F495313

General Info

Members Datasets Scaffolds Average Seq Length
1681 776 1411 295

Family's Representative Sequence

Representative Sequence 3300035170|Ga0373943_0051417|Ga0373943_0051417_186_1223
Length 345
Sequence VRLQLLNILADFYDILTPAIAERSNRTQSMNSAKPEQRKETAQTWFEALRDRLLAALEGVEDALPAGAPLSDRPAGRFKRTAWQRTDHTGAQPISGLPEIGNVNAGPAGAGLGGGVMAMMQGRVFEKVGVHVSTVFGEFAPEFRNEIPGAADDPRFYASGISLIAHPHNPHVPAAHMNTRYVVTTKSWFGGGADLTPVLERRRGQEDPDAIAFHGAMRAACDAHSRVAHYDEFKKWCDEYFYLKHRGEMRGIGGIFYDWLDSGDFAADFGFTQEVGRAFLDIYPELVRRNFAKPWSEAEREEQLVRRGRYVEFNLLYDRGTIFGLRTGGNVESILSSMPPVVKWP

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
3 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
4 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
5 2508501050 Microvirga lupini Lut6 Isolate Nodule
6 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
7 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
8 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
9 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
10 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
11 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
12 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
13 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
14 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
15 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
16 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
17 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
18 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
19 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
20 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
21 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
22 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
23 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
24 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
25 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
26 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
27 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
28 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
29 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
30 2643221563 Sphingopyxis sp. Root154 Isolate Unclassified
31 2643221608 Sphingopyxis sp. Root214 Isolate Unclassified
32 2643221651 Afipia sp. Root123D2 Isolate Unclassified
33 2643221733 Bosea sp. Root381 Isolate Unclassified
34 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
35 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
36 2738541281 Methylobacterium sp. GV094 Isolate Unclassified
37 2738543032 Methylobacterium sp. GV104 Isolate Unclassified
38 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
39 2773857925 Microvirga vignae BR3299 Isolate Unclassified
40 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
41 2775507255 Sphingobium indicum B90A Isolate Rhizosphere
42 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
43 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
44 2791355199
45 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
46 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
47 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
48 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
49 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
50 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
51 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
52 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
53 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
54 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
55 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
56 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
57 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
58 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
59 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
60 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
61 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
62 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
63 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
64 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
65 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
66 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
67 2829745981 Methylorubrum rhodinum DSM 2163 Isolate Rhizosphere
68 2835312727 Microvirga calopogonii CCBAU 65841 Isolate Nodule
69 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
70 2841911363 Bosea caraganae RCAM04685 Isolate Nodule
71 2841917233 Bosea caraganae RCAM04680 Isolate Nodule
72 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
73 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
74 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
75 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
76 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
77 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
78 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
79 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
80 2842698319 Methylobacterium sp. R-72139 Isolate Unclassified
81 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
82 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
83 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
84 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
85 2851182111 Bosea sp. Tri-44 Isolate Nodule
86 2852653556 Sphingopyxis sp. JAI108 Isolate Rhizosphere
87 2852680915 Sphingopyxis sp. JAI128 Isolate Rhizosphere
88 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
89 2861691609 Methylorubrum thiocyanatum DSM 11490 Isolate Rhizosphere
90 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
91 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
92 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
93 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
94 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
95 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
96 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
97 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
98 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
99 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
100 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
101 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
102 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
103 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
104 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
105 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
106 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
107 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
108 2882456835 Microvirga sp. KLBC 81 Isolate Unclassified
109 2883577096 Roseococcus sp. SYP-B2431 Isolate Rhizosphere
110 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
111 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
112 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
113 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
114 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
115 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
116 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
117 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
118 2894817345 Aureimonas psammosilenae YIM DR1026 Isolate Unclassified
119 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
120 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
121 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
122 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
123 2904699407
124 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
125 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
126 2906610324
127 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
128 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
129 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
130 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
131 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
132 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
133 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
134 2922368715
135 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
136 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
137 2922425934
138 2929199973 Roseomonas sp. R-73070 Hybrid assembly Isolate Unclassified
139 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
140 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
141 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
142 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
143 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
144 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
145 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
146 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
147 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
148 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
149 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
150 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
151 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
152 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
153 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
154 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
155 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
156 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
157 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
158 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
159 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
160 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
161 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
162 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
163 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
164 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
165 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
166 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
167 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
168 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
169 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
170 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
171 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
172 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
173 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
174 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
175 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
176 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
177 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
178 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
179 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
180 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
181 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
182 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
183 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
184 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
185 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
186 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
187 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
188 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
189 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
190 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
191 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
192 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
193 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
194 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
195 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
196 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
197 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
198 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
199 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
200 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
201 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
202 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
203 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
204 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
205 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
206 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
207 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
208 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
209 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
210 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
211 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
212 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
213 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
214 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
215 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
216 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
217 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
218 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
219 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
220 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
221 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
222 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
223 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
224 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
225 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
226 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
227 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
228 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
229 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
230 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
231 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
232 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
233 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
234 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
235 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
236 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
237 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
238 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
239 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
240 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
241 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
242 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
243 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
244 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
245 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
246 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
247 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
248 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
249 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
250 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
251 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
252 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
253 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
254 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
255 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
256 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
257 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
258 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
259 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
260 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
261 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
262 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
263 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
264 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
265 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
266 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
267 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
268 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
269 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
270 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
271 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
272 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
273 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
274 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
275 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
276 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
277 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
278 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
279 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
280 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
281 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
282 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
283 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
284 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
285 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
286 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
287 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
288 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
289 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
290 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
291 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
292 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
293 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
294 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
295 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
296 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
297 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
298 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
299 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
300 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
301 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
302 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
303 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
304 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
305 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
306 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
307 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
308 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
309 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
310 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
311 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
312 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
313 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
314 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
315 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
316 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
317 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
318 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
319 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
320 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
321 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
322 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
323 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
324 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
325 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
326 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
327 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
328 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
329 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
330 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
331 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
332 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
333 3300009978 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG Metagenome Rhizosphere
334 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
335 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
336 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
337 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
338 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
339 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
340 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
341 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
342 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
343 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
344 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
345 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
346 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
347 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
348 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
349 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
350 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
351 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
352 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
353 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
354 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
355 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
356 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
357 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
358 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
359 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
360 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
361 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
362 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
363 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
364 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
365 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
366 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
367 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
368 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
369 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
370 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
371 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
372 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
373 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
374 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
375 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
376 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
377 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
378 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
379 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
380 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
381 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
382 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
383 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
384 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
385 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
386 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
387 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
388 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
389 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
390 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
391 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
392 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
393 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
394 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
395 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
396 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
397 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
398 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
399 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
400 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
401 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
402 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
403 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
404 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
405 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
406 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
407 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
408 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
409 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
410 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
411 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
412 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
413 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
414 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
415 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
416 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
417 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
418 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
419 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
420 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
421 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
422 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
423 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
424 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
425 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
426 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
427 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
428 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
429 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
430 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
431 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
432 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
433 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
434 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
435 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
436 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
437 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
438 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
439 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
440 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
441 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
442 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
443 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
444 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
445 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
446 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
447 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
448 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
449 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
450 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
451 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
452 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
453 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
454 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
455 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
456 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
457 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
458 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
459 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
460 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
461 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
462 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
463 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
464 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
465 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
466 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
467 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
468 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
469 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
470 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
471 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
472 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
473 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
474 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
475 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
476 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
477 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
478 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
479 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
480 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
481 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
482 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
483 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
484 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
485 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
486 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
487 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
488 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
489 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
490 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
491 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
492 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
493 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
494 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
495 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
496 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
497 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
498 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
499 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
500 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
501 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
502 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
503 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
504 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
505 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
506 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
507 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
508 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
509 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
510 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
511 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
512 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
513 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
514 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
515 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
516 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
517 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
518 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
519 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
520 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
521 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
522 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
523 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
524 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
525 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
526 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
527 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
528 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
529 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
530 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
531 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
532 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
533 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
534 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
535 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
536 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
537 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
538 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
539 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
540 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
541 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
542 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
543 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
544 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
545 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
546 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
547 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
548 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
549 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
550 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
551 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
552 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
553 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
554 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
555 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
556 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
557 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
558 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
559 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
560 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
561 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
562 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
563 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
564 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
565 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
566 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
567 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
568 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
569 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
570 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
571 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
572 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
573 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
574 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
575 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
576 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
577 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
578 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
579 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
580 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
581 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
582 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
583 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
584 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
585 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
586 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
587 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
588 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
589 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
590 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
591 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
592 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
593 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
594 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
595 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
596 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
597 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
598 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
599 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
600 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
601 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
602 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
603 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
604 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
605 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
606 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
607 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
608 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
609 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
610 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
611 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
612 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
613 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
614 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
615 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
616 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
617 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
618 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
619 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
620 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
621 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
622 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
623 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
624 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
625 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
626 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
627 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
628 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
629 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
630 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
631 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
632 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
633 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
634 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
635 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
636 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
637 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
638 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
639 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
640 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
641 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
642 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
643 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
644 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
645 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
646 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
647 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
648 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
649 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
650 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
651 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
652 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
653 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
654 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
655 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
656 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
657 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
658 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
659 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
660 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
661 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
662 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
663 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
664 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
665 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
666 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
667 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
668 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
669 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
670 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
671 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
672 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
673 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
674 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
675 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
676 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
677 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
678 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
679 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
680 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
681 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
682 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
683 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
684 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
685 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
686 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
687 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
688 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
689 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
690 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
691 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
692 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
693 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
694 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
695 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
696 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
697 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
698 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
699 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
700 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
701 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
702 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
703 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
704 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
705 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
706 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
707 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
708 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
709 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
710 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
711 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
712 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
713 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
714 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
715 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
716 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
717 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
718 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
719 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
720 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
721 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
722 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
723 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
724 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
725 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
726 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
727 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
728 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
729 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
730 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
731 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
732 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
733 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
734 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
735 8001845381 Ancylobacter sonchi VKM B-3145 Isolate Unclassified
736 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
737 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
738 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
739 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
740 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
741 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
742 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
743 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
744 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
745 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
746 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
747 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
748 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
749 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
750 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
751 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
752 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
753 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
754 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
755 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
756 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
757 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
758 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
759 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
760 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
761 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
762 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
763 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
764 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
765 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
766 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
767 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
768 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
769 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
770 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
771 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
772 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
773 8055909800 Plastoroseomonas hellenica LMG 31523 Isolate Unclassified
774 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
775 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule
776 8057529695 Bosea vestrisii A18/4-2 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 84.13
Metatranscriptomes 0.06
Isolates 15.81

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.48
Nodule 12.14
Rhizoplane 4.76
Rhizosphere 62.34
Stem 0
Stem Tuber 0
Unclassified 9.28

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2347511 2162886007 Bacteria 2650
2 SwRhRL2b_contig_2406991 2162886007 Bacteria 893
3 JGI24736J21556_1006437 3300001904 Bacteria 1976
4 JGI24741J21665_1000512 3300001915 Bacteria 11846
5 JGI24740J21852_10002132 3300001979 Bacteria 9037
6 JGI24740J21852_10006507 3300001979 Bacteria 4828
7 JGI24739J22299_10031199 3300001989 Bacteria 1843
8 JGI24735J21928_10007012 3300002067 Bacteria 3683
9 JGI25159J45721_1013877 3300002987 Bacteria 1842
10 JGI25151J46595_10000019 3300003187 Bacteria 236340
11 JGI25406J46586_10000449 3300003203 Bacteria 19106
12 JGI25406J46586_10007061 3300003203 Bacteria 5149
13 JGI25153J46596_10001471 3300003215 Bacteria 14056
14 rootH2_10072203 3300003320 Bacteria 11128
15 rootL2_10059632 3300003322 Bacteria 2046
16 JGI25160J50197_1000851 3300003354 Bacteria 16211
17 JGI25404J52841_10007296 3300003659 Bacteria 2336
18 JGI25404J52841_10015597 3300003659 Bacteria 1648
19 Ga0055539_1005268 3300003752 Bacteria 1685
20 Ga0055529_1012682 3300003763 Bacteria 1077
21 Ga0055526_1000150 3300003771 Bacteria 61554
22 Ga0055536_1001293 3300003781 Bacteria 15394
23 Ga0055536_1005334 3300003781 Bacteria 6312
24 Ga0055530_10000310 3300003791 Bacteria 44225
25 Ga0055531_10007025 3300003794 Bacteria 6232
26 Ga0055543_1005200 3300004625 Bacteria 3367
27 Ga0065165_1001015 3300005262 Bacteria 34129
28 Ga0065165_1001200 3300005262 Bacteria 29939
29 Ga0065165_1001308 3300005262 Bacteria 27817
30 Ga0065165_1016121 3300005262 Bacteria 2813
31 Ga0065165_1056808 3300005262 Bacteria 1086
32 Ga0065704_10001979 3300005289 Bacteria 8225
33 Ga0065704_10090027 3300005289 Bacteria 2815
34 Ga0065704_10114843 3300005289 Bacteria 1883
35 Ga0070658_10074317 3300005327 Bacteria 2787
36 Ga0070676_10051847 3300005328 Bacteria 2410
37 Ga0070676_10056064 3300005328 Bacteria 2328
38 Ga0070676_10092865 3300005328 Bacteria 1852
39 Ga0070683_100065303 3300005329 Bacteria 3388
40 Ga0070683_100107348 3300005329 Bacteria 2632
41 Ga0070683_100152795 3300005329 Bacteria 2188
42 Ga0070690_100145626 3300005330 Bacteria 1611
43 Ga0070670_100020327 3300005331 Bacteria 5706
44 Ga0070670_100048139 3300005331 Bacteria 3668
45 Ga0070670_100463664 3300005331 Bacteria 1124
46 Ga0068869_100052862 3300005334 Bacteria 2951
47 Ga0068869_100089048 3300005334 Bacteria 2317
48 Ga0070666_10367110 3300005335 Bacteria 1032
49 Ga0070680_100014862 3300005336 Bacteria 6090
50 Ga0070680_100018980 3300005336 Bacteria 5442
51 Ga0070680_100030489 3300005336 Bacteria 4332
52 Ga0070680_100056438 3300005336 Bacteria 3209
53 Ga0070680_100107792 3300005336 Bacteria 2317
54 Ga0070682_100049913 3300005337 Bacteria 2610
55 Ga0070682_100164765 3300005337 Bacteria 1534
56 Ga0068868_100019171 3300005338 Bacteria 5125
57 Ga0068868_100047184 3300005338 Bacteria 3374
58 Ga0068868_100128947 3300005338 Bacteria 2068
59 Ga0068868_100499830 3300005338 Bacteria 1065
60 Ga0070660_100241659 3300005339 Bacteria 1471
61 Ga0070660_100283425 3300005339 Bacteria 1356
62 Ga0070660_100322397 3300005339 Bacteria 1269
63 Ga0070660_100334349 3300005339 Bacteria 1246
64 Ga0070687_100031773 3300005343 Bacteria 2592
65 Ga0070661_100038289 3300005344 Bacteria 3490
66 Ga0070661_100139477 3300005344 Bacteria 1826
67 Ga0070692_10142743 3300005345 Bacteria 1357
68 Ga0070668_100011646 3300005347 Bacteria 6546
69 Ga0070668_100013005 3300005347 Bacteria 6197
70 Ga0070668_100018194 3300005347 Bacteria 5273
71 Ga0070668_100093723 3300005347 Bacteria 2370
72 Ga0070668_100139662 3300005347 Bacteria 1951
73 Ga0070668_100154949 3300005347 Bacteria 1855
74 Ga0070668_100551145 3300005347 Bacteria 1004
75 Ga0070675_100027856 3300005354 Bacteria 4542
76 Ga0070675_100121009 3300005354 Bacteria 2224
77 Ga0070671_100132984 3300005355 Bacteria 2096
78 Ga0070671_100185850 3300005355 Bacteria 1760
79 Ga0070671_100200532 3300005355 Bacteria 1692
80 Ga0070671_100306662 3300005355 Bacteria 1352
81 Ga0070674_100055392 3300005356 Bacteria 2746
82 Ga0070673_100107335 3300005364 Bacteria 2309
83 Ga0070659_100049654 3300005366 Bacteria 3300
84 Ga0070659_100056042 3300005366 Bacteria 3107
85 Ga0070659_100115383 3300005366 Bacteria 2171
86 Ga0070659_100243918 3300005366 Bacteria 1488
87 Ga0070667_100044105 3300005367 Bacteria 3744
88 Ga0070667_100071421 3300005367 Bacteria 2956
89 Ga0070667_100179772 3300005367 Bacteria 1870
90 Ga0070667_100181233 3300005367 Bacteria 1863
91 Ga0070667_100200543 3300005367 Bacteria 1770
92 Ga0070709_10002072 3300005434 Bacteria 10872
93 Ga0070709_10148464 3300005434 Bacteria 1618
94 Ga0070714_100013419 3300005435 Bacteria 6566
95 Ga0070714_100057152 3300005435 Bacteria 3338
96 Ga0070714_100088227 3300005435 Bacteria 2714
97 Ga0070714_100224507 3300005435 Bacteria 1728
98 Ga0070714_100374816 3300005435 Bacteria 1341
99 Ga0070714_100430100 3300005435 Bacteria 1251
100 Ga0070713_100011888 3300005436 Bacteria 6363
101 Ga0070713_100021271 3300005436 Bacteria 4986
102 Ga0070713_100037676 3300005436 Bacteria 3910
103 Ga0070713_100063344 3300005436 Bacteria 3100
104 Ga0070713_100168782 3300005436 Bacteria 1959
105 Ga0070713_100192212 3300005436 Bacteria 1840
106 Ga0070713_100396108 3300005436 Bacteria 1289
107 Ga0070710_10002467 3300005437 Bacteria 8757
108 Ga0070710_10003520 3300005437 Bacteria 7422
109 Ga0070710_10081532 3300005437 Bacteria 1889
110 Ga0070711_100008018 3300005439 Bacteria 6447
111 Ga0070711_100011413 3300005439 Bacteria 5516
112 Ga0070711_100027217 3300005439 Bacteria 3752
113 Ga0070711_100156833 3300005439 Bacteria 1722
114 Ga0070711_100319821 3300005439 Bacteria 1239
115 Ga0070700_100368708 3300005441 Bacteria 1070
116 Ga0070700_100422605 3300005441 Bacteria 1007
117 Ga0070708_100047917 3300005445 Bacteria 3776
118 Ga0070663_100015327 3300005455 Bacteria 4945
119 Ga0070663_100029415 3300005455 Bacteria 3754
120 Ga0070663_100043607 3300005455 Bacteria 3158
121 Ga0070663_100053294 3300005455 Bacteria 2887
122 Ga0070663_100192040 3300005455 Bacteria 1589
123 Ga0070663_100209096 3300005455 Bacteria 1527
124 Ga0070678_100016373 3300005456 Bacteria 4742
125 Ga0070678_100026225 3300005456 Bacteria 3936
126 Ga0070678_100131264 3300005456 Bacteria 1991
127 Ga0070678_100167776 3300005456 Bacteria 1785
128 Ga0070678_100230267 3300005456 Bacteria 1545
129 Ga0070662_100020307 3300005457 Bacteria 4522
130 Ga0070662_100024830 3300005457 Bacteria 4133
131 Ga0070662_100248845 3300005457 Bacteria 1428
132 Ga0070681_10039132 3300005458 Bacteria 4753
133 Ga0070681_10092574 3300005458 Bacteria 2971
134 Ga0070681_10120467 3300005458 Bacteria 2559
135 Ga0070681_10149558 3300005458 Bacteria 2262
136 Ga0070681_10222783 3300005458 Bacteria 1801
137 Ga0068867_100229408 3300005459 Bacteria 1500
138 Ga0070685_10014330 3300005466 Bacteria 4198
139 Ga0070685_10048997 3300005466 Bacteria 2435
140 Ga0070706_100241629 3300005467 Bacteria 1686
141 Ga0070707_100127762 3300005468 Bacteria 2470
142 Ga0070698_100005261 3300005471 Bacteria 14154
143 Ga0070698_100095596 3300005471 Bacteria 2949
144 Ga0070679_100025223 3300005530 Bacteria 5831
145 Ga0070679_100109221 3300005530 Bacteria 2752
146 Ga0070684_100065744 3300005535 Bacteria 3183
147 Ga0070684_100069991 3300005535 Bacteria 3086
148 Ga0070684_100155743 3300005535 Bacteria 2072
149 Ga0070697_100045150 3300005536 Bacteria 3571
150 Ga0068853_100034208 3300005539 Bacteria 4313
151 Ga0068853_100060774 3300005539 Bacteria 3265
152 Ga0068853_100066013 3300005539 Bacteria 3141
153 Ga0068853_100114427 3300005539 Bacteria 2400
154 Ga0068853_100239452 3300005539 Bacteria 1662
155 Ga0070693_100050228 3300005547 Bacteria 2383
156 Ga0070693_100067096 3300005547 Bacteria 2102
157 Ga0070693_100112991 3300005547 Bacteria 1674
158 Ga0070665_100000195 3300005548 Bacteria 106493
159 Ga0070665_100020638 3300005548 Bacteria 6619
160 Ga0070665_100032502 3300005548 Bacteria 5251
161 Ga0070665_100042843 3300005548 Bacteria 4550
162 Ga0070665_100046098 3300005548 Bacteria 4379
163 Ga0070665_100051909 3300005548 Bacteria 4112
164 Ga0070665_100221673 3300005548 Bacteria 1892
165 Ga0070665_100458561 3300005548 Bacteria 1285
166 Ga0070704_100261957 3300005549 Bacteria 1425
167 Ga0068855_100022551 3300005563 Bacteria 7544
168 Ga0068855_100083171 3300005563 Bacteria 3708
169 Ga0068855_100142681 3300005563 Bacteria 2728
170 Ga0068855_100260993 3300005563 Bacteria 1930
171 Ga0068855_100349099 3300005563 Bacteria 1630
172 Ga0070664_100043999 3300005564 Bacteria 3769
173 Ga0068857_100044596 3300005577 Bacteria 3934
174 Ga0068857_100068387 3300005577 Bacteria 3161
175 Ga0068857_100171945 3300005577 Bacteria 1969
176 Ga0068857_100222594 3300005577 Bacteria 1724
177 Ga0068854_100027292 3300005578 Bacteria 3934
178 Ga0068854_100062641 3300005578 Bacteria 2697
179 Ga0068854_100192023 3300005578 Bacteria 1601
180 Ga0068856_100039721 3300005614 Bacteria 4620
181 Ga0068856_100040183 3300005614 Bacteria 4593
182 Ga0068856_100050744 3300005614 Bacteria 4090
183 Ga0068856_100107964 3300005614 Bacteria 2779
184 Ga0068852_100038691 3300005616 Bacteria 4010
185 Ga0068852_100104089 3300005616 Bacteria 2568
186 Ga0068852_100530297 3300005616 Bacteria 1176
187 Ga0068859_100164000 3300005617 Bacteria 2301
188 Ga0068859_100191528 3300005617 Bacteria 2129
189 Ga0068859_100754882 3300005617 Bacteria 1062
190 Ga0068864_100011654 3300005618 Bacteria 7260
191 Ga0068864_100123779 3300005618 Bacteria 2315
192 Ga0068861_100090532 3300005719 Bacteria 2413
193 Ga0068861_100193677 3300005719 Bacteria 1701
194 Ga0068861_100376780 3300005719 Bacteria 1252
195 Ga0068851_10003264 3300005834 Bacteria 7194
196 Ga0068851_10086111 3300005834 Bacteria 1648
197 Ga0068870_10004317 3300005840 Bacteria 6119
198 Ga0068863_100055359 3300005841 Bacteria 3756
199 Ga0068863_100172388 3300005841 Bacteria 2075
200 Ga0068863_100190541 3300005841 Bacteria 1970
201 Ga0068863_100260383 3300005841 Bacteria 1677
202 Ga0068863_100374385 3300005841 Bacteria 1390
203 Ga0068858_100092104 3300005842 Bacteria 2821
204 Ga0068860_100000324 3300005843 Bacteria 64920
205 Ga0068860_100107413 3300005843 Bacteria 2667
206 Ga0068860_100176074 3300005843 Bacteria 2067
207 Ga0068862_100152635 3300005844 Bacteria 2057
208 Ga0081455_10015269 3300005937 Bacteria 7469
209 Ga0081455_10038767 3300005937 Bacteria 4217
210 Ga0081455_10044492 3300005937 Bacteria 3872
211 Ga0081455_10137647 3300005937 Bacteria 1900
212 Ga0081455_10232590 3300005937 Bacteria 1359
213 Ga0081538_10001580 3300005981 Bacteria 23375
214 Ga0081538_10016342 3300005981 Bacteria 5696
215 Ga0081540_1000027 3300005983 Bacteria 151880
216 Ga0081540_1001733 3300005983 Bacteria 18385
217 Ga0081540_1007198 3300005983 Bacteria 7982
218 Ga0081540_1011781 3300005983 Bacteria 5816
219 Ga0081540_1018982 3300005983 Bacteria 4198
220 Ga0081540_1021410 3300005983 Bacteria 3851
221 Ga0081540_1021535 3300005983 Bacteria 3833
222 Ga0081540_1023827 3300005983 Bacteria 3568
223 Ga0081540_1030775 3300005983 Bacteria 2966
224 Ga0081539_10000306 3300005985 Bacteria 110402
225 Ga0081539_10001290 3300005985 Bacteria 44006
226 Ga0081539_10035506 3300005985 Bacteria 2995
227 Ga0081539_10036165 3300005985 Bacteria 2959
228 Ga0081539_10065113 3300005985 Bacteria 1980
229 Ga0070717_10000521 3300006028 Bacteria 24353
230 Ga0070717_10002083 3300006028 Bacteria 14010
231 Ga0070717_10063067 3300006028 Bacteria 3075
232 Ga0070717_10174051 3300006028 Bacteria 1873
233 Ga0070717_10266080 3300006028 Bacteria 1518
234 Ga0070717_10280886 3300006028 Bacteria 1477
235 Ga0070717_10571280 3300006028 Bacteria 1025
236 Ga0075365_10001829 3300006038 Bacteria 9956
237 Ga0075365_10001918 3300006038 Bacteria 9807
238 Ga0075365_10057269 3300006038 Bacteria 2593
239 Ga0075365_10063772 3300006038 Bacteria 2467
240 Ga0075365_10064317 3300006038 Bacteria 2457
241 Ga0075365_10112194 3300006038 Bacteria 1875
242 Ga0075368_10044308 3300006042 Bacteria 1755
243 Ga0075363_100005107 3300006048 Bacteria 5807
244 Ga0075363_100111851 3300006048 Bacteria 1518
245 Ga0075364_10011122 3300006051 Bacteria 5463
246 Ga0075364_10015623 3300006051 Bacteria 4711
247 Ga0075364_10134993 3300006051 Bacteria 1657
248 Ga0075364_10247364 3300006051 Bacteria 1212
249 Ga0075432_10001165 3300006058 Bacteria 8417
250 Ga0070715_10033829 3300006163 Bacteria 2092
251 Ga0070715_10034300 3300006163 Bacteria 2079
252 Ga0070715_10057089 3300006163 Bacteria 1700
253 Ga0070716_100142970 3300006173 Bacteria 1528
254 Ga0070712_100000210 3300006175 Bacteria 32927
255 Ga0070712_100006981 3300006175 Bacteria 7039
256 Ga0070712_100076021 3300006175 Bacteria 2417
257 Ga0070712_100082360 3300006175 Bacteria 2334
258 Ga0070712_100129627 3300006175 Bacteria 1910
259 Ga0070712_100243594 3300006175 Bacteria 1433
260 Ga0070712_100369824 3300006175 Bacteria 1178
261 Ga0075362_10063047 3300006177 Bacteria 1680
262 Ga0075362_10085750 3300006177 Bacteria 1456
263 Ga0075362_10166907 3300006177 Bacteria 1062
264 Ga0075367_10016972 3300006178 Bacteria 3986
265 Ga0075367_10025808 3300006178 Bacteria 3325
266 Ga0075367_10031445 3300006178 Bacteria 3048
267 Ga0075367_10033657 3300006178 Bacteria 2955
268 Ga0075367_10049089 3300006178 Bacteria 2487
269 Ga0075367_10097787 3300006178 Bacteria 1791
270 Ga0075369_10112321 3300006186 Bacteria 1229
271 Ga0075366_10064465 3300006195 Bacteria 2179
272 Ga0075366_10097533 3300006195 Bacteria 1763
273 Ga0097621_100092306 3300006237 Bacteria 2535
274 Ga0097621_100255253 3300006237 Bacteria 1537
275 Ga0075370_10007146 3300006353 Bacteria 5669
276 Ga0075370_10044151 3300006353 Bacteria 2519
277 Ga0075370_10149513 3300006353 Bacteria 1368
278 Ga0068871_100113715 3300006358 Bacteria 2280
279 Ga0068871_100521004 3300006358 Bacteria 1074
280 Ga0075428_100458633 3300006844 Bacteria 1365
281 Ga0075430_100004969 3300006846 Bacteria 11192
282 Ga0075430_100009540 3300006846 Bacteria 8202
283 Ga0075430_100219005 3300006846 Bacteria 1579
284 Ga0075430_100236589 3300006846 Bacteria 1514
285 Ga0075431_100318824 3300006847 Bacteria 1568
286 Ga0075429_100232719 3300006880 Bacteria 1614
287 Ga0068865_100108753 3300006881 Bacteria 2041
288 Ga0075436_100074121 3300006914 Bacteria 2356
289 Ga0097620_100164003 3300006931 Bacteria 2301
290 Ga0097620_100191521 3300006931 Bacteria 2129
291 Ga0097620_100754866 3300006931 Bacteria 1062
292 Ga0099824_1023696 3300006942 Bacteria 3746
293 Ga0099822_1001510 3300006943 Bacteria 27265
294 Ga0099823_1020698 3300006944 Bacteria 6195
295 Ga0099795_10008505 3300007788 Bacteria 2930
296 Ga0099795_10031291 3300007788 Bacteria 1831
297 Ga0099795_10063617 3300007788 Bacteria 1375
298 Ga0105250_10031361 3300009092 Bacteria 2134
299 Ga0105240_10013788 3300009093 Bacteria 11073
300 Ga0105240_10016073 3300009093 Bacteria 10140
301 Ga0105240_10079684 3300009093 Bacteria 4029
302 Ga0105240_10175366 3300009093 Bacteria 2535
303 Ga0111539_10380217 3300009094 Bacteria 1644
304 Ga0105245_10004787 3300009098 Bacteria 11946
305 Ga0105245_10084292 3300009098 Bacteria 2911
306 Ga0105245_10232066 3300009098 Bacteria 1785
307 Ga0105245_10368055 3300009098 Bacteria 1428
308 Ga0105247_10003270 3300009101 Bacteria 10626
309 Ga0105247_10022626 3300009101 Bacteria 3785
310 Ga0105247_10257812 3300009101 Bacteria 1194
311 Ga0105247_10294940 3300009101 Bacteria 1123
312 Ga0114129_10035205 3300009147 Bacteria 7074
313 Ga0114129_10060760 3300009147 Bacteria 5283
314 Ga0114129_10157410 3300009147 Bacteria 3106
315 Ga0114129_10427101 3300009147 Bacteria 1742
316 Ga0114129_10473554 3300009147 Bacteria 1639
317 Ga0105243_10033198 3300009148 Bacteria 3991
318 Ga0105243_10037948 3300009148 Bacteria 3748
319 Ga0105243_10047590 3300009148 Bacteria 3377
320 Ga0105243_10158934 3300009148 Bacteria 1947
321 Ga0105243_10260156 3300009148 Bacteria 1553
322 Ga0105241_10001008 3300009174 Bacteria 21388
323 Ga0105241_10001825 3300009174 Bacteria 16152
324 Ga0105242_10315799 3300009176 Bacteria 1431
325 Ga0105248_10025905 3300009177 Bacteria 6522
326 Ga0105237_10013142 3300009545 Bacteria 8687
327 Ga0105237_10015187 3300009545 Bacteria 8024
328 Ga0105237_10157999 3300009545 Bacteria 2265
329 Ga0105237_10205238 3300009545 Bacteria 1971
330 Ga0105237_10216219 3300009545 Bacteria 1916
331 Ga0105237_10765192 3300009545 Bacteria 972
332 Ga0105238_10014477 3300009551 Bacteria 7976
333 Ga0105238_10017578 3300009551 Bacteria 7271
334 Ga0105238_10057485 3300009551 Bacteria 3900
335 Ga0105238_10202290 3300009551 Bacteria 1962
336 Ga0105238_10267982 3300009551 Bacteria 1688
337 Ga0105238_10297722 3300009551 Bacteria 1597
338 Ga0105238_10606520 3300009551 Bacteria 1103
339 Ga0105148_100170 3300009978 Bacteria 9565
340 Ga0099796_10038401 3300010159 Bacteria 1606
341 Ga0099796_10038515 3300010159 Bacteria 1604
342 Ga0099796_10054450 3300010159 Bacteria 1399
343 Ga0099796_10072966 3300010159 Bacteria 1243
344 Ga0105239_10004106 3300010375 Bacteria 17509
345 Ga0105239_10075959 3300010375 Bacteria 3695
346 Ga0105239_10153484 3300010375 Bacteria 2571
347 Ga0105239_10240750 3300010375 Bacteria 2031
348 Ga0105239_10301160 3300010375 Bacteria 1805
349 Ga0105239_10388821 3300010375 Bacteria 1578
350 Ga0105246_10041134 3300011119 Bacteria 3122
351 Ga0105246_10091525 3300011119 Bacteria 2193
352 Ga0157373_10030403 3300013100 Bacteria 3887
353 Ga0157373_10041007 3300013100 Bacteria 3312
354 Ga0157371_10275834 3300013102 Bacteria 1214
355 Ga0157370_10199275 3300013104 Bacteria 1857
356 Ga0157369_10005277 3300013105 Bacteria 15062
357 Ga0157369_10013807 3300013105 Bacteria 9129
358 Ga0157369_10036963 3300013105 Bacteria 5349
359 Ga0171462_1006 3300013250 Bacteria 432986
360 Ga0157374_10003779 3300013296 Bacteria 12738
361 Ga0157374_10083182 3300013296 Bacteria 3040
362 Ga0157374_10095661 3300013296 Bacteria 2840
363 Ga0157378_10088994 3300013297 Bacteria 2803
364 Ga0157378_10398268 3300013297 Bacteria 1356
365 Ga0163162_10027469 3300013306 Bacteria 5628
366 Ga0163162_10032877 3300013306 Bacteria 5152
367 Ga0163162_10051503 3300013306 Bacteria 4131
368 Ga0157372_10026601 3300013307 Bacteria 6295
369 Ga0157372_10125611 3300013307 Bacteria 2949
370 Ga0157372_10136025 3300013307 Bacteria 2830
371 Ga0163163_10055459 3300014325 Bacteria 3917
372 Ga0163163_10121364 3300014325 Bacteria 2647
373 Ga0163163_10531547 3300014325 Bacteria 1238
374 Ga0157380_10059935 3300014326 Bacteria 3039
375 Ga0157380_10197691 3300014326 Bacteria 1781
376 Ga0157379_10145562 3300014968 Bacteria 2137
377 Ga0157379_10206154 3300014968 Bacteria 1778
378 Ga0157379_10309899 3300014968 Bacteria 1440
379 Ga0157376_10075336 3300014969 Bacteria 2880
380 Ga0157376_10125927 3300014969 Bacteria 2279
381 Ga0157376_10126647 3300014969 Bacteria 2273
382 Ga0157376_10698410 3300014969 Bacteria 1019
383 Ga0163161_10233747 3300017792 Bacteria 1427
384 Ga0214544_1000136 3300021320 Bacteria 107814
385 Ga0214542_1000127 3300021321 Bacteria 107829
386 Ga0214545_1000063 3300021324 Bacteria 107829
387 Ga0214543_1000238 3300021327 Bacteria 84004
388 Ga0214543_1041052 3300021327 Bacteria 1210
389 Ga0213874_10001203 3300021377 Bacteria 5314
390 Ga0213874_10003862 3300021377 Bacteria 3367
391 Ga0213876_10000346 3300021384 Bacteria 40175
392 Ga0213876_10024127 3300021384 Bacteria 3210
393 Ga0213876_10037137 3300021384 Bacteria 2570
394 Ga0213876_10053186 3300021384 Bacteria 2139
395 Ga0213875_10000098 3300021388 Bacteria 98684
396 Ga0213875_10000122 3300021388 Bacteria 87195
397 Ga0213875_10018956 3300021388 Bacteria 3312
398 Ga0228598_1001518 3300024227 Bacteria 5089
399 Ga0228598_1023939 3300024227 Bacteria 1202
400 Ga0209147_101667 3300025229 Bacteria 7306
401 Ga0209563_102268 3300025230 Bacteria 4438
402 Ga0209677_100344 3300025253 Bacteria 29159
403 Ga0209677_103699 3300025253 Bacteria 4798
404 Ga0209148_1005097 3300025254 Bacteria 3076
405 Ga0209148_1018454 3300025254 Bacteria 1171
406 Ga0209233_1003337 3300025261 Bacteria 5683
407 Ga0209233_1005247 3300025261 Bacteria 4320
408 Ga0209455_1001850 3300025272 Bacteria 8855
409 Ga0209455_1003980 3300025272 Bacteria 5010
410 Ga0209130_1000343 3300025284 Bacteria 53596
411 Ga0209675_1000025 3300025291 Bacteria 294102
412 Ga0209676_1000238 3300025292 Bacteria 117732
413 Ga0209676_1000571 3300025292 Bacteria 55434
414 Ga0209676_1001500 3300025292 Bacteria 21339
415 Ga0209025_1000008 3300025294 Bacteria 1130876
416 Ga0209025_1000835 3300025294 Bacteria 48894
417 Ga0209025_1024276 3300025294 Bacteria 3135
418 Ga0209564_1000015 3300025295 Bacteria 615324
419 Ga0209564_1004802 3300025295 Bacteria 8054
420 Ga0209758_1000011 3300025297 Bacteria 1049685
421 Ga0209758_1000455 3300025297 Bacteria 68279
422 Ga0209758_1000720 3300025297 Bacteria 48767
423 Ga0209758_1001990 3300025297 Bacteria 22036
424 Ga0209758_1021230 3300025297 Bacteria 3036
425 Ga0209758_1029293 3300025297 Bacteria 2306
426 Ga0209758_1037173 3300025297 Bacteria 1886
427 Ga0209758_1056030 3300025297 Bacteria 1334
428 Ga0209758_1056739 3300025297 Bacteria 1320
429 Ga0209050_1000104 3300025298 Bacteria 228921
430 Ga0209050_1001457 3300025298 Bacteria 25353
431 Ga0209050_1016456 3300025298 Bacteria 3024
432 Ga0209256_1001342 3300025299 Bacteria 26115
433 Ga0209256_1002097 3300025299 Bacteria 17422
434 Ga0207426_1000480 3300025302 Bacteria 60866
435 Ga0207426_1001491 3300025302 Bacteria 19157
436 Ga0207426_1005196 3300025302 Bacteria 6046
437 Ga0207426_1010749 3300025302 Bacteria 3535
438 Ga0209257_1000120 3300025304 Bacteria 223025
439 Ga0209257_1000323 3300025304 Bacteria 100164
440 Ga0209257_1000936 3300025304 Bacteria 40346
441 Ga0209257_1007849 3300025304 Bacteria 6298
442 Ga0207656_10002484 3300025321 Bacteria 6226
443 Ga0207692_10283508 3300025898 Bacteria 1003
444 Ga0207710_10053419 3300025900 Bacteria 1818
445 Ga0207688_10001072 3300025901 Bacteria 13993
446 Ga0207688_10056128 3300025901 Bacteria 2212
447 Ga0207680_10084601 3300025903 Bacteria 2002
448 Ga0207647_10004039 3300025904 Bacteria 10933
449 Ga0207647_10017981 3300025904 Bacteria 4793
450 Ga0207647_10032878 3300025904 Bacteria 3327
451 Ga0207685_10016487 3300025905 Bacteria 2367
452 Ga0207685_10037311 3300025905 Bacteria 1788
453 Ga0207699_10007606 3300025906 Bacteria 5305
454 Ga0207699_10008437 3300025906 Bacteria 5086
455 Ga0207699_10008554 3300025906 Bacteria 5059
456 Ga0207699_10024585 3300025906 Bacteria 3296
457 Ga0207699_10049055 3300025906 Bacteria 2483
458 Ga0207699_10049293 3300025906 Bacteria 2479
459 Ga0207699_10249241 3300025906 Bacteria 1223
460 Ga0207645_10005025 3300025907 Bacteria 9692
461 Ga0207645_10032981 3300025907 Bacteria 3329
462 Ga0207645_10049857 3300025907 Bacteria 2674
463 Ga0207645_10093764 3300025907 Bacteria 1932
464 Ga0207643_10000532 3300025908 Bacteria 24445
465 Ga0207684_10190965 3300025910 Bacteria 1767
466 Ga0207654_10004108 3300025911 Bacteria 7337
467 Ga0207654_10027201 3300025911 Bacteria 3107
468 Ga0207654_10074355 3300025911 Bacteria 2028
469 Ga0207707_10003605 3300025912 Bacteria 13731
470 Ga0207707_10004780 3300025912 Bacteria 11881
471 Ga0207707_10010530 3300025912 Bacteria 8028
472 Ga0207707_10078899 3300025912 Bacteria 2875
473 Ga0207707_10329085 3300025912 Bacteria 1318
474 Ga0207695_10000157 3300025913 Bacteria 204140
475 Ga0207695_10001596 3300025913 Bacteria 36807
476 Ga0207695_10062576 3300025913 Bacteria 3841
477 Ga0207671_10033853 3300025914 Bacteria 3799
478 Ga0207671_10136860 3300025914 Bacteria 1884
479 Ga0207693_10002870 3300025915 Bacteria 14928
480 Ga0207693_10003944 3300025915 Bacteria 12612
481 Ga0207693_10005583 3300025915 Bacteria 10455
482 Ga0207693_10013523 3300025915 Bacteria 6578
483 Ga0207693_10084313 3300025915 Bacteria 2490
484 Ga0207693_10235354 3300025915 Bacteria 1438
485 Ga0207663_10000211 3300025916 Bacteria 25872
486 Ga0207663_10032353 3300025916 Bacteria 3104
487 Ga0207663_10036712 3300025916 Bacteria 2949
488 Ga0207663_10162680 3300025916 Bacteria 1577
489 Ga0207660_10001786 3300025917 Bacteria 14369
490 Ga0207660_10105387 3300025917 Bacteria 2113
491 Ga0207660_10156950 3300025917 Bacteria 1752
492 Ga0207662_10009678 3300025918 Bacteria 5313
493 Ga0207657_10017803 3300025919 Bacteria 6802
494 Ga0207657_10019229 3300025919 Bacteria 6492
495 Ga0207657_10078209 3300025919 Bacteria 2786
496 Ga0207657_10100066 3300025919 Bacteria 2407
497 Ga0207657_10113079 3300025919 Bacteria 2240
498 Ga0207657_10215280 3300025919 Bacteria 1540
499 Ga0207657_10315064 3300025919 Bacteria 1238
500 Ga0207649_10032745 3300025920 Bacteria 3101
501 Ga0207652_10002365 3300025921 Bacteria 15944
502 Ga0207652_10049408 3300025921 Bacteria 3601
503 Ga0207652_10151833 3300025921 Bacteria 2074
504 Ga0207652_10316120 3300025921 Bacteria 1410
505 Ga0207646_10251517 3300025922 Bacteria 1597
506 Ga0207681_10251936 3300025923 Bacteria 1379
507 Ga0207694_10000757 3300025924 Bacteria 28985
508 Ga0207694_10075811 3300025924 Bacteria 2633
509 Ga0207694_10077700 3300025924 Bacteria 2601
510 Ga0207650_10144680 3300025925 Bacteria 1871
511 Ga0207659_10051882 3300025926 Bacteria 2919
512 Ga0207687_10008071 3300025927 Bacteria 6888
513 Ga0207687_10055560 3300025927 Bacteria 2775
514 Ga0207700_10048834 3300025928 Bacteria 3144
515 Ga0207700_10063040 3300025928 Bacteria 2818
516 Ga0207700_10092942 3300025928 Bacteria 2386
517 Ga0207700_10111611 3300025928 Bacteria 2201
518 Ga0207700_10149786 3300025928 Bacteria 1927
519 Ga0207700_10157297 3300025928 Bacteria 1884
520 Ga0207700_10189902 3300025928 Bacteria 1726
521 Ga0207700_10303250 3300025928 Bacteria 1380
522 Ga0207700_10439593 3300025928 Bacteria 1148
523 Ga0207664_10063187 3300025929 Bacteria 2958
524 Ga0207644_10056256 3300025931 Bacteria 2838
525 Ga0207644_10172994 3300025931 Bacteria 1687
526 Ga0207644_10194363 3300025931 Bacteria 1597
527 Ga0207644_10314876 3300025931 Bacteria 1264
528 Ga0207690_10044119 3300025932 Bacteria 2938
529 Ga0207690_10139140 3300025932 Bacteria 1787
530 Ga0207690_10194786 3300025932 Bacteria 1535
531 Ga0207690_10201295 3300025932 Bacteria 1512
532 Ga0207706_10004051 3300025933 Bacteria 13860
533 Ga0207706_10017396 3300025933 Bacteria 6476
534 Ga0207706_10065152 3300025933 Bacteria 3208
535 Ga0207686_10034158 3300025934 Bacteria 3042
536 Ga0207686_10116429 3300025934 Bacteria 1812
537 Ga0207709_10296888 3300025935 Bacteria 1200
538 Ga0207709_10317320 3300025935 Bacteria 1165
539 Ga0207670_10113184 3300025936 Bacteria 1959
540 Ga0207670_10365632 3300025936 Bacteria 1146
541 Ga0207669_10078652 3300025937 Bacteria 2102
542 Ga0207669_10110270 3300025937 Bacteria 1842
543 Ga0207669_10302709 3300025937 Bacteria 1216
544 Ga0207704_10021550 3300025938 Bacteria 3435
545 Ga0207704_10104069 3300025938 Bacteria 1900
546 Ga0207665_10125730 3300025939 Bacteria 1815
547 Ga0207665_10183928 3300025939 Bacteria 1515
548 Ga0207691_10030766 3300025940 Bacteria 5014
549 Ga0207691_10214545 3300025940 Bacteria 1671
550 Ga0207691_10229209 3300025940 Bacteria 1609
551 Ga0207711_10046779 3300025941 Bacteria 3697
552 Ga0207689_10009477 3300025942 Bacteria 8407
553 Ga0207689_10111351 3300025942 Bacteria 2250
554 Ga0207661_10084573 3300025944 Bacteria 2628
555 Ga0207661_10191420 3300025944 Bacteria 1793
556 Ga0207661_10537881 3300025944 Bacteria 1069
557 Ga0207679_10284134 3300025945 Bacteria 1420
558 Ga0207679_10293986 3300025945 Bacteria 1397
559 Ga0207667_10013120 3300025949 Bacteria 9507
560 Ga0207667_10021274 3300025949 Bacteria 7189
561 Ga0207667_10109742 3300025949 Bacteria 2846
562 Ga0207667_10158436 3300025949 Bacteria 2329
563 Ga0207667_10246951 3300025949 Bacteria 1826
564 Ga0207667_10302965 3300025949 Bacteria 1633
565 Ga0207667_10511890 3300025949 Bacteria 1217
566 Ga0207651_10001012 3300025960 Bacteria 12423
567 Ga0207651_10098996 3300025960 Bacteria 2158
568 Ga0207651_10145749 3300025960 Bacteria 1836
569 Ga0207651_10334633 3300025960 Bacteria 1270
570 Ga0207651_10352342 3300025960 Bacteria 1240
571 Ga0207712_10131992 3300025961 Bacteria 1904
572 Ga0207668_10026041 3300025972 Bacteria 3793
573 Ga0207668_10040041 3300025972 Bacteria 3158
574 Ga0207668_10111304 3300025972 Bacteria 2055
575 Ga0207668_10123658 3300025972 Bacteria 1963
576 Ga0207668_10330485 3300025972 Bacteria 1268
577 Ga0207640_10045297 3300025981 Bacteria 2824
578 Ga0207640_10134059 3300025981 Bacteria 1795
579 Ga0207640_10150476 3300025981 Bacteria 1709
580 Ga0207658_10205748 3300025986 Bacteria 1646
581 Ga0207658_10291668 3300025986 Bacteria 1402
582 Ga0207658_10495527 3300025986 Bacteria 1088
583 Ga0207677_10029898 3300026023 Bacteria 3469
584 Ga0207677_10058963 3300026023 Bacteria 2646
585 Ga0207677_10213254 3300026023 Bacteria 1543
586 Ga0207639_10012898 3300026041 Bacteria 5830
587 Ga0207639_10013907 3300026041 Bacteria 5644
588 Ga0207639_10014848 3300026041 Bacteria 5485
589 Ga0207639_10019630 3300026041 Bacteria 4824
590 Ga0207639_10020336 3300026041 Bacteria 4750
591 Ga0207639_10088539 3300026041 Bacteria 2471
592 Ga0207639_10161946 3300026041 Bacteria 1886
593 Ga0207639_10171739 3300026041 Bacteria 1836
594 Ga0207639_10278024 3300026041 Bacteria 1471
595 Ga0207639_10312904 3300026041 Bacteria 1392
596 Ga0207639_10343195 3300026041 Bacteria 1332
597 Ga0207678_10000095 3300026067 Bacteria 73553
598 Ga0207678_10003302 3300026067 Bacteria 14538
599 Ga0207678_10020636 3300026067 Bacteria 5775
600 Ga0207678_10023203 3300026067 Bacteria 5428
601 Ga0207678_10027731 3300026067 Bacteria 4945
602 Ga0207678_10056727 3300026067 Bacteria 3372
603 Ga0207678_10516441 3300026067 Bacteria 1042
604 Ga0207708_10027941 3300026075 Bacteria 4271
605 Ga0207708_10444525 3300026075 Bacteria 1079
606 Ga0207702_10000003 3300026078 Bacteria 434196
607 Ga0207702_10014085 3300026078 Bacteria 6640
608 Ga0207702_10564676 3300026078 Bacteria 1114
609 Ga0207641_10158085 3300026088 Bacteria 2058
610 Ga0207648_10274269 3300026089 Bacteria 1507
611 Ga0207676_10075837 3300026095 Bacteria 2714
612 Ga0207676_10142072 3300026095 Bacteria 2056
613 Ga0207676_10208533 3300026095 Bacteria 1732
614 Ga0207676_10339501 3300026095 Bacteria 1385
615 Ga0207674_10011995 3300026116 Bacteria 9712
616 Ga0207674_10019244 3300026116 Bacteria 7401
617 Ga0207674_10052521 3300026116 Bacteria 4156
618 Ga0207674_10088541 3300026116 Bacteria 3089
619 Ga0207674_10098539 3300026116 Bacteria 2906
620 Ga0207674_10187970 3300026116 Bacteria 2015
621 Ga0207674_10191273 3300026116 Bacteria 1996
622 Ga0207674_10256684 3300026116 Bacteria 1695
623 Ga0207675_100044992 3300026118 Bacteria 4124
624 Ga0207675_100204825 3300026118 Bacteria 1896
625 Ga0207675_100272158 3300026118 Bacteria 1644
626 Ga0207683_10051243 3300026121 Bacteria 3616
627 Ga0207683_10063915 3300026121 Bacteria 3242
628 Ga0207683_10065026 3300026121 Bacteria 3215
629 Ga0207683_10075863 3300026121 Bacteria 2977
630 Ga0207683_10132912 3300026121 Bacteria 2238
631 Ga0207683_10212588 3300026121 Bacteria 1761
632 Ga0207698_10008823 3300026142 Bacteria 6391
633 Ga0207698_10027211 3300026142 Bacteria 4056
634 Ga0207698_10106915 3300026142 Bacteria 2335
635 Ga0207698_10108423 3300026142 Bacteria 2321
636 Ga0207698_10120100 3300026142 Bacteria 2222
637 Ga0207698_10168842 3300026142 Bacteria 1924
638 Ga0207698_10240254 3300026142 Bacteria 1650
639 Ga0209389_1000009 3300027296 Bacteria 226873
640 Ga0209389_1000088 3300027296 Bacteria 83578
641 Ga0209589_1000007 3300027357 Bacteria 425699
642 Ga0209589_1000189 3300027357 Bacteria 71403
643 Ga0209489_100008 3300027361 Bacteria 425699
644 Ga0209489_100050 3300027361 Bacteria 154669
645 Ga0209489_100085 3300027361 Bacteria 126199
646 Ga0209700_100009 3300027363 Bacteria 425699
647 Ga0209700_100016 3300027363 Bacteria 252567
648 Ga0209179_1015550 3300027512 Bacteria 1415
649 Ga0209588_1044110 3300027671 Bacteria 1442
650 Ga0268266_10001710 3300028379 Bacteria 25123
651 Ga0268266_10010017 3300028379 Bacteria 8318
652 Ga0268266_10019820 3300028379 Bacteria 5731
653 Ga0268266_10030342 3300028379 Bacteria 4593
654 Ga0268265_10067985 3300028380 Bacteria 2760
655 Ga0268265_10408757 3300028380 Bacteria 1257
656 Ga0268264_10000038 3300028381 Bacteria 383623
657 Ga0268264_10044034 3300028381 Bacteria 3701
658 Ga0268264_10217737 3300028381 Bacteria 1756
659 Ga0268264_10691708 3300028381 Bacteria 1012
660 Ga0265318_10000046 3300028577 Bacteria 126568
661 Ga0307517_10000512 3300028786 Bacteria 66501
662 Ga0307515_10022025 3300028794 Bacteria 11255
663 Ga0265338_10190710 3300028800 Bacteria 1554
664 Ga0265762_1006912 3300030760 Bacteria 2027
665 Ga0265330_10003886 3300031235 Bacteria 7683
666 Ga0265330_10047336 3300031235 Bacteria 1893
667 Ga0265330_10062964 3300031235 Bacteria 1612
668 Ga0265332_10000839 3300031238 Bacteria 18678
669 Ga0265325_10032340 3300031241 Bacteria 2793
670 Ga0265340_10000382 3300031247 Bacteria 23632
671 Ga0265340_10005741 3300031247 Bacteria 6857
672 Ga0265340_10025504 3300031247 Bacteria 2993
673 Ga0265339_10001051 3300031249 Bacteria 20994
674 Ga0265339_10002691 3300031249 Bacteria 12639
675 Ga0265339_10003487 3300031249 Bacteria 10996
676 Ga0265331_10022264 3300031250 Bacteria 3235
677 Ga0265331_10032490 3300031250 Bacteria 2586
678 Ga0265331_10039516 3300031250 Bacteria 2300
679 Ga0265331_10144471 3300031250 Bacteria 1081
680 Ga0307509_10228195 3300031507 Bacteria 1668
681 Ga0307408_100072109 3300031548 Bacteria 2556
682 Ga0307408_100159116 3300031548 Bacteria 1792
683 Ga0265313_10000024 3300031595 Bacteria 138587
684 Ga0307508_10362640 3300031616 Bacteria 1040
685 Ga0265314_10001759 3300031711 Bacteria 23380
686 Ga0265314_10019173 3300031711 Bacteria 5305
687 Ga0265314_10084820 3300031711 Bacteria 2079
688 Ga0265342_10000179 3300031712 Bacteria 70615
689 Ga0265342_10006885 3300031712 Bacteria 8400
690 Ga0307516_10113504 3300031730 Bacteria 2508
691 Ga0307405_10024417 3300031731 Bacteria 3453
692 Ga0307405_10108479 3300031731 Bacteria 1876
693 Ga0307413_10172951 3300031824 Bacteria 1531
694 Ga0307413_10201728 3300031824 Bacteria 1437
695 Ga0307406_10004247 3300031901 Bacteria 7797
696 Ga0307406_10081169 3300031901 Bacteria 2155
697 Ga0307406_10256942 3300031901 Bacteria 1319
698 Ga0307407_10094299 3300031903 Bacteria 1842
699 Ga0307412_10039929 3300031911 Bacteria 3033
700 Ga0307412_10331127 3300031911 Bacteria 1215
701 Ga0307412_10349352 3300031911 Bacteria 1187
702 Ga0307409_100051758 3300031995 Bacteria 3144
703 Ga0307409_100373028 3300031995 Bacteria 1354
704 Ga0307409_100543160 3300031995 Bacteria 1139
705 Ga0307416_100105994 3300032002 Bacteria 2462
706 Ga0307414_10006076 3300032004 Bacteria 6698
707 Ga0307414_10201129 3300032004 Bacteria 1620
708 Ga0307411_10025647 3300032005 Bacteria 3536
709 Ga0307411_10037015 3300032005 Bacteria 3064
710 Ga0307415_100005649 3300032126 Bacteria 6661
711 Ga0307415_100122163 3300032126 Bacteria 1955
712 Ga0307415_100493549 3300032126 Bacteria 1069
713 Ga0307507_10133866 3300033179 Bacteria 1928
714 Ga0307510_10009742 3300033180 Bacteria 11434
715 Ga0307510_10050764 3300033180 Bacteria 4396
716 Ga0315911_1000004 3300033442 Bacteria 472637
717 Ga0373944_0009011 3300035089 Bacteria 2698
718 Ga0373944_0013282 3300035089 Bacteria 2282
719 Ga0373944_0047494 3300035089 Bacteria 1345
720 Ga0373923_0024351 3300035111 Bacteria 2388
721 Ga0373923_0065895 3300035111 Bacteria 1547
722 Ga0373923_0110406 3300035111 Bacteria 1221
723 Ga0373932_0016637 3300035112 Bacteria 1879
724 Ga0373936_0015883 3300035113 Bacteria 2889
725 Ga0373936_0031865 3300035113 Bacteria 2083
726 Ga0373945_0014901 3300035116 Bacteria 2610
727 Ga0373945_0030108 3300035116 Bacteria 1911
728 Ga0373945_0104221 3300035116 Bacteria 1113
729 Ga0373953_0008522 3300035117 Bacteria 3487
730 Ga0373956_0002426 3300035119 Bacteria 7599
731 Ga0373956_0024994 3300035119 Bacteria 2579
732 Ga0373943_0000755 3300035170 Bacteria 14106
733 Ga0373943_0003068 3300035170 Bacteria 7590
734 Ga0373943_0016037 3300035170 Bacteria 3412
735 Ga0373943_0045194 3300035170 Bacteria 2145
736 Ga0373943_0051417 3300035170 Bacteria 2028
737 Ga0373946_0004314 3300035171 Bacteria 5083
738 Ga0373946_0012162 3300035171 Bacteria 3218
739 Ga0373955_0003015 3300035172 Bacteria 7380
740 Ga0373955_0030906 3300035172 Bacteria 2801
741 Ga0373955_0032541 3300035172 Bacteria 2738
742 Ga0316574_0102778 3300035398 Bacteria 1829
743 Ga0373924_0007778 3300035410 Bacteria 3876
744 Ga0373924_0017111 3300035410 Bacteria 2777
745 Ga0373924_0127105 3300035410 Bacteria 1108
746 Ga0373931_0329918 3300035691 Bacteria 950
747 Ga0373935_0001766 3300035692 Bacteria 12152
748 Ga0373935_0019355 3300035692 Bacteria 4151
749 Ga0373935_0019696 3300035692 Bacteria 4114
750 Ga0373935_0070177 3300035692 Bacteria 2258
751 Ga0373927_0000113 3300035695 Bacteria 60608
752 Ga0373927_0000346 3300035695 Bacteria 36389
753 Ga0373927_0003142 3300035695 Bacteria 11934
754 Ga0373927_0018992 3300035695 Bacteria 4510
755 Ga0373927_0021985 3300035695 Bacteria 4180
756 Ga0373927_0028798 3300035695 Bacteria 3622
757 Ga0373927_0031222 3300035695 Bacteria 3473
758 Ga0373927_0034162 3300035695 Bacteria 3309
759 Ga0373927_0038647 3300035695 Bacteria 3098
760 Ga0373927_0073207 3300035695 Bacteria 2218
761 Ga0373927_0076618 3300035695 Bacteria 2166
762 Ga0373927_0087313 3300035695 Bacteria 2025
763 Ga0373933_0000258 3300035724 Bacteria 34845
764 Ga0373933_0004420 3300035724 Bacteria 7717
765 Ga0373933_0024198 3300035724 Bacteria 3476
766 Ga0373933_0124883 3300035724 Bacteria 1614
767 Ga0373947_0001267 3300035725 Bacteria 15562
768 Ga0373947_0002417 3300035725 Bacteria 11265
769 Ga0373947_0036794 3300035725 Bacteria 2903
770 Ga0373947_0066104 3300035725 Bacteria 2206
771 Ga0373947_0121693 3300035725 Bacteria 1658
772 Ga0373937_0023839 3300036401 Bacteria 5517
773 Ga0373937_0038979 3300036401 Bacteria 4329
774 Ga0373937_0049868 3300036401 Bacteria 3833
775 Ga0373937_0140279 3300036401 Bacteria 2261
776 Ga0373937_0486385 3300036401 Bacteria 1172
777 Ga0373925_0001404 3300037068 Bacteria 20938
778 Ga0373925_0004601 3300037068 Bacteria 10423
779 Ga0373925_0020265 3300037068 Bacteria 4839
780 Ga0373925_0030842 3300037068 Bacteria 3937
781 Ga0373925_0055678 3300037068 Bacteria 2961
782 Ga0373925_0061215 3300037068 Bacteria 2827
783 Ga0373925_0123671 3300037068 Bacteria 2011
784 Ga0373925_0366525 3300037068 Bacteria 1172
785 Ga0373925_0447654 3300037068 Bacteria 1057
786 Ga0395899_0017832 3300037312 Bacteria 5405
787 Ga0395899_0019536 3300037312 Bacteria 5146
788 Ga0395899_0069735 3300037312 Bacteria 2574
789 Ga0395899_0079770 3300037312 Bacteria 2384
790 Ga0395900_0000134 3300037418 Bacteria 124444
791 Ga0395900_0065161 3300037418 Bacteria 3742
792 Ga0395900_0140876 3300037418 Bacteria 2469
793 Ga0395900_0302164 3300037418 Bacteria 1586
794 Ga0395898_0037354 3300037466 Bacteria 4819
795 Ga0395898_0087335 3300037466 Bacteria 3004
796 Ga0395905_0000123 3300037471 Bacteria 127888
797 Ga0395905_0013864 3300037471 Bacteria 7711
798 Ga0436364_0235209 3300037853 Bacteria 1582
799 Ga0436364_0423755 3300037853 Bacteria 87339
800 Ga0436364_0838358 3300037853 Bacteria 1233
801 Ga0436364_1139859 3300037853 Bacteria 6995
802 Ga0436364_1390920 3300037853 Bacteria 113944
803 Ga0395901_0000880 3300038443 Bacteria 33025
804 Ga0395901_0013321 3300038443 Bacteria 8353
805 Ga0395901_0081261 3300038443 Bacteria 3385
806 Ga0395901_0084968 3300038443 Bacteria 3308
807 Ga0395901_0086295 3300038443 Bacteria 3281
808 Ga0395901_0362943 3300038443 Bacteria 1493
809 Ga0400483_063769 3300039062 Bacteria 35431
810 Ga0436365_0012938 3300039437 Bacteria 927
811 Ga0436365_0061308 3300039437 Bacteria 1478
812 Ga0436365_0076921 3300039437 Bacteria 40502
813 Ga0436365_0293736 3300039437 Bacteria 2240
814 Ga0436365_0481444 3300039437 Bacteria 17117
815 Ga0436365_0731168 3300039437 Bacteria 5585
816 Ga0436365_0741042 3300039437 Bacteria 3633
817 Ga0436365_0768275 3300039437 Bacteria 19205
818 Ga0436365_0798167 3300039437 Bacteria 89850
819 Ga0436365_1102823 3300039437 Bacteria 1362
820 Ga0436365_1160728 3300039437 Bacteria 3509
821 Ga0436365_1523930 3300039437 Bacteria 2477
822 Ga0436365_1710304 3300039437 Bacteria 4348
823 Ga0436360_0938879 3300039438 Bacteria 4192
824 Ga0436360_1120596 3300039438 Bacteria 2534
825 Ga0436361_0208634 3300039447 Bacteria 4022
826 Ga0436361_0904010 3300039447 Bacteria 3674
827 Ga0436361_1104477 3300039447 Bacteria 5204
828 Ga0436363_1401795 3300039450 Bacteria 17008
829 Ga0436363_1471097 3300039450 Bacteria 7386
830 Ga0436362_0088818 3300039453 Bacteria 8797
831 Ga0436362_0429757 3300039453 Bacteria 6386
832 Ga0436362_1218894 3300039453 Bacteria 1670
833 Ga0436362_1265935 3300039453 Bacteria 4789
834 Ga0451793_0652808 3300041452 Bacteria 1887
835 Ga0439441_022654 3300042001 Bacteria 1169
836 Ga0439440_0030274 3300042993 Bacteria 1274
837 Ga0466969_0063638 3300044656 Bacteria 1787
838 Ga0466972_0001603 3300044658 Bacteria 11060
839 Ga0466966_0005030 3300044684 Bacteria 8695
840 Ga0466966_0075035 3300044684 Bacteria 2113
841 Ga0466961_0000060 3300044693 Bacteria 65360
842 Ga0466963_0020642 3300044694 Bacteria 4143
843 Ga0466964_0026242 3300044706 Bacteria 2280
844 Ga0466964_0065741 3300044706 Bacteria 1520
845 Ga0453684_1261641 3300044712 Bacteria 773
846 Ga0466971_0141290 3300044719 Bacteria 1121
847 Ga0466957_0010425 3300044842 Bacteria 5336
848 Ga0466957_0038885 3300044842 Bacteria 2869
849 Ga0466959_0001866 3300045049 Bacteria 13243
850 Ga0466967_0002368 3300045976 Bacteria 11671
851 Ga0466967_0235265 3300045976 Bacteria 1745
852 Ga0495617_051104 3300046452 Bacteria 1374
853 Ga0495592_0003878 3300046454 Bacteria 10821
854 Ga0495592_0006304 3300046454 Bacteria 8827
855 Ga0495592_0034880 3300046454 Bacteria 3791
856 Ga0495603_0000092 3300046455 Bacteria 40980
857 Ga0495603_0031557 3300046455 Bacteria 3190
858 Ga0495603_0035014 3300046455 Bacteria 3017
859 Ga0495603_0120014 3300046455 Bacteria 1532
860 Ga0495603_0323701 3300046455 Bacteria 885
861 Ga0495629_0000181 3300046459 Bacteria 56739
862 Ga0495629_0020090 3300046459 Bacteria 4769
863 Ga0495629_0062627 3300046459 Bacteria 2598
864 Ga0495629_0159207 3300046459 Bacteria 1568
865 Ga0495638_0009594 3300046460 Bacteria 6776
866 Ga0495641_0001499 3300046461 Bacteria 19900
867 Ga0495651_0025351 3300046462 Bacteria 4615
868 Ga0495651_0043114 3300046462 Bacteria 3501
869 Ga0495651_0124654 3300046462 Bacteria 1887
870 Ga0495651_0132580 3300046462 Bacteria 1817
871 Ga0495651_0182590 3300046462 Bacteria 1484
872 Ga0495653_0018848 3300046463 Bacteria 5599
873 Ga0495653_0031775 3300046463 Bacteria 4195
874 Ga0495653_0064907 3300046463 Bacteria 2750
875 Ga0495653_0113252 3300046463 Bacteria 1946
876 Ga0495650_0045002 3300046471 Bacteria 1861
877 Ga0495580_0001467 3300046472 Bacteria 20684
878 Ga0495580_0007886 3300046472 Bacteria 8520
879 Ga0495580_0063846 3300046472 Bacteria 2582
880 Ga0495580_0240952 3300046472 Bacteria 1240
881 Ga0495580_0368284 3300046472 Bacteria 972
882 Ga0495582_0000039 3300046473 Bacteria 66883
883 Ga0495582_0131633 3300046473 Bacteria 1413
884 Ga0495605_0061747 3300046474 Bacteria 1792
885 Ga0495639_0000489 3300046475 Bacteria 18815
886 Ga0495639_0049551 3300046475 Bacteria 1906
887 Ga0495662_0000223 3300046476 Bacteria 23829
888 Ga0495662_0000343 3300046476 Bacteria 20338
889 Ga0495664_0000800 3300046477 Bacteria 16088
890 Ga0495664_0002664 3300046477 Bacteria 9612
891 Ga0495664_0015258 3300046477 Bacteria 4365
892 Ga0495664_0063746 3300046477 Bacteria 2196
893 Ga0495584_0079078 3300046491 Bacteria 1654
894 Ga0495584_0114570 3300046491 Bacteria 1364
895 Ga0495585_0081330 3300046492 Bacteria 1755
896 Ga0495585_0091525 3300046492 Bacteria 1637
897 Ga0495594_0000619 3300046499 Bacteria 18269
898 Ga0495596_0073887 3300046500 Bacteria 1324
899 Ga0495607_0132886 3300046501 Bacteria 1293
900 Ga0495583_0077489 3300046506 Bacteria 1450
901 Ga0495606_0003208 3300046507 Bacteria 17626
902 Ga0495606_0103057 3300046507 Bacteria 1734
903 Ga0495606_0105250 3300046507 Bacteria 1710
904 Ga0495608_0000398 3300046511 Bacteria 30359
905 Ga0495610_0054926 3300046512 Bacteria 1922
906 Ga0495618_0005331 3300046514 Bacteria 7846
907 Ga0495618_0152608 3300046514 Bacteria 1475
908 Ga0495618_0215734 3300046514 Bacteria 1212
909 Ga0495618_0223287 3300046514 Bacteria 1188
910 Ga0495628_0046997 3300046516 Bacteria 3426
911 Ga0495628_0056656 3300046516 Bacteria 3084
912 Ga0495628_0073295 3300046516 Bacteria 2668
913 Ga0495628_0173442 3300046516 Bacteria 1634
914 Ga0495630_0001653 3300046517 Bacteria 15507
915 Ga0495630_0006103 3300046517 Bacteria 8540
916 Ga0495630_0037785 3300046517 Bacteria 3610
917 Ga0495630_0209914 3300046517 Bacteria 1486
918 Ga0495632_0000075 3300046519 Bacteria 102051
919 Ga0495632_0023362 3300046519 Bacteria 3302
920 Ga0495637_0006157 3300046520 Bacteria 6036
921 Ga0495643_0000009 3300046522 Bacteria 344767
922 Ga0495643_0032803 3300046522 Bacteria 2879
923 Ga0495644_0029123 3300046523 Bacteria 2087
924 Ga0495644_0037512 3300046523 Bacteria 1829
925 Ga0495648_0000032 3300046524 Bacteria 205970
926 Ga0495648_0002686 3300046524 Bacteria 16072
927 Ga0495648_0134859 3300046524 Bacteria 1307
928 Ga0495663_0000003 3300046525 Bacteria 362694
929 Ga0495666_0003729 3300046526 Bacteria 7699
930 Ga0495666_0034265 3300046526 Bacteria 2478
931 Ga0495666_0053055 3300046526 Bacteria 1947
932 Ga0495652_0064544 3300046529 Bacteria 3079
933 Ga0495652_0074129 3300046529 Bacteria 2831
934 Ga0495652_0117068 3300046529 Bacteria 2132
935 Ga0495652_0177613 3300046529 Bacteria 1637
936 Ga0495652_0203878 3300046529 Bacteria 1499
937 Ga0495654_0070152 3300046530 Bacteria 1662
938 Ga0495665_0000079 3300046531 Bacteria 42321
939 Ga0495665_0020095 3300046531 Bacteria 3588
940 Ga0495665_0163905 3300046531 Bacteria 1158
941 Ga0495640_0000544 3300046533 Bacteria 27687
942 Ga0495640_0003085 3300046533 Bacteria 13431
943 Ga0495640_0009778 3300046533 Bacteria 7451
944 Ga0495640_0036273 3300046533 Bacteria 3484
945 Ga0495640_0057977 3300046533 Bacteria 2642
946 Ga0495640_0099925 3300046533 Bacteria 1906
947 Ga0495586_0097140 3300046535 Bacteria 1632
948 Ga0495587_0000599 3300046536 Bacteria 24689
949 Ga0495587_0041927 3300046536 Bacteria 2731
950 Ga0495598_0006329 3300046537 Bacteria 2671
951 Ga0495609_0085810 3300046538 Bacteria 1373
952 Ga0495609_0086862 3300046538 Bacteria 1363
953 Ga0495621_0013233 3300046539 Bacteria 2589
954 Ga0495645_0002211 3300046543 Bacteria 13235
955 Ga0495645_0026193 3300046543 Bacteria 4232
956 Ga0495645_0026869 3300046543 Bacteria 4180
957 Ga0495645_0100441 3300046543 Bacteria 2058
958 Ga0495622_0000987 3300046557 Bacteria 15239
959 Ga0495622_0042359 3300046557 Bacteria 2116
960 Ga0495633_0000102 3300046558 Bacteria 115655
961 Ga0495633_0000786 3300046558 Bacteria 28391
962 Ga0495633_0079091 3300046558 Bacteria 1531
963 Ga0495667_0006293 3300046559 Bacteria 8054
964 Ga0495667_0032424 3300046559 Bacteria 3502
965 Ga0495667_0043859 3300046559 Bacteria 2963
966 Ga0495667_0056782 3300046559 Bacteria 2574
967 Ga0495656_0016225 3300046615 Bacteria 2824
968 Ga0495656_0060648 3300046615 Bacteria 1649
969 Ga0495656_0078564 3300046615 Bacteria 1483
970 Ga0495656_0090968 3300046615 Bacteria 1395
971 Ga0495668_0000001 3300046616 Bacteria 1013420
972 Ga0495668_0046640 3300046616 Bacteria 2407
973 Ga0495668_0230353 3300046616 Bacteria 1014
974 Ga0495634_0004026 3300046642 Bacteria 11657
975 Ga0495634_0007670 3300046642 Bacteria 8079
976 Ga0495634_0017214 3300046642 Bacteria 5161
977 Ga0495634_0089976 3300046642 Bacteria 1994
978 Ga0495634_0122922 3300046642 Bacteria 1661
979 Ga0495634_0124835 3300046642 Bacteria 1646
980 Ga0495611_0058626 3300046648 Bacteria 1746
981 Ga0495611_0063062 3300046648 Bacteria 1686
982 Ga0495611_0125309 3300046648 Bacteria 1198
983 Ga0495625_0000751 3300046660 Bacteria 45255
984 Ga0495635_0004288 3300046663 Bacteria 9872
985 Ga0495635_0006922 3300046663 Bacteria 7920
986 Ga0495635_0051635 3300046663 Bacteria 2832
987 Ga0495635_0173248 3300046663 Bacteria 1467
988 Ga0495659_0029756 3300046664 Bacteria 1897
989 Ga0495588_0023653 3300046674 Bacteria 3044
990 Ga0495657_0014016 3300046675 Bacteria 5889
991 Ga0495657_0103148 3300046675 Bacteria 1815
992 Ga0495657_0150578 3300046675 Bacteria 1445
993 Ga0495599_0005233 3300046678 Bacteria 7740
994 Ga0495599_0012657 3300046678 Bacteria 5203
995 Ga0495599_0039924 3300046678 Bacteria 2949
996 Ga0495599_0061226 3300046678 Bacteria 2352
997 Ga0495623_0006342 3300046679 Bacteria 7687
998 Ga0495646_0038525 3300046680 Bacteria 2951
999 Ga0495647_0000562 3300046681 Bacteria 10934
1000 Ga0495647_0029527 3300046681 Bacteria 2028
1001 Ga0495658_0000733 3300046683 Bacteria 17682
1002 Ga0495658_0001039 3300046683 Bacteria 14680
1003 Ga0495658_0154370 3300046683 Bacteria 1412
1004 Ga0495658_0156532 3300046683 Bacteria 1403
1005 Ga0495669_0012302 3300046684 Bacteria 3641
1006 Ga0495669_0033891 3300046684 Bacteria 2250
1007 Ga0495669_0081198 3300046684 Bacteria 1488
1008 Ga0495613_0000543 3300046689 Bacteria 31253
1009 Ga0495613_0044732 3300046689 Bacteria 3274
1010 Ga0495624_0006648 3300046690 Bacteria 8175
1011 Ga0495624_0048239 3300046690 Bacteria 2703
1012 Ga0495624_0052513 3300046690 Bacteria 2575
1013 Ga0495624_0068223 3300046690 Bacteria 2217
1014 Ga0495670_0085783 3300046691 Bacteria 1607
1015 Ga0495671_0000013 3300046692 Bacteria 344767
1016 Ga0495649_0065369 3300046694 Bacteria 1952
1017 Ga0495600_0001478 3300046809 Bacteria 13016
1018 Ga0495581_0000024 3300047315 Bacteria 55574
1019 Ga0495581_0004287 3300047315 Bacteria 8231
1020 Ga0495604_0014602 3300047317 Bacteria 6259
1021 Ga0495604_0017775 3300047317 Bacteria 5689
1022 Ga0495604_0108363 3300047317 Bacteria 2029
1023 Ga0495604_0385595 3300047317 Bacteria 925
1024 Ga0495674_0001161 3300047319 Bacteria 25370
1025 Ga0495674_0045284 3300047319 Bacteria 3906
1026 Ga0495674_0197545 3300047319 Bacteria 1670
1027 Ga0495672_0017804 3300047320 Bacteria 4740
1028 Ga0495672_0114140 3300047320 Bacteria 1446
1029 Ga0495676_0040839 3300047321 Bacteria 3825
1030 Ga0495676_0056510 3300047321 Bacteria 3103
1031 Ga0495676_0154833 3300047321 Bacteria 1627
1032 Ga0495680_0000313 3300047322 Bacteria 54486
1033 Ga0495680_0008182 3300047322 Bacteria 9536
1034 Ga0495675_0058711 3300047444 Bacteria 2439
1035 Ga0495675_0061217 3300047444 Bacteria 2385
1036 Ga0495673_0020913 3300047469 Bacteria 3246
1037 Ga0495673_0048974 3300047469 Bacteria 1861
1038 Ga0495673_0109692 3300047469 Bacteria 1105
1039 Ga0495681_0000202 3300047470 Bacteria 49721
1040 Ga0495681_0068429 3300047470 Bacteria 1616
1041 Ga0495684_0000845 3300047471 Bacteria 24740
1042 Ga0495684_0003192 3300047471 Bacteria 12855
1043 Ga0495684_0009222 3300047471 Bacteria 7619
1044 Ga0495684_0010217 3300047471 Bacteria 7261
1045 Ga0495684_0025703 3300047471 Bacteria 4524
1046 Ga0495684_0123972 3300047471 Bacteria 1944
1047 Ga0495684_0257886 3300047471 Bacteria 1266
1048 Ga0495686_0043890 3300047472 Bacteria 2832
1049 Ga0495593_0000019 3300047673 Bacteria 74042
1050 Ga0495593_0011906 3300047673 Bacteria 4988
1051 Ga0495593_0037204 3300047673 Bacteria 2634
1052 Ga0495602_0059824 3300048088 Bacteria 3323
1053 Ga0495602_0068416 3300048088 Bacteria 3049
1054 Ga0495602_0246993 3300048088 Bacteria 1332
1055 Ga0495614_0003524 3300048089 Bacteria 7011
1056 Ga0495615_0000085 3300048090 Bacteria 27694
1057 Ga0496100_0008443 3300048903 Bacteria 5744
1058 Ga0496100_0015869 3300048903 Bacteria 4409
1059 Ga0496100_0020444 3300048903 Bacteria 3969
1060 Ga0496101_0001983 3300048904 Bacteria 12419
1061 Ga0496101_0004532 3300048904 Bacteria 8770
1062 Ga0496101_0141383 3300048904 Bacteria 1835
1063 Ga0496102_0009611 3300048905 Bacteria 8317
1064 Ga0496102_0110103 3300048905 Bacteria 2567
1065 Ga0496102_0159788 3300048905 Bacteria 2119
1066 Ga0496102_0180446 3300048905 Bacteria 1989
1067 Ga0496102_0272046 3300048905 Bacteria 1597
1068 Ga0496103_0013950 3300048906 Bacteria 4770
1069 Ga0496104_0007514 3300048907 Bacteria 9635
1070 Ga0496104_0009587 3300048907 Bacteria 8619
1071 Ga0496104_0014513 3300048907 Bacteria 7116
1072 Ga0496104_0014678 3300048907 Bacteria 7076
1073 Ga0496104_0018299 3300048907 Bacteria 6392
1074 Ga0496104_0025914 3300048907 Bacteria 5407
1075 Ga0496105_0002708 3300048908 Bacteria 12919
1076 Ga0496105_0159538 3300048908 Bacteria 1852
1077 Ga0496105_0315551 3300048908 Bacteria 1254
1078 Ga0496105_0337501 3300048908 Bacteria 1205
1079 Ga0496106_0000634 3300048909 Bacteria 25214
1080 Ga0496106_0006039 3300048909 Bacteria 8965
1081 Ga0496106_0080469 3300048909 Bacteria 2502
1082 Ga0496106_0145610 3300048909 Bacteria 1866
1083 Ga0496106_0267991 3300048909 Bacteria 1367
1084 Ga0496106_0276121 3300048909 Bacteria 1346
1085 Ga0496106_0317929 3300048909 Bacteria 1249
1086 Ga0496107_0002095 3300048910 Bacteria 12782
1087 Ga0496107_0009028 3300048910 Bacteria 6913
1088 Ga0496107_0019014 3300048910 Bacteria 4844
1089 Ga0496108_0001003 3300048911 Bacteria 22020
1090 Ga0496108_0009284 3300048911 Bacteria 7960
1091 Ga0496108_0033687 3300048911 Bacteria 4255
1092 Ga0496108_0110277 3300048911 Bacteria 2352
1093 Ga0496108_0118090 3300048911 Bacteria 2273
1094 Ga0496108_0134259 3300048911 Bacteria 2128
1095 Ga0496108_0287562 3300048911 Bacteria 1431
1096 Ga0496109_0000166 3300048912 Bacteria 64848
1097 Ga0496109_0046847 3300048912 Bacteria 3928
1098 Ga0496109_0057575 3300048912 Bacteria 3548
1099 Ga0496109_0072226 3300048912 Bacteria 3169
1100 Ga0496109_0195085 3300048912 Bacteria 1903
1101 Ga0496109_0272144 3300048912 Bacteria 1596
1102 Ga0496110_0012878 3300048913 Bacteria 6894
1103 Ga0496110_0081141 3300048913 Bacteria 2891
1104 Ga0496110_0103214 3300048913 Bacteria 2557
1105 Ga0496110_0106657 3300048913 Bacteria 2514
1106 Ga0496110_0132270 3300048913 Bacteria 2253
1107 Ga0496110_0142547 3300048913 Bacteria 2166
1108 Ga0496110_0212338 3300048913 Bacteria 1759
1109 Ga0496111_0059949 3300048914 Bacteria 2758
1110 Ga0496111_0063517 3300048914 Bacteria 2678
1111 Ga0496111_0081065 3300048914 Bacteria 2368
1112 Ga0496111_0094947 3300048914 Bacteria 2187
1113 Ga0496111_0111787 3300048914 Bacteria 2012
1114 Ga0496112_0000142 3300048915 Bacteria 44742
1115 Ga0496112_0000358 3300048915 Bacteria 29716
1116 Ga0496112_0007378 3300048915 Bacteria 9759
1117 Ga0496112_0009986 3300048915 Bacteria 8591
1118 Ga0496112_0035315 3300048915 Bacteria 4869
1119 Ga0496112_0046849 3300048915 Bacteria 4241
1120 Ga0496112_0048503 3300048915 Bacteria 4163
1121 Ga0496112_0126707 3300048915 Bacteria 2524
1122 Ga0496112_0283875 3300048915 Bacteria 1602
1123 Ga0496112_0331623 3300048915 Bacteria 1465
1124 Ga0496113_0004839 3300048916 Bacteria 8333
1125 Ga0496113_0017064 3300048916 Bacteria 5031
1126 Ga0496113_0024393 3300048916 Bacteria 4299
1127 Ga0496114_0085730 3300048917 Bacteria 2668
1128 Ga0496114_0180374 3300048917 Bacteria 1844
1129 Ga0496115_0008385 3300048918 Bacteria 7647
1130 Ga0496115_0008444 3300048918 Bacteria 7619
1131 Ga0496115_0034316 3300048918 Bacteria 4010
1132 Ga0496115_0050923 3300048918 Bacteria 3320
1133 Ga0496115_0115596 3300048918 Bacteria 2206
1134 Ga0496115_0124043 3300048918 Bacteria 2127
1135 Ga0496115_0360388 3300048918 Bacteria 1185
1136 Ga0496116_0078789 3300048919 Bacteria 2053
1137 Ga0496117_0126685 3300048920 Bacteria 1557
1138 Ga0496118_0210540 3300048921 Bacteria 1141
1139 Ga0496119_0011287 3300048922 Bacteria 7421
1140 Ga0496121_0001214 3300048924 Bacteria 44944
1141 Ga0496121_0005804 3300048924 Bacteria 15651
1142 Ga0496121_0005812 3300048924 Bacteria 15639
1143 Ga0496121_0007712 3300048924 Bacteria 12910
1144 Ga0496121_0056369 3300048924 Bacteria 3264
1145 Ga0496121_0059432 3300048924 Bacteria 3152
1146 Ga0496121_0177421 3300048924 Bacteria 1541
1147 Ga0496121_0179979 3300048924 Bacteria 1527
1148 Ga0496121_0216962 3300048924 Bacteria 1350
1149 Ga0496121_0286124 3300048924 Bacteria 1125
1150 Ga0496122_0004715 3300048925 Bacteria 16745
1151 Ga0496122_0006838 3300048925 Bacteria 12935
1152 Ga0496122_0029438 3300048925 Bacteria 4632
1153 Ga0496122_0081360 3300048925 Bacteria 2255
1154 Ga0496123_0000896 3300048926 Bacteria 47149
1155 Ga0496123_0002007 3300048926 Bacteria 26274
1156 Ga0496123_0008924 3300048926 Bacteria 9117
1157 Ga0496124_0002458 3300048927 Bacteria 24217
1158 Ga0496124_0283122 3300048927 Bacteria 1207
1159 Ga0496125_0002535 3300048928 Bacteria 23546
1160 Ga0496125_0056031 3300048928 Bacteria 3205
1161 Ga0496125_0173659 3300048928 Bacteria 1445
1162 Ga0496126_0001612 3300048929 Bacteria 34184
1163 Ga0496126_0004467 3300048929 Bacteria 16697
1164 Ga0496126_0006114 3300048929 Bacteria 13498
1165 Ga0496126_0023193 3300048929 Bacteria 6016
1166 Ga0496126_0047582 3300048929 Bacteria 3926
1167 Ga0496126_0080441 3300048929 Bacteria 2884
1168 Ga0496126_0100547 3300048929 Bacteria 2530
1169 Ga0496126_0119352 3300048929 Bacteria 2288
1170 Ga0496126_0132740 3300048929 Bacteria 2150
1171 Ga0496126_0135659 3300048929 Bacteria 2123
1172 Ga0496126_0168246 3300048929 Bacteria 1869
1173 Ga0496126_0205257 3300048929 Bacteria 1662
1174 Ga0496126_0216255 3300048929 Bacteria 1612
1175 Ga0496126_0380234 3300048929 Bacteria 1150
1176 Ga0495678_042737 3300049459 Bacteria 1805
1177 Ga0495682_0034924 3300049460 Bacteria 1853
1178 Ga0495682_0084648 3300049460 Bacteria 1140
1179 Ga0501031_0004996 3300049568 Bacteria 8624
1180 Ga0501031_0144281 3300049568 Bacteria 1556
1181 Ga0501032_0099204 3300049569 Bacteria 1929
1182 Ga0501033_0000447 3300049570 Bacteria 39400
1183 Ga0501033_0017233 3300049570 Bacteria 5459
1184 Ga0501033_0044800 3300049570 Bacteria 3293
1185 Ga0501034_0000109 3300049571 Bacteria 151550
1186 Ga0501034_0001175 3300049571 Bacteria 36278
1187 Ga0501034_0011170 3300049571 Bacteria 9321
1188 Ga0501034_0117991 3300049571 Bacteria 2641
1189 Ga0501034_0136391 3300049571 Bacteria 2435
1190 Ga0501034_0286335 3300049571 Bacteria 1587
1191 Ga0501034_0367092 3300049571 Bacteria 1366
1192 Ga0501034_0387252 3300049571 Bacteria 1322
1193 Ga0501034_0517213 3300049571 Bacteria 1106
1194 Ga0501036_0012191 3300049572 Bacteria 7121
1195 Ga0501036_0013642 3300049572 Bacteria 6756
1196 Ga0501036_0070213 3300049572 Bacteria 2962
1197 Ga0501037_0001078 3300049573 Bacteria 20227
1198 Ga0501037_0172105 3300049573 Bacteria 1539
1199 Ga0501038_0071505 3300049574 Bacteria 2942
1200 Ga0501039_0052494 3300049575 Bacteria 3154
1201 Ga0501039_0110707 3300049575 Bacteria 2147
1202 Ga0501043_0003281 3300049579 Bacteria 13334
1203 Ga0501043_0019644 3300049579 Bacteria 5304
1204 Ga0501043_0041532 3300049579 Bacteria 3614
1205 Ga0501046_0034192 3300049580 Bacteria 4103
1206 Ga0501046_0185844 3300049580 Bacteria 1552
1207 Ga0501047_0012173 3300049581 Bacteria 8143
1208 Ga0501047_0030884 3300049581 Bacteria 5165
1209 Ga0501047_0132937 3300049581 Bacteria 2368
1210 Ga0501047_0205392 3300049581 Bacteria 1829
1211 Ga0501047_0321571 3300049581 Bacteria 1387
1212 Ga0501047_0376022 3300049581 Bacteria 1255
1213 Ga0501067_0013811 3300049583 Bacteria 4472
1214 Ga0501068_0011640 3300049584 Bacteria 4971
1215 Ga0501069_0025002 3300049585 Bacteria 3261
1216 Ga0501069_0295505 3300049585 Bacteria 949
1217 Ga0501070_0024998 3300049586 Bacteria 5009
1218 Ga0501070_0125601 3300049586 Bacteria 2120
1219 Ga0501070_0180587 3300049586 Bacteria 1737
1220 Ga0501070_0204314 3300049586 Bacteria 1622
1221 Ga0501071_0022307 3300049587 Bacteria 4414
1222 Ga0501072_0168067 3300049588 Bacteria 1750
1223 Ga0501073_0022644 3300049589 Bacteria 4521
1224 Ga0501073_0050737 3300049589 Bacteria 2907
1225 Ga0501073_0058167 3300049589 Bacteria 2702
1226 Ga0501073_0092976 3300049589 Bacteria 2096
1227 Ga0501073_0197079 3300049589 Bacteria 1393
1228 Ga0501074_0069404 3300049590 Bacteria 2534
1229 Ga0501074_0261272 3300049590 Bacteria 1231
1230 Ga0501075_0046475 3300049591 Bacteria 3261
1231 Ga0501075_0077585 3300049591 Bacteria 2514
1232 Ga0501075_0319193 3300049591 Bacteria 1184
1233 Ga0501076_0128678 3300049592 Bacteria 2053
1234 Ga0501076_0171895 3300049592 Bacteria 1766
1235 Ga0501076_0277831 3300049592 Bacteria 1372
1236 Ga0501077_0292885 3300049593 Bacteria 1037
1237 Ga0501211_003699 3300049658 Bacteria 1573
1238 Ga0501223_000289 3300049663 Bacteria 12651
1239 Ga0501224_000002 3300049664 Bacteria 229331
1240 Ga0501233_006556 3300049668 Bacteria 2190
1241 Ga0501225_0000045 3300049705 Bacteria 41541
1242 Ga0501225_0018576 3300049705 Bacteria 1927
1243 Ga0501234_000055 3300049707 Bacteria 13099
1244 Ga0501079_0054277 3300049741 Bacteria 3091
1245 Ga0501079_0143047 3300049741 Bacteria 1863
1246 Ga0501079_0253254 3300049741 Bacteria 1376
1247 Ga0501079_0366676 3300049741 Bacteria 1129
1248 Ga0501079_0368635 3300049741 Bacteria 1126
1249 Ga0501080_0111454 3300049742 Bacteria 2536
1250 Ga0501081_0020783 3300049743 Bacteria 4379
1251 Ga0501081_0132933 3300049743 Bacteria 1779
1252 Ga0501083_0012517 3300049744 Bacteria 5935
1253 Ga0501035_0002396 3300049822 Bacteria 18390
1254 Ga0501035_0030042 3300049822 Bacteria 4955
1255 Ga0501035_0056002 3300049822 Bacteria 3520
1256 Ga0501035_0070987 3300049822 Bacteria 3084
1257 Ga0501035_0071340 3300049822 Bacteria 3076
1258 Ga0501035_0072618 3300049822 Bacteria 3045
1259 Ga0501035_0154414 3300049822 Bacteria 1990
1260 Ga0501044_0000266 3300049823 Bacteria 66205
1261 Ga0501044_0029012 3300049823 Bacteria 5836
1262 Ga0501044_0030690 3300049823 Bacteria 5663
1263 Ga0501044_0041958 3300049823 Bacteria 4762
1264 Ga0501044_0045060 3300049823 Bacteria 4574
1265 Ga0501044_0067189 3300049823 Bacteria 3653
1266 Ga0501044_0077325 3300049823 Bacteria 3375
1267 Ga0501044_0172223 3300049823 Bacteria 2135
1268 Ga0501045_0148673 3300049824 Bacteria 1743
1269 Ga0501226_000026 3300049853 Bacteria 91031
1270 nmdc:mga03683_138675_c1 3300050489 Bacteria 1092
1271 nmdc:mga03n38_1841_c1 3300050490 Bacteria 6321
1272 nmdc:mga00v17_134798_c1 3300050491 Bacteria 1580
1273 nmdc:mga00v17_15240_c1 3300050491 Bacteria 4311
1274 nmdc:mga00v17_162975_c1 3300050491 Bacteria 1436
1275 nmdc:mga00v17_266129_c1 3300050491 Bacteria 1112
1276 nmdc:mga00v17_58269_c1 3300050491 Bacteria 2366
1277 nmdc:mga0yw44_1073_c2 3300050492 Bacteria 3816
1278 nmdc:mga0yw44_115170_c1 3300050492 Bacteria 1726
1279 nmdc:mga0yw44_64077_c1 3300050492 Bacteria 2261
1280 nmdc:mga0yw44_813_c1 3300050492 Bacteria 11629
1281 nmdc:mga0k408_221755_c1 3300050493 Bacteria 1129
1282 nmdc:mga0k408_85015_c1 3300050493 Bacteria 1857
1283 nmdc:mga06z11_12290_c1 3300050494 Bacteria 3720
1284 nmdc:mga06z11_28342_c1 3300050494 Bacteria 2686
1285 nmdc:mga06z11_67329_c1 3300050494 Bacteria 1885
1286 nmdc:mga07m45_134096_c1 3300050496 Bacteria 1433
1287 nmdc:mga07m45_19367_c1 3300050496 Bacteria 3687
1288 nmdc:mga07m45_7723_c1 3300050496 Bacteria 5504
1289 nmdc:mga05p37_154875_c1 3300050507 Bacteria 2801
1290 nmdc:mga05p37_301611_c1 3300050507 Bacteria 1903
1291 nmdc:mga05p37_358558_c1 3300050507 Bacteria 1715
1292 nmdc:mga05p37_389441_c1 3300050507 Bacteria 1630
1293 nmdc:mga05p37_602943_c1 3300050507 Bacteria 1239
1294 nmdc:mga05p37_82855_c1 3300050507 Bacteria 3952
1295 nmdc:mga09592_206097_c1 3300050508 Bacteria 1703
1296 nmdc:mga0qj67_21529_c1 3300050509 Bacteria 1192
1297 nmdc:mga0qj67_50_c1 3300050509 Bacteria 50243
1298 nmdc:mga0qj67_74334_c1 3300050509 Bacteria 2716
1299 nmdc:mga06r32_214387_c1 3300050510 Bacteria 1913
1300 nmdc:mga06r32_345166_c1 3300050510 Bacteria 1473
1301 nmdc:mga06r32_94551_c1 3300050510 Bacteria 2924
1302 nmdc:mga0rr50_48411_c1 3300050513 Bacteria 3142
1303 nmdc:mga08x19_334637_c1 3300050514 Bacteria 1055
1304 nmdc:mga0a205_364436_c1 3300050515 Bacteria 1311
1305 nmdc:mga0sz30_13149_c1 3300050516 Bacteria 3235
1306 Ga0495601_0000589 3300053077 Bacteria 19331
1307 Ga0495601_0010473 3300053077 Bacteria 5519
1308 Ga0495601_0032032 3300053077 Bacteria 3270
1309 Ga0495601_0062698 3300053077 Bacteria 2361
1310 Ga0495612_0001270 3300053078 Bacteria 10413
1311 Ga0495612_0002637 3300053078 Bacteria 7395
1312 Ga0495612_0013700 3300053078 Bacteria 3266
1313 Ga0495612_0027714 3300053078 Bacteria 2279
1314 Ga0495612_0045474 3300053078 Bacteria 1797
1315 Ga0500635_0072083 3300053080 Bacteria 1227
1316 Ga0495595_0001037 3300053084 Bacteria 10708
1317 Ga0495595_0099637 3300053084 Bacteria 1401
1318 Ga0495595_0112432 3300053084 Bacteria 1321
1319 Ga0495619_0005308 3300053085 Bacteria 8163
1320 Ga0495619_0017953 3300053085 Bacteria 4485
1321 Ga0495619_0211036 3300053085 Bacteria 1345
1322 Ga0500643_000042 3300053087 Bacteria 158933
1323 Ga0500643_001251 3300053087 Bacteria 15060
1324 Ga0500643_058698 3300053087 Bacteria 1085
1325 Ga0500644_0000533 3300053088 Bacteria 15780
1326 Ga0500647_0024199 3300053091 Bacteria 2854
1327 Ga0500647_0029042 3300053091 Bacteria 2621
1328 Ga0500651_0000628 3300053093 Bacteria 17559
1329 Ga0500651_0001643 3300053093 Bacteria 11381
1330 Ga0500566_0000178 3300053094 Bacteria 32469
1331 Ga0500566_0000834 3300053094 Bacteria 17566
1332 Ga0500566_0010268 3300053094 Bacteria 5520
1333 Ga0500566_0032693 3300053094 Bacteria 3034
1334 Ga0500640_029138 3300053095 Bacteria 2412
1335 Ga0500640_064959 3300053095 Bacteria 1575
1336 Ga0500641_0003159 3300053096 Bacteria 5838
1337 Ga0500641_0004944 3300053096 Bacteria 4725
1338 Ga0500641_0067877 3300053096 Bacteria 1496
1339 Ga0500641_0133642 3300053096 Bacteria 1071
1340 Ga0500554_073532 3300053102 Bacteria 1116
1341 Ga0500555_000735 3300053103 Bacteria 12142
1342 Ga0500555_002532 3300053103 Bacteria 5281
1343 Ga0500555_019657 3300053103 Bacteria 1945
1344 Ga0500556_0000290 3300053104 Bacteria 39103
1345 Ga0500556_0004619 3300053104 Bacteria 3913
1346 Ga0500557_000006 3300053105 Bacteria 141252
1347 Ga0500562_005693 3300053108 Bacteria 3138
1348 Ga0500562_048309 3300053108 Bacteria 1136
1349 Ga0500572_000041 3300053111 Bacteria 39295
1350 Ga0500572_015508 3300053111 Bacteria 1923
1351 Ga0500592_009871 3300053116 Bacteria 1519
1352 Ga0500594_0031311 3300053118 Bacteria 1402
1353 Ga0500595_000002 3300053119 Bacteria 1074388
1354 Ga0500595_001597 3300053119 Bacteria 11940
1355 Ga0500595_009190 3300053119 Bacteria 3999
1356 Ga0500595_015184 3300053119 Bacteria 2894
1357 Ga0500595_018294 3300053119 Bacteria 2566
1358 Ga0500608_080244 3300053122 Bacteria 1540
1359 Ga0500614_002436 3300053123 Bacteria 4154
1360 Ga0500621_058891 3300053126 Bacteria 1553
1361 Ga0500642_0000040 3300053130 Bacteria 96160
1362 Ga0500642_0022271 3300053130 Bacteria 2525
1363 Ga0500642_0099608 3300053130 Bacteria 1350
1364 Ga0500652_082782 3300053131 Bacteria 1337
1365 Ga0500658_0058151 3300053134 Bacteria 1600
1366 Ga0500658_0068364 3300053134 Bacteria 1493
1367 Ga0500559_0000597 3300053136 Bacteria 24582
1368 Ga0500559_0006230 3300053136 Bacteria 5400
1369 Ga0500561_0009191 3300053137 Bacteria 1997
1370 Ga0500568_0003040 3300053139 Bacteria 9591
1371 Ga0500568_0003788 3300053139 Bacteria 8277
1372 Ga0500568_0013672 3300053139 Bacteria 3692
1373 Ga0500568_0019093 3300053139 Bacteria 2987
1374 Ga0500568_0033871 3300053139 Bacteria 2093
1375 Ga0500588_0061365 3300053146 Bacteria 1206
1376 Ga0500590_116353 3300053148 Bacteria 1260
1377 Ga0500603_000312 3300053150 Bacteria 12796
1378 Ga0500604_0016250 3300053151 Bacteria 2048
1379 Ga0500616_0000002 3300053153 Bacteria 1611257
1380 Ga0500616_0002157 3300053153 Bacteria 17033
1381 Ga0500616_0008096 3300053153 Bacteria 6573
1382 Ga0500616_0023517 3300053153 Bacteria 3432
1383 Ga0500616_0027058 3300053153 Bacteria 3169
1384 Ga0500622_0012774 3300053156 Bacteria 4537
1385 Ga0500622_0089240 3300053156 Bacteria 1532
1386 Ga0500627_0033845 3300053158 Bacteria 2162
1387 Ga0500627_0127748 3300053158 Bacteria 1148
1388 Ga0500627_0197651 3300053158 Bacteria 902
1389 Ga0500630_000840 3300053159 Bacteria 14239
1390 Ga0500633_0071169 3300053160 Bacteria 1242
1391 Ga0500638_001878 3300053162 Bacteria 6970
1392 Ga0500639_000029 3300053163 Bacteria 76014
1393 Ga0500639_140429 3300053163 Bacteria 1130
1394 Ga0500636_0000105 3300053177 Bacteria 43109
1395 Ga0500636_0025642 3300053177 Bacteria 3485
1396 Ga0500636_0075129 3300053177 Bacteria 1955
1397 Ga0500636_0100425 3300053177 Bacteria 1645
1398 Ga0500636_0155768 3300053177 Bacteria 1251
1399 Ga0500637_0000215 3300053178 Bacteria 21698
1400 Ga0500645_064109 3300053730 Bacteria 1060
1401 Ga0500609_004989 3300053731 Bacteria 1817
1402 Ga0500552_007034 3300053733 Bacteria 1284
1403 Ga0500596_002014 3300053735 Bacteria 4061
1404 Ga0500596_006334 3300053735 Bacteria 2013
1405 Ga0500601_000682 3300053737 Bacteria 4577
1406 Ga0500587_001664 3300053739 Bacteria 3161
1407 Ga0501084_0015828 3300054114 Bacteria 6256
1408 Ga0501084_0053971 3300054114 Bacteria 3361
1409 Ga0501082_0018385 3300060353 Bacteria 6020
1410 Ga0501082_0029700 3300060353 Bacteria 4710
1411 Ga0501082_0312271 3300060353 Bacteria 1369

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044712 Ga0453684_1261641 Ga0453684_1261641_23_763 240
2 3300026118 Ga0207675_100272158 Ga0207675_1002721582 243
3 3300006038 Ga0075365_10063772 Ga0075365_100637723 249
4 3300032004 Ga0307414_10201129 Ga0307414_102011293 251
5 3300038443 Ga0395901_0362943 Ga0395901_0362943_498_1382 251
6 3300003771 Ga0055526_1000150 Ga0055526_100015029 256
7 3300025295 Ga0209564_1000015 Ga0209564_1000015568 256
8 3300002987 JGI25159J45721_1013877 JGI25159J45721_10138772 257
9 3300003187 JGI25151J46595_10000019 JGI25151J46595_100000196 257
10 3300005262 Ga0065165_1001200 Ga0065165_100120030 257
11 3300006177 Ga0075362_10166907 Ga0075362_101669071 257
12 3300025284 Ga0209130_1000343 Ga0209130_10003438 257
13 3300025294 Ga0209025_1000008 Ga0209025_1000008491 257
14 3300025294 Ga0209025_1000835 Ga0209025_100083531 257
15 3300025297 Ga0209758_1056030 Ga0209758_10560302 257
16 3300049589 Ga0501073_0197079 Ga0501073_0197079_434_1348 258
17 3300009101 Ga0105247_10022626 Ga0105247_100226263 259
18 3300025900 Ga0207710_10053419 Ga0207710_100534192 259
19 3300026075 Ga0207708_10444525 Ga0207708_104445251 259
20 3300035691 Ga0373931_0329918 Ga0373931_0329918_47_883 259
21 3300048929 Ga0496126_0047582 Ga0496126_0047582_1813_2751 259
22 3300025299 Ga0209256_1001342 Ga0209256_100134218 260
23 3300035089 Ga0373944_0009011 Ga0373944_0009011_1508_2458 260
24 3300035116 Ga0373945_0030108 Ga0373945_0030108_559_1509 260
25 3300035170 Ga0373943_0000755 Ga0373943_0000755_6076_7026 260
26 3300035171 Ga0373946_0004314 Ga0373946_0004314_579_1529 260
27 3300035692 Ga0373935_0019696 Ga0373935_0019696_1897_2847 260
28 3300035695 Ga0373927_0000113 Ga0373927_0000113_24730_25680 260
29 3300035725 Ga0373947_0002417 Ga0373947_0002417_6995_7945 260
30 3300037068 Ga0373925_0020265 Ga0373925_0020265_556_1506 260
31 3300046472 Ga0495580_0007886 Ga0495580_0007886_1860_2810 260
32 3300046514 Ga0495618_0152608 Ga0495618_0152608_427_1377 260
33 3300046517 Ga0495630_0006103 Ga0495630_0006103_7372_8322 260
34 3300046526 Ga0495666_0034265 Ga0495666_0034265_1291_2241 260
35 3300046533 Ga0495640_0057977 Ga0495640_0057977_1029_1979 260
36 3300046689 Ga0495613_0044732 Ga0495613_0044732_911_1861 260
37 3300046690 Ga0495624_0048239 Ga0495624_0048239_1178_2128 260
38 3300047315 Ga0495581_0004287 Ga0495581_0004287_346_1296 260
39 3300047321 Ga0495676_0056510 Ga0495676_0056510_1515_2465 260
40 3300047471 Ga0495684_0000845 Ga0495684_0000845_552_1502 260
41 3300047673 Ga0495593_0011906 Ga0495593_0011906_2747_3697 260
42 3300025928 Ga0207700_10189902 Ga0207700_101899022 261
43 3300028800 Ga0265338_10190710 Ga0265338_101907102 261
44 3300046455 Ga0495603_0323701 Ga0495603_0323701_23_853 261
45 3300046472 Ga0495580_0240952 Ga0495580_0240952_26_856 261
46 3300046664 Ga0495659_0029756 Ga0495659_0029756_1042_1872 261
47 3300049822 Ga0501035_0056002 Ga0501035_0056002_43_927 261
48 3300050494 nmdc:mga06z11_67329_c1 nmdc:mga06z11_67329_c1_1045_1875 261
49 3300053111 Ga0500572_000041 Ga0500572_000041_18915_19808 261
50 3300053136 Ga0500559_0000597 Ga0500559_0000597_18244_19137 261
51 3300053163 Ga0500639_140429 Ga0500639_140429_72_965 261
52 3300053735 Ga0500596_006334 Ga0500596_006334_708_1601 261
53 3300005458 Ga0070681_10092574 Ga0070681_100925741 262
54 3300025294 Ga0209025_1024276 Ga0209025_10242764 262
55 3300013250 Ga0171462_1006 Ga0171462_1006285 263
56 3300031901 Ga0307406_10004247 Ga0307406_100042478 263
57 3300049575 Ga0501039_0110707 Ga0501039_0110707_230_1066 263
58 3300021377 Ga0213874_10003862 Ga0213874_100038625 264
59 3300021384 Ga0213876_10053186 Ga0213876_100531861 264
60 3300039437 Ga0436365_1710304 Ga0436365_1710304_1263_2150 264
61 3300039450 Ga0436363_1471097 Ga0436363_1471097_4289_5176 264
62 3300048903 Ga0496100_0008443 Ga0496100_0008443_2042_2932 264
63 3300048907 Ga0496104_0007514 Ga0496104_0007514_355_1245 264
64 3300048909 Ga0496106_0000634 Ga0496106_0000634_4583_5473 264
65 3300048910 Ga0496107_0009028 Ga0496107_0009028_2240_3130 264
66 3300048911 Ga0496108_0001003 Ga0496108_0001003_18163_19053 264
67 3300048912 Ga0496109_0000166 Ga0496109_0000166_16368_17258 264
68 3300048913 Ga0496110_0012878 Ga0496110_0012878_2118_3008 264
69 3300048914 Ga0496111_0059949 Ga0496111_0059949_36_926 264
70 3300048915 Ga0496112_0000358 Ga0496112_0000358_6897_7787 264
71 3300049593 Ga0501077_0292885 Ga0501077_0292885_34_873 264
72 3300050507 nmdc:mga05p37_301611_c1 nmdc:mga05p37_301611_c1_739_1650 264
73 3300003322 rootL2_10059632 rootL2_100596321 265
74 3300009551 Ga0105238_10606520 Ga0105238_106065201 265
75 3300010375 Ga0105239_10388821 Ga0105239_103888212 265
76 3300037471 Ga0395905_0000123 Ga0395905_0000123_109201_110088 265
77 3300050491 nmdc:mga00v17_266129_c1 nmdc:mga00v17_266129_c1_97_1020 265
78 3300025254 Ga0209148_1018454 Ga0209148_10184541 266
79 3300026116 Ga0207674_10191273 Ga0207674_101912732 266
80 3300049581 Ga0501047_0376022 Ga0501047_0376022_35_931 266
81 3300049586 Ga0501070_0180587 Ga0501070_0180587_593_1489 266
82 3300049822 Ga0501035_0072618 Ga0501035_0072618_140_1027 266
83 3300053096 Ga0500641_0004944 Ga0500641_0004944_1398_2300 266
84 3300005328 Ga0070676_10092865 Ga0070676_100928653 267
85 3300005356 Ga0070674_100055392 Ga0070674_1000553922 267
86 3300005981 Ga0081538_10001580 Ga0081538_1000158022 267
87 3300006880 Ga0075429_100232719 Ga0075429_1002327192 267
88 3300025907 Ga0207645_10093764 Ga0207645_100937642 267
89 3300025937 Ga0207669_10110270 Ga0207669_101102702 267
90 3300026121 Ga0207683_10051243 Ga0207683_100512434 267
91 3300037068 Ga0373925_0447654 Ga0373925_0447654_64_930 267
92 3300049568 Ga0501031_0144281 Ga0501031_0144281_565_1497 267
93 3300050508 nmdc:mga09592_206097_c1 nmdc:mga09592_206097_c1_511_1365 267
94 3300050510 nmdc:mga06r32_345166_c1 nmdc:mga06r32_345166_c1_482_1420 267
95 3300021377 Ga0213874_10001203 Ga0213874_100012032 268
96 3300025928 Ga0207700_10092942 Ga0207700_100929422 268
97 3300039450 Ga0436363_1401795 Ga0436363_1401795_7620_8507 268
98 3300048088 Ga0495602_0068416 Ga0495602_0068416_2048_2938 268
99 3300005355 Ga0070671_100200532 Ga0070671_1002005323 269
100 3300005367 Ga0070667_100071421 Ga0070667_1000714211 269
101 3300005456 Ga0070678_100016373 Ga0070678_1000163736 269
102 3300005617 Ga0068859_100754882 Ga0068859_1007548822 269
103 3300005843 Ga0068860_100176074 Ga0068860_1001760742 269
104 3300005983 Ga0081540_1001733 Ga0081540_100173316 269
105 3300006847 Ga0075431_100318824 Ga0075431_1003188242 269
106 3300006931 Ga0097620_100754866 Ga0097620_1007548662 269
107 3300006942 Ga0099824_1023696 Ga0099824_10236962 269
108 3300009148 Ga0105243_10033198 Ga0105243_100331981 269
109 3300014968 Ga0157379_10206154 Ga0157379_102061542 269
110 3300014969 Ga0157376_10126647 Ga0157376_101266471 269
111 3300021320 Ga0214544_1000136 Ga0214544_100013665 269
112 3300021321 Ga0214542_1000127 Ga0214542_100012765 269
113 3300021324 Ga0214545_1000063 Ga0214545_100006333 269
114 3300021327 Ga0214543_1000238 Ga0214543_100023845 269
115 3300021327 Ga0214543_1041052 Ga0214543_10410521 269
116 3300025907 Ga0207645_10049857 Ga0207645_100498572 269
117 3300025931 Ga0207644_10172994 Ga0207644_101729943 269
118 3300025938 Ga0207704_10104069 Ga0207704_101040693 269
119 3300025940 Ga0207691_10229209 Ga0207691_102292092 269
120 3300025960 Ga0207651_10145749 Ga0207651_101457493 269
121 3300027296 Ga0209389_1000088 Ga0209389_100008839 269
122 3300027357 Ga0209589_1000189 Ga0209589_100018929 269
123 3300027361 Ga0209489_100085 Ga0209489_10008578 269
124 3300028381 Ga0268264_10044034 Ga0268264_100440343 269
125 3300031711 Ga0265314_10001759 Ga0265314_1000175916 269
126 3300046523 Ga0495644_0037512 Ga0495644_0037512_595_1482 269
127 3300046615 Ga0495656_0060648 Ga0495656_0060648_285_1172 269
128 3300046684 Ga0495669_0012302 Ga0495669_0012302_2209_3096 269
129 3300003763 Ga0055529_1012682 Ga0055529_10126822 270
130 3300005843 Ga0068860_100000324 Ga0068860_10000032410 270
131 3300024227 Ga0228598_1023939 Ga0228598_10239392 270
132 3300025254 Ga0209148_1005097 Ga0209148_10050973 270
133 3300025261 Ga0209233_1005247 Ga0209233_10052473 270
134 3300025272 Ga0209455_1003980 Ga0209455_10039803 270
135 3300025901 Ga0207688_10056128 Ga0207688_100561282 270
136 3300028381 Ga0268264_10000038 Ga0268264_10000038311 270
137 3300031250 Ga0265331_10022264 Ga0265331_100222644 270
138 3300053095 Ga0500640_064959 Ga0500640_064959_418_1317 270
139 3300053103 Ga0500555_002532 Ga0500555_002532_829_1686 270
140 3300053111 Ga0500572_015508 Ga0500572_015508_964_1863 270
141 3300053177 Ga0500636_0000105 Ga0500636_0000105_22260_23159 270
142 3300053177 Ga0500636_0155768 Ga0500636_0155768_67_954 270
143 3300003320 rootH2_10072203 rootH2_100722035 271
144 3300004625 Ga0055543_1005200 Ga0055543_10052003 271
145 3300005262 Ga0065165_1001308 Ga0065165_10013084 271
146 3300005841 Ga0068863_100260383 Ga0068863_1002603832 271
147 3300006028 Ga0070717_10000521 Ga0070717_1000052119 271
148 3300006058 Ga0075432_10001165 Ga0075432_100011656 271
149 3300007788 Ga0099795_10031291 Ga0099795_100312912 271
150 3300025261 Ga0209233_1003337 Ga0209233_10033373 271
151 3300025904 Ga0207647_10017981 Ga0207647_100179814 271
152 3300031235 Ga0265330_10003886 Ga0265330_100038866 271
153 3300031247 Ga0265340_10005741 Ga0265340_100057415 271
154 3300035695 Ga0373927_0028798 Ga0373927_0028798_833_1720 271
155 3300035724 Ga0373933_0004420 Ga0373933_0004420_5596_6483 271
156 3300037068 Ga0373925_0061215 Ga0373925_0061215_353_1240 271
157 3300039447 Ga0436361_0208634 Ga0436361_0208634_2508_3407 271
158 3300046683 Ga0495658_0156532 Ga0495658_0156532_154_1041 271
159 3300047471 Ga0495684_0010217 Ga0495684_0010217_3077_4108 271
160 3300048924 Ga0496121_0286124 Ga0496121_0286124_166_1053 271
161 3300049570 Ga0501033_0017233 Ga0501033_0017233_3657_4544 271
162 3300049572 Ga0501036_0013642 Ga0501036_0013642_2669_3556 271
163 3300049579 Ga0501043_0019644 Ga0501043_0019644_2678_3565 271
164 3300049581 Ga0501047_0030884 Ga0501047_0030884_1680_2567 271
165 3300049822 Ga0501035_0030042 Ga0501035_0030042_1822_2709 271
166 3300049823 Ga0501044_0077325 Ga0501044_0077325_1786_2673 271
167 3300050514 nmdc:mga08x19_334637_c1 nmdc:mga08x19_334637_c1_43_960 271
168 3300053080 Ga0500635_0072083 Ga0500635_0072083_81_968 271
169 3300053119 Ga0500595_018294 Ga0500595_018294_390_1277 271
170 3300053177 Ga0500636_0100425 Ga0500636_0100425_34_921 271
171 3300053733 Ga0500552_007034 Ga0500552_007034_359_1246 271
172 iso_pu_bacteria 2883577096 2883577319 271
173 3300005328 Ga0070676_10051847 Ga0070676_100518474 272
174 3300005719 Ga0068861_100193677 Ga0068861_1001936772 272
175 3300005985 Ga0081539_10065113 Ga0081539_100651133 272
176 3300009147 Ga0114129_10157410 Ga0114129_101574102 272
177 3300009148 Ga0105243_10260156 Ga0105243_102601562 272
178 3300009551 Ga0105238_10202290 Ga0105238_102022901 272
179 3300025935 Ga0207709_10317320 Ga0207709_103173202 272
180 3300025972 Ga0207668_10040041 Ga0207668_100400412 272
181 3300031235 Ga0265330_10062964 Ga0265330_100629642 272
182 3300035112 Ga0373932_0016637 Ga0373932_0016637_240_1103 272
183 3300045976 Ga0466967_0235265 Ga0466967_0235265_229_1113 272
184 3300048918 Ga0496115_0124043 Ga0496115_0124043_1008_1898 272
185 3300050507 nmdc:mga05p37_154875_c1 nmdc:mga05p37_154875_c1_1120_2055 272
186 3300053177 Ga0500636_0025642 Ga0500636_0025642_386_1276 272
187 3300053730 Ga0500645_064109 Ga0500645_064109_11_880 272
188 iso_pu_bacteria 2617270735 2617347187 272
189 iso_pu_bacteria 8016566248 8016571468 272
190 3300005262 Ga0065165_1016121 Ga0065165_10161211 273
191 3300025302 Ga0207426_1005196 Ga0207426_10051966 273
192 3300039437 Ga0436365_0012938 Ga0436365_0012938_52_900 273
193 3300050513 nmdc:mga0rr50_48411_c1 nmdc:mga0rr50_48411_c1_319_1206 273
194 3300050515 nmdc:mga0a205_364436_c1 nmdc:mga0a205_364436_c1_53_931 273
195 3300005536 Ga0070697_100045150 Ga0070697_1000451505 274
196 3300010375 Ga0105239_10240750 Ga0105239_102407502 274
197 3300026041 Ga0207639_10278024 Ga0207639_102780242 274
198 3300026116 Ga0207674_10098539 Ga0207674_100985394 274
199 3300039062 Ga0400483_063769 Ga0400483_063769_19149_20000 274
200 3300049585 Ga0501069_0025002 Ga0501069_0025002_1048_1923 274
201 3300053108 Ga0500562_005693 Ga0500562_005693_285_1133 274
202 iso_pu_bacteria 2824671348 2824676835 274
203 iso_pu_bacteria 2824687955 2824693295 274
204 iso_pu_bacteria 2824696289 2824701316 274
205 iso_pu_bacteria 2824746037 2824751825 274
206 iso_pu_bacteria 2824773399 2824776099 274
207 iso_pu_bacteria 2838122688 2838127044 274
208 iso_pu_bacteria 2841941048 2841945474 274
209 iso_pu_bacteria 2841949485 2841955927 274
210 iso_pu_bacteria 2841966195 2841973998 274
211 iso_pu_bacteria 2841974524 2841980609 274
212 iso_pu_bacteria 2841983080 2841987145 274
213 iso_pu_bacteria 2847939898 2847939943 274
214 iso_pu_bacteria 2849076700 2849077853 274
215 iso_pu_bacteria 2874620515 2874625817 274
216 iso_pu_bacteria 2904666416 2904673822 274
217 3300005336 Ga0070680_100107792 Ga0070680_1001077922 275
218 3300005337 Ga0070682_100164765 Ga0070682_1001647652 275
219 3300005347 Ga0070668_100018194 Ga0070668_1000181946 275
220 3300005435 Ga0070714_100088227 Ga0070714_1000882274 275
221 3300005436 Ga0070713_100021271 Ga0070713_1000212715 275
222 3300005439 Ga0070711_100027217 Ga0070711_1000272172 275
223 3300005458 Ga0070681_10149558 Ga0070681_101495582 275
224 3300005459 Ga0068867_100229408 Ga0068867_1002294082 275
225 3300006175 Ga0070712_100006981 Ga0070712_1000069818 275
226 3300006195 Ga0075366_10064465 Ga0075366_100644652 275
227 3300013100 Ga0157373_10030403 Ga0157373_100304032 275
228 3300013307 Ga0157372_10125611 Ga0157372_101256112 275
229 3300025906 Ga0207699_10049055 Ga0207699_100490553 275
230 3300025912 Ga0207707_10329085 Ga0207707_103290852 275
231 3300025928 Ga0207700_10157297 Ga0207700_101572973 275
232 3300025932 Ga0207690_10044119 Ga0207690_100441192 275
233 3300025934 Ga0207686_10034158 Ga0207686_100341583 275
234 3300025949 Ga0207667_10021274 Ga0207667_100212744 275
235 3300026089 Ga0207648_10274269 Ga0207648_102742692 275
236 3300049571 Ga0501034_0136391 Ga0501034_0136391_643_1497 275
237 3300049573 Ga0501037_0172105 Ga0501037_0172105_468_1322 275
238 3300049588 Ga0501072_0168067 Ga0501072_0168067_775_1662 275
239 3300050507 nmdc:mga05p37_358558_c1 nmdc:mga05p37_358558_c1_507_1451 275
240 3300050510 nmdc:mga06r32_214387_c1 nmdc:mga06r32_214387_c1_930_1874 275
241 3300053087 Ga0500643_001251 Ga0500643_001251_1146_2045 275
242 3300053088 Ga0500644_0000533 Ga0500644_0000533_2776_3675 275
243 3300053093 Ga0500651_0001643 Ga0500651_0001643_5759_6658 275
244 3300053094 Ga0500566_0032693 Ga0500566_0032693_1709_2608 275
245 3300053119 Ga0500595_000002 Ga0500595_000002_981068_981967 275
246 3300053153 Ga0500616_0000002 Ga0500616_0000002_1091715_1092614 275
247 iso_pu_bacteria 2513237141 2513887472 275
248 iso_pu_bacteria 2894817345 2894820490 275
249 iso_pu_bacteria 2929199973 2929205503 275
250 iso_pu_bacteria 8001845381 8001849991 275
251 iso_pu_bacteria 8006994254 8006998552 275
252 iso_pu_bacteria 8055909800 8055914500 275
253 3300001989 JGI24739J22299_10031199 JGI24739J22299_100311993 276
254 3300005328 Ga0070676_10056064 Ga0070676_100560642 276
255 3300005330 Ga0070690_100145626 Ga0070690_1001456263 276
256 3300005331 Ga0070670_100048139 Ga0070670_1000481393 276
257 3300005334 Ga0068869_100052862 Ga0068869_1000528622 276
258 3300005335 Ga0070666_10367110 Ga0070666_103671101 276
259 3300005336 Ga0070680_100030489 Ga0070680_1000304892 276
260 3300005338 Ga0068868_100047184 Ga0068868_1000471842 276
261 3300005339 Ga0070660_100241659 Ga0070660_1002416592 276
262 3300005339 Ga0070660_100334349 Ga0070660_1003343491 276
263 3300005343 Ga0070687_100031773 Ga0070687_1000317733 276
264 3300005345 Ga0070692_10142743 Ga0070692_101427431 276
265 3300005347 Ga0070668_100139662 Ga0070668_1001396621 276
266 3300005354 Ga0070675_100027856 Ga0070675_1000278566 276
267 3300005355 Ga0070671_100132984 Ga0070671_1001329843 276
268 3300005364 Ga0070673_100107335 Ga0070673_1001073352 276
269 3300005366 Ga0070659_100056042 Ga0070659_1000560423 276
270 3300005366 Ga0070659_100115383 Ga0070659_1001153832 276
271 3300005367 Ga0070667_100044105 Ga0070667_1000441054 276
272 3300005367 Ga0070667_100181233 Ga0070667_1001812331 276
273 3300005435 Ga0070714_100224507 Ga0070714_1002245072 276
274 3300005436 Ga0070713_100168782 Ga0070713_1001687823 276
275 3300005437 Ga0070710_10081532 Ga0070710_100815322 276
276 3300005439 Ga0070711_100319821 Ga0070711_1003198212 276
277 3300005441 Ga0070700_100422605 Ga0070700_1004226051 276
278 3300005457 Ga0070662_100020307 Ga0070662_1000203071 276
279 3300005457 Ga0070662_100248845 Ga0070662_1002488452 276
280 3300005466 Ga0070685_10014330 Ga0070685_100143305 276
281 3300005467 Ga0070706_100241629 Ga0070706_1002416292 276
282 3300005468 Ga0070707_100127762 Ga0070707_1001277622 276
283 3300005471 Ga0070698_100005261 Ga0070698_1000052618 276
284 3300005539 Ga0068853_100060774 Ga0068853_1000607741 276
285 3300005539 Ga0068853_100114427 Ga0068853_1001144273 276
286 3300005547 Ga0070693_100112991 Ga0070693_1001129913 276
287 3300005549 Ga0070704_100261957 Ga0070704_1002619571 276
288 3300005578 Ga0068854_100062641 Ga0068854_1000626412 276
289 3300005616 Ga0068852_100104089 Ga0068852_1001040893 276
290 3300005719 Ga0068861_100376780 Ga0068861_1003767802 276
291 3300005834 Ga0068851_10086111 Ga0068851_100861112 276
292 3300005840 Ga0068870_10004317 Ga0068870_100043172 276
293 3300005841 Ga0068863_100172388 Ga0068863_1001723883 276
294 3300005843 Ga0068860_100107413 Ga0068860_1001074133 276
295 3300005844 Ga0068862_100152635 Ga0068862_1001526351 276
296 3300005983 Ga0081540_1000027 Ga0081540_100002734 276
297 3300006028 Ga0070717_10002083 Ga0070717_100020832 276
298 3300006028 Ga0070717_10063067 Ga0070717_100630673 276
299 3300006028 Ga0070717_10174051 Ga0070717_101740512 276
300 3300006028 Ga0070717_10571280 Ga0070717_105712802 276
301 3300006038 Ga0075365_10001829 Ga0075365_100018292 276
302 3300006038 Ga0075365_10001918 Ga0075365_100019182 276
303 3300006163 Ga0070715_10057089 Ga0070715_100570892 276
304 3300006175 Ga0070712_100000210 Ga0070712_10000021013 276
305 3300006175 Ga0070712_100076021 Ga0070712_1000760212 276
306 3300006175 Ga0070712_100129627 Ga0070712_1001296271 276
307 3300006178 Ga0075367_10049089 Ga0075367_100490891 276
308 3300006178 Ga0075367_10097787 Ga0075367_100977872 276
309 3300006237 Ga0097621_100092306 Ga0097621_1000923063 276
310 3300006846 Ga0075430_100004969 Ga0075430_1000049697 276
311 3300006881 Ga0068865_100108753 Ga0068865_1001087533 276
312 3300007788 Ga0099795_10063617 Ga0099795_100636172 276
313 3300009098 Ga0105245_10004787 Ga0105245_100047872 276
314 3300009098 Ga0105245_10368055 Ga0105245_103680551 276
315 3300009101 Ga0105247_10003270 Ga0105247_100032706 276
316 3300009148 Ga0105243_10037948 Ga0105243_100379484 276
317 3300009177 Ga0105248_10025905 Ga0105248_100259053 276
318 3300009545 Ga0105237_10205238 Ga0105237_102052383 276
319 3300009551 Ga0105238_10297722 Ga0105238_102977222 276
320 3300010159 Ga0099796_10038401 Ga0099796_100384012 276
321 3300010159 Ga0099796_10072966 Ga0099796_100729661 276
322 3300011119 Ga0105246_10041134 Ga0105246_100411342 276
323 3300013296 Ga0157374_10095661 Ga0157374_100956612 276
324 3300013297 Ga0157378_10088994 Ga0157378_100889942 276
325 3300014326 Ga0157380_10059935 Ga0157380_100599355 276
326 3300014968 Ga0157379_10309899 Ga0157379_103098991 276
327 3300021384 Ga0213876_10000346 Ga0213876_1000034613 276
328 3300021388 Ga0213875_10000098 Ga0213875_100000981 276
329 3300024227 Ga0228598_1001518 Ga0228598_10015182 276
330 3300025898 Ga0207692_10283508 Ga0207692_102835082 276
331 3300025901 Ga0207688_10001072 Ga0207688_1000107211 276
332 3300025903 Ga0207680_10084601 Ga0207680_100846012 276
333 3300025905 Ga0207685_10037311 Ga0207685_100373112 276
334 3300025906 Ga0207699_10249241 Ga0207699_102492411 276
335 3300025907 Ga0207645_10005025 Ga0207645_100050259 276
336 3300025908 Ga0207643_10000532 Ga0207643_1000053210 276
337 3300025910 Ga0207684_10190965 Ga0207684_101909652 276
338 3300025915 Ga0207693_10002870 Ga0207693_1000287012 276
339 3300025915 Ga0207693_10005583 Ga0207693_100055837 276
340 3300025915 Ga0207693_10235354 Ga0207693_102353542 276
341 3300025916 Ga0207663_10162680 Ga0207663_101626802 276
342 3300025918 Ga0207662_10009678 Ga0207662_100096783 276
343 3300025919 Ga0207657_10019229 Ga0207657_1001922911 276
344 3300025922 Ga0207646_10251517 Ga0207646_102515171 276
345 3300025923 Ga0207681_10251936 Ga0207681_102519362 276
346 3300025926 Ga0207659_10051882 Ga0207659_100518822 276
347 3300025927 Ga0207687_10008071 Ga0207687_100080711 276
348 3300025928 Ga0207700_10063040 Ga0207700_100630404 276
349 3300025928 Ga0207700_10111611 Ga0207700_101116113 276
350 3300025928 Ga0207700_10303250 Ga0207700_103032501 276
351 3300025931 Ga0207644_10194363 Ga0207644_101943633 276
352 3300025933 Ga0207706_10017396 Ga0207706_100173965 276
353 3300025936 Ga0207670_10113184 Ga0207670_101131842 276
354 3300025937 Ga0207669_10078652 Ga0207669_100786521 276
355 3300025940 Ga0207691_10030766 Ga0207691_100307668 276
356 3300025942 Ga0207689_10009477 Ga0207689_100094775 276
357 3300025960 Ga0207651_10001012 Ga0207651_100010126 276
358 3300025960 Ga0207651_10098996 Ga0207651_100989962 276
359 3300025960 Ga0207651_10352342 Ga0207651_103523422 276
360 3300025972 Ga0207668_10330485 Ga0207668_103304851 276
361 3300025986 Ga0207658_10205748 Ga0207658_102057482 276
362 3300025986 Ga0207658_10291668 Ga0207658_102916681 276
363 3300026023 Ga0207677_10058963 Ga0207677_100589632 276
364 3300026023 Ga0207677_10213254 Ga0207677_102132542 276
365 3300026041 Ga0207639_10019630 Ga0207639_100196305 276
366 3300026067 Ga0207678_10020636 Ga0207678_100206365 276
367 3300026075 Ga0207708_10027941 Ga0207708_100279414 276
368 3300026078 Ga0207702_10564676 Ga0207702_105646761 276
369 3300026088 Ga0207641_10158085 Ga0207641_101580853 276
370 3300026095 Ga0207676_10339501 Ga0207676_103395011 276
371 3300026118 Ga0207675_100044992 Ga0207675_1000449923 276
372 3300026121 Ga0207683_10063915 Ga0207683_100639154 276
373 3300026142 Ga0207698_10108423 Ga0207698_101084233 276
374 3300028380 Ga0268265_10408757 Ga0268265_104087572 276
375 3300028381 Ga0268264_10691708 Ga0268264_106917081 276
376 3300028577 Ga0265318_10000046 Ga0265318_10000046101 276
377 3300030760 Ga0265762_1006912 Ga0265762_10069122 276
378 3300031235 Ga0265330_10047336 Ga0265330_100473362 276
379 3300031247 Ga0265340_10025504 Ga0265340_100255042 276
380 3300031249 Ga0265339_10002691 Ga0265339_100026916 276
381 3300031595 Ga0265313_10000024 Ga0265313_10000024134 276
382 3300035111 Ga0373923_0110406 Ga0373923_0110406_252_1145 276
383 3300035119 Ga0373956_0002426 Ga0373956_0002426_4186_5079 276
384 3300035119 Ga0373956_0024994 Ga0373956_0024994_1646_2539 276
385 3300035170 Ga0373943_0016037 Ga0373943_0016037_895_1788 276
386 3300035172 Ga0373955_0003015 Ga0373955_0003015_5982_6875 276
387 3300035410 Ga0373924_0127105 Ga0373924_0127105_130_1023 276
388 3300035692 Ga0373935_0070177 Ga0373935_0070177_191_1099 276
389 3300035695 Ga0373927_0031222 Ga0373927_0031222_1052_1945 276
390 3300035695 Ga0373927_0034162 Ga0373927_0034162_976_1884 276
391 3300035695 Ga0373927_0076618 Ga0373927_0076618_324_1217 276
392 3300035724 Ga0373933_0000258 Ga0373933_0000258_12982_13875 276
393 3300035724 Ga0373933_0124883 Ga0373933_0124883_680_1573 276
394 3300036401 Ga0373937_0049868 Ga0373937_0049868_2592_3485 276
395 3300037068 Ga0373925_0123671 Ga0373925_0123671_611_1504 276
396 3300037853 Ga0436364_0235209 Ga0436364_0235209_641_1513 276
397 3300037853 Ga0436364_1390920 Ga0436364_1390920_356_1237 276
398 3300039437 Ga0436365_0076921 Ga0436365_0076921_8889_9785 276
399 3300039437 Ga0436365_0731168 Ga0436365_0731168_817_1689 276
400 3300039437 Ga0436365_0798167 Ga0436365_0798167_27724_28584 276
401 3300039437 Ga0436365_1102823 Ga0436365_1102823_320_1189 276
402 3300039438 Ga0436360_1120596 Ga0436360_1120596_361_1233 276
403 3300039447 Ga0436361_1104477 Ga0436361_1104477_659_1531 276
404 3300039453 Ga0436362_1218894 Ga0436362_1218894_138_1010 276
405 3300039453 Ga0436362_1265935 Ga0436362_1265935_2125_2997 276
406 3300046454 Ga0495592_0003878 Ga0495592_0003878_2457_3350 276
407 3300046459 Ga0495629_0020090 Ga0495629_0020090_1040_1933 276
408 3300046462 Ga0495651_0025351 Ga0495651_0025351_2533_3426 276
409 3300046462 Ga0495651_0124654 Ga0495651_0124654_173_1066 276
410 3300046463 Ga0495653_0018848 Ga0495653_0018848_2867_3760 276
411 3300046463 Ga0495653_0113252 Ga0495653_0113252_96_989 276
412 3300046477 Ga0495664_0015258 Ga0495664_0015258_935_1828 276
413 3300046511 Ga0495608_0000398 Ga0495608_0000398_17055_17948 276
414 3300046514 Ga0495618_0223287 Ga0495618_0223287_249_1142 276
415 3300046516 Ga0495628_0046997 Ga0495628_0046997_1608_2501 276
416 3300046516 Ga0495628_0173442 Ga0495628_0173442_373_1266 276
417 3300046529 Ga0495652_0117068 Ga0495652_0117068_1190_2083 276
418 3300046529 Ga0495652_0177613 Ga0495652_0177613_374_1267 276
419 3300046533 Ga0495640_0036273 Ga0495640_0036273_1509_2402 276
420 3300046536 Ga0495587_0000599 Ga0495587_0000599_15146_16039 276
421 3300046537 Ga0495598_0006329 Ga0495598_0006329_1379_2272 276
422 3300046538 Ga0495609_0086862 Ga0495609_0086862_428_1321 276
423 3300046543 Ga0495645_0026193 Ga0495645_0026193_3169_4062 276
424 3300046559 Ga0495667_0043859 Ga0495667_0043859_281_1174 276
425 3300046615 Ga0495656_0016225 Ga0495656_0016225_134_1030 276
426 3300046642 Ga0495634_0017214 Ga0495634_0017214_2925_3818 276
427 3300046663 Ga0495635_0051635 Ga0495635_0051635_1058_1951 276
428 3300046675 Ga0495657_0014016 Ga0495657_0014016_1980_2873 276
429 3300046675 Ga0495657_0150578 Ga0495657_0150578_307_1200 276
430 3300046678 Ga0495599_0005233 Ga0495599_0005233_5177_6070 276
431 3300046678 Ga0495599_0039924 Ga0495599_0039924_496_1389 276
432 3300046679 Ga0495623_0006342 Ga0495623_0006342_4149_5042 276
433 3300046684 Ga0495669_0033891 Ga0495669_0033891_1157_2050 276
434 3300046694 Ga0495649_0065369 Ga0495649_0065369_110_1003 276
435 3300046809 Ga0495600_0001478 Ga0495600_0001478_6258_7151 276
436 3300047317 Ga0495604_0014602 Ga0495604_0014602_680_1573 276
437 3300047317 Ga0495604_0108363 Ga0495604_0108363_604_1497 276
438 3300047319 Ga0495674_0045284 Ga0495674_0045284_1728_2621 276
439 3300047322 Ga0495680_0000313 Ga0495680_0000313_16051_16944 276
440 3300047471 Ga0495684_0257886 Ga0495684_0257886_232_1125 276
441 3300048088 Ga0495602_0059824 Ga0495602_0059824_1221_2114 276
442 3300048903 Ga0496100_0015869 Ga0496100_0015869_805_1698 276
443 3300048904 Ga0496101_0001983 Ga0496101_0001983_119_1012 276
444 3300048905 Ga0496102_0159788 Ga0496102_0159788_805_1698 276
445 3300048906 Ga0496103_0013950 Ga0496103_0013950_3313_4206 276
446 3300048909 Ga0496106_0317929 Ga0496106_0317929_94_987 276
447 3300048910 Ga0496107_0019014 Ga0496107_0019014_3753_4646 276
448 3300048911 Ga0496108_0009284 Ga0496108_0009284_3453_4346 276
449 3300048913 Ga0496110_0142547 Ga0496110_0142547_1216_2109 276
450 3300048914 Ga0496111_0081065 Ga0496111_0081065_1377_2270 276
451 3300048915 Ga0496112_0007378 Ga0496112_0007378_1744_2637 276
452 3300048915 Ga0496112_0046849 Ga0496112_0046849_364_1257 276
453 3300048916 Ga0496113_0017064 Ga0496113_0017064_401_1294 276
454 3300048918 Ga0496115_0008385 Ga0496115_0008385_6439_7332 276
455 3300049571 Ga0501034_0011170 Ga0501034_0011170_2521_3417 276
456 3300049571 Ga0501034_0367092 Ga0501034_0367092_160_1068 276
457 3300049572 Ga0501036_0070213 Ga0501036_0070213_1407_2294 276
458 3300049579 Ga0501043_0041532 Ga0501043_0041532_2495_3382 276
459 3300049581 Ga0501047_0012173 Ga0501047_0012173_3268_4179 276
460 3300049581 Ga0501047_0205392 Ga0501047_0205392_597_1484 276
461 3300049586 Ga0501070_0024998 Ga0501070_0024998_2589_3485 276
462 3300049586 Ga0501070_0204314 Ga0501070_0204314_627_1538 276
463 3300049587 Ga0501071_0022307 Ga0501071_0022307_2710_3606 276
464 3300049591 Ga0501075_0046475 Ga0501075_0046475_1977_2900 276
465 3300049591 Ga0501075_0077585 Ga0501075_0077585_1482_2390 276
466 3300049592 Ga0501076_0171895 Ga0501076_0171895_820_1743 276
467 3300049741 Ga0501079_0054277 Ga0501079_0054277_269_1192 276
468 3300049743 Ga0501081_0132933 Ga0501081_0132933_227_1150 276
469 3300049822 Ga0501035_0070987 Ga0501035_0070987_1750_2637 276
470 3300049822 Ga0501035_0071340 Ga0501035_0071340_978_1874 276
471 3300049823 Ga0501044_0000266 Ga0501044_0000266_56979_57887 276
472 3300049823 Ga0501044_0030690 Ga0501044_0030690_2557_3444 276
473 3300049823 Ga0501044_0067189 Ga0501044_0067189_1767_2663 276
474 3300049824 Ga0501045_0148673 Ga0501045_0148673_143_1066 276
475 3300050492 nmdc:mga0yw44_1073_c2 nmdc:mga0yw44_1073_c2_1148_2062 276
476 3300050492 nmdc:mga0yw44_813_c1 nmdc:mga0yw44_813_c1_10420_11313 276
477 3300050507 nmdc:mga05p37_82855_c1 nmdc:mga05p37_82855_c1_61_954 276
478 3300050509 nmdc:mga0qj67_50_c1 nmdc:mga0qj67_50_c1_12783_13676 276
479 3300050510 nmdc:mga06r32_94551_c1 nmdc:mga06r32_94551_c1_1242_2171 276
480 3300053077 Ga0495601_0000589 Ga0495601_0000589_2601_3494 276
481 3300053078 Ga0495612_0002637 Ga0495612_0002637_5022_5915 276
482 3300053084 Ga0495595_0001037 Ga0495595_0001037_2534_3427 276
483 3300053085 Ga0495619_0005308 Ga0495619_0005308_4734_5627 276
484 3300053096 Ga0500641_0133642 Ga0500641_0133642_112_1005 276
485 3300060353 Ga0501082_0018385 Ga0501082_0018385_2550_3446 276
486 iso_pu_bacteria 2508501042 2508690778 276
487 iso_pu_bacteria 2508501042 2508693413 276
488 iso_pu_bacteria 2511231028 2511397754 276
489 iso_pu_bacteria 2513237094 2513637168 276
490 iso_pu_bacteria 2513237095 2513651577 276
491 iso_pu_bacteria 2513237098 2513677753 276
492 iso_pu_bacteria 2513237101 2513693268 276
493 iso_pu_bacteria 2513237102 2513702709 276
494 iso_pu_bacteria 2513237104 2513717462 276
495 iso_pu_bacteria 2513237139 2513876138 276
496 iso_pu_bacteria 2513237139 2513876737 276
497 iso_pu_bacteria 2513237161 2514012222 276
498 iso_pu_bacteria 2517093001 2517104872 276
499 iso_pu_bacteria 2524023210 2524467739 276
500 iso_pu_bacteria 2528768022 2528857425 276
501 iso_pu_bacteria 2617270735 2617347987 276
502 iso_pu_bacteria 2643221651 2644289454 276
503 iso_pu_bacteria 2721755755 2723848178 276
504 iso_pu_bacteria 2791355196 2793065523 276
505 iso_pu_bacteria 2791355199 2793078112 276
506 iso_pu_bacteria 2802429603 2805918717 276
507 iso_pu_bacteria 2816332527 2818243838 276
508 iso_pu_bacteria 2824617872 2824623635 276
509 iso_pu_bacteria 2824626560 2824632448 276
510 iso_pu_bacteria 2824635225 2824639904 276
511 iso_pu_bacteria 2824644064 2824646462 276
512 iso_pu_bacteria 2824661429 2824668480 276
513 iso_pu_bacteria 2824679649 2824684180 276
514 iso_pu_bacteria 2824704595 2824708427 276
515 iso_pu_bacteria 2824714736 2824717231 276
516 iso_pu_bacteria 2824723954 2824726929 276
517 iso_pu_bacteria 2824753945 2824762391 276
518 iso_pu_bacteria 2824763712 2824770742 276
519 iso_pu_bacteria 2829745981 2829750286 276
520 iso_pu_bacteria 2841957949 2841961629 276
521 iso_pu_bacteria 2842038055 2842041221 276
522 iso_pu_bacteria 2842045827 2842045834 276
523 iso_pu_bacteria 2847930680 2847938002 276
524 iso_pu_bacteria 2861691609 2861696454 276
525 iso_pu_bacteria 2874604998 2874608834 276
526 iso_pu_bacteria 2874620515 2874625446 276
527 iso_pu_bacteria 2874628541 2874632845 276
528 iso_pu_bacteria 2876761206 2876769076 276
529 iso_pu_bacteria 2876808645 2876813897 276
530 iso_pu_bacteria 2879083081 2879084450 276
531 iso_pu_bacteria 2879099564 2879105326 276
532 iso_pu_bacteria 2879110137 2879115438 276
533 iso_pu_bacteria 2881364244 2881367852 276
534 iso_pu_bacteria 2885366525 2885368428 276
535 iso_pu_bacteria 2885383462 2885390392 276
536 iso_pu_bacteria 2888378607 2888385980 276
537 iso_pu_bacteria 2889033259 2889037306 276
538 iso_pu_bacteria 2903768456 2903774286 276
539 iso_pu_bacteria 2904666416 2904670595 276
540 iso_pu_bacteria 2904711408 2904711415 276
541 iso_pu_bacteria 2906626472 2906626594 276
542 iso_pu_bacteria 2906643746 2906647068 276
543 iso_pu_bacteria 2922361189 2922361436 276
544 iso_pu_bacteria 2922368715 2922376300 276
545 iso_pu_bacteria 2922386360 2922388859 276
546 iso_pu_bacteria 2922393267 2922399985 276
547 iso_pu_bacteria 2929615660 2929624268 276
548 iso_pu_bacteria 2929624759 2929633306 276
549 iso_pu_bacteria 2932784394 2932789450 276
550 iso_pu_bacteria 2932784394 2932793600 276
551 iso_pu_bacteria 2932801729 2932804303 276
552 iso_pu_bacteria 2932809354 2932816499 276
553 iso_pu_bacteria 2932818245 2932827380 276
554 iso_pu_bacteria 2932828146 2932832057 276
555 iso_pu_bacteria 2933577622 2933585983 276
556 iso_pu_bacteria 2935616580 2935621996 276
557 iso_pu_bacteria 2935638405 2935643994 276
558 iso_pu_bacteria 2935648319 2935653099 276
559 iso_pu_bacteria 2935648319 2935654378 276
560 iso_pu_bacteria 2935656913 2935661682 276
561 iso_pu_bacteria 2935656913 2935663258 276
562 iso_pu_bacteria 2935665750 2935669091 276
563 iso_pu_bacteria 2935675223 2935683351 276
564 iso_pu_bacteria 2935684952 2935692292 276
565 iso_pu_bacteria 2935694250 2935700537 276
566 iso_pu_bacteria 2935703347 2935708834 276
567 iso_pu_bacteria 2935713505 2935720470 276
568 iso_pu_bacteria 2935722832 2935729751 276
569 iso_pu_bacteria 2935732158 2935739267 276
570 iso_pu_bacteria 2935741537 2935748192 276
571 iso_pu_bacteria 2935750917 2935758395 276
572 iso_pu_bacteria 2935760218 2935767474 276
573 iso_pu_bacteria 2935760218 2935769628 276
574 iso_pu_bacteria 2935801545 2935805807 276
575 iso_pu_bacteria 2935810662 2935815635 276
576 iso_pu_bacteria 2935827899 2935833246 276
577 iso_pu_bacteria 2935837841 2935843179 276
578 iso_pu_bacteria 2935837841 2935845911 276
579 iso_pu_bacteria 2935855204 2935860243 276
580 iso_pu_bacteria 2935864058 2935867640 276
581 iso_pu_bacteria 2935873716 2935878550 276
582 iso_pu_bacteria 2935873716 2935880038 276
583 iso_pu_bacteria 2935908558 2935912805 276
584 iso_pu_bacteria 2935916978 2935922876 276
585 iso_pu_bacteria 2935926038 2935930301 276
586 iso_pu_bacteria 2935934488 2935939201 276
587 iso_pu_bacteria 2935942939 2935946149 276
588 iso_pu_bacteria 2935951376 2935955486 276
589 iso_pu_bacteria 2935967501 2935972143 276
590 iso_pu_bacteria 2935992306 2935998173 276
591 iso_pu_bacteria 2936002035 2936006873 276
592 iso_pu_bacteria 2936011229 2936015961 276
593 iso_pu_bacteria 2936011229 2936017414 276
594 iso_pu_bacteria 2936019824 2936024603 276
595 iso_pu_bacteria 2936019824 2936025916 276
596 iso_pu_bacteria 2936028420 2936033833 276
597 iso_pu_bacteria 2936028420 2936034676 276
598 iso_pu_bacteria 2936037263 2936040873 276
599 iso_pu_bacteria 2936046547 2936051704 276
600 iso_pu_bacteria 2936046547 2936052733 276
601 iso_pu_bacteria 2936055302 2936059928 276
602 iso_pu_bacteria 2936055302 2936061662 276
603 iso_pu_bacteria 2940556831 2940564299 276
604 iso_pu_bacteria 2941538514 2941544725 276
605 iso_pu_bacteria 2941538514 2941546054 276
606 iso_pu_bacteria 3005506211 3005511563 276
607 iso_pu_bacteria 3005710791 3005716261 276
608 iso_pu_bacteria 8006926726 8006931418 276
609 iso_pu_bacteria 8006933436 8006934483 276
610 iso_pu_bacteria 8006964411 8006968886 276
611 iso_pu_bacteria 8006984368 8006985233 276
612 iso_pu_bacteria 8016511872 8016520110 276
613 iso_pu_bacteria 8016603502 8016603725 276
614 iso_pu_bacteria 8016613128 8016613780 276
615 iso_pu_bacteria 8017057580 8017065444 276
616 iso_pu_bacteria 8019576017 8019584841 276
617 iso_pu_bacteria 8019586578 8019592790 276
618 iso_pu_bacteria 8019597564 8019598659 276
619 iso_pu_bacteria 8019608314 8019609711 276
620 iso_pu_bacteria 8055742211 8055744573 276
621 iso_pu_bacteria 8056673599 8056675915 276
622 3300003203 JGI25406J46586_10000449 JGI25406J46586_1000044918 277
623 3300005329 Ga0070683_100065303 Ga0070683_1000653032 277
624 3300005339 Ga0070660_100283425 Ga0070660_1002834252 277
625 3300005344 Ga0070661_100139477 Ga0070661_1001394771 277
626 3300005366 Ga0070659_100243918 Ga0070659_1002439181 277
627 3300005435 Ga0070714_100430100 Ga0070714_1004301002 277
628 3300005441 Ga0070700_100368708 Ga0070700_1003687081 277
629 3300005535 Ga0070684_100069991 Ga0070684_1000699912 277
630 3300005548 Ga0070665_100020638 Ga0070665_1000206383 277
631 3300005548 Ga0070665_100032502 Ga0070665_1000325028 277
632 3300005614 Ga0068856_100040183 Ga0068856_1000401832 277
633 3300005981 Ga0081538_10016342 Ga0081538_100163425 277
634 3300005985 Ga0081539_10001290 Ga0081539_1000129020 277
635 3300006028 Ga0070717_10266080 Ga0070717_102660802 277
636 3300006028 Ga0070717_10280886 Ga0070717_102808862 277
637 3300006051 Ga0075364_10247364 Ga0075364_102473642 277
638 3300006163 Ga0070715_10033829 Ga0070715_100338292 277
639 3300006195 Ga0075366_10097533 Ga0075366_100975331 277
640 3300006846 Ga0075430_100009540 Ga0075430_1000095402 277
641 3300006846 Ga0075430_100219005 Ga0075430_1002190052 277
642 3300006846 Ga0075430_100236589 Ga0075430_1002365892 277
643 3300009147 Ga0114129_10035205 Ga0114129_100352057 277
644 3300009148 Ga0105243_10158934 Ga0105243_101589343 277
645 3300009545 Ga0105237_10765192 Ga0105237_107651921 277
646 3300013102 Ga0157371_10275834 Ga0157371_102758342 277
647 3300013297 Ga0157378_10398268 Ga0157378_103982682 277
648 3300013307 Ga0157372_10026601 Ga0157372_100266016 277
649 3300013307 Ga0157372_10136025 Ga0157372_101360252 277
650 3300014326 Ga0157380_10197691 Ga0157380_101976912 277
651 3300021388 Ga0213875_10000122 Ga0213875_1000012247 277
652 3300025302 Ga0207426_1010749 Ga0207426_10107492 277
653 3300025906 Ga0207699_10007606 Ga0207699_100076064 277
654 3300025919 Ga0207657_10215280 Ga0207657_102152803 277
655 3300025919 Ga0207657_10315064 Ga0207657_103150642 277
656 3300025924 Ga0207694_10077700 Ga0207694_100777002 277
657 3300025932 Ga0207690_10201295 Ga0207690_102012952 277
658 3300025939 Ga0207665_10125730 Ga0207665_101257302 277
659 3300025939 Ga0207665_10183928 Ga0207665_101839281 277
660 3300025940 Ga0207691_10214545 Ga0207691_102145452 277
661 3300025944 Ga0207661_10191420 Ga0207661_101914202 277
662 3300025986 Ga0207658_10495527 Ga0207658_104955271 277
663 3300026041 Ga0207639_10312904 Ga0207639_103129042 277
664 3300026078 Ga0207702_10014085 Ga0207702_100140854 277
665 3300026142 Ga0207698_10120100 Ga0207698_101201001 277
666 3300031824 Ga0307413_10172951 Ga0307413_101729511 277
667 3300031901 Ga0307406_10256942 Ga0307406_102569422 277
668 3300031903 Ga0307407_10094299 Ga0307407_100942991 277
669 3300031995 Ga0307409_100051758 Ga0307409_1000517582 277
670 3300032002 Ga0307416_100105994 Ga0307416_1001059942 277
671 3300032126 Ga0307415_100005649 Ga0307415_1000056495 277
672 3300032126 Ga0307415_100493549 Ga0307415_1004935492 277
673 3300035113 Ga0373936_0031865 Ga0373936_0031865_627_1514 277
674 3300035398 Ga0316574_0102778 Ga0316574_0102778_860_1762 277
675 3300037853 Ga0436364_0423755 Ga0436364_0423755_47463_48353 277
676 3300039437 Ga0436365_0293736 Ga0436365_0293736_58_948 277
677 3300042001 Ga0439441_022654 Ga0439441_022654_78_950 277
678 3300044656 Ga0466969_0063638 Ga0466969_0063638_795_1679 277
679 3300044694 Ga0466963_0020642 Ga0466963_0020642_1073_1936 277
680 3300044706 Ga0466964_0026242 Ga0466964_0026242_320_1183 277
681 3300044842 Ga0466957_0010425 Ga0466957_0010425_3511_4374 277
682 3300045976 Ga0466967_0002368 Ga0466967_0002368_4587_5450 277
683 3300046507 Ga0495606_0003208 Ga0495606_0003208_6068_6946 277
684 3300047320 Ga0495672_0114140 Ga0495672_0114140_97_969 277
685 3300049571 Ga0501034_0001175 Ga0501034_0001175_33696_34559 277
686 3300049571 Ga0501034_0387252 Ga0501034_0387252_415_1278 277
687 3300049581 Ga0501047_0132937 Ga0501047_0132937_918_1781 277
688 3300049585 Ga0501069_0295505 Ga0501069_0295505_30_911 277
689 3300049589 Ga0501073_0022644 Ga0501073_0022644_175_1089 277
690 3300049589 Ga0501073_0058167 Ga0501073_0058167_289_1170 277
691 3300049590 Ga0501074_0069404 Ga0501074_0069404_1489_2403 277
692 3300049741 Ga0501079_0253254 Ga0501079_0253254_368_1249 277
693 3300049741 Ga0501079_0368635 Ga0501079_0368635_25_966 277
694 3300049742 Ga0501080_0111454 Ga0501080_0111454_1490_2371 277
695 3300049744 Ga0501083_0012517 Ga0501083_0012517_263_1144 277
696 3300049823 Ga0501044_0029012 Ga0501044_0029012_1758_2639 277
697 3300050496 nmdc:mga07m45_134096_c1 nmdc:mga07m45_134096_c1_29_934 277
698 3300050509 nmdc:mga0qj67_21529_c1 nmdc:mga0qj67_21529_c1_53_973 277
699 3300050509 nmdc:mga0qj67_74334_c1 nmdc:mga0qj67_74334_c1_24_983 277
700 3300053153 Ga0500616_0023517 Ga0500616_0023517_97_978 277
701 3300053158 Ga0500627_0127748 Ga0500627_0127748_150_1055 277
702 3300054114 Ga0501084_0053971 Ga0501084_0053971_2339_3220 277
703 3300060353 Ga0501082_0029700 Ga0501082_0029700_182_1063 277
704 3300060353 Ga0501082_0312271 Ga0501082_0312271_84_974 277
705 iso_pu_bacteria 2508501050 2508727836 277
706 iso_pu_bacteria 2508501114 2509077574 277
707 iso_pu_bacteria 2513237092 2513627066 277
708 iso_pu_bacteria 2513237096 2513655772 277
709 iso_pu_bacteria 2513237137 2513856734 277
710 iso_pu_bacteria 2513237145 2513917315 277
711 iso_pu_bacteria 2517572143 2517895399 277
712 iso_pu_bacteria 2524023228 2524540499 277
713 iso_pu_bacteria 2617270741 2617377787 277
714 iso_pu_bacteria 2643221733 2644731760 277
715 iso_pu_bacteria 2728368998 2728750867 277
716 iso_pu_bacteria 2738541281 2738743832 277
717 iso_pu_bacteria 2738543032 2739353062 277
718 iso_pu_bacteria 2773857925 2774870387 277
719 iso_pu_bacteria 2775506901 2776258551 277
720 iso_pu_bacteria 2791355197 2793069373 277
721 iso_pu_bacteria 2824732956 2824737328 277
722 iso_pu_bacteria 2835312727 2835315213 277
723 iso_pu_bacteria 2841911363 2841915835 277
724 iso_pu_bacteria 2841917233 2841921785 277
725 iso_pu_bacteria 2842698319 2842698688 277
726 iso_pu_bacteria 2851182111 2851187290 277
727 iso_pu_bacteria 2874612657 2874616833 277
728 iso_pu_bacteria 2881665667 2881668801 277
729 iso_pu_bacteria 2882456835 2882460560 277
730 iso_pu_bacteria 2885374607 2885378936 277
731 iso_pu_bacteria 2894232714 2894233833 277
732 iso_pu_bacteria 2903748898 2903759079 277
733 iso_pu_bacteria 2904699407 2904710862 277
734 iso_pu_bacteria 2906610324 2906615991 277
735 iso_pu_bacteria 2906635258 2906639078 277
736 iso_pu_bacteria 2906660503 2906665223 277
737 iso_pu_bacteria 2908775508 2908782163 277
738 iso_pu_bacteria 2917699015 2917704471 277
739 iso_pu_bacteria 2922425934 2922432042 277
740 iso_pu_bacteria 2935630451 2935631082 277
741 iso_pu_bacteria 2935675223 2935680983 277
742 iso_pu_bacteria 2935992306 2935993692 277
743 iso_pu_bacteria 2941507105 2941507734 277
744 iso_pu_bacteria 2941515067 2941516161 277
745 iso_pu_bacteria 2941523033 2941523131 277
746 iso_pu_bacteria 2941531003 2941531679 277
747 iso_pu_bacteria 3005474847 3005476936 277
748 iso_pu_bacteria 3005483717 3005485622 277
749 iso_pu_bacteria 3005587118 3005594446 277
750 iso_pu_bacteria 8006973647 8006974453 277
751 iso_pu_bacteria 8019555841 8019564199 277
752 iso_pu_bacteria 8019565922 8019574276 277
753 iso_pu_bacteria 8057529695 8057531110 277
754 3300001979 JGI24740J21852_10002132 JGI24740J21852_100021324 278
755 3300003203 JGI25406J46586_10007061 JGI25406J46586_100070615 278
756 3300003215 JGI25153J46596_10001471 JGI25153J46596_100014714 278
757 3300003354 JGI25160J50197_1000851 JGI25160J50197_10008515 278
758 3300003659 JGI25404J52841_10007296 JGI25404J52841_100072963 278
759 3300003659 JGI25404J52841_10015597 JGI25404J52841_100155972 278
760 3300003752 Ga0055539_1005268 Ga0055539_10052682 278
761 3300003794 Ga0055531_10007025 Ga0055531_100070257 278
762 3300005262 Ga0065165_1001015 Ga0065165_100101529 278
763 3300005262 Ga0065165_1056808 Ga0065165_10568081 278
764 3300005327 Ga0070658_10074317 Ga0070658_100743173 278
765 3300005329 Ga0070683_100107348 Ga0070683_1001073482 278
766 3300005329 Ga0070683_100152795 Ga0070683_1001527952 278
767 3300005331 Ga0070670_100463664 Ga0070670_1004636641 278
768 3300005334 Ga0068869_100089048 Ga0068869_1000890483 278
769 3300005336 Ga0070680_100014862 Ga0070680_1000148626 278
770 3300005336 Ga0070680_100018980 Ga0070680_1000189803 278
771 3300005336 Ga0070680_100056438 Ga0070680_1000564383 278
772 3300005337 Ga0070682_100049913 Ga0070682_1000499133 278
773 3300005338 Ga0068868_100019171 Ga0068868_1000191716 278
774 3300005338 Ga0068868_100128947 Ga0068868_1001289472 278
775 3300005338 Ga0068868_100499830 Ga0068868_1004998301 278
776 3300005347 Ga0070668_100011646 Ga0070668_1000116466 278
777 3300005347 Ga0070668_100093723 Ga0070668_1000937233 278
778 3300005347 Ga0070668_100154949 Ga0070668_1001549492 278
779 3300005347 Ga0070668_100551145 Ga0070668_1005511451 278
780 3300005354 Ga0070675_100121009 Ga0070675_1001210093 278
781 3300005355 Ga0070671_100185850 Ga0070671_1001858502 278
782 3300005355 Ga0070671_100306662 Ga0070671_1003066621 278
783 3300005366 Ga0070659_100049654 Ga0070659_1000496544 278
784 3300005367 Ga0070667_100179772 Ga0070667_1001797722 278
785 3300005367 Ga0070667_100200543 Ga0070667_1002005432 278
786 3300005434 Ga0070709_10002072 Ga0070709_100020724 278
787 3300005434 Ga0070709_10148464 Ga0070709_101484642 278
788 3300005435 Ga0070714_100013419 Ga0070714_1000134191 278
789 3300005435 Ga0070714_100057152 Ga0070714_1000571525 278
790 3300005435 Ga0070714_100374816 Ga0070714_1003748161 278
791 3300005436 Ga0070713_100037676 Ga0070713_1000376762 278
792 3300005436 Ga0070713_100063344 Ga0070713_1000633443 278
793 3300005436 Ga0070713_100192212 Ga0070713_1001922122 278
794 3300005436 Ga0070713_100396108 Ga0070713_1003961081 278
795 3300005437 Ga0070710_10003520 Ga0070710_100035205 278
796 3300005439 Ga0070711_100011413 Ga0070711_1000114132 278
797 3300005439 Ga0070711_100156833 Ga0070711_1001568332 278
798 3300005445 Ga0070708_100047917 Ga0070708_1000479174 278
799 3300005455 Ga0070663_100015327 Ga0070663_1000153275 278
800 3300005455 Ga0070663_100029415 Ga0070663_1000294152 278
801 3300005455 Ga0070663_100043607 Ga0070663_1000436074 278
802 3300005455 Ga0070663_100053294 Ga0070663_1000532943 278
803 3300005455 Ga0070663_100192040 Ga0070663_1001920402 278
804 3300005455 Ga0070663_100209096 Ga0070663_1002090962 278
805 3300005456 Ga0070678_100026225 Ga0070678_1000262252 278
806 3300005456 Ga0070678_100131264 Ga0070678_1001312643 278
807 3300005456 Ga0070678_100167776 Ga0070678_1001677761 278
808 3300005456 Ga0070678_100230267 Ga0070678_1002302671 278
809 3300005457 Ga0070662_100024830 Ga0070662_1000248302 278
810 3300005458 Ga0070681_10039132 Ga0070681_100391322 278
811 3300005458 Ga0070681_10120467 Ga0070681_101204673 278
812 3300005458 Ga0070681_10222783 Ga0070681_102227832 278
813 3300005466 Ga0070685_10048997 Ga0070685_100489974 278
814 3300005471 Ga0070698_100095596 Ga0070698_1000955963 278
815 3300005530 Ga0070679_100025223 Ga0070679_1000252236 278
816 3300005530 Ga0070679_100109221 Ga0070679_1001092212 278
817 3300005535 Ga0070684_100065744 Ga0070684_1000657443 278
818 3300005535 Ga0070684_100155743 Ga0070684_1001557432 278
819 3300005539 Ga0068853_100034208 Ga0068853_1000342085 278
820 3300005539 Ga0068853_100066013 Ga0068853_1000660132 278
821 3300005539 Ga0068853_100239452 Ga0068853_1002394521 278
822 3300005547 Ga0070693_100050228 Ga0070693_1000502283 278
823 3300005547 Ga0070693_100067096 Ga0070693_1000670961 278
824 3300005548 Ga0070665_100042843 Ga0070665_1000428436 278
825 3300005548 Ga0070665_100046098 Ga0070665_1000460982 278
826 3300005548 Ga0070665_100221673 Ga0070665_1002216733 278
827 3300005548 Ga0070665_100458561 Ga0070665_1004585612 278
828 3300005563 Ga0068855_100022551 Ga0068855_1000225512 278
829 3300005563 Ga0068855_100083171 Ga0068855_1000831715 278
830 3300005563 Ga0068855_100142681 Ga0068855_1001426812 278
831 3300005563 Ga0068855_100260993 Ga0068855_1002609933 278
832 3300005564 Ga0070664_100043999 Ga0070664_1000439992 278
833 3300005577 Ga0068857_100068387 Ga0068857_1000683873 278
834 3300005577 Ga0068857_100171945 Ga0068857_1001719452 278
835 3300005577 Ga0068857_100222594 Ga0068857_1002225942 278
836 3300005578 Ga0068854_100027292 Ga0068854_1000272923 278
837 3300005578 Ga0068854_100192023 Ga0068854_1001920232 278
838 3300005614 Ga0068856_100039721 Ga0068856_1000397213 278
839 3300005614 Ga0068856_100107964 Ga0068856_1001079643 278
840 3300005616 Ga0068852_100038691 Ga0068852_1000386912 278
841 3300005616 Ga0068852_100530297 Ga0068852_1005302971 278
842 3300005617 Ga0068859_100164000 Ga0068859_1001640003 278
843 3300005617 Ga0068859_100191528 Ga0068859_1001915283 278
844 3300005618 Ga0068864_100011654 Ga0068864_1000116543 278
845 3300005618 Ga0068864_100123779 Ga0068864_1001237792 278
846 3300005719 Ga0068861_100090532 Ga0068861_1000905323 278
847 3300005834 Ga0068851_10003264 Ga0068851_100032641 278
848 3300005841 Ga0068863_100055359 Ga0068863_1000553594 278
849 3300005841 Ga0068863_100190541 Ga0068863_1001905413 278
850 3300005841 Ga0068863_100374385 Ga0068863_1003743852 278
851 3300005842 Ga0068858_100092104 Ga0068858_1000921043 278
852 3300005937 Ga0081455_10038767 Ga0081455_100387675 278
853 3300005937 Ga0081455_10044492 Ga0081455_100444925 278
854 3300005937 Ga0081455_10232590 Ga0081455_102325901 278
855 3300005983 Ga0081540_1007198 Ga0081540_10071984 278
856 3300005983 Ga0081540_1011781 Ga0081540_10117813 278
857 3300005983 Ga0081540_1018982 Ga0081540_10189822 278
858 3300005983 Ga0081540_1021410 Ga0081540_10214103 278
859 3300005983 Ga0081540_1021535 Ga0081540_10215353 278
860 3300005983 Ga0081540_1023827 Ga0081540_10238272 278
861 3300005983 Ga0081540_1030775 Ga0081540_10307756 278
862 3300005985 Ga0081539_10000306 Ga0081539_1000030627 278
863 3300005985 Ga0081539_10035506 Ga0081539_100355062 278
864 3300005985 Ga0081539_10036165 Ga0081539_100361653 278
865 3300006038 Ga0075365_10057269 Ga0075365_100572692 278
866 3300006038 Ga0075365_10064317 Ga0075365_100643171 278
867 3300006038 Ga0075365_10112194 Ga0075365_101121943 278
868 3300006042 Ga0075368_10044308 Ga0075368_100443083 278
869 3300006048 Ga0075363_100005107 Ga0075363_1000051076 278
870 3300006048 Ga0075363_100111851 Ga0075363_1001118512 278
871 3300006051 Ga0075364_10011122 Ga0075364_100111225 278
872 3300006051 Ga0075364_10134993 Ga0075364_101349932 278
873 3300006163 Ga0070715_10034300 Ga0070715_100343003 278
874 3300006173 Ga0070716_100142970 Ga0070716_1001429702 278
875 3300006175 Ga0070712_100243594 Ga0070712_1002435942 278
876 3300006177 Ga0075362_10063047 Ga0075362_100630472 278
877 3300006177 Ga0075362_10085750 Ga0075362_100857502 278
878 3300006178 Ga0075367_10016972 Ga0075367_100169723 278
879 3300006178 Ga0075367_10025808 Ga0075367_100258084 278
880 3300006178 Ga0075367_10031445 Ga0075367_100314452 278
881 3300006178 Ga0075367_10033657 Ga0075367_100336574 278
882 3300006237 Ga0097621_100255253 Ga0097621_1002552532 278
883 3300006353 Ga0075370_10007146 Ga0075370_100071464 278
884 3300006353 Ga0075370_10044151 Ga0075370_100441513 278
885 3300006353 Ga0075370_10149513 Ga0075370_101495132 278
886 3300006358 Ga0068871_100113715 Ga0068871_1001137152 278
887 3300006358 Ga0068871_100521004 Ga0068871_1005210041 278
888 3300006844 Ga0075428_100458633 Ga0075428_1004586331 278
889 3300006931 Ga0097620_100164003 Ga0097620_1001640032 278
890 3300006931 Ga0097620_100191521 Ga0097620_1001915211 278
891 3300006944 Ga0099823_1020698 Ga0099823_10206984 278
892 3300007788 Ga0099795_10008505 Ga0099795_100085054 278
893 3300009092 Ga0105250_10031361 Ga0105250_100313612 278
894 3300009093 Ga0105240_10013788 Ga0105240_100137889 278
895 3300009093 Ga0105240_10016073 Ga0105240_100160737 278
896 3300009093 Ga0105240_10079684 Ga0105240_100796844 278
897 3300009094 Ga0111539_10380217 Ga0111539_103802173 278
898 3300009098 Ga0105245_10084292 Ga0105245_100842923 278
899 3300009098 Ga0105245_10232066 Ga0105245_102320662 278
900 3300009101 Ga0105247_10257812 Ga0105247_102578121 278
901 3300009101 Ga0105247_10294940 Ga0105247_102949401 278
902 3300009147 Ga0114129_10060760 Ga0114129_100607603 278
903 3300009147 Ga0114129_10473554 Ga0114129_104735543 278
904 3300009148 Ga0105243_10047590 Ga0105243_100475904 278
905 3300009174 Ga0105241_10001008 Ga0105241_1000100817 278
906 3300009176 Ga0105242_10315799 Ga0105242_103157992 278
907 3300009545 Ga0105237_10013142 Ga0105237_100131427 278
908 3300009545 Ga0105237_10015187 Ga0105237_100151872 278
909 3300009545 Ga0105237_10157999 Ga0105237_101579993 278
910 3300009545 Ga0105237_10216219 Ga0105237_102162192 278
911 3300009551 Ga0105238_10014477 Ga0105238_100144775 278
912 3300009551 Ga0105238_10017578 Ga0105238_100175786 278
913 3300009551 Ga0105238_10057485 Ga0105238_100574854 278
914 3300009551 Ga0105238_10267982 Ga0105238_102679822 278
915 3300010159 Ga0099796_10038515 Ga0099796_100385152 278
916 3300010159 Ga0099796_10054450 Ga0099796_100544502 278
917 3300010375 Ga0105239_10004106 Ga0105239_1000410614 278
918 3300010375 Ga0105239_10075959 Ga0105239_100759593 278
919 3300010375 Ga0105239_10153484 Ga0105239_101534842 278
920 3300010375 Ga0105239_10301160 Ga0105239_103011603 278
921 3300011119 Ga0105246_10091525 Ga0105246_100915252 278
922 3300013105 Ga0157369_10005277 Ga0157369_1000527710 278
923 3300013105 Ga0157369_10013807 Ga0157369_1001380710 278
924 3300013105 Ga0157369_10036963 Ga0157369_100369633 278
925 3300013296 Ga0157374_10003779 Ga0157374_1000377911 278
926 3300013296 Ga0157374_10083182 Ga0157374_100831823 278
927 3300013306 Ga0163162_10027469 Ga0163162_100274696 278
928 3300013306 Ga0163162_10032877 Ga0163162_100328774 278
929 3300013306 Ga0163162_10051503 Ga0163162_100515033 278
930 3300014325 Ga0163163_10055459 Ga0163163_100554593 278
931 3300014325 Ga0163163_10121364 Ga0163163_101213644 278
932 3300014325 Ga0163163_10531547 Ga0163163_105315472 278
933 3300014968 Ga0157379_10145562 Ga0157379_101455622 278
934 3300014969 Ga0157376_10075336 Ga0157376_100753362 278
935 3300014969 Ga0157376_10125927 Ga0157376_101259272 278
936 3300014969 Ga0157376_10698410 Ga0157376_106984101 278
937 3300017792 Ga0163161_10233747 Ga0163161_102337472 278
938 3300021384 Ga0213876_10024127 Ga0213876_100241273 278
939 3300021388 Ga0213875_10018956 Ga0213875_100189563 278
940 3300025229 Ga0209147_101667 Ga0209147_1016672 278
941 3300025230 Ga0209563_102268 Ga0209563_1022682 278
942 3300025253 Ga0209677_100344 Ga0209677_10034415 278
943 3300025253 Ga0209677_103699 Ga0209677_1036996 278
944 3300025272 Ga0209455_1001850 Ga0209455_10018507 278
945 3300025295 Ga0209564_1004802 Ga0209564_10048021 278
946 3300025297 Ga0209758_1000011 Ga0209758_1000011841 278
947 3300025297 Ga0209758_1000455 Ga0209758_100045562 278
948 3300025297 Ga0209758_1000720 Ga0209758_100072015 278
949 3300025297 Ga0209758_1001990 Ga0209758_100199011 278
950 3300025297 Ga0209758_1021230 Ga0209758_10212304 278
951 3300025297 Ga0209758_1029293 Ga0209758_10292932 278
952 3300025297 Ga0209758_1056739 Ga0209758_10567392 278
953 3300025299 Ga0209256_1002097 Ga0209256_100209715 278
954 3300025302 Ga0207426_1000480 Ga0207426_100048050 278
955 3300025302 Ga0207426_1001491 Ga0207426_10014913 278
956 3300025304 Ga0209257_1000936 Ga0209257_100093634 278
957 3300025304 Ga0209257_1007849 Ga0209257_10078497 278
958 3300025321 Ga0207656_10002484 Ga0207656_100024843 278
959 3300025904 Ga0207647_10004039 Ga0207647_100040395 278
960 3300025904 Ga0207647_10032878 Ga0207647_100328781 278
961 3300025905 Ga0207685_10016487 Ga0207685_100164873 278
962 3300025906 Ga0207699_10008554 Ga0207699_100085544 278
963 3300025906 Ga0207699_10024585 Ga0207699_100245854 278
964 3300025906 Ga0207699_10049293 Ga0207699_100492932 278
965 3300025907 Ga0207645_10032981 Ga0207645_100329815 278
966 3300025911 Ga0207654_10004108 Ga0207654_100041082 278
967 3300025911 Ga0207654_10027201 Ga0207654_100272013 278
968 3300025911 Ga0207654_10074355 Ga0207654_100743552 278
969 3300025912 Ga0207707_10003605 Ga0207707_100036052 278
970 3300025912 Ga0207707_10004780 Ga0207707_100047805 278
971 3300025912 Ga0207707_10010530 Ga0207707_100105303 278
972 3300025912 Ga0207707_10078899 Ga0207707_100788995 278
973 3300025913 Ga0207695_10000157 Ga0207695_10000157167 278
974 3300025913 Ga0207695_10001596 Ga0207695_1000159617 278
975 3300025913 Ga0207695_10062576 Ga0207695_100625764 278
976 3300025914 Ga0207671_10033853 Ga0207671_100338534 278
977 3300025914 Ga0207671_10136860 Ga0207671_101368603 278
978 3300025915 Ga0207693_10013523 Ga0207693_100135232 278
979 3300025915 Ga0207693_10084313 Ga0207693_100843132 278
980 3300025916 Ga0207663_10000211 Ga0207663_1000021116 278
981 3300025916 Ga0207663_10032353 Ga0207663_100323533 278
982 3300025917 Ga0207660_10001786 Ga0207660_1000178610 278
983 3300025917 Ga0207660_10105387 Ga0207660_101053872 278
984 3300025917 Ga0207660_10156950 Ga0207660_101569501 278
985 3300025919 Ga0207657_10017803 Ga0207657_100178031 278
986 3300025919 Ga0207657_10078209 Ga0207657_100782092 278
987 3300025919 Ga0207657_10100066 Ga0207657_101000662 278
988 3300025919 Ga0207657_10113079 Ga0207657_101130793 278
989 3300025921 Ga0207652_10002365 Ga0207652_1000236510 278
990 3300025921 Ga0207652_10049408 Ga0207652_100494081 278
991 3300025921 Ga0207652_10151833 Ga0207652_101518332 278
992 3300025921 Ga0207652_10316120 Ga0207652_103161201 278
993 3300025924 Ga0207694_10000757 Ga0207694_1000075716 278
994 3300025924 Ga0207694_10075811 Ga0207694_100758113 278
995 3300025925 Ga0207650_10144680 Ga0207650_101446802 278
996 3300025927 Ga0207687_10055560 Ga0207687_100555603 278
997 3300025928 Ga0207700_10149786 Ga0207700_101497862 278
998 3300025928 Ga0207700_10439593 Ga0207700_104395932 278
999 3300025929 Ga0207664_10063187 Ga0207664_100631873 278
1000 3300025931 Ga0207644_10314876 Ga0207644_103148761 278
1001 3300025932 Ga0207690_10139140 Ga0207690_101391402 278
1002 3300025932 Ga0207690_10194786 Ga0207690_101947861 278
1003 3300025933 Ga0207706_10065152 Ga0207706_100651523 278
1004 3300025934 Ga0207686_10116429 Ga0207686_101164292 278
1005 3300025935 Ga0207709_10296888 Ga0207709_102968882 278
1006 3300025936 Ga0207670_10365632 Ga0207670_103656322 278
1007 3300025937 Ga0207669_10302709 Ga0207669_103027092 278
1008 3300025938 Ga0207704_10021550 Ga0207704_100215502 278
1009 3300025941 Ga0207711_10046779 Ga0207711_100467794 278
1010 3300025942 Ga0207689_10111351 Ga0207689_101113512 278
1011 3300025944 Ga0207661_10084573 Ga0207661_100845733 278
1012 3300025944 Ga0207661_10537881 Ga0207661_105378812 278
1013 3300025945 Ga0207679_10284134 Ga0207679_102841342 278
1014 3300025945 Ga0207679_10293986 Ga0207679_102939862 278
1015 3300025949 Ga0207667_10013120 Ga0207667_100131207 278
1016 3300025949 Ga0207667_10109742 Ga0207667_101097423 278
1017 3300025949 Ga0207667_10158436 Ga0207667_101584361 278
1018 3300025949 Ga0207667_10246951 Ga0207667_102469512 278
1019 3300025949 Ga0207667_10302965 Ga0207667_103029652 278
1020 3300025949 Ga0207667_10511890 Ga0207667_105118902 278
1021 3300025960 Ga0207651_10334633 Ga0207651_103346331 278
1022 3300025972 Ga0207668_10111304 Ga0207668_101113043 278
1023 3300025972 Ga0207668_10123658 Ga0207668_101236582 278
1024 3300025981 Ga0207640_10045297 Ga0207640_100452973 278
1025 3300025981 Ga0207640_10134059 Ga0207640_101340593 278
1026 3300025981 Ga0207640_10150476 Ga0207640_101504761 278
1027 3300026023 Ga0207677_10029898 Ga0207677_100298984 278
1028 3300026041 Ga0207639_10012898 Ga0207639_100128982 278
1029 3300026041 Ga0207639_10013907 Ga0207639_100139076 278
1030 3300026041 Ga0207639_10014848 Ga0207639_100148482 278
1031 3300026041 Ga0207639_10088539 Ga0207639_100885393 278
1032 3300026041 Ga0207639_10161946 Ga0207639_101619462 278
1033 3300026041 Ga0207639_10171739 Ga0207639_101717391 278
1034 3300026041 Ga0207639_10343195 Ga0207639_103431952 278
1035 3300026067 Ga0207678_10003302 Ga0207678_1000330214 278
1036 3300026067 Ga0207678_10023203 Ga0207678_100232034 278
1037 3300026067 Ga0207678_10027731 Ga0207678_100277315 278
1038 3300026067 Ga0207678_10056727 Ga0207678_100567274 278
1039 3300026067 Ga0207678_10516441 Ga0207678_105164412 278
1040 3300026078 Ga0207702_10000003 Ga0207702_10000003328 278
1041 3300026095 Ga0207676_10075837 Ga0207676_100758373 278
1042 3300026095 Ga0207676_10142072 Ga0207676_101420722 278
1043 3300026095 Ga0207676_10208533 Ga0207676_102085332 278
1044 3300026116 Ga0207674_10052521 Ga0207674_100525213 278
1045 3300026116 Ga0207674_10088541 Ga0207674_100885412 278
1046 3300026116 Ga0207674_10187970 Ga0207674_101879702 278
1047 3300026116 Ga0207674_10256684 Ga0207674_102566842 278
1048 3300026118 Ga0207675_100204825 Ga0207675_1002048252 278
1049 3300026121 Ga0207683_10065026 Ga0207683_100650263 278
1050 3300026121 Ga0207683_10075863 Ga0207683_100758634 278
1051 3300026121 Ga0207683_10132912 Ga0207683_101329122 278
1052 3300026121 Ga0207683_10212588 Ga0207683_102125882 278
1053 3300026142 Ga0207698_10008823 Ga0207698_100088233 278
1054 3300026142 Ga0207698_10027211 Ga0207698_100272113 278
1055 3300026142 Ga0207698_10106915 Ga0207698_101069152 278
1056 3300026142 Ga0207698_10168842 Ga0207698_101688423 278
1057 3300026142 Ga0207698_10240254 Ga0207698_102402541 278
1058 3300027296 Ga0209389_1000009 Ga0209389_100000966 278
1059 3300027361 Ga0209489_100050 Ga0209489_10005059 278
1060 3300027363 Ga0209700_100016 Ga0209700_100016167 278
1061 3300027512 Ga0209179_1015550 Ga0209179_10155501 278
1062 3300027671 Ga0209588_1044110 Ga0209588_10441101 278
1063 3300028379 Ga0268266_10010017 Ga0268266_100100173 278
1064 3300028379 Ga0268266_10019820 Ga0268266_100198207 278
1065 3300028379 Ga0268266_10030342 Ga0268266_100303424 278
1066 3300028380 Ga0268265_10067985 Ga0268265_100679854 278
1067 3300028381 Ga0268264_10217737 Ga0268264_102177372 278
1068 3300028786 Ga0307517_10000512 Ga0307517_100005128 278
1069 3300028794 Ga0307515_10022025 Ga0307515_1002202510 278
1070 3300031238 Ga0265332_10000839 Ga0265332_1000083916 278
1071 3300031241 Ga0265325_10032340 Ga0265325_100323404 278
1072 3300031247 Ga0265340_10000382 Ga0265340_1000038214 278
1073 3300031249 Ga0265339_10001051 Ga0265339_1000105113 278
1074 3300031249 Ga0265339_10003487 Ga0265339_100034872 278
1075 3300031250 Ga0265331_10032490 Ga0265331_100324902 278
1076 3300031250 Ga0265331_10039516 Ga0265331_100395161 278
1077 3300031507 Ga0307509_10228195 Ga0307509_102281952 278
1078 3300031548 Ga0307408_100159116 Ga0307408_1001591163 278
1079 3300031616 Ga0307508_10362640 Ga0307508_103626402 278
1080 3300031711 Ga0265314_10019173 Ga0265314_100191734 278
1081 3300031711 Ga0265314_10084820 Ga0265314_100848203 278
1082 3300031712 Ga0265342_10000179 Ga0265342_1000017931 278
1083 3300031712 Ga0265342_10006885 Ga0265342_100068856 278
1084 3300031730 Ga0307516_10113504 Ga0307516_101135043 278
1085 3300031731 Ga0307405_10108479 Ga0307405_101084793 278
1086 3300031824 Ga0307413_10201728 Ga0307413_102017282 278
1087 3300031911 Ga0307412_10331127 Ga0307412_103311271 278
1088 3300031911 Ga0307412_10349352 Ga0307412_103493521 278
1089 3300031995 Ga0307409_100373028 Ga0307409_1003730282 278
1090 3300032005 Ga0307411_10025647 Ga0307411_100256475 278
1091 3300032126 Ga0307415_100122163 Ga0307415_1001221633 278
1092 3300033179 Ga0307507_10133866 Ga0307507_101338662 278
1093 3300033180 Ga0307510_10009742 Ga0307510_100097425 278
1094 3300033180 Ga0307510_10050764 Ga0307510_100507644 278
1095 3300035089 Ga0373944_0013282 Ga0373944_0013282_949_1887 278
1096 3300035089 Ga0373944_0047494 Ga0373944_0047494_90_977 278
1097 3300035111 Ga0373923_0024351 Ga0373923_0024351_1360_2298 278
1098 3300035111 Ga0373923_0065895 Ga0373923_0065895_600_1487 278
1099 3300035113 Ga0373936_0015883 Ga0373936_0015883_961_1848 278
1100 3300035116 Ga0373945_0104221 Ga0373945_0104221_212_1099 278
1101 3300035117 Ga0373953_0008522 Ga0373953_0008522_1291_2229 278
1102 3300035170 Ga0373943_0003068 Ga0373943_0003068_40_927 278
1103 3300035172 Ga0373955_0030906 Ga0373955_0030906_936_1823 278
1104 3300035172 Ga0373955_0032541 Ga0373955_0032541_1686_2600 278
1105 3300035410 Ga0373924_0017111 Ga0373924_0017111_1572_2510 278
1106 3300035692 Ga0373935_0001766 Ga0373935_0001766_882_1769 278
1107 3300035692 Ga0373935_0019355 Ga0373935_0019355_40_978 278
1108 3300035695 Ga0373927_0000346 Ga0373927_0000346_17560_18447 278
1109 3300035695 Ga0373927_0003142 Ga0373927_0003142_4084_4971 278
1110 3300035695 Ga0373927_0018992 Ga0373927_0018992_1185_2072 278
1111 3300035695 Ga0373927_0021985 Ga0373927_0021985_2062_2949 278
1112 3300035695 Ga0373927_0073207 Ga0373927_0073207_796_1683 278
1113 3300035724 Ga0373933_0024198 Ga0373933_0024198_786_1724 278
1114 3300035725 Ga0373947_0001267 Ga0373947_0001267_8494_9381 278
1115 3300035725 Ga0373947_0036794 Ga0373947_0036794_1667_2554 278
1116 3300035725 Ga0373947_0066104 Ga0373947_0066104_538_1476 278
1117 3300036401 Ga0373937_0023839 Ga0373937_0023839_2690_3628 278
1118 3300036401 Ga0373937_0038979 Ga0373937_0038979_1523_2410 278
1119 3300036401 Ga0373937_0486385 Ga0373937_0486385_37_924 278
1120 3300037068 Ga0373925_0001404 Ga0373925_0001404_6798_7685 278
1121 3300037068 Ga0373925_0030842 Ga0373925_0030842_2600_3487 278
1122 3300037312 Ga0395899_0017832 Ga0395899_0017832_3656_4534 278
1123 3300037312 Ga0395899_0069735 Ga0395899_0069735_968_1855 278
1124 3300037312 Ga0395899_0079770 Ga0395899_0079770_682_1569 278
1125 3300037418 Ga0395900_0000134 Ga0395900_0000134_82034_82921 278
1126 3300037418 Ga0395900_0065161 Ga0395900_0065161_1125_2003 278
1127 3300037418 Ga0395900_0140876 Ga0395900_0140876_470_1357 278
1128 3300037466 Ga0395898_0037354 Ga0395898_0037354_3420_4307 278
1129 3300037471 Ga0395905_0013864 Ga0395905_0013864_2464_3351 278
1130 3300037853 Ga0436364_1139859 Ga0436364_1139859_5253_6140 278
1131 3300038443 Ga0395901_0013321 Ga0395901_0013321_5404_6291 278
1132 3300038443 Ga0395901_0084968 Ga0395901_0084968_1825_2712 278
1133 3300038443 Ga0395901_0086295 Ga0395901_0086295_1216_2094 278
1134 3300039437 Ga0436365_0061308 Ga0436365_0061308_517_1413 278
1135 3300039437 Ga0436365_0481444 Ga0436365_0481444_6013_6900 278
1136 3300039437 Ga0436365_0741042 Ga0436365_0741042_587_1474 278
1137 3300039453 Ga0436362_0088818 Ga0436362_0088818_1770_2657 278
1138 3300039453 Ga0436362_0429757 Ga0436362_0429757_1983_2870 278
1139 3300041452 Ga0451793_0652808 Ga0451793_0652808_127_1014 278
1140 3300042993 Ga0439440_0030274 Ga0439440_0030274_289_1176 278
1141 3300044658 Ga0466972_0001603 Ga0466972_0001603_9963_10850 278
1142 3300044684 Ga0466966_0005030 Ga0466966_0005030_2469_3368 278
1143 3300044684 Ga0466966_0075035 Ga0466966_0075035_104_991 278
1144 3300044693 Ga0466961_0000060 Ga0466961_0000060_52025_52924 278
1145 3300044706 Ga0466964_0065741 Ga0466964_0065741_130_1029 278
1146 3300044719 Ga0466971_0141290 Ga0466971_0141290_181_1080 278
1147 3300044842 Ga0466957_0038885 Ga0466957_0038885_1213_2112 278
1148 3300045049 Ga0466959_0001866 Ga0466959_0001866_1085_1984 278
1149 3300046452 Ga0495617_051104 Ga0495617_051104_150_1037 278
1150 3300046454 Ga0495592_0006304 Ga0495592_0006304_4688_5575 278
1151 3300046454 Ga0495592_0034880 Ga0495592_0034880_1608_2495 278
1152 3300046455 Ga0495603_0000092 Ga0495603_0000092_11096_11983 278
1153 3300046455 Ga0495603_0031557 Ga0495603_0031557_2026_2913 278
1154 3300046455 Ga0495603_0035014 Ga0495603_0035014_1040_1927 278
1155 3300046455 Ga0495603_0120014 Ga0495603_0120014_261_1148 278
1156 3300046459 Ga0495629_0000181 Ga0495629_0000181_37980_38867 278
1157 3300046460 Ga0495638_0009594 Ga0495638_0009594_1209_2096 278
1158 3300046461 Ga0495641_0001499 Ga0495641_0001499_7542_8429 278
1159 3300046462 Ga0495651_0043114 Ga0495651_0043114_741_1628 278
1160 3300046462 Ga0495651_0132580 Ga0495651_0132580_862_1749 278
1161 3300046463 Ga0495653_0031775 Ga0495653_0031775_2697_3584 278
1162 3300046472 Ga0495580_0001467 Ga0495580_0001467_1848_2735 278
1163 3300046472 Ga0495580_0063846 Ga0495580_0063846_726_1664 278
1164 3300046472 Ga0495580_0368284 Ga0495580_0368284_10_897 278
1165 3300046473 Ga0495582_0000039 Ga0495582_0000039_34931_35818 278
1166 3300046474 Ga0495605_0061747 Ga0495605_0061747_262_1149 278
1167 3300046475 Ga0495639_0000489 Ga0495639_0000489_13293_14180 278
1168 3300046475 Ga0495639_0049551 Ga0495639_0049551_129_1067 278
1169 3300046476 Ga0495662_0000343 Ga0495662_0000343_12687_13574 278
1170 3300046477 Ga0495664_0002664 Ga0495664_0002664_2990_3877 278
1171 3300046477 Ga0495664_0063746 Ga0495664_0063746_1151_2089 278
1172 3300046491 Ga0495584_0079078 Ga0495584_0079078_147_1034 278
1173 3300046491 Ga0495584_0114570 Ga0495584_0114570_295_1182 278
1174 3300046492 Ga0495585_0081330 Ga0495585_0081330_540_1427 278
1175 3300046492 Ga0495585_0091525 Ga0495585_0091525_183_1070 278
1176 3300046499 Ga0495594_0000619 Ga0495594_0000619_7162_8049 278
1177 3300046500 Ga0495596_0073887 Ga0495596_0073887_264_1151 278
1178 3300046501 Ga0495607_0132886 Ga0495607_0132886_248_1135 278
1179 3300046507 Ga0495606_0103057 Ga0495606_0103057_578_1465 278
1180 3300046507 Ga0495606_0105250 Ga0495606_0105250_89_976 278
1181 3300046512 Ga0495610_0054926 Ga0495610_0054926_346_1233 278
1182 3300046516 Ga0495628_0056656 Ga0495628_0056656_1839_2726 278
1183 3300046516 Ga0495628_0073295 Ga0495628_0073295_907_1821 278
1184 3300046517 Ga0495630_0001653 Ga0495630_0001653_10494_11381 278
1185 3300046517 Ga0495630_0209914 Ga0495630_0209914_147_1085 278
1186 3300046519 Ga0495632_0023362 Ga0495632_0023362_2307_3194 278
1187 3300046520 Ga0495637_0006157 Ga0495637_0006157_1773_2657 278
1188 3300046522 Ga0495643_0000009 Ga0495643_0000009_231976_232860 278
1189 3300046522 Ga0495643_0032803 Ga0495643_0032803_708_1595 278
1190 3300046523 Ga0495644_0029123 Ga0495644_0029123_917_1804 278
1191 3300046524 Ga0495648_0134859 Ga0495648_0134859_50_937 278
1192 3300046526 Ga0495666_0003729 Ga0495666_0003729_887_1774 278
1193 3300046526 Ga0495666_0053055 Ga0495666_0053055_866_1804 278
1194 3300046529 Ga0495652_0074129 Ga0495652_0074129_691_1578 278
1195 3300046529 Ga0495652_0203878 Ga0495652_0203878_277_1164 278
1196 3300046530 Ga0495654_0070152 Ga0495654_0070152_298_1185 278
1197 3300046531 Ga0495665_0000079 Ga0495665_0000079_22897_23784 278
1198 3300046531 Ga0495665_0020095 Ga0495665_0020095_108_1046 278
1199 3300046533 Ga0495640_0003085 Ga0495640_0003085_10483_11370 278
1200 3300046533 Ga0495640_0009778 Ga0495640_0009778_2439_3377 278
1201 3300046538 Ga0495609_0085810 Ga0495609_0085810_327_1214 278
1202 3300046539 Ga0495621_0013233 Ga0495621_0013233_54_941 278
1203 3300046543 Ga0495645_0026869 Ga0495645_0026869_730_1617 278
1204 3300046543 Ga0495645_0100441 Ga0495645_0100441_956_1870 278
1205 3300046557 Ga0495622_0000987 Ga0495622_0000987_682_1569 278
1206 3300046557 Ga0495622_0042359 Ga0495622_0042359_263_1162 278
1207 3300046558 Ga0495633_0000102 Ga0495633_0000102_5258_6142 278
1208 3300046558 Ga0495633_0079091 Ga0495633_0079091_153_1040 278
1209 3300046559 Ga0495667_0006293 Ga0495667_0006293_2333_3220 278
1210 3300046559 Ga0495667_0056782 Ga0495667_0056782_589_1476 278
1211 3300046615 Ga0495656_0078564 Ga0495656_0078564_458_1345 278
1212 3300046615 Ga0495656_0090968 Ga0495656_0090968_265_1152 278
1213 3300046616 Ga0495668_0230353 Ga0495668_0230353_42_929 278
1214 3300046642 Ga0495634_0004026 Ga0495634_0004026_8564_9451 278
1215 3300046642 Ga0495634_0089976 Ga0495634_0089976_108_1046 278
1216 3300046642 Ga0495634_0122922 Ga0495634_0122922_730_1617 278
1217 3300046648 Ga0495611_0058626 Ga0495611_0058626_566_1453 278
1218 3300046648 Ga0495611_0063062 Ga0495611_0063062_196_1083 278
1219 3300046648 Ga0495611_0125309 Ga0495611_0125309_281_1168 278
1220 3300046663 Ga0495635_0006922 Ga0495635_0006922_276_1163 278
1221 3300046663 Ga0495635_0173248 Ga0495635_0173248_285_1172 278
1222 3300046674 Ga0495588_0023653 Ga0495588_0023653_285_1172 278
1223 3300046675 Ga0495657_0103148 Ga0495657_0103148_316_1203 278
1224 3300046678 Ga0495599_0012657 Ga0495599_0012657_804_1691 278
1225 3300046678 Ga0495599_0061226 Ga0495599_0061226_1267_2154 278
1226 3300046680 Ga0495646_0038525 Ga0495646_0038525_2004_2891 278
1227 3300046681 Ga0495647_0000562 Ga0495647_0000562_5105_5992 278
1228 3300046683 Ga0495658_0000733 Ga0495658_0000733_1668_2555 278
1229 3300046683 Ga0495658_0154370 Ga0495658_0154370_25_912 278
1230 3300046684 Ga0495669_0081198 Ga0495669_0081198_42_929 278
1231 3300046689 Ga0495613_0000543 Ga0495613_0000543_14786_15673 278
1232 3300046690 Ga0495624_0006648 Ga0495624_0006648_6669_7556 278
1233 3300046690 Ga0495624_0068223 Ga0495624_0068223_1247_2185 278
1234 3300046691 Ga0495670_0085783 Ga0495670_0085783_175_1062 278
1235 3300046692 Ga0495671_0000013 Ga0495671_0000013_231976_232860 278
1236 3300047315 Ga0495581_0000024 Ga0495581_0000024_4763_5650 278
1237 3300047317 Ga0495604_0017775 Ga0495604_0017775_1657_2544 278
1238 3300047317 Ga0495604_0385595 Ga0495604_0385595_21_908 278
1239 3300047319 Ga0495674_0001161 Ga0495674_0001161_24114_25001 278
1240 3300047319 Ga0495674_0197545 Ga0495674_0197545_331_1218 278
1241 3300047320 Ga0495672_0017804 Ga0495672_0017804_1007_1894 278
1242 3300047321 Ga0495676_0040839 Ga0495676_0040839_619_1506 278
1243 3300047321 Ga0495676_0154833 Ga0495676_0154833_710_1609 278
1244 3300047322 Ga0495680_0008182 Ga0495680_0008182_3926_4813 278
1245 3300047444 Ga0495675_0058711 Ga0495675_0058711_963_1850 278
1246 3300047444 Ga0495675_0061217 Ga0495675_0061217_708_1646 278
1247 3300047469 Ga0495673_0020913 Ga0495673_0020913_1430_2317 278
1248 3300047469 Ga0495673_0048974 Ga0495673_0048974_545_1432 278
1249 3300047469 Ga0495673_0109692 Ga0495673_0109692_99_992 278
1250 3300047470 Ga0495681_0000202 Ga0495681_0000202_1560_2444 278
1251 3300047470 Ga0495681_0068429 Ga0495681_0068429_389_1276 278
1252 3300047471 Ga0495684_0009222 Ga0495684_0009222_3452_4390 278
1253 3300047471 Ga0495684_0025703 Ga0495684_0025703_2096_2983 278
1254 3300047471 Ga0495684_0123972 Ga0495684_0123972_561_1448 278
1255 3300047673 Ga0495593_0000019 Ga0495593_0000019_60926_61813 278
1256 3300047673 Ga0495593_0037204 Ga0495593_0037204_42_935 278
1257 3300048089 Ga0495614_0003524 Ga0495614_0003524_681_1568 278
1258 3300048903 Ga0496100_0020444 Ga0496100_0020444_711_1598 278
1259 3300048904 Ga0496101_0004532 Ga0496101_0004532_2561_3448 278
1260 3300048905 Ga0496102_0009611 Ga0496102_0009611_5349_6236 278
1261 3300048905 Ga0496102_0180446 Ga0496102_0180446_155_1042 278
1262 3300048905 Ga0496102_0272046 Ga0496102_0272046_557_1444 278
1263 3300048907 Ga0496104_0009587 Ga0496104_0009587_6734_7621 278
1264 3300048907 Ga0496104_0014513 Ga0496104_0014513_1690_2577 278
1265 3300048907 Ga0496104_0014678 Ga0496104_0014678_678_1565 278
1266 3300048908 Ga0496105_0002708 Ga0496105_0002708_10888_11775 278
1267 3300048908 Ga0496105_0159538 Ga0496105_0159538_716_1603 278
1268 3300048909 Ga0496106_0006039 Ga0496106_0006039_4695_5582 278
1269 3300048909 Ga0496106_0080469 Ga0496106_0080469_1211_2098 278
1270 3300048909 Ga0496106_0145610 Ga0496106_0145610_539_1426 278
1271 3300048909 Ga0496106_0276121 Ga0496106_0276121_35_922 278
1272 3300048910 Ga0496107_0002095 Ga0496107_0002095_5950_6837 278
1273 3300048911 Ga0496108_0110277 Ga0496108_0110277_928_1815 278
1274 3300048911 Ga0496108_0134259 Ga0496108_0134259_749_1636 278
1275 3300048911 Ga0496108_0287562 Ga0496108_0287562_439_1326 278
1276 3300048912 Ga0496109_0046847 Ga0496109_0046847_439_1326 278
1277 3300048912 Ga0496109_0057575 Ga0496109_0057575_607_1494 278
1278 3300048912 Ga0496109_0072226 Ga0496109_0072226_670_1557 278
1279 3300048912 Ga0496109_0195085 Ga0496109_0195085_407_1294 278
1280 3300048913 Ga0496110_0081141 Ga0496110_0081141_781_1668 278
1281 3300048913 Ga0496110_0106657 Ga0496110_0106657_1486_2442 278
1282 3300048913 Ga0496110_0132270 Ga0496110_0132270_397_1284 278
1283 3300048913 Ga0496110_0212338 Ga0496110_0212338_558_1445 278
1284 3300048914 Ga0496111_0094947 Ga0496111_0094947_227_1114 278
1285 3300048914 Ga0496111_0111787 Ga0496111_0111787_515_1402 278
1286 3300048915 Ga0496112_0000142 Ga0496112_0000142_24234_25121 278
1287 3300048915 Ga0496112_0009986 Ga0496112_0009986_5740_6627 278
1288 3300048915 Ga0496112_0035315 Ga0496112_0035315_372_1259 278
1289 3300048915 Ga0496112_0048503 Ga0496112_0048503_619_1506 278
1290 3300048915 Ga0496112_0126707 Ga0496112_0126707_1151_2038 278
1291 3300048915 Ga0496112_0283875 Ga0496112_0283875_168_1055 278
1292 3300048915 Ga0496112_0331623 Ga0496112_0331623_202_1089 278
1293 3300048916 Ga0496113_0004839 Ga0496113_0004839_927_1814 278
1294 3300048917 Ga0496114_0085730 Ga0496114_0085730_1024_1911 278
1295 3300048918 Ga0496115_0008444 Ga0496115_0008444_6174_7061 278
1296 3300048918 Ga0496115_0034316 Ga0496115_0034316_452_1339 278
1297 3300048918 Ga0496115_0115596 Ga0496115_0115596_457_1344 278
1298 3300048918 Ga0496115_0360388 Ga0496115_0360388_286_1173 278
1299 3300048920 Ga0496117_0126685 Ga0496117_0126685_110_997 278
1300 3300048921 Ga0496118_0210540 Ga0496118_0210540_96_983 278
1301 3300048922 Ga0496119_0011287 Ga0496119_0011287_381_1310 278
1302 3300048924 Ga0496121_0005804 Ga0496121_0005804_11813_12712 278
1303 3300048924 Ga0496121_0005812 Ga0496121_0005812_13003_13890 278
1304 3300048924 Ga0496121_0007712 Ga0496121_0007712_264_1157 278
1305 3300048924 Ga0496121_0056369 Ga0496121_0056369_937_1824 278
1306 3300048924 Ga0496121_0179979 Ga0496121_0179979_26_919 278
1307 3300048924 Ga0496121_0216962 Ga0496121_0216962_260_1147 278
1308 3300048925 Ga0496122_0004715 Ga0496122_0004715_4263_5192 278
1309 3300048926 Ga0496123_0000896 Ga0496123_0000896_28853_29782 278
1310 3300048927 Ga0496124_0283122 Ga0496124_0283122_219_1106 278
1311 3300048928 Ga0496125_0056031 Ga0496125_0056031_590_1477 278
1312 3300048928 Ga0496125_0173659 Ga0496125_0173659_170_1057 278
1313 3300048929 Ga0496126_0001612 Ga0496126_0001612_2607_3494 278
1314 3300048929 Ga0496126_0004467 Ga0496126_0004467_6066_6953 278
1315 3300048929 Ga0496126_0023193 Ga0496126_0023193_2587_3474 278
1316 3300048929 Ga0496126_0080441 Ga0496126_0080441_1566_2453 278
1317 3300048929 Ga0496126_0100547 Ga0496126_0100547_755_1642 278
1318 3300048929 Ga0496126_0119352 Ga0496126_0119352_885_1772 278
1319 3300048929 Ga0496126_0135659 Ga0496126_0135659_188_1075 278
1320 3300048929 Ga0496126_0168246 Ga0496126_0168246_200_1087 278
1321 3300048929 Ga0496126_0205257 Ga0496126_0205257_712_1599 278
1322 3300048929 Ga0496126_0216255 Ga0496126_0216255_610_1500 278
1323 3300049459 Ga0495678_042737 Ga0495678_042737_383_1270 278
1324 3300049460 Ga0495682_0034924 Ga0495682_0034924_895_1794 278
1325 3300049460 Ga0495682_0084648 Ga0495682_0084648_38_925 278
1326 3300049568 Ga0501031_0004996 Ga0501031_0004996_3947_4861 278
1327 3300049569 Ga0501032_0099204 Ga0501032_0099204_387_1301 278
1328 3300049570 Ga0501033_0000447 Ga0501033_0000447_34804_35718 278
1329 3300049570 Ga0501033_0044800 Ga0501033_0044800_956_1843 278
1330 3300049571 Ga0501034_0000109 Ga0501034_0000109_19244_20107 278
1331 3300049571 Ga0501034_0117991 Ga0501034_0117991_1607_2521 278
1332 3300049571 Ga0501034_0286335 Ga0501034_0286335_22_909 278
1333 3300049572 Ga0501036_0012191 Ga0501036_0012191_3213_4127 278
1334 3300049573 Ga0501037_0001078 Ga0501037_0001078_17878_18792 278
1335 3300049574 Ga0501038_0071505 Ga0501038_0071505_1436_2350 278
1336 3300049575 Ga0501039_0052494 Ga0501039_0052494_1776_2690 278
1337 3300049579 Ga0501043_0003281 Ga0501043_0003281_8665_9579 278
1338 3300049580 Ga0501046_0034192 Ga0501046_0034192_1436_2350 278
1339 3300049580 Ga0501046_0185844 Ga0501046_0185844_629_1516 278
1340 3300049581 Ga0501047_0321571 Ga0501047_0321571_21_908 278
1341 3300049584 Ga0501068_0011640 Ga0501068_0011640_949_1812 278
1342 3300049586 Ga0501070_0125601 Ga0501070_0125601_1077_1964 278
1343 3300049589 Ga0501073_0092976 Ga0501073_0092976_887_1801 278
1344 3300049591 Ga0501075_0319193 Ga0501075_0319193_94_981 278
1345 3300049592 Ga0501076_0128678 Ga0501076_0128678_931_1818 278
1346 3300049741 Ga0501079_0366676 Ga0501079_0366676_187_1101 278
1347 3300049822 Ga0501035_0002396 Ga0501035_0002396_10556_11470 278
1348 3300049822 Ga0501035_0154414 Ga0501035_0154414_1034_1921 278
1349 3300049823 Ga0501044_0041958 Ga0501044_0041958_2367_3281 278
1350 3300049823 Ga0501044_0045060 Ga0501044_0045060_3019_3906 278
1351 3300049823 Ga0501044_0172223 Ga0501044_0172223_1110_1973 278
1352 3300050489 nmdc:mga03683_138675_c1 nmdc:mga03683_138675_c1_32_919 278
1353 3300050490 nmdc:mga03n38_1841_c1 nmdc:mga03n38_1841_c1_5008_5895 278
1354 3300050491 nmdc:mga00v17_134798_c1 nmdc:mga00v17_134798_c1_210_1097 278
1355 3300050491 nmdc:mga00v17_162975_c1 nmdc:mga00v17_162975_c1_43_930 278
1356 3300050491 nmdc:mga00v17_58269_c1 nmdc:mga00v17_58269_c1_850_1737 278
1357 3300050492 nmdc:mga0yw44_115170_c1 nmdc:mga0yw44_115170_c1_303_1190 278
1358 3300050492 nmdc:mga0yw44_64077_c1 nmdc:mga0yw44_64077_c1_326_1225 278
1359 3300050493 nmdc:mga0k408_221755_c1 nmdc:mga0k408_221755_c1_87_974 278
1360 3300050493 nmdc:mga0k408_85015_c1 nmdc:mga0k408_85015_c1_574_1461 278
1361 3300050494 nmdc:mga06z11_12290_c1 nmdc:mga06z11_12290_c1_567_1454 278
1362 3300050494 nmdc:mga06z11_28342_c1 nmdc:mga06z11_28342_c1_303_1190 278
1363 3300050496 nmdc:mga07m45_19367_c1 nmdc:mga07m45_19367_c1_1091_1978 278
1364 3300050496 nmdc:mga07m45_7723_c1 nmdc:mga07m45_7723_c1_3189_4076 278
1365 3300050507 nmdc:mga05p37_602943_c1 nmdc:mga05p37_602943_c1_279_1166 278
1366 3300050516 nmdc:mga0sz30_13149_c1 nmdc:mga0sz30_13149_c1_938_1825 278
1367 3300053078 Ga0495612_0013700 Ga0495612_0013700_786_1724 278
1368 3300053078 Ga0495612_0027714 Ga0495612_0027714_1035_1922 278
1369 3300053084 Ga0495595_0099637 Ga0495595_0099637_405_1292 278
1370 3300053085 Ga0495619_0211036 Ga0495619_0211036_440_1327 278
1371 3300053087 Ga0500643_000042 Ga0500643_000042_52220_53119 278
1372 3300053087 Ga0500643_058698 Ga0500643_058698_28_915 278
1373 3300053091 Ga0500647_0024199 Ga0500647_0024199_202_1101 278
1374 3300053093 Ga0500651_0000628 Ga0500651_0000628_15208_16095 278
1375 3300053094 Ga0500566_0000178 Ga0500566_0000178_13454_14341 278
1376 3300053094 Ga0500566_0000834 Ga0500566_0000834_16353_17252 278
1377 3300053094 Ga0500566_0010268 Ga0500566_0010268_2333_3223 278
1378 3300053095 Ga0500640_029138 Ga0500640_029138_20_907 278
1379 3300053096 Ga0500641_0003159 Ga0500641_0003159_1037_1924 278
1380 3300053096 Ga0500641_0067877 Ga0500641_0067877_529_1428 278
1381 3300053102 Ga0500554_073532 Ga0500554_073532_153_1043 278
1382 3300053103 Ga0500555_000735 Ga0500555_000735_99_986 278
1383 3300053103 Ga0500555_019657 Ga0500555_019657_663_1550 278
1384 3300053104 Ga0500556_0000290 Ga0500556_0000290_28640_29569 278
1385 3300053104 Ga0500556_0004619 Ga0500556_0004619_1289_2176 278
1386 3300053105 Ga0500557_000006 Ga0500557_000006_82265_83164 278
1387 3300053108 Ga0500562_048309 Ga0500562_048309_16_903 278
1388 3300053118 Ga0500594_0031311 Ga0500594_0031311_276_1163 278
1389 3300053119 Ga0500595_001597 Ga0500595_001597_2964_3854 278
1390 3300053119 Ga0500595_009190 Ga0500595_009190_2903_3796 278
1391 3300053119 Ga0500595_015184 Ga0500595_015184_1700_2587 278
1392 3300053123 Ga0500614_002436 Ga0500614_002436_802_1689 278
1393 3300053126 Ga0500621_058891 Ga0500621_058891_640_1527 278
1394 3300053130 Ga0500642_0000040 Ga0500642_0000040_47851_48750 278
1395 3300053130 Ga0500642_0022271 Ga0500642_0022271_760_1659 278
1396 3300053130 Ga0500642_0099608 Ga0500642_0099608_302_1189 278
1397 3300053131 Ga0500652_082782 Ga0500652_082782_301_1200 278
1398 3300053134 Ga0500658_0068364 Ga0500658_0068364_351_1238 278
1399 3300053136 Ga0500559_0006230 Ga0500559_0006230_2847_3734 278
1400 3300053137 Ga0500561_0009191 Ga0500561_0009191_628_1515 278
1401 3300053139 Ga0500568_0003788 Ga0500568_0003788_6789_7688 278
1402 3300053139 Ga0500568_0033871 Ga0500568_0033871_304_1191 278
1403 3300053146 Ga0500588_0061365 Ga0500588_0061365_253_1140 278
1404 3300053150 Ga0500603_000312 Ga0500603_000312_6030_6917 278
1405 3300053151 Ga0500604_0016250 Ga0500604_0016250_57_944 278
1406 3300053156 Ga0500622_0012774 Ga0500622_0012774_3451_4338 278
1407 3300053156 Ga0500622_0089240 Ga0500622_0089240_26_913 278
1408 3300053158 Ga0500627_0033845 Ga0500627_0033845_230_1117 278
1409 3300053159 Ga0500630_000840 Ga0500630_000840_5296_6183 278
1410 3300053160 Ga0500633_0071169 Ga0500633_0071169_121_1008 278
1411 3300053162 Ga0500638_001878 Ga0500638_001878_1367_2257 278
1412 3300053163 Ga0500639_000029 Ga0500639_000029_16307_17194 278
1413 3300053177 Ga0500636_0075129 Ga0500636_0075129_1018_1905 278
1414 3300053178 Ga0500637_0000215 Ga0500637_0000215_18798_19688 278
1415 3300053731 Ga0500609_004989 Ga0500609_004989_466_1353 278
1416 3300053735 Ga0500596_002014 Ga0500596_002014_2975_3862 278
1417 3300053737 Ga0500601_000682 Ga0500601_000682_2316_3215 278
1418 iso_pu_bacteria 2507262055 2507507203 278
1419 iso_pu_bacteria 2508501009 2508541257 278
1420 iso_pu_bacteria 2515154112 2515628774 278
1421 iso_pu_bacteria 2524023205 2524440677 278
1422 iso_pu_bacteria 2744054633 2745077477 278
1423 iso_pu_bacteria 2824600985 2824607836 278
1424 iso_pu_bacteria 2824609381 2824616935 278
1425 iso_pu_bacteria 2824653114 2824658969 278
1426 iso_pu_bacteria 2844315083 2844320473 278
1427 iso_pu_bacteria 2857509624 2857511049 278
1428 iso_pu_bacteria 2874590934 2874596057 278
1429 iso_pu_bacteria 2874645413 2874650881 278
1430 iso_pu_bacteria 2876771140 2876776115 278
1431 iso_pu_bacteria 2876818435 2876820613 278
1432 iso_pu_bacteria 2879074833 2879080204 278
1433 iso_pu_bacteria 2879127579 2879129977 278
1434 iso_pu_bacteria 2879142872 2879147456 278
1435 iso_pu_bacteria 2888388044 2888392327 278
1436 iso_pu_bacteria 2888419890 2888426083 278
1437 iso_pu_bacteria 2903727486 2903732882 278
1438 iso_pu_bacteria 2906602504 2906606989 278
1439 iso_pu_bacteria 2932794094 2932797786 278
1440 iso_pu_bacteria 2935608549 2935610419 278
1441 iso_pu_bacteria 2935769743 2935771049 278
1442 iso_pu_bacteria 2935777560 2935781217 278
1443 iso_pu_bacteria 2935785616 2935786250 278
1444 iso_pu_bacteria 2935793552 2935793953 278
1445 iso_pu_bacteria 2935819856 2935823580 278
1446 iso_pu_bacteria 2935847175 2935849105 278
1447 iso_pu_bacteria 2935883170 2935888330 278
1448 iso_pu_bacteria 2935959822 2935965311 278
1449 iso_pu_bacteria 2935975950 2935976072 278
1450 iso_pu_bacteria 3005594810 3005600848 278
1451 iso_pu_bacteria 3005718088 3005723641 278
1452 iso_pu_bacteria 8016522445 8016528024 278
1453 iso_pu_bacteria 8016530956 8016533148 278
1454 iso_pu_bacteria 8016539877 8016546386 278
1455 iso_pu_bacteria 8016548790 8016555740 278
1456 iso_pu_bacteria 8016557553 8016564092 278
1457 iso_pu_bacteria 8016575299 8016575723 278
1458 iso_pu_bacteria 8016583857 8016594971 278
1459 iso_pu_bacteria 8016595262 8016601798 278
1460 iso_pu_bacteria 8016603502 8016608450 278
1461 iso_pu_bacteria 8016613128 8016616415 278
1462 iso_pu_bacteria 8016622563 8016624723 278
1463 iso_pu_bacteria 8016630954 8016638219 278
1464 iso_pu_bacteria 8019530166 8019532945 278
1465 iso_pu_bacteria 8019538911 8019546908 278
1466 iso_pu_bacteria 8019629233 8019632799 278
1467 iso_pu_bacteria 8019638758 8019647128 278
1468 iso_pu_bacteria 8019648815 8019655564 278
1469 iso_pu_bacteria 8019659431 8019660662 278
1470 iso_pu_bacteria 8019668869 8019670077 278
1471 iso_pu_bacteria 8019678201 8019686016 278
1472 iso_pu_bacteria 8019687851 8019692181 278
1473 iso_pu_bacteria 8056967851 8056971855 278
1474 3300005436 Ga0070713_100011888 Ga0070713_1000118885 279
1475 3300005437 Ga0070710_10002467 Ga0070710_100024672 279
1476 3300005439 Ga0070711_100008018 Ga0070711_1000080182 279
1477 3300005548 Ga0070665_100051909 Ga0070665_1000519091 279
1478 3300006051 Ga0075364_10015623 Ga0075364_100156234 279
1479 3300006175 Ga0070712_100369824 Ga0070712_1003698242 279
1480 3300006914 Ga0075436_100074121 Ga0075436_1000741212 279
1481 3300006943 Ga0099822_1001510 Ga0099822_100151024 279
1482 3300009093 Ga0105240_10175366 Ga0105240_101753662 279
1483 3300021384 Ga0213876_10037137 Ga0213876_100371373 279
1484 3300025906 Ga0207699_10008437 Ga0207699_100084371 279
1485 3300025915 Ga0207693_10003944 Ga0207693_100039443 279
1486 3300025916 Ga0207663_10036712 Ga0207663_100367122 279
1487 3300027357 Ga0209589_1000007 Ga0209589_1000007168 279
1488 3300027361 Ga0209489_100008 Ga0209489_100008168 279
1489 3300027363 Ga0209700_100009 Ga0209700_100009168 279
1490 3300033442 Ga0315911_1000004 Ga0315911_1000004365 279
1491 3300035116 Ga0373945_0014901 Ga0373945_0014901_1539_2408 279
1492 3300035170 Ga0373943_0045194 Ga0373943_0045194_1064_1933 279
1493 3300035170 Ga0373943_0051417 Ga0373943_0051417_186_1223 279
1494 3300035171 Ga0373946_0012162 Ga0373946_0012162_1550_2419 279
1495 3300035410 Ga0373924_0007778 Ga0373924_0007778_853_1890 279
1496 3300035695 Ga0373927_0038647 Ga0373927_0038647_160_1197 279
1497 3300035695 Ga0373927_0087313 Ga0373927_0087313_642_1544 279
1498 3300035725 Ga0373947_0121693 Ga0373947_0121693_776_1645 279
1499 3300036401 Ga0373937_0140279 Ga0373937_0140279_157_1059 279
1500 3300037068 Ga0373925_0004601 Ga0373925_0004601_6149_7018 279
1501 3300037068 Ga0373925_0055678 Ga0373925_0055678_1157_2194 279
1502 3300037068 Ga0373925_0366525 Ga0373925_0366525_258_1127 279
1503 3300037853 Ga0436364_0838358 Ga0436364_0838358_142_1044 279
1504 3300039437 Ga0436365_0768275 Ga0436365_0768275_9337_10257 279
1505 3300039437 Ga0436365_1160728 Ga0436365_1160728_2308_3210 279
1506 3300039437 Ga0436365_1523930 Ga0436365_1523930_1188_2090 279
1507 3300039438 Ga0436360_0938879 Ga0436360_0938879_1821_2723 279
1508 3300046459 Ga0495629_0062627 Ga0495629_0062627_235_1104 279
1509 3300046459 Ga0495629_0159207 Ga0495629_0159207_39_989 279
1510 3300046462 Ga0495651_0182590 Ga0495651_0182590_187_1089 279
1511 3300046463 Ga0495653_0064907 Ga0495653_0064907_986_2023 279
1512 3300046471 Ga0495650_0045002 Ga0495650_0045002_943_1842 279
1513 3300046473 Ga0495582_0131633 Ga0495582_0131633_375_1244 279
1514 3300046476 Ga0495662_0000223 Ga0495662_0000223_113_1063 279
1515 3300046477 Ga0495664_0000800 Ga0495664_0000800_14028_15065 279
1516 3300046514 Ga0495618_0005331 Ga0495618_0005331_1727_2764 279
1517 3300046514 Ga0495618_0215734 Ga0495618_0215734_168_1070 279
1518 3300046517 Ga0495630_0037785 Ga0495630_0037785_1499_2536 279
1519 3300046529 Ga0495652_0064544 Ga0495652_0064544_854_1891 279
1520 3300046531 Ga0495665_0163905 Ga0495665_0163905_109_1059 279
1521 3300046533 Ga0495640_0000544 Ga0495640_0000544_13772_14809 279
1522 3300046533 Ga0495640_0099925 Ga0495640_0099925_773_1675 279
1523 3300046535 Ga0495586_0097140 Ga0495586_0097140_248_1198 279
1524 3300046536 Ga0495587_0041927 Ga0495587_0041927_1768_2670 279
1525 3300046543 Ga0495645_0002211 Ga0495645_0002211_5503_6540 279
1526 3300046559 Ga0495667_0032424 Ga0495667_0032424_443_1345 279
1527 3300046642 Ga0495634_0007670 Ga0495634_0007670_4200_5237 279
1528 3300046642 Ga0495634_0124835 Ga0495634_0124835_467_1369 279
1529 3300046663 Ga0495635_0004288 Ga0495635_0004288_8407_9444 279
1530 3300046681 Ga0495647_0029527 Ga0495647_0029527_215_1165 279
1531 3300046683 Ga0495658_0001039 Ga0495658_0001039_12643_13512 279
1532 3300046690 Ga0495624_0052513 Ga0495624_0052513_1429_2466 279
1533 3300047471 Ga0495684_0003192 Ga0495684_0003192_7032_8069 279
1534 3300048088 Ga0495602_0246993 Ga0495602_0246993_235_1137 279
1535 3300048905 Ga0496102_0110103 Ga0496102_0110103_824_1726 279
1536 3300048908 Ga0496105_0315551 Ga0496105_0315551_235_1137 279
1537 3300048909 Ga0496106_0267991 Ga0496106_0267991_169_1071 279
1538 3300048912 Ga0496109_0272144 Ga0496109_0272144_533_1435 279
1539 3300048914 Ga0496111_0063517 Ga0496111_0063517_90_992 279
1540 3300048917 Ga0496114_0180374 Ga0496114_0180374_690_1592 279
1541 3300048924 Ga0496121_0177421 Ga0496121_0177421_95_991 279
1542 3300048929 Ga0496126_0380234 Ga0496126_0380234_155_1051 279
1543 3300049571 Ga0501034_0517213 Ga0501034_0517213_86_955 279
1544 3300049583 Ga0501067_0013811 Ga0501067_0013811_3510_4457 279
1545 3300049589 Ga0501073_0050737 Ga0501073_0050737_1962_2882 279
1546 3300050491 nmdc:mga00v17_15240_c1 nmdc:mga00v17_15240_c1_1814_2752 279
1547 3300053077 Ga0495601_0010473 Ga0495601_0010473_754_1656 279
1548 3300053077 Ga0495601_0032032 Ga0495601_0032032_1672_2574 279
1549 3300053077 Ga0495601_0062698 Ga0495601_0062698_1024_2061 279
1550 3300053078 Ga0495612_0001270 Ga0495612_0001270_2012_3049 279
1551 3300053078 Ga0495612_0045474 Ga0495612_0045474_472_1374 279
1552 3300053084 Ga0495595_0112432 Ga0495595_0112432_122_1024 279
1553 3300053085 Ga0495619_0017953 Ga0495619_0017953_1727_2764 279
1554 3300053091 Ga0500647_0029042 Ga0500647_0029042_1029_1919 279
1555 3300053122 Ga0500608_080244 Ga0500608_080244_464_1399 279
1556 3300053134 Ga0500658_0058151 Ga0500658_0058151_72_992 279
1557 3300053139 Ga0500568_0013672 Ga0500568_0013672_1490_2386 279
1558 3300053139 Ga0500568_0019093 Ga0500568_0019093_1649_2569 279
1559 3300053148 Ga0500590_116353 Ga0500590_116353_258_1193 279
1560 3300053153 Ga0500616_0008096 Ga0500616_0008096_321_1256 279
1561 3300054114 Ga0501084_0015828 Ga0501084_0015828_1612_2559 279
1562 iso_pu_bacteria 2775507255 2778126252 279
1563 3300005563 Ga0068855_100349099 Ga0068855_1003490992 280
1564 3300005577 Ga0068857_100044596 Ga0068857_1000445963 280
1565 3300005937 Ga0081455_10015269 Ga0081455_100152699 280
1566 3300005937 Ga0081455_10137647 Ga0081455_101376472 280
1567 3300006175 Ga0070712_100082360 Ga0070712_1000823603 280
1568 3300006186 Ga0075369_10112321 Ga0075369_101123212 280
1569 3300013104 Ga0157370_10199275 Ga0157370_101992752 280
1570 3300025928 Ga0207700_10048834 Ga0207700_100488344 280
1571 3300026116 Ga0207674_10019244 Ga0207674_100192443 280
1572 3300037312 Ga0395899_0019536 Ga0395899_0019536_4156_5079 280
1573 3300037418 Ga0395900_0302164 Ga0395900_0302164_181_1104 280
1574 3300037466 Ga0395898_0087335 Ga0395898_0087335_209_1132 280
1575 3300038443 Ga0395901_0000880 Ga0395901_0000880_19984_20907 280
1576 3300038443 Ga0395901_0081261 Ga0395901_0081261_139_1062 280
1577 3300048904 Ga0496101_0141383 Ga0496101_0141383_758_1717 280
1578 3300048907 Ga0496104_0018299 Ga0496104_0018299_3099_4025 280
1579 3300048907 Ga0496104_0025914 Ga0496104_0025914_2213_3172 280
1580 3300048908 Ga0496105_0337501 Ga0496105_0337501_262_1188 280
1581 3300048916 Ga0496113_0024393 Ga0496113_0024393_2302_3228 280
1582 3300048918 Ga0496115_0050923 Ga0496115_0050923_210_1169 280
1583 3300049590 Ga0501074_0261272 Ga0501074_0261272_223_1197 280
1584 3300049592 Ga0501076_0277831 Ga0501076_0277831_381_1355 280
1585 3300049741 Ga0501079_0143047 Ga0501079_0143047_99_1073 280
1586 3300049743 Ga0501081_0020783 Ga0501081_0020783_57_1031 280
1587 3300053153 Ga0500616_0002157 Ga0500616_0002157_4783_5706 280
1588 3300003781 Ga0055536_1005334 Ga0055536_10053343 281
1589 3300025292 Ga0209676_1000238 Ga0209676_1000238113 281
1590 3300025298 Ga0209050_1016456 Ga0209050_10164564 281
1591 3300031250 Ga0265331_10144471 Ga0265331_101444711 281
1592 3300039447 Ga0436361_0904010 Ga0436361_0904010_934_1842 281
1593 3300050507 nmdc:mga05p37_389441_c1 nmdc:mga05p37_389441_c1_64_909 281
1594 3300031548 Ga0307408_100072109 Ga0307408_1000721092 282
1595 3300031731 Ga0307405_10024417 Ga0307405_100244173 282
1596 3300031911 Ga0307412_10039929 Ga0307412_100399293 282
1597 3300032004 Ga0307414_10006076 Ga0307414_100060763 282
1598 3300032005 Ga0307411_10037015 Ga0307411_100370154 282
1599 3300046524 Ga0495648_0000032 Ga0495648_0000032_145937_146785 282
1600 3300049663 Ga0501223_000289 Ga0501223_000289_5907_6755 282
1601 3300049664 Ga0501224_000002 Ga0501224_000002_100340_101188 282
1602 3300049668 Ga0501233_006556 Ga0501233_006556_585_1433 282
1603 3300049705 Ga0501225_0000045 Ga0501225_0000045_22325_23173 282
1604 3300049707 Ga0501234_000055 Ga0501234_000055_8916_9764 282
1605 3300049853 Ga0501226_000026 Ga0501226_000026_80962_81810 282
1606 iso_pu_bacteria 2643221563 2643835571 282
1607 iso_pu_bacteria 2643221608 2644056497 282
1608 iso_pu_bacteria 2852653556 2852655173 282
1609 iso_pu_bacteria 2852680915 2852681269 282
1610 3300001904 JGI24736J21556_1006437 JGI24736J21556_10064372 283
1611 3300001915 JGI24741J21665_1000512 JGI24741J21665_100051212 283
1612 3300001979 JGI24740J21852_10006507 JGI24740J21852_100065072 283
1613 3300002067 JGI24735J21928_10007012 JGI24735J21928_100070124 283
1614 3300005339 Ga0070660_100322397 Ga0070660_1003223972 283
1615 3300005344 Ga0070661_100038289 Ga0070661_1000382894 283
1616 3300005614 Ga0068856_100050744 Ga0068856_1000507442 283
1617 3300009147 Ga0114129_10427101 Ga0114129_104271013 283
1618 3300009174 Ga0105241_10001825 Ga0105241_1000182516 283
1619 3300013100 Ga0157373_10041007 Ga0157373_100410072 283
1620 3300025920 Ga0207649_10032745 Ga0207649_100327452 283
1621 3300025933 Ga0207706_10004051 Ga0207706_100040514 283
1622 3300026041 Ga0207639_10020336 Ga0207639_100203362 283
1623 3300026067 Ga0207678_10000095 Ga0207678_1000009578 283
1624 3300026116 Ga0207674_10011995 Ga0207674_100119955 283
1625 3300031901 Ga0307406_10081169 Ga0307406_100811693 283
1626 3300031995 Ga0307409_100543160 Ga0307409_1005431602 283
1627 3300053153 Ga0500616_0027058 Ga0500616_0027058_959_1813 283
1628 3300005548 Ga0070665_100000195 Ga0070665_10000019586 284
1629 3300028379 Ga0268266_10001710 Ga0268266_100017108 284
1630 3300053739 Ga0500587_001664 Ga0500587_001664_77_1006 284
1631 3300046616 Ga0495668_0046640 Ga0495668_0046640_115_975 285
1632 3300053116 Ga0500592_009871 Ga0500592_009871_579_1439 285
1633 3300053158 Ga0500627_0197651 Ga0500627_0197651_26_886 285
1634 3300003781 Ga0055536_1001293 Ga0055536_100129314 286
1635 3300003791 Ga0055530_10000310 Ga0055530_1000031014 286
1636 3300025291 Ga0209675_1000025 Ga0209675_1000025165 286
1637 3300025292 Ga0209676_1000571 Ga0209676_100057164 286
1638 3300025292 Ga0209676_1001500 Ga0209676_100150023 286
1639 3300025297 Ga0209758_1037173 Ga0209758_10371732 286
1640 3300025298 Ga0209050_1000104 Ga0209050_100010423 286
1641 3300025298 Ga0209050_1001457 Ga0209050_100145721 286
1642 3300025304 Ga0209257_1000120 Ga0209257_10001203 286
1643 3300025304 Ga0209257_1000323 Ga0209257_1000323105 286
1644 3300046506 Ga0495583_0077489 Ga0495583_0077489_399_1274 286
1645 3300046616 Ga0495668_0000001 Ga0495668_0000001_344164_345024 286
1646 3300046660 Ga0495625_0000751 Ga0495625_0000751_36241_37101 286
1647 3300048090 Ga0495615_0000085 Ga0495615_0000085_13534_14409 286
1648 3300048925 Ga0496122_0006838 Ga0496122_0006838_4872_5747 286
1649 3300048926 Ga0496123_0002007 Ga0496123_0002007_13260_14135 286
1650 3300053139 Ga0500568_0003040 Ga0500568_0003040_7299_8159 286
1651 2162886007 SwRhRL2b_contig_2347511 SwRhRL2b_0389.00001910 287
1652 2162886007 SwRhRL2b_contig_2406991 SwRhRL2b_0789.00009750 287
1653 3300005289 Ga0065704_10001979 Ga0065704_100019797 287
1654 3300005289 Ga0065704_10090027 Ga0065704_100900274 287
1655 3300005289 Ga0065704_10114843 Ga0065704_101148431 287
1656 3300005331 Ga0070670_100020327 Ga0070670_1000203272 287
1657 3300005347 Ga0070668_100013005 Ga0070668_1000130055 287
1658 3300009978 Ga0105148_100170 Ga0105148_1001704 287
1659 3300025931 Ga0207644_10056256 Ga0207644_100562563 287
1660 3300025961 Ga0207712_10131992 Ga0207712_101319922 287
1661 3300025972 Ga0207668_10026041 Ga0207668_100260413 287
1662 3300046519 Ga0495632_0000075 Ga0495632_0000075_13840_14724 287
1663 3300046524 Ga0495648_0002686 Ga0495648_0002686_1524_2408 287
1664 3300046525 Ga0495663_0000003 Ga0495663_0000003_60524_61408 287
1665 3300046558 Ga0495633_0000786 Ga0495633_0000786_21471_22355 287
1666 3300047472 Ga0495686_0043890 Ga0495686_0043890_1142_2026 287
1667 3300048911 Ga0496108_0033687 Ga0496108_0033687_1665_2528 287
1668 3300048911 Ga0496108_0118090 Ga0496108_0118090_180_1043 287
1669 3300048913 Ga0496110_0103214 Ga0496110_0103214_1053_1916 287
1670 3300048919 Ga0496116_0078789 Ga0496116_0078789_385_1248 287
1671 3300048924 Ga0496121_0001214 Ga0496121_0001214_1755_2618 287
1672 3300048924 Ga0496121_0059432 Ga0496121_0059432_991_1854 287
1673 3300048925 Ga0496122_0029438 Ga0496122_0029438_1574_2437 287
1674 3300048925 Ga0496122_0081360 Ga0496122_0081360_1306_2169 287
1675 3300048926 Ga0496123_0008924 Ga0496123_0008924_7031_7894 287
1676 3300048927 Ga0496124_0002458 Ga0496124_0002458_5596_6459 287
1677 3300048928 Ga0496125_0002535 Ga0496125_0002535_1878_2741 287
1678 3300048929 Ga0496126_0006114 Ga0496126_0006114_10754_11617 287
1679 3300048929 Ga0496126_0132740 Ga0496126_0132740_202_1065 287
1680 3300049658 Ga0501211_003699 Ga0501211_003699_607_1470 287
1681 3300049705 Ga0501225_0018576 Ga0501225_0018576_586_1449 287

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01218

Coprogen_oxidas

Coproporphyrinogen III oxidase

41

345

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
5eo6-assembly1.cif.gz_B coproporphyrinogen iii oxidase (hemf) from acinetobacter baumannii 0.943 10 287
3e8j-assembly1.cif.gz_B coproporphyrinogen iii oxidase from leishmania naiffi 0.9363 10 287
3dwr-assembly1.cif.gz_B leishmania major coproporphyrinogen iii oxidase with bound ligand 0.9339 8 287
3e8j-assembly1.cif.gz_A coproporphyrinogen iii oxidase from leishmania naiffi 0.9222 10 287
8t7w-assembly1.cif.gz_A crystal structure of oxygen-dependent coproporphyrinogen-iii oxidase (hemf) from klebsiella aerogenes 0.9189 10 287
ID Description Score Start End Superfamily
3dwsA00 Alpha Beta;3-Layer(aba) Sandwich;oxygen-dependent coproporphyrinogen oxidase;Coproporphyrinogen III oxidase, aerobic 0.9014 10 287 3.40.1500.10
af_Q9UTE2_2_312_3.40.1500.10 Alpha Beta;3-Layer(aba) Sandwich;oxygen-dependent coproporphyrinogen oxidase;Coproporphyrinogen III oxidase, aerobic 0.8685 1 287 3.40.1500.10
af_Q9UTE2_2_312_3.40.1500.10 Alpha Beta;3-Layer(aba) Sandwich;oxygen-dependent coproporphyrinogen oxidase;Coproporphyrinogen III oxidase, aerobic 0.8655 1 287 3.40.1500.10
af_Q7XPL2_53_398_3.40.1500.10 Alpha Beta;3-Layer(aba) Sandwich;oxygen-dependent coproporphyrinogen oxidase;Coproporphyrinogen III oxidase, aerobic 0.8557 12 287 3.40.1500.10
af_Q54IA7_2_331_3.40.1500.10 Alpha Beta;3-Layer(aba) Sandwich;oxygen-dependent coproporphyrinogen oxidase;Coproporphyrinogen III oxidase, aerobic 0.8548 5 287 3.40.1500.10
ID Description Score Start End GO Terms
AF-A0A3D4M0P0-F1-model_v4 deleted 0.989 103 287
AF-A0A1R1YWK0-F1-model_v4 coproporphyrinogen oxidase (EC 1.3.3.3) 0.9871 3 287 GO:0004109
GO:0005737
GO:0006782
AF-A0A3D2P2U3-F1-model_v4 coproporphyrinogen oxidase (EC 1.3.3.3) 0.9869 69 177 GO:0004109
GO:0005737
GO:0006782
AF-A0A3M1G5I1-F1-model_v4 coproporphyrinogen oxidase (EC 1.3.3.3) 0.9853 67 287 GO:0004109
GO:0005737
GO:0006782
AF-A0A848SJ21-F1-model_v4 deleted 0.982 128 287

Feature Viewer

pLDDT pTM Quality
94.84 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map