8006964411 | Bacteria | 8966052 |
| 1706 | 8006975642 | 8006973647 | Bacteria | 10679141 |
| 1707 | 8006992642 | 8006984368 | Bacteria | 9651211 |
| 1708 | 8006998371 | 8006994254 | Bacteria | 8309700 |
| 1709 | 8016518806 | 8016511872 | Bacteria | 9921665 |
| 1710 | 8016587078 | 8016583857 | Bacteria | 10421953 |
| 1711 | 8017057872 | 8017057580 | Bacteria | 10023680 |
| 1712 | 8019563069 | 8019555841 | Bacteria | 9642137 |
| 1713 | 8019573151 | 8019565922 | Bacteria | 9639779 |
| 1714 | 8019577853 | 8019576017 | Bacteria | 10049540 |
| 1715 | 8019595955 | 8019586578 | Bacteria | 10212056 |
| 1716 | 8019605802 | 8019597564 | Bacteria | 10041141 |
| 1717 | 8019612733 | 8019608314 | Bacteria | 10042931 |
| 1718 | 8019653171 | 8019648815 | Bacteria | 10014479 |
| 1719 | 8055750844 | 8055742211 | Bacteria | 9226248 |
| 1720 | 8056678409 | 8056673599 | Bacteria | 7871253 |
| 1721 | 8056687785 | 8056681323 | Bacteria | 8472857 |
| 1722 | 8056694086 | 8056689827 | Bacteria | 6712655 |
| 1723 | 8056970665 | 8056967851 | Bacteria | 9038162 |
| 1724 | CNAas_1007064 | |||
| 1725 | CNAas_1016288 | |||
| 1726 | JGI24752J21851_1014742 | |||
| 1727 | JGI24752J21851_1042018 | |||
| 1728 | JGI24746J21847_1002860 | |||
| 1729 | JGI24739J22299_10011021 | |||
| 1730 | JGI24739J22299_10071708 | |||
| 1731 | JGI24737J22298_10008157 | |||
| 1732 | JGI24737J22298_10050504 | |||
| 1733 | JGI24743J22301_10024237 | |||
| 1734 | JGI24743J22301_10029493 | |||
| 1735 | JGI24735J21928_10031758 | |||
| 1736 | JGI24750J21931_1001747 | |||
| 1737 | JGI24750J21931_1003723 | |||
| 1738 | JGI24745J21846_1018492 | |||
| 1739 | JGI24748J21848_1013455 | |||
| 1740 | JGI24738J21930_10019399 | |||
| 1741 | JGI24744J21845_10004946 | |||
| 1742 | JGI24033J26618_1008262 | |||
| 1743 | JGI24034J26672_10026686 | |||
| 1744 | JGI24742J22300_10014955 | |||
| 1745 | JGI24751J29686_10034545 | |||
| 1746 | JGI25153J46596_10001947 | |||
| 1747 | JGI25153J46596_10006672 | |||
| 1748 | JGI25153J46596_10011948 | |||
| 1749 | JGI25160J50197_1003445 | |||
| 1750 | JGI25160J50197_1021526 | |||
| 1751 | JGI25404J52841_10114818 | |||
| 1752 | Ga0055542_1012564 | |||
| 1753 | Ga0055526_1017736 | |||
| 1754 | Ga0055524_1044957 | |||
| 1755 | Ga0055531_10005248 | |||
| 1756 | JGI25405J52794_10008372 | |||
| 1757 | Ga0065165_1002353 | |||
| 1758 | Ga0065165_1003437 | |||
| 1759 | Ga0065165_1020999 | |||
| 1760 | Ga0065704_10158960 | |||
| 1761 | Ga0070658_10650403 | |||
| 1762 | Ga0070658_11243293 | |||
| 1763 | Ga0070676_10256132 | |||
| 1764 | Ga0070683_100001565 | |||
| 1765 | Ga0070683_100030774 | |||
| 1766 | Ga0070690_100015243 | |||
| 1767 | Ga0070670_100008743 | |||
| 1768 | Ga0070670_100121742 | |||
| 1769 | Ga0068869_100063993 | |||
| 1770 | Ga0068869_100869605 | |||
| 1771 | Ga0070666_10035271 | |||
| 1772 | Ga0070666_10077319 | |||
| 1773 | Ga0070680_100021428 | |||
| 1774 | Ga0070680_100036045 | |||
| 1775 | Ga0070680_100086516 | |||
| 1776 | Ga0070682_100083151 | |||
| 1777 | Ga0070682_100376278 | |||
| 1778 | Ga0070682_100527707 | |||
| 1779 | Ga0068868_100041855 | |||
| 1780 | Ga0068868_100423390 | |||
| 1781 | Ga0070660_100399137 | |||
| 1782 | Ga0070660_100851486 | |||
| 1783 | Ga0070689_100060091 | |||
| 1784 | Ga0070691_10091962 | |||
| 1785 | Ga0070691_10187112 | |||
| 1786 | Ga0070687_100341399 | |||
| 1787 | Ga0070687_100465401 | |||
| 1788 | Ga0070661_100048583 | |||
| 1789 | Ga0070661_100144999 | |||
| 1790 | Ga0070661_100414778 | |||
| 1791 | Ga0070692_10042076 | |||
| 1792 | Ga0070692_10392284 | |||
| 1793 | Ga0070668_100039946 | |||
| 1794 | Ga0070668_100070709 | |||
| 1795 | Ga0070668_100286040 | |||
| 1796 | Ga0070668_100375762 | |||
| 1797 | Ga0070668_100668782 | |||
| 1798 | Ga0070668_100710332 | |||
| 1799 | Ga0070669_100011139 | |||
| 1800 | Ga0070675_100070988 | |||
| 1801 | Ga0070671_100006990 | |||
| 1802 | Ga0070671_100258320 | |||
| 1803 | Ga0070671_101422674 | |||
| 1804 | Ga0070674_100044981 | |||
| 1805 | Ga0070674_100087726 | |||
| 1806 | Ga0070674_100370164 | |||
| 1807 | Ga0070674_100558687 | |||
| 1808 | Ga0070673_100031845 | |||
| 1809 | Ga0070673_101187499 | |||
| 1810 | Ga0070688_100052318 | |||
| 1811 | Ga0070659_100125139 | |||
| 1812 | Ga0070667_100030018 | |||
| 1813 | Ga0070667_101120646 | |||
| 1814 | Ga0070703_10057915 | |||
| 1815 | Ga0070709_10159999 | |||
| 1816 | Ga0070709_10740061 | |||
| 1817 | Ga0070709_11027051 | |||
| 1818 | Ga0070714_100145457 | |||
| 1819 | Ga0070714_100185949 | |||
| 1820 | Ga0070714_100622138 | |||
| 1821 | Ga0070714_100787064 | |||
| 1822 | Ga0070714_101523903 | |||
| 1823 | Ga0070713_100041745 | |||
| 1824 | Ga0070713_100094501 | |||
| 1825 | Ga0070713_100410108 | |||
| 1826 | Ga0070713_100563342 | |||
| 1827 | Ga0070710_10006631 | |||
| 1828 | Ga0070710_10068125 | |||
| 1829 | Ga0070710_10562440 | |||
| 1830 | Ga0070710_10881557 | |||
| 1831 | Ga0070701_10092793 | |||
| 1832 | Ga0070711_100005768 | |||
| 1833 | Ga0070711_100010477 | |||
| 1834 | Ga0070711_100134144 | |||
| 1835 | Ga0070711_100608034 | |||
| 1836 | Ga0070700_100046342 | |||
| 1837 | Ga0070700_100403356 | |||
| 1838 | Ga0070694_100660815 | |||
| 1839 | Ga0070663_100003176 | |||
| 1840 | Ga0070663_100009537 | |||
| 1841 | Ga0070663_100026370 | |||
| 1842 | Ga0070663_100026462 | |||
| 1843 | Ga0070663_100068400 | |||
| 1844 | Ga0070663_100088275 | |||
| 1845 | Ga0070663_101222767 | |||
| 1846 | Ga0070678_100033201 | |||
| 1847 | Ga0070678_100036936 | |||
| 1848 | Ga0070678_100136851 | |||
| 1849 | Ga0070678_100258846 | |||
| 1850 | Ga0070678_100670886 | |||
| 1851 | Ga0070662_100002656 | |||
| 1852 | Ga0070662_100009910 | |||
| 1853 | Ga0070662_100069500 | |||
| 1854 | Ga0070681_10411229 | |||
| 1855 | Ga0070681_10871132 | |||
| 1856 | Ga0068867_100014079 | |||
| 1857 | Ga0068867_100031702 | |||
| 1858 | Ga0068867_100421945 | |||
| 1859 | Ga0068867_100649420 | |||
| 1860 | Ga0068867_100896653 | |||
| 1861 | Ga0068867_101901825 | |||
| 1862 | Ga0070685_10043293 | |||
| 1863 | Ga0070685_10229312 | |||
| 1864 | Ga0070707_100432434 | |||
| 1865 | Ga0070698_100402308 | |||
| 1866 | Ga0070699_100182152 | |||
| 1867 | Ga0070679_100010325 | |||
| 1868 | Ga0070679_100022659 | |||
| 1869 | Ga0070679_100095128 | |||
| 1870 | Ga0070679_100702860 | |||
| 1871 | Ga0070684_100038357 | |||
| 1872 | Ga0070684_100044466 | |||
| 1873 | Ga0070697_101460792 | |||
| 1874 | Ga0068853_100005156 | |||
| 1875 | Ga0068853_100067627 | |||
| 1876 | Ga0068853_100404177 | |||
| 1877 | Ga0070672_100014120 | |||
| 1878 | Ga0070672_100038206 | |||
| 1879 | Ga0070696_100129789 | |||
| 1880 | Ga0070696_100584535 | |||
| 1881 | Ga0070693_100028312 | |||
| 1882 | Ga0070693_100072573 | |||
| 1883 | Ga0070693_100118543 | |||
| 1884 | Ga0070693_100403398 | |||
| 1885 | Ga0070665_100046497 | |||
| 1886 | Ga0070665_100051999 | |||
| 1887 | Ga0070665_100068708 | |||
| 1888 | Ga0070665_100291457 | |||
| 1889 | Ga0070665_100324291 | |||
| 1890 | Ga0070665_100986298 | |||
| 1891 | Ga0070704_100037230 | |||
| 1892 | Ga0068855_100019978 | |||
| 1893 | Ga0068855_100136155 | |||
| 1894 | Ga0068855_100165617 | |||
| 1895 | Ga0068855_100312920 | |||
| 1896 | Ga0068855_100362099 | |||
| 1897 | Ga0068855_100478450 | |||
| 1898 | Ga0068855_100516417 | |||
| 1899 | Ga0070664_100162609 | |||
| 1900 | Ga0068857_100126257 | |||
| 1901 | Ga0068857_101694345 | |||
| 1902 | Ga0068854_100047503 | |||
| 1903 | Ga0068854_100058007 | |||
| 1904 | Ga0068854_100081599 | |||
| 1905 | Ga0068854_100356681 | |||
| 1906 | Ga0068854_100382956 | |||
| 1907 | Ga0068856_100053956 | |||
| 1908 | Ga0068856_100463353 | |||
| 1909 | Ga0068856_100692350 | |||
| 1910 | Ga0070702_100061895 | |||
| 1911 | Ga0068852_100147236 | |||
| 1912 | Ga0068852_100200033 | |||
| 1913 | Ga0068852_100201666 | |||
| 1914 | Ga0068852_100236521 | |||
| 1915 | Ga0068859_100101341 | |||
| 1916 | Ga0068859_100125588 | |||
| 1917 | Ga0068859_100563278 | |||
| 1918 | Ga0068859_101052294 | |||
| 1919 | Ga0068859_101364972 | |||
| 1920 | Ga0068864_100040306 | |||
| 1921 | Ga0068864_100292997 | |||
| 1922 | Ga0068864_100362652 | |||
| 1923 | Ga0068864_101066983 | |||
| 1924 | Ga0068866_10002426 | |||
| 1925 | Ga0068866_10033495 | |||
| 1926 | Ga0068861_100077067 | |||
| 1927 | Ga0068861_100356152 | |||
| 1928 | Ga0068861_101131658 | |||
| 1929 | Ga0068851_10049326 | |||
| 1930 | Ga0068851_10053457 | |||
| 1931 | Ga0068870_10021594 | |||
| 1932 | Ga0068870_10022666 | |||
| 1933 | Ga0068863_100022284 | |||
| 1934 | Ga0068863_100119182 | |||
| 1935 | Ga0068858_100505793 | |||
| 1936 | Ga0068860_100008962 | |||
| 1937 | Ga0068860_100009362 | |||
| 1938 | Ga0068860_100067553 | |||
| 1939 | Ga0068860_100535033 | |||
| 1940 | Ga0068860_100650756 | |||
| 1941 | Ga0068862_100031732 | |||
| 1942 | Ga0068862_100285275 | |||
| 1943 | Ga0068862_100438039 | |||
| 1944 | Ga0068862_100536366 | |||
| 1945 | Ga0068862_100934225 | |||
| 1946 | Ga0081455_10003720 | |||
| 1947 | Ga0081455_10022574 | |||
| 1948 | Ga0081455_10025887 | |||
| 1949 | Ga0081455_10037014 | |||
| 1950 | Ga0081538_10032637 | |||
| 1951 | Ga0081538_10225715 | |||
| 1952 | Ga0081540_1002390 | |||
| 1953 | Ga0081540_1013147 | |||
| 1954 | Ga0081540_1015337 | |||
| 1955 | Ga0081540_1017529 | |||
| 1956 | Ga0081540_1020352 | |||
| 1957 | Ga0081540_1029940 | |||
| 1958 | Ga0081540_1057036 | |||
| 1959 | Ga0081540_1078120 | |||
| 1960 | Ga0081540_1080661 | |||
| 1961 | Ga0081539_10057175 | |||
| 1962 | Ga0070717_10067804 | |||
| 1963 | Ga0070717_10125289 | |||
| 1964 | Ga0075365_10003009 | |||
| 1965 | Ga0075365_10042733 | |||
| 1966 | Ga0075365_10049499 | |||
| 1967 | Ga0075365_10051739 | |||
| 1968 | Ga0075365_10055538 | |||
| 1969 | Ga0075365_10169864 | |||
| 1970 | Ga0075365_10250500 | |||
| 1971 | Ga0075365_10315185 | |||
| 1972 | Ga0075365_10400501 | |||
| 1973 | Ga0075365_10507378 | |||
| 1974 | Ga0075368_10020688 | |||
| 1975 | Ga0075368_10048722 | |||
| 1976 | Ga0075368_10068298 | |||
| 1977 | Ga0075363_100134074 | |||
| 1978 | Ga0075363_100235982 | |||
| 1979 | Ga0075363_100476082 | |||
| 1980 | Ga0075363_100564883 | |||
| 1981 | Ga0075363_100574396 | |||
| 1982 | Ga0075364_10082487 | |||
| 1983 | Ga0075364_10207456 | |||
| 1984 | Ga0075364_10342750 | |||
| 1985 | Ga0075432_10120583 | |||
| 1986 | Ga0070715_10080047 | |||
| 1987 | Ga0070716_100034264 | |||
| 1988 | Ga0070716_100103296 | |||
| 1989 | Ga0070716_100104491 | |||
| 1990 | Ga0070716_100138237 | |||
| 1991 | Ga0070716_100266207 | |||
| 1992 | Ga0070712_100028396 | |||
| 1993 | Ga0070712_100680400 | |||
| 1994 | Ga0070712_100893489 | |||
| 1995 | Ga0075362_10079252 | |||
| 1996 | Ga0075362_10089156 | |||
| 1997 | Ga0075362_10197755 | |||
| 1998 | Ga0075367_10024941 | |||
| 1999 | Ga0075367_10029951 | |||
| 2000 | Ga0075367_10104932 | |||
| 2001 | Ga0075367_10110463 | |||
| 2002 | Ga0075367_10240617 | |||
| 2003 | Ga0075369_10033272 | |||
| 2004 | Ga0075369_10047695 | |||
| 2005 | Ga0075369_10168023 | |||
| 2006 | Ga0075369_10231437 | |||
| 2007 | Ga0075366_10055832 | |||
| 2008 | Ga0075366_10764718 | |||
| 2009 | Ga0097621_100059211 | |||
| 2010 | Ga0097621_100156305 | |||
| 2011 | Ga0097621_100618265 | |||
| 2012 | Ga0075370_10019347 | |||
| 2013 | Ga0075370_10035805 | |||
| 2014 | Ga0075370_10040301 | |||
| 2015 | Ga0075370_10477177 | |||
| 2016 | Ga0075370_10683419 | |||
| 2017 | Ga0068871_100007042 | |||
| 2018 | Ga0068871_100890450 | |||
| 2019 | Ga0075428_100162297 | |||
| 2020 | Ga0075428_100170083 | |||
| 2021 | Ga0075428_100344851 | |||
| 2022 | Ga0075430_100000092 | |||
| 2023 | Ga0075430_100057037 | |||
| 2024 | Ga0075430_100122412 | |||
| 2025 | Ga0075431_100595866 | |||
| 2026 | Ga0075431_100815598 | |||
| 2027 | Ga0075431_101146964 | |||
| 2028 | Ga0075433_10056373 | |||
| 2029 | Ga0075434_100010423 | |||
| 2030 | Ga0075434_100030654 | |||
| 2031 | Ga0075434_100241358 | |||
| 2032 | Ga0068865_100172438 | |||
| 2033 | Ga0068865_100511837 | |||
| 2034 | Ga0068865_101343343 | |||
| 2035 | Ga0075436_100006947 | |||
| 2036 | Ga0097620_100101354 | |||
| 2037 | Ga0097620_100125592 | |||
| 2038 | Ga0097620_100563295 | |||
| 2039 | Ga0097620_101052296 | |||
| 2040 | Ga0097620_101364982 | |||
| 2041 | Ga0097620_101586738 | |||
| 2042 | Ga0099824_1005597 | |||
| 2043 | Ga0099822_1000135 | |||
| 2044 | Ga0075435_100114500 | |||
| 2045 | Ga0075435_100131793 | |||
| 2046 | Ga0075435_100766264 | |||
| 2047 | Ga0099794_10021912 | |||
| 2048 | Ga0099794_10060044 | |||
| 2049 | Ga0099795_10035994 | |||
| 2050 | Ga0099795_10044832 | |||
| 2051 | Ga0099795_10048741 | |||
| 2052 | Ga0099795_10170855 | |||
| 2053 | Ga0105251_10390400 | |||
| 2054 | Ga0105244_10484345 | |||
| 2055 | Ga0105250_10174340 | |||
| 2056 | Ga0105240_10021688 | |||
| 2057 | Ga0105240_10025074 | |||
| 2058 | Ga0105240_10050477 | |||
| 2059 | Ga0105240_10825297 | |||
| 2060 | Ga0111539_10054794 | |||
| 2061 | Ga0111539_10060771 | |||
| 2062 | Ga0111539_10109696 | |||
| 2063 | Ga0111539_10110862 | |||
| 2064 | Ga0111539_10543708 | |||
| 2065 | Ga0111539_10849268 | |||
| 2066 | Ga0105245_10016805 | |||
| 2067 | Ga0105245_10024798 | |||
| 2068 | Ga0105245_10203823 | |||
| 2069 | Ga0105245_10821810 | |||
| 2070 | Ga0105247_10009003 | |||
| 2071 | Ga0105247_10060745 | |||
| 2072 | Ga0105247_10066180 | |||
| 2073 | Ga0105247_10175907 | |||
| 2074 | Ga0105247_10180619 | |||
| 2075 | Ga0105247_10550669 | |||
| 2076 | Ga0114129_10012565 | |||
| 2077 | Ga0114129_10099152 | |||
| 2078 | Ga0114129_10103012 | |||
| 2079 | Ga0114129_10164114 | |||
| 2080 | Ga0114129_10637713 | |||
| 2081 | Ga0114129_10639519 | |||
| 2082 | Ga0114129_10878100 | |||
| 2083 | Ga0105243_10022026 | |||
| 2084 | Ga0105243_10346140 | |||
| 2085 | Ga0105243_10356067 | |||
| 2086 | Ga0105241_10024174 | |||
| 2087 | Ga0105241_10048580 | |||
| 2088 | Ga0105241_10116858 | |||
| 2089 | Ga0105241_10368126 | |||
| 2090 | Ga0105241_10492911 | |||
| 2091 | Ga0105241_10658765 | |||
| 2092 | Ga0105241_10846850 | |||
| 2093 | Ga0105241_11211076 | |||
| 2094 | Ga0105242_10101504 | |||
| 2095 | Ga0105248_10077052 | |||
| 2096 | Ga0105248_10512781 | |||
| 2097 | Ga0105237_10008878 | |||
| 2098 | Ga0105237_10015340 | |||
| 2099 | Ga0105237_10129706 | |||
| 2100 | Ga0105237_10133066 | |||
| 2101 | Ga0105237_10792988 | |||
| 2102 | Ga0105238_10146676 | |||
| 2103 | Ga0105238_10148405 | |||
| 2104 | Ga0105238_10286075 | |||
| 2105 | Ga0105238_12207788 | |||
| 2106 | Ga0105249_10012243 | |||
| 2107 | Ga0105249_10036785 | |||
| 2108 | Ga0105249_10204487 | |||
| 2109 | Ga0105249_10931613 | |||
| 2110 | Ga0099796_10001500 | |||
| 2111 | Ga0099796_10021234 | |||
| 2112 | Ga0099796_10146526 | |||
| 2113 | Ga0105239_10058078 | |||
| 2114 | Ga0105239_10075274 | |||
| 2115 | Ga0105239_10079699 | |||
| 2116 | Ga0105239_10082681 | |||
| 2117 | Ga0105239_10141126 | |||
| 2118 | Ga0105239_10162375 | |||
| 2119 | Ga0105239_10424858 | |||
| 2120 | Ga0105239_10609090 | |||
| 2121 | Ga0105239_11020883 | |||
| 2122 | Ga0105239_11691636 | |||
| 2123 | Ga0105246_10042475 | |||
| 2124 | Ga0105246_10105627 | |||
| 2125 | Ga0105246_10145260 | |||
| 2126 | Ga0105246_10484884 | |||
| 2127 | Ga0157373_10149571 | |||
| 2128 | Ga0157373_10736059 | |||
| 2129 | Ga0157373_10821079 | |||
| 2130 | Ga0157371_10191662 | |||
| 2131 | Ga0157370_10139150 | |||
| 2132 | Ga0157370_10238280 | |||
| 2133 | Ga0157370_10289018 | |||
| 2134 | Ga0157370_10622911 | |||
| 2135 | Ga0157370_10665099 | |||
| 2136 | Ga0157369_10006988 | |||
| 2137 | Ga0157369_10022714 | |||
| 2138 | Ga0157369_10074385 | |||
| 2139 | Ga0157369_10083984 | |||
| 2140 | Ga0157374_10037462 | |||
| 2141 | Ga0157378_10005022 | |||
| 2142 | Ga0157378_10061841 | |||
| 2143 | Ga0157378_10091824 | |||
| 2144 | Ga0163162_10074563 | |||
| 2145 | Ga0163162_10471223 | |||
| 2146 | Ga0163162_10700368 | |||
| 2147 | Ga0163162_11794836 | |||
| 2148 | Ga0157372_10066194 | |||
| 2149 | Ga0157372_10082819 | |||
| 2150 | Ga0157372_10575715 | |||
| 2151 | Ga0157372_10640431 | |||
| 2152 | Ga0157372_11260609 | |||
| 2153 | Ga0157375_10075347 | |||
| 2154 | Ga0157375_11213923 | |||
| 2155 | Ga0157375_11856529 | |||
| 2156 | Ga0163163_10006441 | |||
| 2157 | Ga0163163_10064789 | |||
| 2158 | Ga0163163_10084291 | |||
| 2159 | Ga0157380_10025556 | |||
| 2160 | Ga0157380_10157958 | |||
| 2161 | Ga0157380_10329859 | |||
| 2162 | Ga0157380_11266089 | |||
| 2163 | Ga0157377_10072463 | |||
| 2164 | Ga0157377_10198181 | |||
| 2165 | Ga0157379_10135168 | |||
| 2166 | Ga0157379_10233368 | |||
| 2167 | Ga0157379_10269860 | |||
| 2168 | Ga0157379_11086241 | |||
| 2169 | Ga0157376_10042914 | |||
| 2170 | Ga0157376_12733539 | |||
| 2171 | Ga0163161_10013443 | |||
| 2172 | Ga0163161_10022945 | |||
| 2173 | Ga0163161_10334211 | |||
| 2174 | Ga0206356_10349572 | |||
| 2175 | Ga0206356_11053787 | |||
| 2176 | Ga0206354_10934028 | |||
| 2177 | Ga0154015_1287332 | |||
| 2178 | Ga0214544_1000007 | |||
| 2179 | Ga0214542_1000007 | |||
| 2180 | Ga0214545_1000006 | |||
| 2181 | Ga0214545_1023938 | |||
| 2182 | Ga0214543_1000009 | |||
| 2183 | Ga0214543_1032603 | |||
| 2184 | Ga0214543_1041664 | |||
| 2185 | Ga0213872_10054957 | |||
| 2186 | Ga0213871_10099441 | |||
| 2187 | Ga0224712_10217562 | |||
| 2188 | Ga0228598_1049778 | |||
| 2189 | Ga0209148_1000526 | |||
| 2190 | Ga0209129_1050782 | |||
| 2191 | Ga0209233_1001391 | |||
| 2192 | Ga0209233_1001927 | |||
| 2193 | Ga0209233_1002233 | |||
| 2194 | Ga0209455_1004411 | |||
| 2195 | Ga0209455_1004523 | |||
| 2196 | Ga0207673_1052412 | |||
| 2197 | Ga0209564_1000842 | |||
| 2198 | Ga0209564_1023370 | |||
| 2199 | Ga0209758_1000015 | |||
| 2200 | Ga0209758_1001439 | |||
| 2201 | Ga0209758_1001478 | |||
| 2202 | Ga0209758_1011326 | |||
| 2203 | Ga0209758_1021699 | |||
| 2204 | Ga0209758_1048050 | |||
| 2205 | Ga0209256_1007010 | |||
| 2206 | Ga0209256_1072347 | |||
| 2207 | Ga0207426_1000186 | |||
| 2208 | Ga0207426_1001603 | |||
| 2209 | Ga0207426_1051408 | |||
| 2210 | Ga0207426_1078886 | |||
| 2211 | Ga0209257_1000983 | |||
| 2212 | Ga0207697_10094523 | |||
| 2213 | Ga0207656_10068588 | |||
| 2214 | Ga0207656_10125749 | |||
| 2215 | Ga0207696_1115447 | |||
| 2216 | Ga0207692_10407875 | |||
| 2217 | Ga0207642_10159591 | |||
| 2218 | Ga0207642_10397203 | |||
| 2219 | Ga0207710_10019564 | |||
| 2220 | Ga0207710_10061501 | |||
| 2221 | Ga0207688_10021104 | |||
| 2222 | Ga0207688_10030330 | |||
| 2223 | Ga0207680_10030111 | |||
| 2224 | Ga0207647_10097648 | |||
| 2225 | Ga0207647_10251809 | |||
| 2226 | Ga0207647_10517307 | |||
| 2227 | Ga0207699_10024964 | |||
| 2228 | Ga0207699_10172248 | |||
| 2229 | Ga0207699_10795567 | |||
| 2230 | Ga0207643_10005803 | |||
| 2231 | Ga0207643_10181086 | |||
| 2232 | Ga0207654_10005282 | |||
| 2233 | Ga0207654_10019075 | |||
| 2234 | Ga0207654_10218768 | |||
| 2235 | Ga0207654_10584195 | |||
| 2236 | Ga0207707_10000749 | |||
| 2237 | Ga0207707_10015886 | |||
| 2238 | Ga0207707_10038314 | |||
| 2239 | Ga0207707_10055348 | |||
| 2240 | Ga0207707_10419045 | |||
| 2241 | Ga0207707_10770523 | |||
| 2242 | Ga0207695_10000006 | |||
| 2243 | Ga0207695_10011353 | |||
| 2244 | Ga0207695_10338819 | |||
| 2245 | Ga0207695_10503838 | |||
| 2246 | Ga0207671_10001082 | |||
| 2247 | Ga0207671_10167317 | |||
| 2248 | Ga0207671_10237189 | |||
| 2249 | Ga0207671_10419199 | |||
| 2250 | Ga0207671_10646507 | |||
| 2251 | Ga0207671_10954732 | |||
| 2252 | Ga0207693_10012511 | |||
| 2253 | Ga0207693_10137700 | |||
| 2254 | Ga0207693_10566541 | |||
| 2255 | Ga0207663_10068214 | |||
| 2256 | Ga0207663_10281585 | |||
| 2257 | Ga0207663_10373059 | |||
| 2258 | Ga0207663_10810940 | |||
| 2259 | Ga0207663_10820053 | |||
| 2260 | Ga0207660_10001899 | |||
| 2261 | Ga0207660_10374702 | |||
| 2262 | Ga0207660_10516037 | |||
| 2263 | Ga0207660_10557944 | |||
| 2264 | Ga0207662_10004262 | |||
| 2265 | Ga0207657_10058330 | |||
| 2266 | Ga0207649_10347305 | |||
| 2267 | Ga0207652_10006792 | |||
| 2268 | Ga0207652_10016701 | |||
| 2269 | Ga0207652_10114418 | |||
| 2270 | Ga0207652_10217268 | |||
| 2271 | Ga0207652_11138165 | |||
| 2272 | Ga0207681_10043643 | |||
| 2273 | Ga0207681_10230628 | |||
| 2274 | Ga0207681_10594372 | |||
| 2275 | Ga0207681_11240734 | |||
| 2276 | Ga0207694_10382450 | |||
| 2277 | Ga0207694_11409509 | |||
| 2278 | Ga0207650_10002601 | |||
| 2279 | Ga0207650_10070888 | |||
| 2280 | Ga0207659_10110718 | |||
| 2281 | Ga0207687_10018889 | |||
| 2282 | Ga0207687_10066193 | |||
| 2283 | Ga0207687_10137034 | |||
| 2284 | Ga0207687_10157973 | |||
| 2285 | Ga0207700_10125141 | |||
| 2286 | Ga0207700_10237546 | |||
| 2287 | Ga0207700_10241217 | |||
| 2288 | Ga0207700_10326804 | |||
| 2289 | Ga0207700_10362422 | |||
| 2290 | Ga0207664_10003797 | |||
| 2291 | Ga0207664_10745102 | |||
| 2292 | Ga0207644_10122681 | |||
| 2293 | Ga0207644_10247582 | |||
| 2294 | Ga0207644_10438543 | |||
| 2295 | Ga0207644_10674083 | |||
| 2296 | Ga0207644_11012418 | |||
| 2297 | Ga0207690_10085492 | |||
| 2298 | Ga0207706_10011066 | |||
| 2299 | Ga0207706_10036752 | |||
| 2300 | Ga0207706_10054486 | |||
| 2301 | Ga0207706_11061708 | |||
| 2302 | Ga0207686_10094152 | |||
| 2303 | Ga0207686_10204173 | |||
| 2304 | Ga0207709_10932500 | |||
| 2305 | Ga0207670_10093638 | |||
| 2306 | Ga0207669_10043599 | |||
| 2307 | Ga0207669_11281898 | |||
| 2308 | Ga0207704_10053388 | |||
| 2309 | Ga0207704_10960360 | |||
| 2310 | Ga0207665_10013036 | |||
| 2311 | Ga0207665_10171960 | |||
| 2312 | Ga0207665_10360131 | |||
| 2313 | Ga0207691_10023624 | |||
| 2314 | Ga0207691_10042886 | |||
| 2315 | Ga0207691_10140532 | |||
| 2316 | Ga0207691_10184237 | |||
| 2317 | Ga0207711_10019696 | |||
| 2318 | Ga0207711_11095509 | |||
| 2319 | Ga0207689_10013175 | |||
| 2320 | Ga0207661_10001882 | |||
| 2321 | Ga0207661_10007875 | |||
| 2322 | Ga0207661_10842557 | |||
| 2323 | Ga0207661_11025764 | |||
| 2324 | Ga0207679_10301313 | |||
| 2325 | Ga0207667_10011746 | |||
| 2326 | Ga0207667_10068809 | |||
| 2327 | Ga0207667_10233887 | |||
| 2328 | Ga0207667_10423865 | |||
| 2329 | Ga0207667_10618831 | |||
| 2330 | Ga0207651_10022434 | |||
| 2331 | Ga0207712_10013189 | |||
| 2332 | Ga0207712_10123899 | |||
| 2333 | Ga0207712_11409346 | |||
| 2334 | Ga0207668_10023026 | |||
| 2335 | Ga0207668_10138499 | |||
| 2336 | Ga0207668_10179233 | |||
| 2337 | Ga0207668_10282630 | |||
| 2338 | Ga0207668_11365385 | |||
| 2339 | Ga0207640_10102563 | |||
| 2340 | Ga0207640_10111010 | |||
| 2341 | Ga0207640_10555623 | |||
| 2342 | Ga0207658_10254686 | |||
| 2343 | Ga0207658_10507851 | |||
| 2344 | Ga0207677_10129019 | |||
| 2345 | Ga0207703_10067309 | |||
| 2346 | Ga0207703_10170577 | |||
| 2347 | Ga0207703_11066605 | |||
| 2348 | Ga0207703_11067001 | |||
| 2349 | Ga0207639_10003831 | |||
| 2350 | Ga0207639_10043257 | |||
| 2351 | Ga0207639_10226608 | |||
| 2352 | Ga0207639_10246384 | |||
| 2353 | Ga0207639_10284636 | |||
| 2354 | Ga0207639_10328155 | |||
| 2355 | Ga0207639_10807629 | |||
| 2356 | Ga0207678_10009212 | |||
| 2357 | Ga0207678_10010040 | |||
| 2358 | Ga0207678_10012549 | |||
| 2359 | Ga0207678_10056124 | |||
| 2360 | Ga0207678_10148960 | |||
| 2361 | Ga0207678_10247500 | |||
| 2362 | Ga0207678_10401991 | |||
| 2363 | Ga0207708_10001417 | |||
| 2364 | Ga0207708_10071060 | |||
| 2365 | Ga0207708_10074492 | |||
| 2366 | Ga0207702_10244911 | |||
| 2367 | Ga0207702_10514314 | |||
| 2368 | Ga0207641_10670621 | |||
| 2369 | Ga0207641_11274485 | |||
| 2370 | Ga0207648_10003456 | |||
| 2371 | Ga0207648_10040258 | |||
| 2372 | Ga0207648_11376965 | |||
| 2373 | Ga0207648_11499871 | |||
| 2374 | Ga0207676_10048873 | |||
| 2375 | Ga0207676_10222358 | |||
| 2376 | Ga0207676_10277471 | |||
| 2377 | Ga0207676_11159217 | |||
| 2378 | Ga0207674_10070098 | |||
| 2379 | Ga0207674_11069282 | |||
| 2380 | Ga0207675_100006895 | |||
| 2381 | Ga0207675_100041152 | |||
| 2382 | Ga0207675_100044665 | |||
| 2383 | Ga0207675_100131130 | |||
| 2384 | Ga0207675_100576068 | |||
| 2385 | Ga0207675_101515866 | |||
| 2386 | Ga0207683_10034607 | |||
| 2387 | Ga0207683_10035919 | |||
| 2388 | Ga0207683_10036573 | |||
| 2389 | Ga0207683_10098907 | |||
| 2390 | Ga0207683_10151805 | |||
| 2391 | Ga0207683_10277959 | |||
| 2392 | Ga0207683_10629619 | |||
| 2393 | Ga0207698_10012596 | |||
| 2394 | Ga0207698_10178467 | |||
| 2395 | Ga0207698_10445823 | |||
| 2396 | Ga0207698_10561113 | |||
| 2397 | Ga0209389_1000076 | |||
| 2398 | Ga0209589_1000017 | |||
| 2399 | Ga0209489_100018 | |||
| 2400 | Ga0209489_108247 | |||
| 2401 | Ga0209700_100014 | |||
| 2402 | Ga0209700_100028 | |||
| 2403 | Ga0209179_1017211 | |||
| 2404 | Ga0209179_1036362 | |||
| 2405 | Ga0209588_1008658 | |||
| 2406 | Ga0209813_10003889 | |||
| 2407 | Ga0207428_10121533 | |||
| 2408 | Ga0207428_10138284 | |||
| 2409 | Ga0207428_10220298 | |||
| 2410 | Ga0207428_11298634 | |||
| 2411 | Ga0268266_10001497 | |||
| 2412 | Ga0268266_10003206 | |||
| 2413 | Ga0268266_10144068 | |||
| 2414 | Ga0268266_10338655 | |||
| 2415 | Ga0268266_10750908 | |||
| 2416 | Ga0268266_10810563 | |||
| 2417 | Ga0268265_10049761 | |||
| 2418 | Ga0268265_10056708 | |||
| 2419 | Ga0268265_10324697 | |||
| 2420 | Ga0268265_10653716 | |||
| 2421 | Ga0268265_11242667 | |||
| 2422 | Ga0268264_10000187 | |||
| 2423 | Ga0268264_10018605 | |||
| 2424 | Ga0307517_10000066 | |||
| 2425 | Ga0307517_10205126 | |||
| 2426 | Ga0307515_10028181 | |||
| 2427 | Ga0307515_10243883 | |||
| 2428 | Ga0265338_10245230 | |||
| 2429 | Ga0307511_10023569 | |||
| 2430 | Ga0307511_10153032 | |||
| 2431 | Ga0307512_10162610 | |||
| 2432 | Ga0265760_10057896 | |||
| 2433 | Ga0265332_10174372 | |||
| 2434 | Ga0265325_10058474 | |||
| 2435 | Ga0265340_10024355 | |||
| 2436 | Ga0265340_10402465 | |||
| 2437 | Ga0265339_10000069 | |||
| 2438 | Ga0307513_10183304 | |||
| 2439 | Ga0307513_10278109 | |||
| 2440 | Ga0307513_10297608 | |||
| 2441 | Ga0307509_10034527 | |||
| 2442 | Ga0307408_100042411 | |||
| 2443 | Ga0307408_100961785 | |||
| 2444 | Ga0265313_10000386 | |||
| 2445 | Ga0307508_10175895 | |||
| 2446 | Ga0307508_10183351 | |||
| 2447 | Ga0307514_10427146 | |||
| 2448 | Ga0265314_10000439 | |||
| 2449 | Ga0307516_10017467 | |||
| 2450 | Ga0307516_10039368 | |||
| 2451 | Ga0307516_10308489 | |||
| 2452 | Ga0307405_10598580 | |||
| 2453 | Ga0307405_10826569 | |||
| 2454 | Ga0307413_10024522 | |||
| 2455 | Ga0307410_10159378 | |||
| 2456 | Ga0307410_11689174 | |||
| 2457 | Ga0307412_10057105 | |||
| 2458 | Ga0307412_10145624 | |||
| 2459 | Ga0307412_10341865 | |||
| 2460 | Ga0307416_100512478 | |||
| 2461 | Ga0307414_10656081 | |||
| 2462 | Ga0307415_100182625 | |||
| 2463 | Ga0307507_10030087 | |||
| 2464 | Ga0307510_10023148 | |||
| 2465 | Ga0315911_1000033 | |||
| 2466 | Ga0373926_0174533 | |||
| 2467 | Ga0373934_0084521 | |||
| 2468 | Ga0373934_0129219 | |||
| 2469 | Ga0373944_0116703 | |||
| 2470 | Ga0373944_0155764 | |||
| 2471 | Ga0373923_0014604 | |||
| 2472 | Ga0373923_0340621 | |||
| 2473 | Ga0373936_0004895 | |||
| 2474 | Ga0373936_0032420 | |||
| 2475 | Ga0373939_0187585 | |||
| 2476 | Ga0373945_0019587 | |||
| 2477 | Ga0373945_0037419 | |||
| 2478 | Ga0373945_0106158 | |||
| 2479 | Ga0373953_0001843 | |||
| 2480 | Ga0373953_0250299 | |||
| 2481 | Ga0373954_0009761 | |||
| 2482 | Ga0373954_0070743 | |||
| 2483 | Ga0373954_0073176 | |||
| 2484 | Ga0373954_0187073 | |||
| 2485 | Ga0373954_0698591 | |||
| 2486 | Ga0373956_0135575 | |||
| 2487 | Ga0373957_0020259 | |||
| 2488 | Ga0373943_0001873 | |||
| 2489 | Ga0373943_0009955 | |||
| 2490 | Ga0373946_0002579 | |||
| 2491 | Ga0373946_0035152 | |||
| 2492 | Ga0373946_0186651 | |||
| 2493 | Ga0373955_0000087 | |||
| 2494 | Ga0373955_0009214 | |||
| 2495 | Ga0373955_0040125 | |||
| 2496 | Ga0373955_0348138 | |||
| 2497 | Ga0373955_0724914 | |||
| 2498 | Ga0373942_0056891 | |||
| 2499 | Ga0373961_0137895 | |||
| 2500 | Ga0373961_0173131 | |||
| 2501 | Ga0373924_0000324 | |||
| 2502 | Ga0373924_0022632 | |||
| 2503 | Ga0373931_0188606 | |||
| 2504 | Ga0373931_0285100 | |||
| 2505 | Ga0373931_0399189 | |||
| 2506 | Ga0373931_0811535 | |||
| 2507 | Ga0373935_0019260 | |||
| 2508 | Ga0373935_0081412 | |||
| 2509 | Ga0373935_0498432 | |||
| 2510 | Ga0373927_0005233 | |||
| 2511 | Ga0373927_0012312 | |||
| 2512 | Ga0373927_0022113 | |||
| 2513 | Ga0373927_0034876 | |||
| 2514 | Ga0373927_0043078 | |||
| 2515 | Ga0373927_0046856 | |||
| 2516 | Ga0373927_0111907 | |||
| 2517 | Ga0373927_0418466 | |||
| 2518 | Ga0373927_1018130 | |||
| 2519 | Ga0373933_0007764 | |||
| 2520 | Ga0373933_0014573 | |||
| 2521 | Ga0373933_0388563 | |||
| 2522 | Ga0373947_0013251 | |||
| 2523 | Ga0373947_0025730 | |||
| 2524 | Ga0373947_0032870 | |||
| 2525 | Ga0373947_0484254 | |||
| 2526 | Ga0373937_0000006 | |||
| 2527 | Ga0373937_0019279 | |||
| 2528 | Ga0373937_0021048 | |||
| 2529 | Ga0373937_0344465 | |||
| 2530 | Ga0373937_0574558 | |||
| 2531 | Ga0373925_0000002 | |||
| 2532 | Ga0373925_0025105 | |||
| 2533 | Ga0373925_0079650 | |||
| 2534 | Ga0373925_0287582 | |||
| 2535 | Ga0373925_1480571 | |||
| 2536 | Ga0395899_0095878 | |||
| 2537 | Ga0395900_0021672 | |||
| 2538 | Ga0395900_0029051 | |||
| 2539 | Ga0395900_1048587 | |||
| 2540 | Ga0395898_0027664 | |||
| 2541 | Ga0395898_0220933 | |||
| 2542 | Ga0395898_0442651 | |||
| 2543 | Ga0395898_0865863 | |||
| 2544 | Ga0395905_0007000 | |||
| 2545 | Ga0395905_0025550 | |||
| 2546 | Ga0395905_0067233 | |||
| 2547 | Ga0395905_0117155 | |||
| 2548 | Ga0395905_0862894 | |||
| 2549 | Ga0436364_0037060 | |||
| 2550 | Ga0436364_1045430 | |||
| 2551 | Ga0436364_1133893 | |||
| 2552 | Ga0395901_0045375 | |||
| 2553 | Ga0395901_0121953 | |||
| 2554 | Ga0395901_0208490 | |||
| 2555 | Ga0395901_0544413 | |||
| 2556 | Ga0436365_1167627 | |||
| 2557 | Ga0436365_1735497 | |||
| 2558 | Ga0436365_1749409 | |||
| 2559 | Ga0436360_0863636 | |||
| 2560 | Ga0436360_0962184 | |||
| 2561 | Ga0436360_1149403 | |||
| 2562 | Ga0436361_0295849 | |||
| 2563 | Ga0436361_0483823 | |||
| 2564 | Ga0436361_0722741 | |||
| 2565 | Ga0436361_0934439 | |||
| 2566 | Ga0436363_0935857 | |||
| 2567 | Ga0436363_1014075 | |||
| 2568 | Ga0436363_1035293 | |||
| 2569 | Ga0436363_1632085 | |||
| 2570 | Ga0436362_1188241 | |||
| 2571 | Ga0439465_0079935 | |||
| 2572 | Ga0451793_0264920 | |||
| 2573 | Ga0451793_0741245 | |||
| 2574 | Ga0451798_0486087 | |||
| 2575 | Ga0451802_0958539 | |||
| 2576 | Ga0451802_2060284 | |||
| 2577 | Ga0451835_0850209 | |||
| 2578 | Ga0451853_0710420 | |||
| 2579 | Ga0451853_1645550 | |||
| 2580 | Ga0451853_1941107 | |||
| 2581 | Ga0439431_0009109 | |||
| 2582 | Ga0439441_124859 | |||
| 2583 | Ga0450923_017676 | |||
| 2584 | Ga0439458_0008335 | |||
| 2585 | Ga0439459_0116366 | |||
| 2586 | Ga0439464_0100755 | |||
| 2587 | Ga0466969_0104606 | |||
| 2588 | Ga0466972_0000048 | |||
| 2589 | Ga0466965_0138547 | |||
| 2590 | Ga0466966_0001825 | |||
| 2591 | Ga0466961_0000010 | |||
| 2592 | Ga0466961_0061354 | |||
| 2593 | Ga0466961_0691196 | |||
| 2594 | Ga0466963_0060666 | |||
| 2595 | Ga0466968_0015512 | |||
| 2596 | Ga0466968_0411037 | |||
| 2597 | Ga0466968_0546284 | |||
| 2598 | Ga0466970_0150202 | |||
| 2599 | Ga0466970_0174907 | |||
| 2600 | Ga0466970_0574375 | |||
| 2601 | Ga0466960_0023636 | |||
| 2602 | Ga0466960_0094672 | |||
| 2603 | Ga0466959_0001429 | |||
| 2604 | Ga0466959_0018716 | |||
| 2605 | Ga0466959_1140802 | |||
| 2606 | Ga0466958_0209756 | |||
| 2607 | Ga0466958_0453984 | |||
| 2608 | Ga0466967_0084723 | |||
| 2609 | Ga0466967_0130651 | |||
| 2610 | Ga0466967_0173249 | |||
| 2611 | Ga0466967_0191337 | |||
| 2612 | Ga0466967_0587556 | |||
| 2613 | Ga0495617_022289 | |||
| 2614 | Ga0495592_0000039 | |||
| 2615 | Ga0495603_0051969 | |||
| 2616 | Ga0495603_0075019 | |||
| 2617 | Ga0495603_0157955 | |||
| 2618 | Ga0495603_0207689 | |||
| 2619 | Ga0495603_0560032 | |||
| 2620 | Ga0495629_0003335 | |||
| 2621 | Ga0495629_0036410 | |||
| 2622 | Ga0495629_0158978 | |||
| 2623 | Ga0495638_0021343 | |||
| 2624 | Ga0495638_0163599 | |||
| 2625 | Ga0495638_0546485 | |||
| 2626 | Ga0495641_0295703 | |||
| 2627 | Ga0495651_0000420 | |||
| 2628 | Ga0495651_0366299 | |||
| 2629 | Ga0495653_0000006 | |||
| 2630 | Ga0495653_0041475 | |||
| 2631 | Ga0495653_0407255 | |||
| 2632 | Ga0495650_0068534 | |||
| 2633 | Ga0495580_0078460 | |||
| 2634 | Ga0495580_0153692 | |||
| 2635 | Ga0495580_0271641 | |||
| 2636 | Ga0495582_0027180 | |||
| 2637 | Ga0495605_0034235 | |||
| 2638 | Ga0495605_0092174 | |||
| 2639 | Ga0495605_0251872 | |||
| 2640 | Ga0495639_0012056 | |||
| 2641 | Ga0495639_0025212 | |||
| 2642 | Ga0495639_0150935 | |||
| 2643 | Ga0495662_0000902 | |||
| 2644 | Ga0495662_0023798 | |||
| 2645 | Ga0495662_0070029 | |||
| 2646 | Ga0495664_0000002 | |||
| 2647 | Ga0495664_0008426 | |||
| 2648 | Ga0495584_0047627 | |||
| 2649 | Ga0495584_0074774 | |||
| 2650 | Ga0495584_0076532 | |||
| 2651 | Ga0495585_0279377 | |||
| 2652 | Ga0495585_0415052 | |||
| 2653 | Ga0495594_0228725 | |||
| 2654 | Ga0495594_0679336 | |||
| 2655 | Ga0495607_0058480 | |||
| 2656 | Ga0495583_0085220 | |||
| 2657 | Ga0495606_0260689 | |||
| 2658 | Ga0495608_0000009 | |||
| 2659 | Ga0495608_0144852 | |||
| 2660 | Ga0495608_0333098 | |||
| 2661 | Ga0495608_0400685 | |||
| 2662 | Ga0495610_0052428 | |||
| 2663 | Ga0495610_0150081 | |||
| 2664 | Ga0495616_0026359 | |||
| 2665 | Ga0495616_0200356 | |||
| 2666 | Ga0495618_0000005 | |||
| 2667 | Ga0495618_0204992 | |||
| 2668 | Ga0495618_0318103 | |||
| 2669 | Ga0495618_0341197 | |||
| 2670 | Ga0495618_0362495 | |||
| 2671 | Ga0495620_0079093 | |||
| 2672 | Ga0495628_0000002 | |||
| 2673 | Ga0495628_0071172 | |||
| 2674 | Ga0495628_0162538 | |||
| 2675 | Ga0495630_0000865 | |||
| 2676 | Ga0495630_0051956 | |||
| 2677 | Ga0495630_0339656 | |||
| 2678 | Ga0495631_0013951 | |||
| 2679 | Ga0495631_0210660 | |||
| 2680 | Ga0495631_0229205 | |||
| 2681 | Ga0495632_0022096 | |||
| 2682 | Ga0495632_0189658 | |||
| 2683 | Ga0495637_0121236 | |||
| 2684 | Ga0495643_0014364 | |||
| 2685 | Ga0495643_0222249 | |||
| 2686 | Ga0495644_0009734 | |||
| 2687 | Ga0495648_0000581 | |||
| 2688 | Ga0495648_0056213 | |||
| 2689 | Ga0495666_0163386 | |||
| 2690 | Ga0495666_0202210 | |||
| 2691 | Ga0495652_0000004 | |||
| 2692 | Ga0495652_0063438 | |||
| 2693 | Ga0495652_0116012 | |||
| 2694 | Ga0495652_1066318 | |||
| 2695 | Ga0495654_0074136 | |||
| 2696 | Ga0495654_0128388 | |||
| 2697 | Ga0495665_0082870 | |||
| 2698 | Ga0495665_0134275 | |||
| 2699 | Ga0495665_0135993 | |||
| 2700 | Ga0495640_0000005 | |||
| 2701 | Ga0495640_0028545 | |||
| 2702 | Ga0495640_0323139 | |||
| 2703 | Ga0495586_0601236 | |||
| 2704 | Ga0495587_0000007 | |||
| 2705 | Ga0495598_0160184 | |||
| 2706 | Ga0495609_0105005 | |||
| 2707 | Ga0495609_0167390 | |||
| 2708 | Ga0495609_0330708 | |||
| 2709 | Ga0495621_0043019 | |||
| 2710 | Ga0495645_0000003 | |||
| 2711 | Ga0495645_0314421 | |||
| 2712 | Ga0495622_0009840 | |||
| 2713 | Ga0495622_0044248 | |||
| 2714 | Ga0495633_0266823 | |||
| 2715 | Ga0495667_0000002 | |||
| 2716 | Ga0495667_0041062 | |||
| 2717 | Ga0495667_0080819 | |||
| 2718 | Ga0495656_0064619 | |||
| 2719 | Ga0495668_0019526 | |||
| 2720 | Ga0495668_0153539 | |||
| 2721 | Ga0495668_0428804 | |||
| 2722 | Ga0495668_0524465 | |||
| 2723 | Ga0495634_0000022 | |||
| 2724 | Ga0495634_0027017 | |||
| 2725 | Ga0495634_0106852 | |||
| 2726 | Ga0495634_0295407 | |||
| 2727 | Ga0495611_0421801 | |||
| 2728 | Ga0495625_0214820 | |||
| 2729 | Ga0495625_0669228 | |||
| 2730 | Ga0495635_0000020 | |||
| 2731 | Ga0495635_0139403 | |||
| 2732 | Ga0495635_0345915 | |||
| 2733 | Ga0495659_0089483 | |||
| 2734 | Ga0495661_0046551 | |||
| 2735 | Ga0495661_0071177 | |||
| 2736 | Ga0495588_0001128 | |||
| 2737 | Ga0495657_0005933 | |||
| 2738 | Ga0495657_0151728 | |||
| 2739 | Ga0495599_0000001 | |||
| 2740 | Ga0495623_0000001 | |||
| 2741 | Ga0495623_0279726 | |||
| 2742 | Ga0495646_0000013 | |||
| 2743 | Ga0495646_0333880 | |||
| 2744 | Ga0495647_0057606 | |||
| 2745 | Ga0495647_0066275 | |||
| 2746 | Ga0495658_0006871 | |||
| 2747 | Ga0495658_0099679 | |||
| 2748 | Ga0495669_0010706 | |||
| 2749 | Ga0495669_0134825 | |||
| 2750 | Ga0495613_0008762 | |||
| 2751 | Ga0495613_0164148 | |||
| 2752 | Ga0495624_0027286 | |||
| 2753 | Ga0495624_0104910 | |||
| 2754 | Ga0495624_0119842 | |||
| 2755 | Ga0495624_0246240 | |||
| 2756 | Ga0495670_0174025 | |||
| 2757 | Ga0495670_0208396 | |||
| 2758 | Ga0495600_0000006 | |||
| 2759 | Ga0495600_0050180 | |||
| 2760 | Ga0495600_0545247 | |||
| 2761 | Ga0495581_0201426 | |||
| 2762 | Ga0495581_0432674 | |||
| 2763 | Ga0495604_0000005 | |||
| 2764 | Ga0495674_0000003 | |||
| 2765 | Ga0495674_0026763 | |||
| 2766 | Ga0495674_0029755 | |||
| 2767 | Ga0495674_0301755 | |||
| 2768 | Ga0495672_0073646 | |||
| 2769 | Ga0495672_0120039 | |||
| 2770 | Ga0495672_0142437 | |||
| 2771 | Ga0495676_0043345 | |||
| 2772 | Ga0495676_0196698 | |||
| 2773 | Ga0495676_0234846 | |||
| 2774 | Ga0495676_0316426 | |||
| 2775 | Ga0495680_0000002 | |||
| 2776 | Ga0495680_0020201 | |||
| 2777 | Ga0495680_0763443 | |||
| 2778 | Ga0495675_0000010 | |||
| 2779 | Ga0495685_160498 | |||
| 2780 | Ga0495673_0070442 | |||
| 2781 | Ga0495681_0032111 | |||
| 2782 | Ga0495681_0134698 | |||
| 2783 | Ga0495684_0000028 | |||
| 2784 | Ga0495684_0017374 | |||
| 2785 | Ga0495684_0203669 | |||
| 2786 | Ga0495686_0039649 | |||
| 2787 | Ga0495686_0466041 | |||
| 2788 | Ga0495593_0002430 | |||
| 2789 | Ga0495593_0099474 | |||
| 2790 | Ga0495593_0110371 | |||
| 2791 | Ga0495593_0141895 | |||
| 2792 | Ga0495602_0000054 | |||
| 2793 | Ga0495602_0037475 | |||
| 2794 | Ga0495614_0161126 | |||
| 2795 | Ga0496100_0044814 | |||
| 2796 | Ga0496100_0106898 | |||
| 2797 | Ga0496100_0209770 | |||
| 2798 | Ga0496101_0005169 | |||
| 2799 | Ga0496101_0015900 | |||
| 2800 | Ga0496101_0080527 | |||
| 2801 | Ga0496101_0194710 | |||
| 2802 | Ga0496101_0623813 | |||
| 2803 | Ga0496101_0974203 | |||
| 2804 | Ga0496101_1073095 | |||
| 2805 | Ga0496102_0016269 | |||
| 2806 | Ga0496102_0017625 | |||
| 2807 | Ga0496102_0038023 | |||
| 2808 | Ga0496102_0108889 | |||
| 2809 | Ga0496102_0148571 | |||
| 2810 | Ga0496102_0204221 | |||
| 2811 | Ga0496102_0288805 | |||
| 2812 | Ga0496102_0336023 | |||
| 2813 | Ga0496102_0663230 | |||
| 2814 | Ga0496103_0008958 | |||
| 2815 | Ga0496103_0038987 | |||
| 2816 | Ga0496103_0241722 | |||
| 2817 | Ga0496103_0557481 | |||
| 2818 | Ga0496103_0705397 | |||
| 2819 | Ga0496104_0000752 | |||
| 2820 | Ga0496104_0001154 | |||
| 2821 | Ga0496104_0014659 | |||
| 2822 | Ga0496104_0087718 | |||
| 2823 | Ga0496104_0093172 | |||
| 2824 | Ga0496104_0482804 | |||
| 2825 | Ga0496104_0488081 | |||
| 2826 | Ga0496105_0002078 | |||
| 2827 | Ga0496105_0021814 | |||
| 2828 | Ga0496105_0036926 | |||
| 2829 | Ga0496105_0057525 | |||
| 2830 | Ga0496106_0004854 | |||
| 2831 | Ga0496106_0012780 | |||
| 2832 | Ga0496106_0014933 | |||
| 2833 | Ga0496106_0018287 | |||
| 2834 | Ga0496106_0033800 | |||
| 2835 | Ga0496106_0079035 | |||
| 2836 | Ga0496106_0251061 | |||
| 2837 | Ga0496106_0380576 | |||
| 2838 | Ga0496106_0802771 | |||
| 2839 | Ga0496107_0002063 | |||
| 2840 | Ga0496107_0012286 | |||
| 2841 | Ga0496107_0026111 | |||
| 2842 | Ga0496107_0115169 | |||
| 2843 | Ga0496107_0124807 | |||
| 2844 | Ga0496107_0170103 | |||
| 2845 | Ga0496107_0255689 | |||
| 2846 | Ga0496107_0327407 | |||
| 2847 | Ga0496107_0736800 | |||
| 2848 | Ga0496107_0989747 | |||
| 2849 | Ga0496108_0000847 | |||
| 2850 | Ga0496108_0021993 | |||
| 2851 | Ga0496108_0073171 | |||
| 2852 | Ga0496108_0173275 | |||
| 2853 | Ga0496108_0369280 | |||
| 2854 | Ga0496108_0532210 | |||
| 2855 | Ga0496108_1031379 | |||
| 2856 | Ga0496109_0007107 | |||
| 2857 | Ga0496109_0113994 | |||
| 2858 | Ga0496109_0123051 | |||
| 2859 | Ga0496109_0302108 | |||
| 2860 | Ga0496109_1612343 | |||
| 2861 | Ga0496110_0002115 | |||
| 2862 | Ga0496110_0041272 | |||
| 2863 | Ga0496110_0043021 | |||
| 2864 | Ga0496110_0053050 | |||
| 2865 | Ga0496110_0150948 | |||
| 2866 | Ga0496111_0007131 | |||
| 2867 | Ga0496111_0020057 | |||
| 2868 | Ga0496112_0001693 | |||
| 2869 | Ga0496112_0084820 | |||
| 2870 | Ga0496112_0117488 | |||
| 2871 | Ga0496112_0189517 | |||
| 2872 | Ga0496112_0834535 | |||
| 2873 | Ga0496112_0869243 | |||
| 2874 | Ga0496113_0000309 | |||
| 2875 | Ga0496113_0008991 | |||
| 2876 | Ga0496113_0030517 | |||
| 2877 | Ga0496113_0069199 | |||
| 2878 | Ga0496113_0242764 | |||
| 2879 | Ga0496113_0276843 | |||
| 2880 | Ga0496114_0019710 | |||
| 2881 | Ga0496114_0022294 | |||
| 2882 | Ga0496114_0777175 | |||
| 2883 | Ga0496114_1245459 | |||
| 2884 | Ga0496115_0001756 | |||
| 2885 | Ga0496115_0066765 | |||
| 2886 | Ga0496115_0296817 | |||
| 2887 | Ga0496115_0818717 | |||
| 2888 | Ga0496116_0012076 | |||
| 2889 | Ga0496116_0225339 | |||
| 2890 | Ga0496117_0010737 | |||
| 2891 | Ga0496117_0096648 | |||
| 2892 | Ga0496117_0178790 | |||
| 2893 | Ga0496118_0002489 | |||
| 2894 | Ga0496118_0059097 | |||
| 2895 | Ga0496118_0089003 | |||
| 2896 | Ga0496118_0177019 | |||
| 2897 | Ga0496118_0341886 | |||
| 2898 | Ga0496118_0515077 | |||
| 2899 | Ga0496119_0036141 | |||
| 2900 | Ga0496119_0037643 | |||
| 2901 | Ga0496120_0016036 | |||
| 2902 | Ga0496121_0000144 | |||
| 2903 | Ga0496121_0000596 | |||
| 2904 | Ga0496121_0004090 | |||
| 2905 | Ga0496121_0017154 | |||
| 2906 | Ga0496121_0126534 | |||
| 2907 | Ga0496121_0196510 | |||
| 2908 | Ga0496121_0286923 | |||
| 2909 | Ga0496121_0387643 | |||
| 2910 | Ga0496121_0463086 | |||
| 2911 | Ga0496121_0806264 | |||
| 2912 | Ga0496122_0027842 | |||
| 2913 | Ga0496122_0063040 | |||
| 2914 | Ga0496122_0427139 | |||
| 2915 | Ga0496123_0129758 | |||
| 2916 | Ga0496123_0204426 | |||
| 2917 | Ga0496124_0002408 | |||
| 2918 | Ga0496124_0053794 | |||
| 2919 | Ga0496124_0069113 | |||
| 2920 | Ga0496124_0077908 | |||
| 2921 | Ga0496124_0370832 | |||
| 2922 | Ga0496125_0003506 | |||
| 2923 | Ga0496125_0114942 | |||
| 2924 | Ga0496125_0116128 | |||
| 2925 | Ga0496125_0367578 | |||
| 2926 | Ga0496126_0007999 | |||
| 2927 | Ga0496126_0011286 | |||
| 2928 | Ga0496126_0012837 | |||
| 2929 | Ga0496126_0021277 | |||
| 2930 | Ga0496126_0034894 | |||
| 2931 | Ga0496126_0124028 | |||
| 2932 | Ga0496126_0135771 | |||
| 2933 | Ga0496126_0577353 | |||
| 2934 | Ga0495678_164239 | |||
| 2935 | Ga0501031_0000377 | |||
| 2936 | Ga0501031_0145879 | |||
| 2937 | Ga0501031_0168619 | |||
| 2938 | Ga0501031_0239138 | |||
| 2939 | Ga0501032_0000040 | |||
| 2940 | Ga0501032_0037362 | |||
| 2941 | Ga0501032_0052204 | |||
| 2942 | Ga0501032_0067661 | |||
| 2943 | Ga0501032_0558656 | |||
| 2944 | Ga0501032_0877503 | |||
| 2945 | Ga0501033_0000128 | |||
| 2946 | Ga0501033_0011352 | |||
| 2947 | Ga0501033_0095825 | |||
| 2948 | Ga0501033_0253887 | |||
| 2949 | Ga0501033_0577417 | |||
| 2950 | Ga0501033_0599434 | |||
| 2951 | Ga0501033_0648245 | |||
| 2952 | Ga0501034_0000113 | |||
| 2953 | Ga0501034_0013557 | |||
| 2954 | Ga0501034_0040597 | |||
| 2955 | Ga0501034_0053453 | |||
| 2956 | Ga0501034_0158181 | |||
| 2957 | Ga0501034_0167481 | |||
| 2958 | Ga0501034_0217999 | |||
| 2959 | Ga0501036_0001021 | |||
| 2960 | Ga0501036_0020539 | |||
| 2961 | Ga0501036_0098766 | |||
| 2962 | Ga0501036_0110839 | |||
| 2963 | Ga0501036_0173953 | |||
| 2964 | Ga0501036_0211351 | |||
| 2965 | Ga0501036_0535855 | |||
| 2966 | Ga0501036_0577196 | |||
| 2967 | Ga0501036_0997671 | |||
| 2968 | Ga0501037_0000041 | |||
| 2969 | Ga0501037_0010332 | |||
| 2970 | Ga0501037_0012130 | |||
| 2971 | Ga0501037_0021227 | |||
| 2972 | Ga0501037_0041461 | |||
| 2973 | Ga0501037_0045962 | |||
| 2974 | Ga0501037_0294816 | |||
| 2975 | Ga0501037_0370454 | |||
| 2976 | Ga0501038_0003329 | |||
| 2977 | Ga0501038_0039602 | |||
| 2978 | Ga0501038_0055243 | |||
| 2979 | Ga0501038_0427937 | |||
| 2980 | Ga0501038_0680136 | |||
| 2981 | Ga0501038_1068171 | |||
| 2982 | Ga0501038_1216276 | |||
| 2983 | Ga0501039_0005709 | |||
| 2984 | Ga0501039_0058373 | |||
| 2985 | Ga0501039_0184580 | |||
| 2986 | Ga0501039_0186564 | |||
| 2987 | Ga0501039_0334713 | |||
| 2988 | Ga0501039_0341601 | |||
| 2989 | Ga0501039_0647325 | |||
| 2990 | Ga0501039_0717597 | |||
| 2991 | Ga0501040_0039032 | |||
| 2992 | Ga0501040_0220767 | |||
| 2993 | Ga0501040_1059685 | |||
| 2994 | Ga0501042_0011820 | |||
| 2995 | Ga0501042_0020143 | |||
| 2996 | Ga0501042_0318778 | |||
| 2997 | Ga0501042_0715278 | |||
| 2998 | Ga0501042_1384036 | |||
| 2999 | Ga0501043_0001803 | |||
| 3000 | Ga0501043_0005879 | |||
| 3001 | Ga0501043_0014802 | |||
| 3002 | Ga0501043_0168838 | |||
| 3003 | Ga0501043_0194658 | |||
| 3004 | Ga0501043_0268363 | |||
| 3005 | Ga0501043_0269434 | |||
| 3006 | Ga0501043_0341634 | |||
| 3007 | Ga0501046_0002091 | |||
| 3008 | Ga0501046_0004930 | |||
| 3009 | Ga0501046_0272709 | |||
| 3010 | Ga0501046_0564469 | |||
| 3011 | Ga0501046_0785793 | |||
| 3012 | Ga0501047_0000044 | |||
| 3013 | Ga0501047_0014719 | |||
| 3014 | Ga0501047_0017793 | |||
| 3015 | Ga0501047_0043245 | |||
| 3016 | Ga0501047_0113095 | |||
| 3017 | Ga0501047_0285144 | |||
| 3018 | Ga0501047_0515071 | |||
| 3019 | Ga0501047_0584914 | |||
| 3020 | Ga0501048_0000117 | |||
| 3021 | Ga0501048_0000150 | |||
| 3022 | Ga0501048_0083845 | |||
| 3023 | Ga0501067_0000938 | |||
| 3024 | Ga0501067_0090031 | |||
| 3025 | Ga0501067_0103699 | |||
| 3026 | Ga0501067_0122932 | |||
| 3027 | Ga0501068_0003225 | |||
| 3028 | Ga0501068_0032603 | |||
| 3029 | Ga0501068_0085489 | |||
| 3030 | Ga0501068_0252510 | |||
| 3031 | Ga0501069_0005145 | |||
| 3032 | Ga0501069_0035152 | |||
| 3033 | Ga0501070_0002301 | |||
| 3034 | Ga0501070_0015142 | |||
| 3035 | Ga0501070_0088235 | |||
| 3036 | Ga0501070_0116891 | |||
| 3037 | Ga0501070_0169158 | |||
| 3038 | Ga0501070_0497528 | |||
| 3039 | Ga0501070_0970468 | |||
| 3040 | Ga0501071_0036255 | |||
| 3041 | Ga0501071_0078945 | |||
| 3042 | Ga0501071_0371878 | |||
| 3043 | Ga0501072_0000156 | |||
| 3044 | Ga0501072_0213597 | |||
| 3045 | Ga0501072_0222416 | |||
| 3046 | Ga0501072_0783783 | |||
| 3047 | Ga0501072_0987131 | |||
| 3048 | Ga0501073_0000669 | |||
| 3049 | Ga0501073_0103805 | |||
| 3050 | Ga0501073_0119862 | |||
| 3051 | Ga0501073_0691925 | |||
| 3052 | Ga0501073_0747740 | |||
| 3053 | Ga0501074_0000035 | |||
| 3054 | Ga0501074_0065786 | |||
| 3055 | Ga0501074_0066337 | |||
| 3056 | Ga0501074_0147158 | |||
| 3057 | Ga0501074_1233886 | |||
| 3058 | Ga0501075_0085558 | |||
| 3059 | Ga0501075_0155000 | |||
| 3060 | Ga0501075_1065255 | |||
| 3061 | Ga0501075_1182861 | |||
| 3062 | Ga0501076_0057149 | |||
| 3063 | Ga0501076_0088285 | |||
| 3064 | Ga0501076_0092311 | |||
| 3065 | Ga0501076_0327172 | |||
| 3066 | Ga0501077_0456203 | |||
| 3067 | Ga0501077_0681213 | |||
| 3068 | Ga0501253_061590 | |||
| 3069 | Ga0501079_0198613 | |||
| 3070 | Ga0501079_0751103 | |||
| 3071 | Ga0501079_1253174 | |||
| 3072 | Ga0501080_0001372 | |||
| 3073 | Ga0501080_0003476 | |||
| 3074 | Ga0501080_0008844 | |||
| 3075 | Ga0501080_0034245 | |||
| 3076 | Ga0501080_0139418 | |||
| 3077 | Ga0501080_0189542 | |||
| 3078 | Ga0501080_0932591 | |||
| 3079 | Ga0501080_1619056 | |||
| 3080 | Ga0501081_0224850 | |||
| 3081 | Ga0501083_0001836 | |||
| 3082 | Ga0501083_0009709 | |||
| 3083 | Ga0501083_0015275 | |||
| 3084 | Ga0501083_0042930 | |||
| 3085 | Ga0501083_0591005 | |||
| 3086 | Ga0501035_0000128 | |||
| 3087 | Ga0501035_0032494 | |||
| 3088 | Ga0501035_0032953 | |||
| 3089 | Ga0501035_0120217 | |||
| 3090 | Ga0501035_0150940 | |||
| 3091 | Ga0501035_0161475 | |||
| 3092 | Ga0501035_0367334 | |||
| 3093 | Ga0501044_0000108 | |||
| 3094 | Ga0501044_0006423 | |||
| 3095 | Ga0501044_0009883 | |||
| 3096 | Ga0501044_0019459 | |||
| 3097 | Ga0501044_0142723 | |||
| 3098 | Ga0501044_0190215 | |||
| 3099 | Ga0501044_0208322 | |||
| 3100 | Ga0501044_0708604 | |||
| 3101 | Ga0501044_0982868 | |||
| 3102 | Ga0501045_0183885 | |||
| 3103 | Ga0501045_0976428 | |||
| 3104 | nmdc:mga03683_2375_c1 | |||
| 3105 | nmdc:mga03683_91139_c1 | |||
| 3106 | nmdc:mga03n38_118081_c1 | |||
| 3107 | nmdc:mga03n38_3257_c1 | |||
| 3108 | nmdc:mga03n38_405748_c1 | |||
| 3109 | nmdc:mga03n38_529699_c1 | |||
| 3110 | nmdc:mga03n38_53519_c1 | |||
| 3111 | nmdc:mga03n38_55853_c1 | |||
| 3112 | nmdc:mga00v17_103636_c1 | |||
| 3113 | nmdc:mga00v17_140810_c1 | |||
| 3114 | nmdc:mga00v17_16449_c2 | |||
| 3115 | nmdc:mga00v17_201674_c1 | |||
| 3116 | nmdc:mga00v17_624641_c1 | |||
| 3117 | nmdc:mga0yw44_1343_c1 | |||
| 3118 | nmdc:mga0yw44_16958_c1 | |||
| 3119 | nmdc:mga0yw44_263007_c1 | |||
| 3120 | nmdc:mga0yw44_332703_c1 | |||
| 3121 | nmdc:mga0yw44_6896_c1 | |||
| 3122 | nmdc:mga0yw44_73491_c1 | |||
| 3123 | nmdc:mga0yw44_785498_c1 | |||
| 3124 | nmdc:mga0yw44_85195_c1 | |||
| 3125 | nmdc:mga0yw44_87690_c1 | |||
| 3126 | nmdc:mga0yw44_9699_c1 | |||
| 3127 | nmdc:mga0k408_208507_c1 | |||
| 3128 | nmdc:mga0k408_511580_c1 | |||
| 3129 | nmdc:mga06z11_15640_c1 | |||
| 3130 | nmdc:mga06z11_23680_c1 | |||
| 3131 | nmdc:mga06z11_321745_c1 | |||
| 3132 | nmdc:mga06z11_334846_c1 | |||
| 3133 | nmdc:mga04h51_3971_c1 | |||
| 3134 | nmdc:mga07m45_224210_c1 | |||
| 3135 | nmdc:mga07m45_264602_c1 | |||
| 3136 | nmdc:mga07m45_52848_c1 | |||
| 3137 | nmdc:mga07m45_650099_c1 | |||
| 3138 | nmdc:mga07m45_693067_c1 | |||
| 3139 | nmdc:mga05p37_131206_c1 | |||
| 3140 | nmdc:mga05p37_1810829_c1 | |||
| 3141 | nmdc:mga05p37_615640_c1 | |||
| 3142 | nmdc:mga05p37_85477_c1 | |||
| 3143 | nmdc:mga05p37_87002_c1 | |||
| 3144 | nmdc:mga05p37_8728_c1 | |||
| 3145 | nmdc:mga09592_528607_c1 | |||
| 3146 | nmdc:mga09592_662231_c1 | |||
| 3147 | nmdc:mga0qj67_1283644_c1 | |||
| 3148 | nmdc:mga0qj67_184268_c1 | |||
| 3149 | nmdc:mga0qj67_55_c1 | |||
| 3150 | nmdc:mga06r32_1054100_c1 | |||
| 3151 | nmdc:mga06r32_147362_c1 | |||
| 3152 | nmdc:mga06r32_155378_c1 | |||
| 3153 | nmdc:mga06r32_428092_c1 | |||
| 3154 | nmdc:mga06r32_51211_c1 | |||
| 3155 | nmdc:mga06r32_75750_c1 | |||
| 3156 | nmdc:mga06r32_88189_c1 | |||
| 3157 | nmdc:mga08y16_1142763_c1 | |||
| 3158 | nmdc:mga08y16_134099_c1 | |||
| 3159 | nmdc:mga08y16_135009_c1 | |||
| 3160 | nmdc:mga08y16_139869_c1 | |||
| 3161 | nmdc:mga08y16_184749_c1 | |||
| 3162 | nmdc:mga08y16_319802_c1 | |||
| 3163 | nmdc:mga0n895_10223_c1 | |||
| 3164 | nmdc:mga0n895_105146_c1 | |||
| 3165 | nmdc:mga0n895_1322_c1 | |||
| 3166 | nmdc:mga0n895_53760_c1 | |||
| 3167 | nmdc:mga0n895_55453_c1 | |||
| 3168 | nmdc:mga0rr50_264029_c1 | |||
| 3169 | nmdc:mga0rr50_388515_c1 | |||
| 3170 | nmdc:mga0rr50_428656_c1 | |||
| 3171 | nmdc:mga08x19_26607_c1 | |||
| 3172 | nmdc:mga0a205_131847_c1 | |||
| 3173 | nmdc:mga0a205_349472_c1 | |||
| 3174 | nmdc:mga0a205_67193_c1 | |||
| 3175 | nmdc:mga0sz30_119113_c1 | |||
| 3176 | nmdc:mga0sz30_316245_c1 | |||
| 3177 | nmdc:mga0sz30_56993_c2 | |||
| 3178 | Ga0495601_0000008 | |||
| 3179 | Ga0495601_0056850 | |||
| 3180 | Ga0495601_0066236 | |||
| 3181 | Ga0495601_0236845 | |||
| 3182 | Ga0495601_0247343 | |||
| 3183 | Ga0495601_0971416 | |||
| 3184 | Ga0495612_0000002 | |||
| 3185 | Ga0495612_0009839 | |||
| 3186 | Ga0495612_0220273 | |||
| 3187 | Ga0495655_0008907 | |||
| 3188 | Ga0495655_0011257 | |||
| 3189 | Ga0495655_0058527 | |||
| 3190 | Ga0495595_0000008 | |||
| 3191 | Ga0495595_0089654 | |||
| 3192 | Ga0495619_0000002 | |||
| 3193 | Ga0495619_0056568 | |||
| 3194 | Ga0495619_0182480 | |||
| 3195 | Ga0495619_1070853 | |||
| 3196 | Ga0500578_0334058 | |||
| 3197 | Ga0500578_0462427 | |||
| 3198 | Ga0500644_0041434 | |||
| 3199 | Ga0500583_0226366 | |||
| 3200 | Ga0500651_0051030 | |||
| 3201 | Ga0500651_0055403 | |||
| 3202 | Ga0500566_0002184 | |||
| 3203 | Ga0500566_0008546 | |||
| 3204 | Ga0500566_0075420 | |||
| 3205 | Ga0500641_0005872 | |||
| 3206 | Ga0500641_0096783 | |||
| 3207 | Ga0500650_0010755 | |||
| 3208 | Ga0500554_001065 | |||
| 3209 | Ga0500554_057265 | |||
| 3210 | Ga0500556_0000005 | |||
| 3211 | Ga0500556_0031516 | |||
| 3212 | Ga0500562_054520 | |||
| 3213 | Ga0500569_029514 | |||
| 3214 | Ga0500594_0117443 | |||
| 3215 | Ga0500595_005259 | |||
| 3216 | Ga0500595_030385 | |||
| 3217 | Ga0500607_115755 | |||
| 3218 | Ga0500608_000330 | |||
| 3219 | Ga0500608_078733 | |||
| 3220 | Ga0500642_0000009 | |||
| 3221 | Ga0500642_0000022 | |||
| 3222 | Ga0500642_0282913 | |||
| 3223 | Ga0500652_003127 | |||
| 3224 | Ga0500559_0000696 | |||
| 3225 | Ga0500559_0379150 | |||
| 3226 | Ga0500568_0002658 | |||
| 3227 | Ga0500568_0031049 | |||
| 3228 | Ga0500577_0090796 | |||
| 3229 | Ga0500586_006662 | |||
| 3230 | Ga0500588_0035951 | |||
| 3231 | Ga0500589_038036 | |||
| 3232 | Ga0500590_172977 | |||
| 3233 | Ga0500603_274380 | |||
| 3234 | Ga0500604_0152582 | |||
| 3235 | Ga0500604_0333385 | |||
| 3236 | Ga0500616_0000035 | |||
| 3237 | Ga0500616_0049669 | |||
| 3238 | Ga0500622_0002093 | |||
| 3239 | Ga0500622_0029103 | |||
| 3240 | Ga0500622_0096805 | |||
| 3241 | Ga0500627_0052630 | |||
| 3242 | Ga0500627_0356800 | |||
| 3243 | Ga0500627_0472970 | |||
| 3244 | Ga0500633_0093090 | |||
| 3245 | Ga0500633_0146363 | |||
| 3246 | Ga0500634_0086499 | |||
| 3247 | Ga0500638_013277 | |||
| 3248 | Ga0500638_231524 | |||
| 3249 | Ga0500639_098906 | |||
| 3250 | Ga0500636_0074012 | |||
| 3251 | Ga0500636_0169362 | |||
| 3252 | Ga0500637_0000366 | |||
| 3253 | Ga0500637_0037469 | |||
| 3254 | Ga0500576_186502 | |||
| 3255 | Ga0500611_102005 | |||
| 3256 | Ga0500657_058763 | |||
| 3257 | Ga0500645_013757 | |||
| 3258 | Ga0500645_049443 | |||
| 3259 | Ga0500645_054110 | |||
| 3260 | Ga0500552_012778 | |||
| 3261 | Ga0500596_000812 | |||
| 3262 | Ga0501084_0002026 | |||
| 3263 | Ga0501084_0640839 | |||
| 3264 | Ga0500661_000195 | |||
| 3265 | Ga0501082_0057430 | |||
| 3266 | Ga0501082_0077217 | |||
| 3267 | Ga0501082_0159321 | |||
| 3268 | Ga0501082_0257071 | |||
| 3269 | Ga0501082_0666912 | |||
| 3270 | Ga0466962_0068880 | |||
| 3271 | Ga0466962_0214048 | |||
| 3272 | Ga0530510_0233963 | |||
| 3273 | 3005711609 | |||
| 3274 | 2513626998 | |||
| 3275 | 2513638552 | |||
| 3276 | 2513653099 | |||
| 3277 | 2513658976 | |||
| 3278 | 2513680226 | |||
| 3279 | 2513698957 | |||
| 3280 | 2513699159 | |||
| 3281 | 2513714868 | |||
| 3282 | 2513863885 | |||
| 3283 | 2513875666 | |||
| 3284 | 2513889639 | |||
| 3285 | 2513921240 | |||
| 3286 | 2514016334 | |||
| 3287 | 2517105846 | |||
| 3288 | 2517889329 | |||
| 3289 | 2524438617 | |||
| 3290 | 2524466170 | |||
| 3291 | 2524540377 | |||
| 3292 | 2528851492 | |||
| 3293 | 2603857938 | |||
| 3294 | 2617347479 | |||
| 3295 | 2617377113 | |||
| 3296 | 2671121386 | |||
| 3297 | 2723849163 | |||
| 3298 | 2728754271 | |||
| 3299 | 2745077666 | |||
| 3300 | 2793063257 | |||
| 3301 | 2793070994 | |||
| 3302 | 2793078480 | |||
| 3303 | 2805919342 | |||
| 3304 | 2818243405 | |||
| 3305 | 2824622529 | |||
| 3306 | 2824633890 | |||
| 3307 | 2824642893 | |||
| 3308 | 2824651201 | |||
| 3309 | 2824670937 | |||
| 3310 | 2824674721 | |||
| 3311 | 2824684134 | |||
| 3312 | 2824692597 | |||
| 3313 | 2824700966 | |||
| 3314 | 2824713945 | |||
| 3315 | 2824721159 | |||
| 3316 | 2824731248 | |||
| 3317 | 2824740592 | |||
| 3318 | 2824752544 | |||
| 3319 | 2824763337 | |||
| 3320 | 2824770610 | |||
| 3321 | 2824780158 | |||
| 3322 | 2838130258 | |||
| 3323 | 2841944299 | |||
| 3324 | 2841954524 | |||
| 3325 | 2841963427 | |||
| 3326 | 2841969076 | |||
| 3327 | 2841979850 | |||
| 3328 | 2841989552 | |||
| 3329 | 2842044057 | |||
| 3330 | 2842051954 | |||
| 3331 | 2842334500 | |||
| 3332 | 2844316026 | |||
| 3333 | 2847931513 | |||
| 3334 | 2847941593 | |||
| 3335 | 2857515794 | |||
| 3336 | 2857527313 | |||
| 3337 | 2874606899 | |||
| 3338 | 2874619636 | |||
| 3339 | 2874624276 | |||
| 3340 | 2876763394 | |||
| 3341 | 2876810697 | |||
| 3342 | 2879091363 | |||
| 3343 | 2879100211 | |||
| 3344 | 2879112591 | |||
| 3345 | 2881673191 | |||
| 3346 | 2885368159 | |||
| 3347 | 2885377763 | |||
| 3348 | 2885392327 | |||
| 3349 | 2888378838 | |||
| 3350 | 2889036143 | |||
| 3351 | 2893071853 | |||
| 3352 | 2903729578 | |||
| 3353 | 2903752977 | |||
| 3354 | 2903776363 | |||
| 3355 | 2904672385 | |||
| 3356 | 2904692465 | |||
| 3357 | 2904709204 | |||
| 3358 | 2904719856 | |||
| 3359 | 2906606083 | |||
| 3360 | 2906613191 | |||
| 3361 | 2906635079 | |||
| 3362 | 2906635522 | |||
| 3363 | 2906645633 | |||
| 3364 | 2906668653 | |||
| 3365 | 2908747938 | |||
| 3366 | 2908764381 | |||
| 3367 | 2908783025 | |||
| 3368 | 2919078429 | |||
| 3369 | 2922364521 | |||
| 3370 | 2922389204 | |||
| 3371 | 2922400940 | |||
| 3372 | 2922433690 | |||
| 3373 | 2929623649 | |||
| 3374 | 2929632857 | |||
| 3375 | 2932786166 | |||
| 3376 | 2932799719 | |||
| 3377 | 2932816873 | |||
| 3378 | 2932826013 | |||
| 3379 | 2932829430 | |||
| 3380 | 2933585552 | |||
| 3381 | 2935617862 | |||
| 3382 | 2935634734 | |||
| 3383 | 2935647835 | |||
| 3384 | 2935674752 | |||
| 3385 | 2935678114 | |||
| 3386 | 2935685649 | |||
| 3387 | 2935692402 | |||
| 3388 | 2935699380 | |||
| 3389 | 2935707111 | |||
| 3390 | 2935714202 | |||
| 3391 | 2935721020 | |||
| 3392 | 2935722845 | |||
| 3393 | 2935724821 | |||
| 3394 | 2935732821 | |||
| 3395 | 2935739709 | |||
| 3396 | 2935742200 | |||
| 3397 | 2935748747 | |||
| 3398 | 2935751614 | |||
| 3399 | 2935758617 | |||
| 3400 | 2935764597 | |||
| 3401 | 2935806646 | |||
| 3402 | 2935819092 | |||
| 3403 | 2935837319 | |||
| 3404 | 2935841994 | |||
| 3405 | 2935856639 | |||
| 3406 | 2935872927 | |||
| 3407 | 2935874396 | |||
| 3408 | 2935885619 | |||
| 3409 | 2935967326 | |||
| 3410 | 2936001110 | |||
| 3411 | 2936010764 | |||
| 3412 | 2936045757 | |||
| 3413 | 2940557584 | |||
| 3414 | 2940564793 | |||
| 3415 | 2941511936 | |||
| 3416 | 2941519638 | |||
| 3417 | 2941527670 | |||
| 3418 | 2941535887 | |||
| 3419 | 2941547045 | |||
| 3420 | 3005483345 | |||
| 3421 | 3005490507 | |||
| 3422 | 3005509704 | |||
| 3423 | 3005591210 | |||
| 3424 | 3005595618 | |||
| 3425 | 3005718859 | |||
| 3426 | 8006929609 | |||
| 3427 | 8006935721 | |||
| 3428 | 8006967703 | |||
| 3429 | 8006975642 | |||
| 3430 | 8006992642 | |||
| 3431 | 8006998371 | |||
| 3432 | 8016518806 | |||
| 3433 | 8016587078 | |||
| 3434 | 8017057872 | |||
| 3435 | 8019563069 | |||
| 3436 | 8019573151 | |||
| 3437 | 8019577853 | |||
| 3438 | 8019595955 | |||
| 3439 | 8019605802 | |||
| 3440 | 8019612733 | |||
| 3441 | 8019653171 | |||
| 3442 | 8055750844 | |||
| 3443 | 8056678409 | |||
| 3444 | 8056687785 | |||
| 3445 | 8056694086 | |||
| 3446 | 8056970665 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy