F495313
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1681 | 776 | 1411 | 295 |
Family's Representative Sequence
| Representative Sequence | 3300035170|Ga0373943_0051417|Ga0373943_0051417_186_1223 |
| Length | 345 |
| Sequence | VRLQLLNILADFYDILTPAIAERSNRTQSMNSAKPEQRKETAQTWFEALRDRLLAALEGVEDALPAGAPLSDRPAGRFKRTAWQRTDHTGAQPISGLPEIGNVNAGPAGAGLGGGVMAMMQGRVFEKVGVHVSTVFGEFAPEFRNEIPGAADDPRFYASGISLIAHPHNPHVPAAHMNTRYVVTTKSWFGGGADLTPVLERRRGQEDPDAIAFHGAMRAACDAHSRVAHYDEFKKWCDEYFYLKHRGEMRGIGGIFYDWLDSGDFAADFGFTQEVGRAFLDIYPELVRRNFAKPWSEAEREEQLVRRGRYVEFNLLYDRGTIFGLRTGGNVESILSSMPPVVKWP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 3 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 4 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 5 | 2508501050 | Microvirga lupini Lut6 | Isolate | Nodule |
| 6 | 2508501114 | Microvirga lotononidis WSM3557 | Isolate | Nodule |
| 7 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 8 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 9 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 10 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 11 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 12 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 13 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 14 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 15 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 16 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 17 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 18 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 19 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 20 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 21 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 22 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 23 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 24 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 25 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 26 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 27 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 28 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 29 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 30 | 2643221563 | Sphingopyxis sp. Root154 | Isolate | Unclassified |
| 31 | 2643221608 | Sphingopyxis sp. Root214 | Isolate | Unclassified |
| 32 | 2643221651 | Afipia sp. Root123D2 | Isolate | Unclassified |
| 33 | 2643221733 | Bosea sp. Root381 | Isolate | Unclassified |
| 34 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 35 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 36 | 2738541281 | Methylobacterium sp. GV094 | Isolate | Unclassified |
| 37 | 2738543032 | Methylobacterium sp. GV104 | Isolate | Unclassified |
| 38 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 39 | 2773857925 | Microvirga vignae BR3299 | Isolate | Unclassified |
| 40 | 2775506901 | Microvirga ossetica V5/3m | Isolate | Unclassified |
| 41 | 2775507255 | Sphingobium indicum B90A | Isolate | Rhizosphere |
| 42 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 43 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 44 | 2791355199 | |||
| 45 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 46 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 47 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 48 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 49 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 50 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 51 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 52 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 53 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 54 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 55 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 56 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 57 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 58 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 59 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 60 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 61 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 62 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 63 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 64 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 65 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 66 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 67 | 2829745981 | Methylorubrum rhodinum DSM 2163 | Isolate | Rhizosphere |
| 68 | 2835312727 | Microvirga calopogonii CCBAU 65841 | Isolate | Nodule |
| 69 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 70 | 2841911363 | Bosea caraganae RCAM04685 | Isolate | Nodule |
| 71 | 2841917233 | Bosea caraganae RCAM04680 | Isolate | Nodule |
| 72 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 73 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 74 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 75 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 76 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 77 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 78 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 79 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 80 | 2842698319 | Methylobacterium sp. R-72139 | Isolate | Unclassified |
| 81 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 82 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 83 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 84 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 85 | 2851182111 | Bosea sp. Tri-44 | Isolate | Nodule |
| 86 | 2852653556 | Sphingopyxis sp. JAI108 | Isolate | Rhizosphere |
| 87 | 2852680915 | Sphingopyxis sp. JAI128 | Isolate | Rhizosphere |
| 88 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 89 | 2861691609 | Methylorubrum thiocyanatum DSM 11490 | Isolate | Rhizosphere |
| 90 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 91 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 92 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 93 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 94 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 95 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 96 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 97 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 98 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 99 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 100 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 101 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 102 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 103 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 104 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 105 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 106 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 107 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 108 | 2882456835 | Microvirga sp. KLBC 81 | Isolate | Unclassified |
| 109 | 2883577096 | Roseococcus sp. SYP-B2431 | Isolate | Rhizosphere |
| 110 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 111 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 112 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 113 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 114 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 115 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 116 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 117 | 2894232714 | Microvirga tunisiensis Lmie10 | Isolate | Nodule |
| 118 | 2894817345 | Aureimonas psammosilenae YIM DR1026 | Isolate | Unclassified |
| 119 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 120 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 121 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 122 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 123 | 2904699407 | |||
| 124 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 125 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 126 | 2906610324 | |||
| 127 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 128 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 129 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 130 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 131 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 132 | 2917699015 | Bosea sp. F3-2 | Isolate | Rhizosphere |
| 133 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 134 | 2922368715 | |||
| 135 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 136 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 137 | 2922425934 | |||
| 138 | 2929199973 | Roseomonas sp. R-73070 Hybrid assembly | Isolate | Unclassified |
| 139 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 140 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 141 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 142 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 143 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 144 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 145 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 146 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 147 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 148 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 149 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 150 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 151 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 152 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 153 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 154 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 155 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 156 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 157 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 158 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 159 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 160 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 161 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 162 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 163 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 164 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 165 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 166 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 167 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 168 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 169 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 170 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 171 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 172 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 173 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 174 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 175 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 176 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 177 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 178 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 179 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 180 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 181 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 182 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 183 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 184 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 185 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 186 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 187 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 188 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 189 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 190 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 191 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 192 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 193 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 194 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 195 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 196 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 197 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 198 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 199 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 200 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 201 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 202 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 203 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 204 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 205 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 206 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 207 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 208 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 209 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 210 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 211 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 212 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 213 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 214 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 215 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 216 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 217 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 218 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 219 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 220 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 221 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 222 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 223 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 224 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 225 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 226 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 227 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 228 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 229 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 230 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 231 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 232 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 233 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 234 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 235 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 236 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 237 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 238 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 239 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 240 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 241 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 242 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 243 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 244 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 245 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 246 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 247 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 248 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 249 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 250 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 251 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 252 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 253 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 254 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 255 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 256 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 257 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 258 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 259 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 260 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 261 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 262 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 263 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 264 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 265 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 266 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 267 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 268 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 269 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 270 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 271 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 272 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 273 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 274 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 275 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 276 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 277 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 278 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 279 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 280 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 281 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 282 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 283 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 284 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 285 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 286 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 287 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 288 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 289 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 290 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 291 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 292 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 293 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 294 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 295 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 296 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 297 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 298 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 299 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 300 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 301 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 302 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 303 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 304 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 305 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 306 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 307 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 308 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 309 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 310 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 311 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 312 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 313 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 314 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 315 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 316 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 317 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 318 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 319 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 320 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 321 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 322 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 323 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 324 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 325 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 326 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 327 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 328 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 329 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 330 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 331 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 332 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 333 | 3300009978 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG | Metagenome | Rhizosphere |
| 334 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 335 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 336 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 337 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 338 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 339 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 340 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 341 | 3300013250 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 | Metagenome | Rhizosphere |
| 342 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 343 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 344 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 345 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 346 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 347 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 348 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 349 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 350 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 351 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 352 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 353 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 354 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 355 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 356 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 357 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 358 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 359 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 360 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 361 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 362 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 363 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 364 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 365 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 366 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 367 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 368 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 369 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 370 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 371 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 372 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 373 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 374 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 375 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 376 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 377 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 378 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 379 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 380 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 381 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 382 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 383 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 384 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 385 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 386 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 387 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 388 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 389 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 390 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 391 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 392 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 393 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 394 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 395 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 396 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 397 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 398 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 399 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 400 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 401 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 402 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 403 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 404 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 405 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 406 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 407 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 408 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 409 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 410 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 411 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 412 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 413 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 414 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 415 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 416 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 417 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 418 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 419 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 420 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 421 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 422 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 423 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 424 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 425 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 426 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 427 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 428 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 429 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 430 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 431 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 432 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 433 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 434 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 435 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 436 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 437 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 438 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 439 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 440 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 441 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 442 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 443 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 444 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 445 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 446 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 447 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 448 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 449 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 450 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 451 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 452 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 453 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 454 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 455 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 456 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 457 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 458 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 459 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 460 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 461 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 462 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 463 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 464 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 465 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 466 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 467 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 468 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 469 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 470 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 471 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 472 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 473 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 474 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 475 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 476 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 477 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 478 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 479 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 480 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 481 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 482 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 483 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 484 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 485 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 486 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 487 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 488 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 489 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 490 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 491 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 492 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 493 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 494 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 495 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 496 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 497 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 498 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 499 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 500 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 501 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 502 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 503 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 504 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 505 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 506 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 507 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 508 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 509 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 510 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 511 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 512 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 513 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 514 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 515 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 516 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 517 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 518 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 519 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 520 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 521 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 522 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 523 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 524 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 525 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 526 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 527 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 528 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 529 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 530 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 531 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 532 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 533 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 534 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 535 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 536 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 537 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 538 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 539 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 540 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 541 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 542 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 543 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 544 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 545 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 546 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 547 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 548 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 549 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 550 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 551 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 552 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 553 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 554 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 555 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 556 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 557 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 558 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 559 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 560 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 561 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 562 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 563 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 564 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 565 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 566 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 567 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 568 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 569 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 570 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 571 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 572 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 573 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 574 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 575 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 576 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 577 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 578 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 579 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 580 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 581 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 582 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 583 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 584 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 585 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 586 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 587 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 588 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 589 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 590 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 591 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 592 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 593 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 594 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 595 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 596 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 597 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 598 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 599 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 600 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 601 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 602 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 603 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 604 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 605 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 606 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 607 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 608 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 609 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 610 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 611 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 612 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 613 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 614 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 615 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 616 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 617 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 618 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 619 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 620 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 621 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 622 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 623 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 624 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 625 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 626 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 627 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 628 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 629 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 630 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 631 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 632 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 633 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 634 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 635 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 636 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 637 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 638 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 639 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 640 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 641 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 642 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 643 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 644 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 645 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 646 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 647 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 648 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 649 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 650 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 651 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 652 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 653 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 654 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 655 | 3300049658 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought | Metagenome | Rhizosphere |
| 656 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 657 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 658 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 659 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 660 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 661 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 662 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 663 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 664 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 665 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 666 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 667 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 668 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 669 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 670 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 671 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 672 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 673 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 674 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 675 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 676 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 677 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 678 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 679 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 680 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 681 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 682 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 683 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 684 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 685 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 686 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 687 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 688 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 689 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 690 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 691 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 692 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 693 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 694 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 695 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 696 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 697 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 698 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 699 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 700 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 701 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 702 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 703 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 704 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 705 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 706 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 707 | 3300053126 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere | Metagenome | Endosphere |
| 708 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 709 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 710 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 711 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 712 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 713 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 714 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 715 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 716 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 717 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 718 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 719 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 720 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 721 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 722 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 723 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 724 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 725 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 726 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 727 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 728 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 729 | 3300053733 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere | Metagenome | Endosphere |
| 730 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 731 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 732 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 733 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 734 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 735 | 8001845381 | Ancylobacter sonchi VKM B-3145 | Isolate | Unclassified |
| 736 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 737 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 738 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 739 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 740 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 741 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 742 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 743 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 744 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 745 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 746 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 747 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 748 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 749 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 750 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 751 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 752 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 753 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 754 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 755 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 756 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 757 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 758 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 759 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 760 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 761 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 762 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 763 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 764 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 765 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 766 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 767 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 768 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 769 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 770 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 771 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 772 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 773 | 8055909800 | Plastoroseomonas hellenica LMG 31523 | Isolate | Unclassified |
| 774 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 775 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
| 776 | 8057529695 | Bosea vestrisii A18/4-2 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 84.13 |
| Metatranscriptomes | 0.06 |
| Isolates | 15.81 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 11.48 |
| Nodule | 12.14 |
| Rhizoplane | 4.76 |
| Rhizosphere | 62.34 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 9.28 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_2347511 | 2162886007 | Bacteria | 2650 |
| 2 | SwRhRL2b_contig_2406991 | 2162886007 | Bacteria | 893 |
| 3 | JGI24736J21556_1006437 | 3300001904 | Bacteria | 1976 |
| 4 | JGI24741J21665_1000512 | 3300001915 | Bacteria | 11846 |
| 5 | JGI24740J21852_10002132 | 3300001979 | Bacteria | 9037 |
| 6 | JGI24740J21852_10006507 | 3300001979 | Bacteria | 4828 |
| 7 | JGI24739J22299_10031199 | 3300001989 | Bacteria | 1843 |
| 8 | JGI24735J21928_10007012 | 3300002067 | Bacteria | 3683 |
| 9 | JGI25159J45721_1013877 | 3300002987 | Bacteria | 1842 |
| 10 | JGI25151J46595_10000019 | 3300003187 | Bacteria | 236340 |
| 11 | JGI25406J46586_10000449 | 3300003203 | Bacteria | 19106 |
| 12 | JGI25406J46586_10007061 | 3300003203 | Bacteria | 5149 |
| 13 | JGI25153J46596_10001471 | 3300003215 | Bacteria | 14056 |
| 14 | rootH2_10072203 | 3300003320 | Bacteria | 11128 |
| 15 | rootL2_10059632 | 3300003322 | Bacteria | 2046 |
| 16 | JGI25160J50197_1000851 | 3300003354 | Bacteria | 16211 |
| 17 | JGI25404J52841_10007296 | 3300003659 | Bacteria | 2336 |
| 18 | JGI25404J52841_10015597 | 3300003659 | Bacteria | 1648 |
| 19 | Ga0055539_1005268 | 3300003752 | Bacteria | 1685 |
| 20 | Ga0055529_1012682 | 3300003763 | Bacteria | 1077 |
| 21 | Ga0055526_1000150 | 3300003771 | Bacteria | 61554 |
| 22 | Ga0055536_1001293 | 3300003781 | Bacteria | 15394 |
| 23 | Ga0055536_1005334 | 3300003781 | Bacteria | 6312 |
| 24 | Ga0055530_10000310 | 3300003791 | Bacteria | 44225 |
| 25 | Ga0055531_10007025 | 3300003794 | Bacteria | 6232 |
| 26 | Ga0055543_1005200 | 3300004625 | Bacteria | 3367 |
| 27 | Ga0065165_1001015 | 3300005262 | Bacteria | 34129 |
| 28 | Ga0065165_1001200 | 3300005262 | Bacteria | 29939 |
| 29 | Ga0065165_1001308 | 3300005262 | Bacteria | 27817 |
| 30 | Ga0065165_1016121 | 3300005262 | Bacteria | 2813 |
| 31 | Ga0065165_1056808 | 3300005262 | Bacteria | 1086 |
| 32 | Ga0065704_10001979 | 3300005289 | Bacteria | 8225 |
| 33 | Ga0065704_10090027 | 3300005289 | Bacteria | 2815 |
| 34 | Ga0065704_10114843 | 3300005289 | Bacteria | 1883 |
| 35 | Ga0070658_10074317 | 3300005327 | Bacteria | 2787 |
| 36 | Ga0070676_10051847 | 3300005328 | Bacteria | 2410 |
| 37 | Ga0070676_10056064 | 3300005328 | Bacteria | 2328 |
| 38 | Ga0070676_10092865 | 3300005328 | Bacteria | 1852 |
| 39 | Ga0070683_100065303 | 3300005329 | Bacteria | 3388 |
| 40 | Ga0070683_100107348 | 3300005329 | Bacteria | 2632 |
| 41 | Ga0070683_100152795 | 3300005329 | Bacteria | 2188 |
| 42 | Ga0070690_100145626 | 3300005330 | Bacteria | 1611 |
| 43 | Ga0070670_100020327 | 3300005331 | Bacteria | 5706 |
| 44 | Ga0070670_100048139 | 3300005331 | Bacteria | 3668 |
| 45 | Ga0070670_100463664 | 3300005331 | Bacteria | 1124 |
| 46 | Ga0068869_100052862 | 3300005334 | Bacteria | 2951 |
| 47 | Ga0068869_100089048 | 3300005334 | Bacteria | 2317 |
| 48 | Ga0070666_10367110 | 3300005335 | Bacteria | 1032 |
| 49 | Ga0070680_100014862 | 3300005336 | Bacteria | 6090 |
| 50 | Ga0070680_100018980 | 3300005336 | Bacteria | 5442 |
| 51 | Ga0070680_100030489 | 3300005336 | Bacteria | 4332 |
| 52 | Ga0070680_100056438 | 3300005336 | Bacteria | 3209 |
| 53 | Ga0070680_100107792 | 3300005336 | Bacteria | 2317 |
| 54 | Ga0070682_100049913 | 3300005337 | Bacteria | 2610 |
| 55 | Ga0070682_100164765 | 3300005337 | Bacteria | 1534 |
| 56 | Ga0068868_100019171 | 3300005338 | Bacteria | 5125 |
| 57 | Ga0068868_100047184 | 3300005338 | Bacteria | 3374 |
| 58 | Ga0068868_100128947 | 3300005338 | Bacteria | 2068 |
| 59 | Ga0068868_100499830 | 3300005338 | Bacteria | 1065 |
| 60 | Ga0070660_100241659 | 3300005339 | Bacteria | 1471 |
| 61 | Ga0070660_100283425 | 3300005339 | Bacteria | 1356 |
| 62 | Ga0070660_100322397 | 3300005339 | Bacteria | 1269 |
| 63 | Ga0070660_100334349 | 3300005339 | Bacteria | 1246 |
| 64 | Ga0070687_100031773 | 3300005343 | Bacteria | 2592 |
| 65 | Ga0070661_100038289 | 3300005344 | Bacteria | 3490 |
| 66 | Ga0070661_100139477 | 3300005344 | Bacteria | 1826 |
| 67 | Ga0070692_10142743 | 3300005345 | Bacteria | 1357 |
| 68 | Ga0070668_100011646 | 3300005347 | Bacteria | 6546 |
| 69 | Ga0070668_100013005 | 3300005347 | Bacteria | 6197 |
| 70 | Ga0070668_100018194 | 3300005347 | Bacteria | 5273 |
| 71 | Ga0070668_100093723 | 3300005347 | Bacteria | 2370 |
| 72 | Ga0070668_100139662 | 3300005347 | Bacteria | 1951 |
| 73 | Ga0070668_100154949 | 3300005347 | Bacteria | 1855 |
| 74 | Ga0070668_100551145 | 3300005347 | Bacteria | 1004 |
| 75 | Ga0070675_100027856 | 3300005354 | Bacteria | 4542 |
| 76 | Ga0070675_100121009 | 3300005354 | Bacteria | 2224 |
| 77 | Ga0070671_100132984 | 3300005355 | Bacteria | 2096 |
| 78 | Ga0070671_100185850 | 3300005355 | Bacteria | 1760 |
| 79 | Ga0070671_100200532 | 3300005355 | Bacteria | 1692 |
| 80 | Ga0070671_100306662 | 3300005355 | Bacteria | 1352 |
| 81 | Ga0070674_100055392 | 3300005356 | Bacteria | 2746 |
| 82 | Ga0070673_100107335 | 3300005364 | Bacteria | 2309 |
| 83 | Ga0070659_100049654 | 3300005366 | Bacteria | 3300 |
| 84 | Ga0070659_100056042 | 3300005366 | Bacteria | 3107 |
| 85 | Ga0070659_100115383 | 3300005366 | Bacteria | 2171 |
| 86 | Ga0070659_100243918 | 3300005366 | Bacteria | 1488 |
| 87 | Ga0070667_100044105 | 3300005367 | Bacteria | 3744 |
| 88 | Ga0070667_100071421 | 3300005367 | Bacteria | 2956 |
| 89 | Ga0070667_100179772 | 3300005367 | Bacteria | 1870 |
| 90 | Ga0070667_100181233 | 3300005367 | Bacteria | 1863 |
| 91 | Ga0070667_100200543 | 3300005367 | Bacteria | 1770 |
| 92 | Ga0070709_10002072 | 3300005434 | Bacteria | 10872 |
| 93 | Ga0070709_10148464 | 3300005434 | Bacteria | 1618 |
| 94 | Ga0070714_100013419 | 3300005435 | Bacteria | 6566 |
| 95 | Ga0070714_100057152 | 3300005435 | Bacteria | 3338 |
| 96 | Ga0070714_100088227 | 3300005435 | Bacteria | 2714 |
| 97 | Ga0070714_100224507 | 3300005435 | Bacteria | 1728 |
| 98 | Ga0070714_100374816 | 3300005435 | Bacteria | 1341 |
| 99 | Ga0070714_100430100 | 3300005435 | Bacteria | 1251 |
| 100 | Ga0070713_100011888 | 3300005436 | Bacteria | 6363 |
| 101 | Ga0070713_100021271 | 3300005436 | Bacteria | 4986 |
| 102 | Ga0070713_100037676 | 3300005436 | Bacteria | 3910 |
| 103 | Ga0070713_100063344 | 3300005436 | Bacteria | 3100 |
| 104 | Ga0070713_100168782 | 3300005436 | Bacteria | 1959 |
| 105 | Ga0070713_100192212 | 3300005436 | Bacteria | 1840 |
| 106 | Ga0070713_100396108 | 3300005436 | Bacteria | 1289 |
| 107 | Ga0070710_10002467 | 3300005437 | Bacteria | 8757 |
| 108 | Ga0070710_10003520 | 3300005437 | Bacteria | 7422 |
| 109 | Ga0070710_10081532 | 3300005437 | Bacteria | 1889 |
| 110 | Ga0070711_100008018 | 3300005439 | Bacteria | 6447 |
| 111 | Ga0070711_100011413 | 3300005439 | Bacteria | 5516 |
| 112 | Ga0070711_100027217 | 3300005439 | Bacteria | 3752 |
| 113 | Ga0070711_100156833 | 3300005439 | Bacteria | 1722 |
| 114 | Ga0070711_100319821 | 3300005439 | Bacteria | 1239 |
| 115 | Ga0070700_100368708 | 3300005441 | Bacteria | 1070 |
| 116 | Ga0070700_100422605 | 3300005441 | Bacteria | 1007 |
| 117 | Ga0070708_100047917 | 3300005445 | Bacteria | 3776 |
| 118 | Ga0070663_100015327 | 3300005455 | Bacteria | 4945 |
| 119 | Ga0070663_100029415 | 3300005455 | Bacteria | 3754 |
| 120 | Ga0070663_100043607 | 3300005455 | Bacteria | 3158 |
| 121 | Ga0070663_100053294 | 3300005455 | Bacteria | 2887 |
| 122 | Ga0070663_100192040 | 3300005455 | Bacteria | 1589 |
| 123 | Ga0070663_100209096 | 3300005455 | Bacteria | 1527 |
| 124 | Ga0070678_100016373 | 3300005456 | Bacteria | 4742 |
| 125 | Ga0070678_100026225 | 3300005456 | Bacteria | 3936 |
| 126 | Ga0070678_100131264 | 3300005456 | Bacteria | 1991 |
| 127 | Ga0070678_100167776 | 3300005456 | Bacteria | 1785 |
| 128 | Ga0070678_100230267 | 3300005456 | Bacteria | 1545 |
| 129 | Ga0070662_100020307 | 3300005457 | Bacteria | 4522 |
| 130 | Ga0070662_100024830 | 3300005457 | Bacteria | 4133 |
| 131 | Ga0070662_100248845 | 3300005457 | Bacteria | 1428 |
| 132 | Ga0070681_10039132 | 3300005458 | Bacteria | 4753 |
| 133 | Ga0070681_10092574 | 3300005458 | Bacteria | 2971 |
| 134 | Ga0070681_10120467 | 3300005458 | Bacteria | 2559 |
| 135 | Ga0070681_10149558 | 3300005458 | Bacteria | 2262 |
| 136 | Ga0070681_10222783 | 3300005458 | Bacteria | 1801 |
| 137 | Ga0068867_100229408 | 3300005459 | Bacteria | 1500 |
| 138 | Ga0070685_10014330 | 3300005466 | Bacteria | 4198 |
| 139 | Ga0070685_10048997 | 3300005466 | Bacteria | 2435 |
| 140 | Ga0070706_100241629 | 3300005467 | Bacteria | 1686 |
| 141 | Ga0070707_100127762 | 3300005468 | Bacteria | 2470 |
| 142 | Ga0070698_100005261 | 3300005471 | Bacteria | 14154 |
| 143 | Ga0070698_100095596 | 3300005471 | Bacteria | 2949 |
| 144 | Ga0070679_100025223 | 3300005530 | Bacteria | 5831 |
| 145 | Ga0070679_100109221 | 3300005530 | Bacteria | 2752 |
| 146 | Ga0070684_100065744 | 3300005535 | Bacteria | 3183 |
| 147 | Ga0070684_100069991 | 3300005535 | Bacteria | 3086 |
| 148 | Ga0070684_100155743 | 3300005535 | Bacteria | 2072 |
| 149 | Ga0070697_100045150 | 3300005536 | Bacteria | 3571 |
| 150 | Ga0068853_100034208 | 3300005539 | Bacteria | 4313 |
| 151 | Ga0068853_100060774 | 3300005539 | Bacteria | 3265 |
| 152 | Ga0068853_100066013 | 3300005539 | Bacteria | 3141 |
| 153 | Ga0068853_100114427 | 3300005539 | Bacteria | 2400 |
| 154 | Ga0068853_100239452 | 3300005539 | Bacteria | 1662 |
| 155 | Ga0070693_100050228 | 3300005547 | Bacteria | 2383 |
| 156 | Ga0070693_100067096 | 3300005547 | Bacteria | 2102 |
| 157 | Ga0070693_100112991 | 3300005547 | Bacteria | 1674 |
| 158 | Ga0070665_100000195 | 3300005548 | Bacteria | 106493 |
| 159 | Ga0070665_100020638 | 3300005548 | Bacteria | 6619 |
| 160 | Ga0070665_100032502 | 3300005548 | Bacteria | 5251 |
| 161 | Ga0070665_100042843 | 3300005548 | Bacteria | 4550 |
| 162 | Ga0070665_100046098 | 3300005548 | Bacteria | 4379 |
| 163 | Ga0070665_100051909 | 3300005548 | Bacteria | 4112 |
| 164 | Ga0070665_100221673 | 3300005548 | Bacteria | 1892 |
| 165 | Ga0070665_100458561 | 3300005548 | Bacteria | 1285 |
| 166 | Ga0070704_100261957 | 3300005549 | Bacteria | 1425 |
| 167 | Ga0068855_100022551 | 3300005563 | Bacteria | 7544 |
| 168 | Ga0068855_100083171 | 3300005563 | Bacteria | 3708 |
| 169 | Ga0068855_100142681 | 3300005563 | Bacteria | 2728 |
| 170 | Ga0068855_100260993 | 3300005563 | Bacteria | 1930 |
| 171 | Ga0068855_100349099 | 3300005563 | Bacteria | 1630 |
| 172 | Ga0070664_100043999 | 3300005564 | Bacteria | 3769 |
| 173 | Ga0068857_100044596 | 3300005577 | Bacteria | 3934 |
| 174 | Ga0068857_100068387 | 3300005577 | Bacteria | 3161 |
| 175 | Ga0068857_100171945 | 3300005577 | Bacteria | 1969 |
| 176 | Ga0068857_100222594 | 3300005577 | Bacteria | 1724 |
| 177 | Ga0068854_100027292 | 3300005578 | Bacteria | 3934 |
| 178 | Ga0068854_100062641 | 3300005578 | Bacteria | 2697 |
| 179 | Ga0068854_100192023 | 3300005578 | Bacteria | 1601 |
| 180 | Ga0068856_100039721 | 3300005614 | Bacteria | 4620 |
| 181 | Ga0068856_100040183 | 3300005614 | Bacteria | 4593 |
| 182 | Ga0068856_100050744 | 3300005614 | Bacteria | 4090 |
| 183 | Ga0068856_100107964 | 3300005614 | Bacteria | 2779 |
| 184 | Ga0068852_100038691 | 3300005616 | Bacteria | 4010 |
| 185 | Ga0068852_100104089 | 3300005616 | Bacteria | 2568 |
| 186 | Ga0068852_100530297 | 3300005616 | Bacteria | 1176 |
| 187 | Ga0068859_100164000 | 3300005617 | Bacteria | 2301 |
| 188 | Ga0068859_100191528 | 3300005617 | Bacteria | 2129 |
| 189 | Ga0068859_100754882 | 3300005617 | Bacteria | 1062 |
| 190 | Ga0068864_100011654 | 3300005618 | Bacteria | 7260 |
| 191 | Ga0068864_100123779 | 3300005618 | Bacteria | 2315 |
| 192 | Ga0068861_100090532 | 3300005719 | Bacteria | 2413 |
| 193 | Ga0068861_100193677 | 3300005719 | Bacteria | 1701 |
| 194 | Ga0068861_100376780 | 3300005719 | Bacteria | 1252 |
| 195 | Ga0068851_10003264 | 3300005834 | Bacteria | 7194 |
| 196 | Ga0068851_10086111 | 3300005834 | Bacteria | 1648 |
| 197 | Ga0068870_10004317 | 3300005840 | Bacteria | 6119 |
| 198 | Ga0068863_100055359 | 3300005841 | Bacteria | 3756 |
| 199 | Ga0068863_100172388 | 3300005841 | Bacteria | 2075 |
| 200 | Ga0068863_100190541 | 3300005841 | Bacteria | 1970 |
| 201 | Ga0068863_100260383 | 3300005841 | Bacteria | 1677 |
| 202 | Ga0068863_100374385 | 3300005841 | Bacteria | 1390 |
| 203 | Ga0068858_100092104 | 3300005842 | Bacteria | 2821 |
| 204 | Ga0068860_100000324 | 3300005843 | Bacteria | 64920 |
| 205 | Ga0068860_100107413 | 3300005843 | Bacteria | 2667 |
| 206 | Ga0068860_100176074 | 3300005843 | Bacteria | 2067 |
| 207 | Ga0068862_100152635 | 3300005844 | Bacteria | 2057 |
| 208 | Ga0081455_10015269 | 3300005937 | Bacteria | 7469 |
| 209 | Ga0081455_10038767 | 3300005937 | Bacteria | 4217 |
| 210 | Ga0081455_10044492 | 3300005937 | Bacteria | 3872 |
| 211 | Ga0081455_10137647 | 3300005937 | Bacteria | 1900 |
| 212 | Ga0081455_10232590 | 3300005937 | Bacteria | 1359 |
| 213 | Ga0081538_10001580 | 3300005981 | Bacteria | 23375 |
| 214 | Ga0081538_10016342 | 3300005981 | Bacteria | 5696 |
| 215 | Ga0081540_1000027 | 3300005983 | Bacteria | 151880 |
| 216 | Ga0081540_1001733 | 3300005983 | Bacteria | 18385 |
| 217 | Ga0081540_1007198 | 3300005983 | Bacteria | 7982 |
| 218 | Ga0081540_1011781 | 3300005983 | Bacteria | 5816 |
| 219 | Ga0081540_1018982 | 3300005983 | Bacteria | 4198 |
| 220 | Ga0081540_1021410 | 3300005983 | Bacteria | 3851 |
| 221 | Ga0081540_1021535 | 3300005983 | Bacteria | 3833 |
| 222 | Ga0081540_1023827 | 3300005983 | Bacteria | 3568 |
| 223 | Ga0081540_1030775 | 3300005983 | Bacteria | 2966 |
| 224 | Ga0081539_10000306 | 3300005985 | Bacteria | 110402 |
| 225 | Ga0081539_10001290 | 3300005985 | Bacteria | 44006 |
| 226 | Ga0081539_10035506 | 3300005985 | Bacteria | 2995 |
| 227 | Ga0081539_10036165 | 3300005985 | Bacteria | 2959 |
| 228 | Ga0081539_10065113 | 3300005985 | Bacteria | 1980 |
| 229 | Ga0070717_10000521 | 3300006028 | Bacteria | 24353 |
| 230 | Ga0070717_10002083 | 3300006028 | Bacteria | 14010 |
| 231 | Ga0070717_10063067 | 3300006028 | Bacteria | 3075 |
| 232 | Ga0070717_10174051 | 3300006028 | Bacteria | 1873 |
| 233 | Ga0070717_10266080 | 3300006028 | Bacteria | 1518 |
| 234 | Ga0070717_10280886 | 3300006028 | Bacteria | 1477 |
| 235 | Ga0070717_10571280 | 3300006028 | Bacteria | 1025 |
| 236 | Ga0075365_10001829 | 3300006038 | Bacteria | 9956 |
| 237 | Ga0075365_10001918 | 3300006038 | Bacteria | 9807 |
| 238 | Ga0075365_10057269 | 3300006038 | Bacteria | 2593 |
| 239 | Ga0075365_10063772 | 3300006038 | Bacteria | 2467 |
| 240 | Ga0075365_10064317 | 3300006038 | Bacteria | 2457 |
| 241 | Ga0075365_10112194 | 3300006038 | Bacteria | 1875 |
| 242 | Ga0075368_10044308 | 3300006042 | Bacteria | 1755 |
| 243 | Ga0075363_100005107 | 3300006048 | Bacteria | 5807 |
| 244 | Ga0075363_100111851 | 3300006048 | Bacteria | 1518 |
| 245 | Ga0075364_10011122 | 3300006051 | Bacteria | 5463 |
| 246 | Ga0075364_10015623 | 3300006051 | Bacteria | 4711 |
| 247 | Ga0075364_10134993 | 3300006051 | Bacteria | 1657 |
| 248 | Ga0075364_10247364 | 3300006051 | Bacteria | 1212 |
| 249 | Ga0075432_10001165 | 3300006058 | Bacteria | 8417 |
| 250 | Ga0070715_10033829 | 3300006163 | Bacteria | 2092 |
| 251 | Ga0070715_10034300 | 3300006163 | Bacteria | 2079 |
| 252 | Ga0070715_10057089 | 3300006163 | Bacteria | 1700 |
| 253 | Ga0070716_100142970 | 3300006173 | Bacteria | 1528 |
| 254 | Ga0070712_100000210 | 3300006175 | Bacteria | 32927 |
| 255 | Ga0070712_100006981 | 3300006175 | Bacteria | 7039 |
| 256 | Ga0070712_100076021 | 3300006175 | Bacteria | 2417 |
| 257 | Ga0070712_100082360 | 3300006175 | Bacteria | 2334 |
| 258 | Ga0070712_100129627 | 3300006175 | Bacteria | 1910 |
| 259 | Ga0070712_100243594 | 3300006175 | Bacteria | 1433 |
| 260 | Ga0070712_100369824 | 3300006175 | Bacteria | 1178 |
| 261 | Ga0075362_10063047 | 3300006177 | Bacteria | 1680 |
| 262 | Ga0075362_10085750 | 3300006177 | Bacteria | 1456 |
| 263 | Ga0075362_10166907 | 3300006177 | Bacteria | 1062 |
| 264 | Ga0075367_10016972 | 3300006178 | Bacteria | 3986 |
| 265 | Ga0075367_10025808 | 3300006178 | Bacteria | 3325 |
| 266 | Ga0075367_10031445 | 3300006178 | Bacteria | 3048 |
| 267 | Ga0075367_10033657 | 3300006178 | Bacteria | 2955 |
| 268 | Ga0075367_10049089 | 3300006178 | Bacteria | 2487 |
| 269 | Ga0075367_10097787 | 3300006178 | Bacteria | 1791 |
| 270 | Ga0075369_10112321 | 3300006186 | Bacteria | 1229 |
| 271 | Ga0075366_10064465 | 3300006195 | Bacteria | 2179 |
| 272 | Ga0075366_10097533 | 3300006195 | Bacteria | 1763 |
| 273 | Ga0097621_100092306 | 3300006237 | Bacteria | 2535 |
| 274 | Ga0097621_100255253 | 3300006237 | Bacteria | 1537 |
| 275 | Ga0075370_10007146 | 3300006353 | Bacteria | 5669 |
| 276 | Ga0075370_10044151 | 3300006353 | Bacteria | 2519 |
| 277 | Ga0075370_10149513 | 3300006353 | Bacteria | 1368 |
| 278 | Ga0068871_100113715 | 3300006358 | Bacteria | 2280 |
| 279 | Ga0068871_100521004 | 3300006358 | Bacteria | 1074 |
| 280 | Ga0075428_100458633 | 3300006844 | Bacteria | 1365 |
| 281 | Ga0075430_100004969 | 3300006846 | Bacteria | 11192 |
| 282 | Ga0075430_100009540 | 3300006846 | Bacteria | 8202 |
| 283 | Ga0075430_100219005 | 3300006846 | Bacteria | 1579 |
| 284 | Ga0075430_100236589 | 3300006846 | Bacteria | 1514 |
| 285 | Ga0075431_100318824 | 3300006847 | Bacteria | 1568 |
| 286 | Ga0075429_100232719 | 3300006880 | Bacteria | 1614 |
| 287 | Ga0068865_100108753 | 3300006881 | Bacteria | 2041 |
| 288 | Ga0075436_100074121 | 3300006914 | Bacteria | 2356 |
| 289 | Ga0097620_100164003 | 3300006931 | Bacteria | 2301 |
| 290 | Ga0097620_100191521 | 3300006931 | Bacteria | 2129 |
| 291 | Ga0097620_100754866 | 3300006931 | Bacteria | 1062 |
| 292 | Ga0099824_1023696 | 3300006942 | Bacteria | 3746 |
| 293 | Ga0099822_1001510 | 3300006943 | Bacteria | 27265 |
| 294 | Ga0099823_1020698 | 3300006944 | Bacteria | 6195 |
| 295 | Ga0099795_10008505 | 3300007788 | Bacteria | 2930 |
| 296 | Ga0099795_10031291 | 3300007788 | Bacteria | 1831 |
| 297 | Ga0099795_10063617 | 3300007788 | Bacteria | 1375 |
| 298 | Ga0105250_10031361 | 3300009092 | Bacteria | 2134 |
| 299 | Ga0105240_10013788 | 3300009093 | Bacteria | 11073 |
| 300 | Ga0105240_10016073 | 3300009093 | Bacteria | 10140 |
| 301 | Ga0105240_10079684 | 3300009093 | Bacteria | 4029 |
| 302 | Ga0105240_10175366 | 3300009093 | Bacteria | 2535 |
| 303 | Ga0111539_10380217 | 3300009094 | Bacteria | 1644 |
| 304 | Ga0105245_10004787 | 3300009098 | Bacteria | 11946 |
| 305 | Ga0105245_10084292 | 3300009098 | Bacteria | 2911 |
| 306 | Ga0105245_10232066 | 3300009098 | Bacteria | 1785 |
| 307 | Ga0105245_10368055 | 3300009098 | Bacteria | 1428 |
| 308 | Ga0105247_10003270 | 3300009101 | Bacteria | 10626 |
| 309 | Ga0105247_10022626 | 3300009101 | Bacteria | 3785 |
| 310 | Ga0105247_10257812 | 3300009101 | Bacteria | 1194 |
| 311 | Ga0105247_10294940 | 3300009101 | Bacteria | 1123 |
| 312 | Ga0114129_10035205 | 3300009147 | Bacteria | 7074 |
| 313 | Ga0114129_10060760 | 3300009147 | Bacteria | 5283 |
| 314 | Ga0114129_10157410 | 3300009147 | Bacteria | 3106 |
| 315 | Ga0114129_10427101 | 3300009147 | Bacteria | 1742 |
| 316 | Ga0114129_10473554 | 3300009147 | Bacteria | 1639 |
| 317 | Ga0105243_10033198 | 3300009148 | Bacteria | 3991 |
| 318 | Ga0105243_10037948 | 3300009148 | Bacteria | 3748 |
| 319 | Ga0105243_10047590 | 3300009148 | Bacteria | 3377 |
| 320 | Ga0105243_10158934 | 3300009148 | Bacteria | 1947 |
| 321 | Ga0105243_10260156 | 3300009148 | Bacteria | 1553 |
| 322 | Ga0105241_10001008 | 3300009174 | Bacteria | 21388 |
| 323 | Ga0105241_10001825 | 3300009174 | Bacteria | 16152 |
| 324 | Ga0105242_10315799 | 3300009176 | Bacteria | 1431 |
| 325 | Ga0105248_10025905 | 3300009177 | Bacteria | 6522 |
| 326 | Ga0105237_10013142 | 3300009545 | Bacteria | 8687 |
| 327 | Ga0105237_10015187 | 3300009545 | Bacteria | 8024 |
| 328 | Ga0105237_10157999 | 3300009545 | Bacteria | 2265 |
| 329 | Ga0105237_10205238 | 3300009545 | Bacteria | 1971 |
| 330 | Ga0105237_10216219 | 3300009545 | Bacteria | 1916 |
| 331 | Ga0105237_10765192 | 3300009545 | Bacteria | 972 |
| 332 | Ga0105238_10014477 | 3300009551 | Bacteria | 7976 |
| 333 | Ga0105238_10017578 | 3300009551 | Bacteria | 7271 |
| 334 | Ga0105238_10057485 | 3300009551 | Bacteria | 3900 |
| 335 | Ga0105238_10202290 | 3300009551 | Bacteria | 1962 |
| 336 | Ga0105238_10267982 | 3300009551 | Bacteria | 1688 |
| 337 | Ga0105238_10297722 | 3300009551 | Bacteria | 1597 |
| 338 | Ga0105238_10606520 | 3300009551 | Bacteria | 1103 |
| 339 | Ga0105148_100170 | 3300009978 | Bacteria | 9565 |
| 340 | Ga0099796_10038401 | 3300010159 | Bacteria | 1606 |
| 341 | Ga0099796_10038515 | 3300010159 | Bacteria | 1604 |
| 342 | Ga0099796_10054450 | 3300010159 | Bacteria | 1399 |
| 343 | Ga0099796_10072966 | 3300010159 | Bacteria | 1243 |
| 344 | Ga0105239_10004106 | 3300010375 | Bacteria | 17509 |
| 345 | Ga0105239_10075959 | 3300010375 | Bacteria | 3695 |
| 346 | Ga0105239_10153484 | 3300010375 | Bacteria | 2571 |
| 347 | Ga0105239_10240750 | 3300010375 | Bacteria | 2031 |
| 348 | Ga0105239_10301160 | 3300010375 | Bacteria | 1805 |
| 349 | Ga0105239_10388821 | 3300010375 | Bacteria | 1578 |
| 350 | Ga0105246_10041134 | 3300011119 | Bacteria | 3122 |
| 351 | Ga0105246_10091525 | 3300011119 | Bacteria | 2193 |
| 352 | Ga0157373_10030403 | 3300013100 | Bacteria | 3887 |
| 353 | Ga0157373_10041007 | 3300013100 | Bacteria | 3312 |
| 354 | Ga0157371_10275834 | 3300013102 | Bacteria | 1214 |
| 355 | Ga0157370_10199275 | 3300013104 | Bacteria | 1857 |
| 356 | Ga0157369_10005277 | 3300013105 | Bacteria | 15062 |
| 357 | Ga0157369_10013807 | 3300013105 | Bacteria | 9129 |
| 358 | Ga0157369_10036963 | 3300013105 | Bacteria | 5349 |
| 359 | Ga0171462_1006 | 3300013250 | Bacteria | 432986 |
| 360 | Ga0157374_10003779 | 3300013296 | Bacteria | 12738 |
| 361 | Ga0157374_10083182 | 3300013296 | Bacteria | 3040 |
| 362 | Ga0157374_10095661 | 3300013296 | Bacteria | 2840 |
| 363 | Ga0157378_10088994 | 3300013297 | Bacteria | 2803 |
| 364 | Ga0157378_10398268 | 3300013297 | Bacteria | 1356 |
| 365 | Ga0163162_10027469 | 3300013306 | Bacteria | 5628 |
| 366 | Ga0163162_10032877 | 3300013306 | Bacteria | 5152 |
| 367 | Ga0163162_10051503 | 3300013306 | Bacteria | 4131 |
| 368 | Ga0157372_10026601 | 3300013307 | Bacteria | 6295 |
| 369 | Ga0157372_10125611 | 3300013307 | Bacteria | 2949 |
| 370 | Ga0157372_10136025 | 3300013307 | Bacteria | 2830 |
| 371 | Ga0163163_10055459 | 3300014325 | Bacteria | 3917 |
| 372 | Ga0163163_10121364 | 3300014325 | Bacteria | 2647 |
| 373 | Ga0163163_10531547 | 3300014325 | Bacteria | 1238 |
| 374 | Ga0157380_10059935 | 3300014326 | Bacteria | 3039 |
| 375 | Ga0157380_10197691 | 3300014326 | Bacteria | 1781 |
| 376 | Ga0157379_10145562 | 3300014968 | Bacteria | 2137 |
| 377 | Ga0157379_10206154 | 3300014968 | Bacteria | 1778 |
| 378 | Ga0157379_10309899 | 3300014968 | Bacteria | 1440 |
| 379 | Ga0157376_10075336 | 3300014969 | Bacteria | 2880 |
| 380 | Ga0157376_10125927 | 3300014969 | Bacteria | 2279 |
| 381 | Ga0157376_10126647 | 3300014969 | Bacteria | 2273 |
| 382 | Ga0157376_10698410 | 3300014969 | Bacteria | 1019 |
| 383 | Ga0163161_10233747 | 3300017792 | Bacteria | 1427 |
| 384 | Ga0214544_1000136 | 3300021320 | Bacteria | 107814 |
| 385 | Ga0214542_1000127 | 3300021321 | Bacteria | 107829 |
| 386 | Ga0214545_1000063 | 3300021324 | Bacteria | 107829 |
| 387 | Ga0214543_1000238 | 3300021327 | Bacteria | 84004 |
| 388 | Ga0214543_1041052 | 3300021327 | Bacteria | 1210 |
| 389 | Ga0213874_10001203 | 3300021377 | Bacteria | 5314 |
| 390 | Ga0213874_10003862 | 3300021377 | Bacteria | 3367 |
| 391 | Ga0213876_10000346 | 3300021384 | Bacteria | 40175 |
| 392 | Ga0213876_10024127 | 3300021384 | Bacteria | 3210 |
| 393 | Ga0213876_10037137 | 3300021384 | Bacteria | 2570 |
| 394 | Ga0213876_10053186 | 3300021384 | Bacteria | 2139 |
| 395 | Ga0213875_10000098 | 3300021388 | Bacteria | 98684 |
| 396 | Ga0213875_10000122 | 3300021388 | Bacteria | 87195 |
| 397 | Ga0213875_10018956 | 3300021388 | Bacteria | 3312 |
| 398 | Ga0228598_1001518 | 3300024227 | Bacteria | 5089 |
| 399 | Ga0228598_1023939 | 3300024227 | Bacteria | 1202 |
| 400 | Ga0209147_101667 | 3300025229 | Bacteria | 7306 |
| 401 | Ga0209563_102268 | 3300025230 | Bacteria | 4438 |
| 402 | Ga0209677_100344 | 3300025253 | Bacteria | 29159 |
| 403 | Ga0209677_103699 | 3300025253 | Bacteria | 4798 |
| 404 | Ga0209148_1005097 | 3300025254 | Bacteria | 3076 |
| 405 | Ga0209148_1018454 | 3300025254 | Bacteria | 1171 |
| 406 | Ga0209233_1003337 | 3300025261 | Bacteria | 5683 |
| 407 | Ga0209233_1005247 | 3300025261 | Bacteria | 4320 |
| 408 | Ga0209455_1001850 | 3300025272 | Bacteria | 8855 |
| 409 | Ga0209455_1003980 | 3300025272 | Bacteria | 5010 |
| 410 | Ga0209130_1000343 | 3300025284 | Bacteria | 53596 |
| 411 | Ga0209675_1000025 | 3300025291 | Bacteria | 294102 |
| 412 | Ga0209676_1000238 | 3300025292 | Bacteria | 117732 |
| 413 | Ga0209676_1000571 | 3300025292 | Bacteria | 55434 |
| 414 | Ga0209676_1001500 | 3300025292 | Bacteria | 21339 |
| 415 | Ga0209025_1000008 | 3300025294 | Bacteria | 1130876 |
| 416 | Ga0209025_1000835 | 3300025294 | Bacteria | 48894 |
| 417 | Ga0209025_1024276 | 3300025294 | Bacteria | 3135 |
| 418 | Ga0209564_1000015 | 3300025295 | Bacteria | 615324 |
| 419 | Ga0209564_1004802 | 3300025295 | Bacteria | 8054 |
| 420 | Ga0209758_1000011 | 3300025297 | Bacteria | 1049685 |
| 421 | Ga0209758_1000455 | 3300025297 | Bacteria | 68279 |
| 422 | Ga0209758_1000720 | 3300025297 | Bacteria | 48767 |
| 423 | Ga0209758_1001990 | 3300025297 | Bacteria | 22036 |
| 424 | Ga0209758_1021230 | 3300025297 | Bacteria | 3036 |
| 425 | Ga0209758_1029293 | 3300025297 | Bacteria | 2306 |
| 426 | Ga0209758_1037173 | 3300025297 | Bacteria | 1886 |
| 427 | Ga0209758_1056030 | 3300025297 | Bacteria | 1334 |
| 428 | Ga0209758_1056739 | 3300025297 | Bacteria | 1320 |
| 429 | Ga0209050_1000104 | 3300025298 | Bacteria | 228921 |
| 430 | Ga0209050_1001457 | 3300025298 | Bacteria | 25353 |
| 431 | Ga0209050_1016456 | 3300025298 | Bacteria | 3024 |
| 432 | Ga0209256_1001342 | 3300025299 | Bacteria | 26115 |
| 433 | Ga0209256_1002097 | 3300025299 | Bacteria | 17422 |
| 434 | Ga0207426_1000480 | 3300025302 | Bacteria | 60866 |
| 435 | Ga0207426_1001491 | 3300025302 | Bacteria | 19157 |
| 436 | Ga0207426_1005196 | 3300025302 | Bacteria | 6046 |
| 437 | Ga0207426_1010749 | 3300025302 | Bacteria | 3535 |
| 438 | Ga0209257_1000120 | 3300025304 | Bacteria | 223025 |
| 439 | Ga0209257_1000323 | 3300025304 | Bacteria | 100164 |
| 440 | Ga0209257_1000936 | 3300025304 | Bacteria | 40346 |
| 441 | Ga0209257_1007849 | 3300025304 | Bacteria | 6298 |
| 442 | Ga0207656_10002484 | 3300025321 | Bacteria | 6226 |
| 443 | Ga0207692_10283508 | 3300025898 | Bacteria | 1003 |
| 444 | Ga0207710_10053419 | 3300025900 | Bacteria | 1818 |
| 445 | Ga0207688_10001072 | 3300025901 | Bacteria | 13993 |
| 446 | Ga0207688_10056128 | 3300025901 | Bacteria | 2212 |
| 447 | Ga0207680_10084601 | 3300025903 | Bacteria | 2002 |
| 448 | Ga0207647_10004039 | 3300025904 | Bacteria | 10933 |
| 449 | Ga0207647_10017981 | 3300025904 | Bacteria | 4793 |
| 450 | Ga0207647_10032878 | 3300025904 | Bacteria | 3327 |
| 451 | Ga0207685_10016487 | 3300025905 | Bacteria | 2367 |
| 452 | Ga0207685_10037311 | 3300025905 | Bacteria | 1788 |
| 453 | Ga0207699_10007606 | 3300025906 | Bacteria | 5305 |
| 454 | Ga0207699_10008437 | 3300025906 | Bacteria | 5086 |
| 455 | Ga0207699_10008554 | 3300025906 | Bacteria | 5059 |
| 456 | Ga0207699_10024585 | 3300025906 | Bacteria | 3296 |
| 457 | Ga0207699_10049055 | 3300025906 | Bacteria | 2483 |
| 458 | Ga0207699_10049293 | 3300025906 | Bacteria | 2479 |
| 459 | Ga0207699_10249241 | 3300025906 | Bacteria | 1223 |
| 460 | Ga0207645_10005025 | 3300025907 | Bacteria | 9692 |
| 461 | Ga0207645_10032981 | 3300025907 | Bacteria | 3329 |
| 462 | Ga0207645_10049857 | 3300025907 | Bacteria | 2674 |
| 463 | Ga0207645_10093764 | 3300025907 | Bacteria | 1932 |
| 464 | Ga0207643_10000532 | 3300025908 | Bacteria | 24445 |
| 465 | Ga0207684_10190965 | 3300025910 | Bacteria | 1767 |
| 466 | Ga0207654_10004108 | 3300025911 | Bacteria | 7337 |
| 467 | Ga0207654_10027201 | 3300025911 | Bacteria | 3107 |
| 468 | Ga0207654_10074355 | 3300025911 | Bacteria | 2028 |
| 469 | Ga0207707_10003605 | 3300025912 | Bacteria | 13731 |
| 470 | Ga0207707_10004780 | 3300025912 | Bacteria | 11881 |
| 471 | Ga0207707_10010530 | 3300025912 | Bacteria | 8028 |
| 472 | Ga0207707_10078899 | 3300025912 | Bacteria | 2875 |
| 473 | Ga0207707_10329085 | 3300025912 | Bacteria | 1318 |
| 474 | Ga0207695_10000157 | 3300025913 | Bacteria | 204140 |
| 475 | Ga0207695_10001596 | 3300025913 | Bacteria | 36807 |
| 476 | Ga0207695_10062576 | 3300025913 | Bacteria | 3841 |
| 477 | Ga0207671_10033853 | 3300025914 | Bacteria | 3799 |
| 478 | Ga0207671_10136860 | 3300025914 | Bacteria | 1884 |
| 479 | Ga0207693_10002870 | 3300025915 | Bacteria | 14928 |
| 480 | Ga0207693_10003944 | 3300025915 | Bacteria | 12612 |
| 481 | Ga0207693_10005583 | 3300025915 | Bacteria | 10455 |
| 482 | Ga0207693_10013523 | 3300025915 | Bacteria | 6578 |
| 483 | Ga0207693_10084313 | 3300025915 | Bacteria | 2490 |
| 484 | Ga0207693_10235354 | 3300025915 | Bacteria | 1438 |
| 485 | Ga0207663_10000211 | 3300025916 | Bacteria | 25872 |
| 486 | Ga0207663_10032353 | 3300025916 | Bacteria | 3104 |
| 487 | Ga0207663_10036712 | 3300025916 | Bacteria | 2949 |
| 488 | Ga0207663_10162680 | 3300025916 | Bacteria | 1577 |
| 489 | Ga0207660_10001786 | 3300025917 | Bacteria | 14369 |
| 490 | Ga0207660_10105387 | 3300025917 | Bacteria | 2113 |
| 491 | Ga0207660_10156950 | 3300025917 | Bacteria | 1752 |
| 492 | Ga0207662_10009678 | 3300025918 | Bacteria | 5313 |
| 493 | Ga0207657_10017803 | 3300025919 | Bacteria | 6802 |
| 494 | Ga0207657_10019229 | 3300025919 | Bacteria | 6492 |
| 495 | Ga0207657_10078209 | 3300025919 | Bacteria | 2786 |
| 496 | Ga0207657_10100066 | 3300025919 | Bacteria | 2407 |
| 497 | Ga0207657_10113079 | 3300025919 | Bacteria | 2240 |
| 498 | Ga0207657_10215280 | 3300025919 | Bacteria | 1540 |
| 499 | Ga0207657_10315064 | 3300025919 | Bacteria | 1238 |
| 500 | Ga0207649_10032745 | 3300025920 | Bacteria | 3101 |
| 501 | Ga0207652_10002365 | 3300025921 | Bacteria | 15944 |
| 502 | Ga0207652_10049408 | 3300025921 | Bacteria | 3601 |
| 503 | Ga0207652_10151833 | 3300025921 | Bacteria | 2074 |
| 504 | Ga0207652_10316120 | 3300025921 | Bacteria | 1410 |
| 505 | Ga0207646_10251517 | 3300025922 | Bacteria | 1597 |
| 506 | Ga0207681_10251936 | 3300025923 | Bacteria | 1379 |
| 507 | Ga0207694_10000757 | 3300025924 | Bacteria | 28985 |
| 508 | Ga0207694_10075811 | 3300025924 | Bacteria | 2633 |
| 509 | Ga0207694_10077700 | 3300025924 | Bacteria | 2601 |
| 510 | Ga0207650_10144680 | 3300025925 | Bacteria | 1871 |
| 511 | Ga0207659_10051882 | 3300025926 | Bacteria | 2919 |
| 512 | Ga0207687_10008071 | 3300025927 | Bacteria | 6888 |
| 513 | Ga0207687_10055560 | 3300025927 | Bacteria | 2775 |
| 514 | Ga0207700_10048834 | 3300025928 | Bacteria | 3144 |
| 515 | Ga0207700_10063040 | 3300025928 | Bacteria | 2818 |
| 516 | Ga0207700_10092942 | 3300025928 | Bacteria | 2386 |
| 517 | Ga0207700_10111611 | 3300025928 | Bacteria | 2201 |
| 518 | Ga0207700_10149786 | 3300025928 | Bacteria | 1927 |
| 519 | Ga0207700_10157297 | 3300025928 | Bacteria | 1884 |
| 520 | Ga0207700_10189902 | 3300025928 | Bacteria | 1726 |
| 521 | Ga0207700_10303250 | 3300025928 | Bacteria | 1380 |
| 522 | Ga0207700_10439593 | 3300025928 | Bacteria | 1148 |
| 523 | Ga0207664_10063187 | 3300025929 | Bacteria | 2958 |
| 524 | Ga0207644_10056256 | 3300025931 | Bacteria | 2838 |
| 525 | Ga0207644_10172994 | 3300025931 | Bacteria | 1687 |
| 526 | Ga0207644_10194363 | 3300025931 | Bacteria | 1597 |
| 527 | Ga0207644_10314876 | 3300025931 | Bacteria | 1264 |
| 528 | Ga0207690_10044119 | 3300025932 | Bacteria | 2938 |
| 529 | Ga0207690_10139140 | 3300025932 | Bacteria | 1787 |
| 530 | Ga0207690_10194786 | 3300025932 | Bacteria | 1535 |
| 531 | Ga0207690_10201295 | 3300025932 | Bacteria | 1512 |
| 532 | Ga0207706_10004051 | 3300025933 | Bacteria | 13860 |
| 533 | Ga0207706_10017396 | 3300025933 | Bacteria | 6476 |
| 534 | Ga0207706_10065152 | 3300025933 | Bacteria | 3208 |
| 535 | Ga0207686_10034158 | 3300025934 | Bacteria | 3042 |
| 536 | Ga0207686_10116429 | 3300025934 | Bacteria | 1812 |
| 537 | Ga0207709_10296888 | 3300025935 | Bacteria | 1200 |
| 538 | Ga0207709_10317320 | 3300025935 | Bacteria | 1165 |
| 539 | Ga0207670_10113184 | 3300025936 | Bacteria | 1959 |
| 540 | Ga0207670_10365632 | 3300025936 | Bacteria | 1146 |
| 541 | Ga0207669_10078652 | 3300025937 | Bacteria | 2102 |
| 542 | Ga0207669_10110270 | 3300025937 | Bacteria | 1842 |
| 543 | Ga0207669_10302709 | 3300025937 | Bacteria | 1216 |
| 544 | Ga0207704_10021550 | 3300025938 | Bacteria | 3435 |
| 545 | Ga0207704_10104069 | 3300025938 | Bacteria | 1900 |
| 546 | Ga0207665_10125730 | 3300025939 | Bacteria | 1815 |
| 547 | Ga0207665_10183928 | 3300025939 | Bacteria | 1515 |
| 548 | Ga0207691_10030766 | 3300025940 | Bacteria | 5014 |
| 549 | Ga0207691_10214545 | 3300025940 | Bacteria | 1671 |
| 550 | Ga0207691_10229209 | 3300025940 | Bacteria | 1609 |
| 551 | Ga0207711_10046779 | 3300025941 | Bacteria | 3697 |
| 552 | Ga0207689_10009477 | 3300025942 | Bacteria | 8407 |
| 553 | Ga0207689_10111351 | 3300025942 | Bacteria | 2250 |
| 554 | Ga0207661_10084573 | 3300025944 | Bacteria | 2628 |
| 555 | Ga0207661_10191420 | 3300025944 | Bacteria | 1793 |
| 556 | Ga0207661_10537881 | 3300025944 | Bacteria | 1069 |
| 557 | Ga0207679_10284134 | 3300025945 | Bacteria | 1420 |
| 558 | Ga0207679_10293986 | 3300025945 | Bacteria | 1397 |
| 559 | Ga0207667_10013120 | 3300025949 | Bacteria | 9507 |
| 560 | Ga0207667_10021274 | 3300025949 | Bacteria | 7189 |
| 561 | Ga0207667_10109742 | 3300025949 | Bacteria | 2846 |
| 562 | Ga0207667_10158436 | 3300025949 | Bacteria | 2329 |
| 563 | Ga0207667_10246951 | 3300025949 | Bacteria | 1826 |
| 564 | Ga0207667_10302965 | 3300025949 | Bacteria | 1633 |
| 565 | Ga0207667_10511890 | 3300025949 | Bacteria | 1217 |
| 566 | Ga0207651_10001012 | 3300025960 | Bacteria | 12423 |
| 567 | Ga0207651_10098996 | 3300025960 | Bacteria | 2158 |
| 568 | Ga0207651_10145749 | 3300025960 | Bacteria | 1836 |
| 569 | Ga0207651_10334633 | 3300025960 | Bacteria | 1270 |
| 570 | Ga0207651_10352342 | 3300025960 | Bacteria | 1240 |
| 571 | Ga0207712_10131992 | 3300025961 | Bacteria | 1904 |
| 572 | Ga0207668_10026041 | 3300025972 | Bacteria | 3793 |
| 573 | Ga0207668_10040041 | 3300025972 | Bacteria | 3158 |
| 574 | Ga0207668_10111304 | 3300025972 | Bacteria | 2055 |
| 575 | Ga0207668_10123658 | 3300025972 | Bacteria | 1963 |
| 576 | Ga0207668_10330485 | 3300025972 | Bacteria | 1268 |
| 577 | Ga0207640_10045297 | 3300025981 | Bacteria | 2824 |
| 578 | Ga0207640_10134059 | 3300025981 | Bacteria | 1795 |
| 579 | Ga0207640_10150476 | 3300025981 | Bacteria | 1709 |
| 580 | Ga0207658_10205748 | 3300025986 | Bacteria | 1646 |
| 581 | Ga0207658_10291668 | 3300025986 | Bacteria | 1402 |
| 582 | Ga0207658_10495527 | 3300025986 | Bacteria | 1088 |
| 583 | Ga0207677_10029898 | 3300026023 | Bacteria | 3469 |
| 584 | Ga0207677_10058963 | 3300026023 | Bacteria | 2646 |
| 585 | Ga0207677_10213254 | 3300026023 | Bacteria | 1543 |
| 586 | Ga0207639_10012898 | 3300026041 | Bacteria | 5830 |
| 587 | Ga0207639_10013907 | 3300026041 | Bacteria | 5644 |
| 588 | Ga0207639_10014848 | 3300026041 | Bacteria | 5485 |
| 589 | Ga0207639_10019630 | 3300026041 | Bacteria | 4824 |
| 590 | Ga0207639_10020336 | 3300026041 | Bacteria | 4750 |
| 591 | Ga0207639_10088539 | 3300026041 | Bacteria | 2471 |
| 592 | Ga0207639_10161946 | 3300026041 | Bacteria | 1886 |
| 593 | Ga0207639_10171739 | 3300026041 | Bacteria | 1836 |
| 594 | Ga0207639_10278024 | 3300026041 | Bacteria | 1471 |
| 595 | Ga0207639_10312904 | 3300026041 | Bacteria | 1392 |
| 596 | Ga0207639_10343195 | 3300026041 | Bacteria | 1332 |
| 597 | Ga0207678_10000095 | 3300026067 | Bacteria | 73553 |
| 598 | Ga0207678_10003302 | 3300026067 | Bacteria | 14538 |
| 599 | Ga0207678_10020636 | 3300026067 | Bacteria | 5775 |
| 600 | Ga0207678_10023203 | 3300026067 | Bacteria | 5428 |
| 601 | Ga0207678_10027731 | 3300026067 | Bacteria | 4945 |
| 602 | Ga0207678_10056727 | 3300026067 | Bacteria | 3372 |
| 603 | Ga0207678_10516441 | 3300026067 | Bacteria | 1042 |
| 604 | Ga0207708_10027941 | 3300026075 | Bacteria | 4271 |
| 605 | Ga0207708_10444525 | 3300026075 | Bacteria | 1079 |
| 606 | Ga0207702_10000003 | 3300026078 | Bacteria | 434196 |
| 607 | Ga0207702_10014085 | 3300026078 | Bacteria | 6640 |
| 608 | Ga0207702_10564676 | 3300026078 | Bacteria | 1114 |
| 609 | Ga0207641_10158085 | 3300026088 | Bacteria | 2058 |
| 610 | Ga0207648_10274269 | 3300026089 | Bacteria | 1507 |
| 611 | Ga0207676_10075837 | 3300026095 | Bacteria | 2714 |
| 612 | Ga0207676_10142072 | 3300026095 | Bacteria | 2056 |
| 613 | Ga0207676_10208533 | 3300026095 | Bacteria | 1732 |
| 614 | Ga0207676_10339501 | 3300026095 | Bacteria | 1385 |
| 615 | Ga0207674_10011995 | 3300026116 | Bacteria | 9712 |
| 616 | Ga0207674_10019244 | 3300026116 | Bacteria | 7401 |
| 617 | Ga0207674_10052521 | 3300026116 | Bacteria | 4156 |
| 618 | Ga0207674_10088541 | 3300026116 | Bacteria | 3089 |
| 619 | Ga0207674_10098539 | 3300026116 | Bacteria | 2906 |
| 620 | Ga0207674_10187970 | 3300026116 | Bacteria | 2015 |
| 621 | Ga0207674_10191273 | 3300026116 | Bacteria | 1996 |
| 622 | Ga0207674_10256684 | 3300026116 | Bacteria | 1695 |
| 623 | Ga0207675_100044992 | 3300026118 | Bacteria | 4124 |
| 624 | Ga0207675_100204825 | 3300026118 | Bacteria | 1896 |
| 625 | Ga0207675_100272158 | 3300026118 | Bacteria | 1644 |
| 626 | Ga0207683_10051243 | 3300026121 | Bacteria | 3616 |
| 627 | Ga0207683_10063915 | 3300026121 | Bacteria | 3242 |
| 628 | Ga0207683_10065026 | 3300026121 | Bacteria | 3215 |
| 629 | Ga0207683_10075863 | 3300026121 | Bacteria | 2977 |
| 630 | Ga0207683_10132912 | 3300026121 | Bacteria | 2238 |
| 631 | Ga0207683_10212588 | 3300026121 | Bacteria | 1761 |
| 632 | Ga0207698_10008823 | 3300026142 | Bacteria | 6391 |
| 633 | Ga0207698_10027211 | 3300026142 | Bacteria | 4056 |
| 634 | Ga0207698_10106915 | 3300026142 | Bacteria | 2335 |
| 635 | Ga0207698_10108423 | 3300026142 | Bacteria | 2321 |
| 636 | Ga0207698_10120100 | 3300026142 | Bacteria | 2222 |
| 637 | Ga0207698_10168842 | 3300026142 | Bacteria | 1924 |
| 638 | Ga0207698_10240254 | 3300026142 | Bacteria | 1650 |
| 639 | Ga0209389_1000009 | 3300027296 | Bacteria | 226873 |
| 640 | Ga0209389_1000088 | 3300027296 | Bacteria | 83578 |
| 641 | Ga0209589_1000007 | 3300027357 | Bacteria | 425699 |
| 642 | Ga0209589_1000189 | 3300027357 | Bacteria | 71403 |
| 643 | Ga0209489_100008 | 3300027361 | Bacteria | 425699 |
| 644 | Ga0209489_100050 | 3300027361 | Bacteria | 154669 |
| 645 | Ga0209489_100085 | 3300027361 | Bacteria | 126199 |
| 646 | Ga0209700_100009 | 3300027363 | Bacteria | 425699 |
| 647 | Ga0209700_100016 | 3300027363 | Bacteria | 252567 |
| 648 | Ga0209179_1015550 | 3300027512 | Bacteria | 1415 |
| 649 | Ga0209588_1044110 | 3300027671 | Bacteria | 1442 |
| 650 | Ga0268266_10001710 | 3300028379 | Bacteria | 25123 |
| 651 | Ga0268266_10010017 | 3300028379 | Bacteria | 8318 |
| 652 | Ga0268266_10019820 | 3300028379 | Bacteria | 5731 |
| 653 | Ga0268266_10030342 | 3300028379 | Bacteria | 4593 |
| 654 | Ga0268265_10067985 | 3300028380 | Bacteria | 2760 |
| 655 | Ga0268265_10408757 | 3300028380 | Bacteria | 1257 |
| 656 | Ga0268264_10000038 | 3300028381 | Bacteria | 383623 |
| 657 | Ga0268264_10044034 | 3300028381 | Bacteria | 3701 |
| 658 | Ga0268264_10217737 | 3300028381 | Bacteria | 1756 |
| 659 | Ga0268264_10691708 | 3300028381 | Bacteria | 1012 |
| 660 | Ga0265318_10000046 | 3300028577 | Bacteria | 126568 |
| 661 | Ga0307517_10000512 | 3300028786 | Bacteria | 66501 |
| 662 | Ga0307515_10022025 | 3300028794 | Bacteria | 11255 |
| 663 | Ga0265338_10190710 | 3300028800 | Bacteria | 1554 |
| 664 | Ga0265762_1006912 | 3300030760 | Bacteria | 2027 |
| 665 | Ga0265330_10003886 | 3300031235 | Bacteria | 7683 |
| 666 | Ga0265330_10047336 | 3300031235 | Bacteria | 1893 |
| 667 | Ga0265330_10062964 | 3300031235 | Bacteria | 1612 |
| 668 | Ga0265332_10000839 | 3300031238 | Bacteria | 18678 |
| 669 | Ga0265325_10032340 | 3300031241 | Bacteria | 2793 |
| 670 | Ga0265340_10000382 | 3300031247 | Bacteria | 23632 |
| 671 | Ga0265340_10005741 | 3300031247 | Bacteria | 6857 |
| 672 | Ga0265340_10025504 | 3300031247 | Bacteria | 2993 |
| 673 | Ga0265339_10001051 | 3300031249 | Bacteria | 20994 |
| 674 | Ga0265339_10002691 | 3300031249 | Bacteria | 12639 |
| 675 | Ga0265339_10003487 | 3300031249 | Bacteria | 10996 |
| 676 | Ga0265331_10022264 | 3300031250 | Bacteria | 3235 |
| 677 | Ga0265331_10032490 | 3300031250 | Bacteria | 2586 |
| 678 | Ga0265331_10039516 | 3300031250 | Bacteria | 2300 |
| 679 | Ga0265331_10144471 | 3300031250 | Bacteria | 1081 |
| 680 | Ga0307509_10228195 | 3300031507 | Bacteria | 1668 |
| 681 | Ga0307408_100072109 | 3300031548 | Bacteria | 2556 |
| 682 | Ga0307408_100159116 | 3300031548 | Bacteria | 1792 |
| 683 | Ga0265313_10000024 | 3300031595 | Bacteria | 138587 |
| 684 | Ga0307508_10362640 | 3300031616 | Bacteria | 1040 |
| 685 | Ga0265314_10001759 | 3300031711 | Bacteria | 23380 |
| 686 | Ga0265314_10019173 | 3300031711 | Bacteria | 5305 |
| 687 | Ga0265314_10084820 | 3300031711 | Bacteria | 2079 |
| 688 | Ga0265342_10000179 | 3300031712 | Bacteria | 70615 |
| 689 | Ga0265342_10006885 | 3300031712 | Bacteria | 8400 |
| 690 | Ga0307516_10113504 | 3300031730 | Bacteria | 2508 |
| 691 | Ga0307405_10024417 | 3300031731 | Bacteria | 3453 |
| 692 | Ga0307405_10108479 | 3300031731 | Bacteria | 1876 |
| 693 | Ga0307413_10172951 | 3300031824 | Bacteria | 1531 |
| 694 | Ga0307413_10201728 | 3300031824 | Bacteria | 1437 |
| 695 | Ga0307406_10004247 | 3300031901 | Bacteria | 7797 |
| 696 | Ga0307406_10081169 | 3300031901 | Bacteria | 2155 |
| 697 | Ga0307406_10256942 | 3300031901 | Bacteria | 1319 |
| 698 | Ga0307407_10094299 | 3300031903 | Bacteria | 1842 |
| 699 | Ga0307412_10039929 | 3300031911 | Bacteria | 3033 |
| 700 | Ga0307412_10331127 | 3300031911 | Bacteria | 1215 |
| 701 | Ga0307412_10349352 | 3300031911 | Bacteria | 1187 |
| 702 | Ga0307409_100051758 | 3300031995 | Bacteria | 3144 |
| 703 | Ga0307409_100373028 | 3300031995 | Bacteria | 1354 |
| 704 | Ga0307409_100543160 | 3300031995 | Bacteria | 1139 |
| 705 | Ga0307416_100105994 | 3300032002 | Bacteria | 2462 |
| 706 | Ga0307414_10006076 | 3300032004 | Bacteria | 6698 |
| 707 | Ga0307414_10201129 | 3300032004 | Bacteria | 1620 |
| 708 | Ga0307411_10025647 | 3300032005 | Bacteria | 3536 |
| 709 | Ga0307411_10037015 | 3300032005 | Bacteria | 3064 |
| 710 | Ga0307415_100005649 | 3300032126 | Bacteria | 6661 |
| 711 | Ga0307415_100122163 | 3300032126 | Bacteria | 1955 |
| 712 | Ga0307415_100493549 | 3300032126 | Bacteria | 1069 |
| 713 | Ga0307507_10133866 | 3300033179 | Bacteria | 1928 |
| 714 | Ga0307510_10009742 | 3300033180 | Bacteria | 11434 |
| 715 | Ga0307510_10050764 | 3300033180 | Bacteria | 4396 |
| 716 | Ga0315911_1000004 | 3300033442 | Bacteria | 472637 |
| 717 | Ga0373944_0009011 | 3300035089 | Bacteria | 2698 |
| 718 | Ga0373944_0013282 | 3300035089 | Bacteria | 2282 |
| 719 | Ga0373944_0047494 | 3300035089 | Bacteria | 1345 |
| 720 | Ga0373923_0024351 | 3300035111 | Bacteria | 2388 |
| 721 | Ga0373923_0065895 | 3300035111 | Bacteria | 1547 |
| 722 | Ga0373923_0110406 | 3300035111 | Bacteria | 1221 |
| 723 | Ga0373932_0016637 | 3300035112 | Bacteria | 1879 |
| 724 | Ga0373936_0015883 | 3300035113 | Bacteria | 2889 |
| 725 | Ga0373936_0031865 | 3300035113 | Bacteria | 2083 |
| 726 | Ga0373945_0014901 | 3300035116 | Bacteria | 2610 |
| 727 | Ga0373945_0030108 | 3300035116 | Bacteria | 1911 |
| 728 | Ga0373945_0104221 | 3300035116 | Bacteria | 1113 |
| 729 | Ga0373953_0008522 | 3300035117 | Bacteria | 3487 |
| 730 | Ga0373956_0002426 | 3300035119 | Bacteria | 7599 |
| 731 | Ga0373956_0024994 | 3300035119 | Bacteria | 2579 |
| 732 | Ga0373943_0000755 | 3300035170 | Bacteria | 14106 |
| 733 | Ga0373943_0003068 | 3300035170 | Bacteria | 7590 |
| 734 | Ga0373943_0016037 | 3300035170 | Bacteria | 3412 |
| 735 | Ga0373943_0045194 | 3300035170 | Bacteria | 2145 |
| 736 | Ga0373943_0051417 | 3300035170 | Bacteria | 2028 |
| 737 | Ga0373946_0004314 | 3300035171 | Bacteria | 5083 |
| 738 | Ga0373946_0012162 | 3300035171 | Bacteria | 3218 |
| 739 | Ga0373955_0003015 | 3300035172 | Bacteria | 7380 |
| 740 | Ga0373955_0030906 | 3300035172 | Bacteria | 2801 |
| 741 | Ga0373955_0032541 | 3300035172 | Bacteria | 2738 |
| 742 | Ga0316574_0102778 | 3300035398 | Bacteria | 1829 |
| 743 | Ga0373924_0007778 | 3300035410 | Bacteria | 3876 |
| 744 | Ga0373924_0017111 | 3300035410 | Bacteria | 2777 |
| 745 | Ga0373924_0127105 | 3300035410 | Bacteria | 1108 |
| 746 | Ga0373931_0329918 | 3300035691 | Bacteria | 950 |
| 747 | Ga0373935_0001766 | 3300035692 | Bacteria | 12152 |
| 748 | Ga0373935_0019355 | 3300035692 | Bacteria | 4151 |
| 749 | Ga0373935_0019696 | 3300035692 | Bacteria | 4114 |
| 750 | Ga0373935_0070177 | 3300035692 | Bacteria | 2258 |
| 751 | Ga0373927_0000113 | 3300035695 | Bacteria | 60608 |
| 752 | Ga0373927_0000346 | 3300035695 | Bacteria | 36389 |
| 753 | Ga0373927_0003142 | 3300035695 | Bacteria | 11934 |
| 754 | Ga0373927_0018992 | 3300035695 | Bacteria | 4510 |
| 755 | Ga0373927_0021985 | 3300035695 | Bacteria | 4180 |
| 756 | Ga0373927_0028798 | 3300035695 | Bacteria | 3622 |
| 757 | Ga0373927_0031222 | 3300035695 | Bacteria | 3473 |
| 758 | Ga0373927_0034162 | 3300035695 | Bacteria | 3309 |
| 759 | Ga0373927_0038647 | 3300035695 | Bacteria | 3098 |
| 760 | Ga0373927_0073207 | 3300035695 | Bacteria | 2218 |
| 761 | Ga0373927_0076618 | 3300035695 | Bacteria | 2166 |
| 762 | Ga0373927_0087313 | 3300035695 | Bacteria | 2025 |
| 763 | Ga0373933_0000258 | 3300035724 | Bacteria | 34845 |
| 764 | Ga0373933_0004420 | 3300035724 | Bacteria | 7717 |
| 765 | Ga0373933_0024198 | 3300035724 | Bacteria | 3476 |
| 766 | Ga0373933_0124883 | 3300035724 | Bacteria | 1614 |
| 767 | Ga0373947_0001267 | 3300035725 | Bacteria | 15562 |
| 768 | Ga0373947_0002417 | 3300035725 | Bacteria | 11265 |
| 769 | Ga0373947_0036794 | 3300035725 | Bacteria | 2903 |
| 770 | Ga0373947_0066104 | 3300035725 | Bacteria | 2206 |
| 771 | Ga0373947_0121693 | 3300035725 | Bacteria | 1658 |
| 772 | Ga0373937_0023839 | 3300036401 | Bacteria | 5517 |
| 773 | Ga0373937_0038979 | 3300036401 | Bacteria | 4329 |
| 774 | Ga0373937_0049868 | 3300036401 | Bacteria | 3833 |
| 775 | Ga0373937_0140279 | 3300036401 | Bacteria | 2261 |
| 776 | Ga0373937_0486385 | 3300036401 | Bacteria | 1172 |
| 777 | Ga0373925_0001404 | 3300037068 | Bacteria | 20938 |
| 778 | Ga0373925_0004601 | 3300037068 | Bacteria | 10423 |
| 779 | Ga0373925_0020265 | 3300037068 | Bacteria | 4839 |
| 780 | Ga0373925_0030842 | 3300037068 | Bacteria | 3937 |
| 781 | Ga0373925_0055678 | 3300037068 | Bacteria | 2961 |
| 782 | Ga0373925_0061215 | 3300037068 | Bacteria | 2827 |
| 783 | Ga0373925_0123671 | 3300037068 | Bacteria | 2011 |
| 784 | Ga0373925_0366525 | 3300037068 | Bacteria | 1172 |
| 785 | Ga0373925_0447654 | 3300037068 | Bacteria | 1057 |
| 786 | Ga0395899_0017832 | 3300037312 | Bacteria | 5405 |
| 787 | Ga0395899_0019536 | 3300037312 | Bacteria | 5146 |
| 788 | Ga0395899_0069735 | 3300037312 | Bacteria | 2574 |
| 789 | Ga0395899_0079770 | 3300037312 | Bacteria | 2384 |
| 790 | Ga0395900_0000134 | 3300037418 | Bacteria | 124444 |
| 791 | Ga0395900_0065161 | 3300037418 | Bacteria | 3742 |
| 792 | Ga0395900_0140876 | 3300037418 | Bacteria | 2469 |
| 793 | Ga0395900_0302164 | 3300037418 | Bacteria | 1586 |
| 794 | Ga0395898_0037354 | 3300037466 | Bacteria | 4819 |
| 795 | Ga0395898_0087335 | 3300037466 | Bacteria | 3004 |
| 796 | Ga0395905_0000123 | 3300037471 | Bacteria | 127888 |
| 797 | Ga0395905_0013864 | 3300037471 | Bacteria | 7711 |
| 798 | Ga0436364_0235209 | 3300037853 | Bacteria | 1582 |
| 799 | Ga0436364_0423755 | 3300037853 | Bacteria | 87339 |
| 800 | Ga0436364_0838358 | 3300037853 | Bacteria | 1233 |
| 801 | Ga0436364_1139859 | 3300037853 | Bacteria | 6995 |
| 802 | Ga0436364_1390920 | 3300037853 | Bacteria | 113944 |
| 803 | Ga0395901_0000880 | 3300038443 | Bacteria | 33025 |
| 804 | Ga0395901_0013321 | 3300038443 | Bacteria | 8353 |
| 805 | Ga0395901_0081261 | 3300038443 | Bacteria | 3385 |
| 806 | Ga0395901_0084968 | 3300038443 | Bacteria | 3308 |
| 807 | Ga0395901_0086295 | 3300038443 | Bacteria | 3281 |
| 808 | Ga0395901_0362943 | 3300038443 | Bacteria | 1493 |
| 809 | Ga0400483_063769 | 3300039062 | Bacteria | 35431 |
| 810 | Ga0436365_0012938 | 3300039437 | Bacteria | 927 |
| 811 | Ga0436365_0061308 | 3300039437 | Bacteria | 1478 |
| 812 | Ga0436365_0076921 | 3300039437 | Bacteria | 40502 |
| 813 | Ga0436365_0293736 | 3300039437 | Bacteria | 2240 |
| 814 | Ga0436365_0481444 | 3300039437 | Bacteria | 17117 |
| 815 | Ga0436365_0731168 | 3300039437 | Bacteria | 5585 |
| 816 | Ga0436365_0741042 | 3300039437 | Bacteria | 3633 |
| 817 | Ga0436365_0768275 | 3300039437 | Bacteria | 19205 |
| 818 | Ga0436365_0798167 | 3300039437 | Bacteria | 89850 |
| 819 | Ga0436365_1102823 | 3300039437 | Bacteria | 1362 |
| 820 | Ga0436365_1160728 | 3300039437 | Bacteria | 3509 |
| 821 | Ga0436365_1523930 | 3300039437 | Bacteria | 2477 |
| 822 | Ga0436365_1710304 | 3300039437 | Bacteria | 4348 |
| 823 | Ga0436360_0938879 | 3300039438 | Bacteria | 4192 |
| 824 | Ga0436360_1120596 | 3300039438 | Bacteria | 2534 |
| 825 | Ga0436361_0208634 | 3300039447 | Bacteria | 4022 |
| 826 | Ga0436361_0904010 | 3300039447 | Bacteria | 3674 |
| 827 | Ga0436361_1104477 | 3300039447 | Bacteria | 5204 |
| 828 | Ga0436363_1401795 | 3300039450 | Bacteria | 17008 |
| 829 | Ga0436363_1471097 | 3300039450 | Bacteria | 7386 |
| 830 | Ga0436362_0088818 | 3300039453 | Bacteria | 8797 |
| 831 | Ga0436362_0429757 | 3300039453 | Bacteria | 6386 |
| 832 | Ga0436362_1218894 | 3300039453 | Bacteria | 1670 |
| 833 | Ga0436362_1265935 | 3300039453 | Bacteria | 4789 |
| 834 | Ga0451793_0652808 | 3300041452 | Bacteria | 1887 |
| 835 | Ga0439441_022654 | 3300042001 | Bacteria | 1169 |
| 836 | Ga0439440_0030274 | 3300042993 | Bacteria | 1274 |
| 837 | Ga0466969_0063638 | 3300044656 | Bacteria | 1787 |
| 838 | Ga0466972_0001603 | 3300044658 | Bacteria | 11060 |
| 839 | Ga0466966_0005030 | 3300044684 | Bacteria | 8695 |
| 840 | Ga0466966_0075035 | 3300044684 | Bacteria | 2113 |
| 841 | Ga0466961_0000060 | 3300044693 | Bacteria | 65360 |
| 842 | Ga0466963_0020642 | 3300044694 | Bacteria | 4143 |
| 843 | Ga0466964_0026242 | 3300044706 | Bacteria | 2280 |
| 844 | Ga0466964_0065741 | 3300044706 | Bacteria | 1520 |
| 845 | Ga0453684_1261641 | 3300044712 | Bacteria | 773 |
| 846 | Ga0466971_0141290 | 3300044719 | Bacteria | 1121 |
| 847 | Ga0466957_0010425 | 3300044842 | Bacteria | 5336 |
| 848 | Ga0466957_0038885 | 3300044842 | Bacteria | 2869 |
| 849 | Ga0466959_0001866 | 3300045049 | Bacteria | 13243 |
| 850 | Ga0466967_0002368 | 3300045976 | Bacteria | 11671 |
| 851 | Ga0466967_0235265 | 3300045976 | Bacteria | 1745 |
| 852 | Ga0495617_051104 | 3300046452 | Bacteria | 1374 |
| 853 | Ga0495592_0003878 | 3300046454 | Bacteria | 10821 |
| 854 | Ga0495592_0006304 | 3300046454 | Bacteria | 8827 |
| 855 | Ga0495592_0034880 | 3300046454 | Bacteria | 3791 |
| 856 | Ga0495603_0000092 | 3300046455 | Bacteria | 40980 |
| 857 | Ga0495603_0031557 | 3300046455 | Bacteria | 3190 |
| 858 | Ga0495603_0035014 | 3300046455 | Bacteria | 3017 |
| 859 | Ga0495603_0120014 | 3300046455 | Bacteria | 1532 |
| 860 | Ga0495603_0323701 | 3300046455 | Bacteria | 885 |
| 861 | Ga0495629_0000181 | 3300046459 | Bacteria | 56739 |
| 862 | Ga0495629_0020090 | 3300046459 | Bacteria | 4769 |
| 863 | Ga0495629_0062627 | 3300046459 | Bacteria | 2598 |
| 864 | Ga0495629_0159207 | 3300046459 | Bacteria | 1568 |
| 865 | Ga0495638_0009594 | 3300046460 | Bacteria | 6776 |
| 866 | Ga0495641_0001499 | 3300046461 | Bacteria | 19900 |
| 867 | Ga0495651_0025351 | 3300046462 | Bacteria | 4615 |
| 868 | Ga0495651_0043114 | 3300046462 | Bacteria | 3501 |
| 869 | Ga0495651_0124654 | 3300046462 | Bacteria | 1887 |
| 870 | Ga0495651_0132580 | 3300046462 | Bacteria | 1817 |
| 871 | Ga0495651_0182590 | 3300046462 | Bacteria | 1484 |
| 872 | Ga0495653_0018848 | 3300046463 | Bacteria | 5599 |
| 873 | Ga0495653_0031775 | 3300046463 | Bacteria | 4195 |
| 874 | Ga0495653_0064907 | 3300046463 | Bacteria | 2750 |
| 875 | Ga0495653_0113252 | 3300046463 | Bacteria | 1946 |
| 876 | Ga0495650_0045002 | 3300046471 | Bacteria | 1861 |
| 877 | Ga0495580_0001467 | 3300046472 | Bacteria | 20684 |
| 878 | Ga0495580_0007886 | 3300046472 | Bacteria | 8520 |
| 879 | Ga0495580_0063846 | 3300046472 | Bacteria | 2582 |
| 880 | Ga0495580_0240952 | 3300046472 | Bacteria | 1240 |
| 881 | Ga0495580_0368284 | 3300046472 | Bacteria | 972 |
| 882 | Ga0495582_0000039 | 3300046473 | Bacteria | 66883 |
| 883 | Ga0495582_0131633 | 3300046473 | Bacteria | 1413 |
| 884 | Ga0495605_0061747 | 3300046474 | Bacteria | 1792 |
| 885 | Ga0495639_0000489 | 3300046475 | Bacteria | 18815 |
| 886 | Ga0495639_0049551 | 3300046475 | Bacteria | 1906 |
| 887 | Ga0495662_0000223 | 3300046476 | Bacteria | 23829 |
| 888 | Ga0495662_0000343 | 3300046476 | Bacteria | 20338 |
| 889 | Ga0495664_0000800 | 3300046477 | Bacteria | 16088 |
| 890 | Ga0495664_0002664 | 3300046477 | Bacteria | 9612 |
| 891 | Ga0495664_0015258 | 3300046477 | Bacteria | 4365 |
| 892 | Ga0495664_0063746 | 3300046477 | Bacteria | 2196 |
| 893 | Ga0495584_0079078 | 3300046491 | Bacteria | 1654 |
| 894 | Ga0495584_0114570 | 3300046491 | Bacteria | 1364 |
| 895 | Ga0495585_0081330 | 3300046492 | Bacteria | 1755 |
| 896 | Ga0495585_0091525 | 3300046492 | Bacteria | 1637 |
| 897 | Ga0495594_0000619 | 3300046499 | Bacteria | 18269 |
| 898 | Ga0495596_0073887 | 3300046500 | Bacteria | 1324 |
| 899 | Ga0495607_0132886 | 3300046501 | Bacteria | 1293 |
| 900 | Ga0495583_0077489 | 3300046506 | Bacteria | 1450 |
| 901 | Ga0495606_0003208 | 3300046507 | Bacteria | 17626 |
| 902 | Ga0495606_0103057 | 3300046507 | Bacteria | 1734 |
| 903 | Ga0495606_0105250 | 3300046507 | Bacteria | 1710 |
| 904 | Ga0495608_0000398 | 3300046511 | Bacteria | 30359 |
| 905 | Ga0495610_0054926 | 3300046512 | Bacteria | 1922 |
| 906 | Ga0495618_0005331 | 3300046514 | Bacteria | 7846 |
| 907 | Ga0495618_0152608 | 3300046514 | Bacteria | 1475 |
| 908 | Ga0495618_0215734 | 3300046514 | Bacteria | 1212 |
| 909 | Ga0495618_0223287 | 3300046514 | Bacteria | 1188 |
| 910 | Ga0495628_0046997 | 3300046516 | Bacteria | 3426 |
| 911 | Ga0495628_0056656 | 3300046516 | Bacteria | 3084 |
| 912 | Ga0495628_0073295 | 3300046516 | Bacteria | 2668 |
| 913 | Ga0495628_0173442 | 3300046516 | Bacteria | 1634 |
| 914 | Ga0495630_0001653 | 3300046517 | Bacteria | 15507 |
| 915 | Ga0495630_0006103 | 3300046517 | Bacteria | 8540 |
| 916 | Ga0495630_0037785 | 3300046517 | Bacteria | 3610 |
| 917 | Ga0495630_0209914 | 3300046517 | Bacteria | 1486 |
| 918 | Ga0495632_0000075 | 3300046519 | Bacteria | 102051 |
| 919 | Ga0495632_0023362 | 3300046519 | Bacteria | 3302 |
| 920 | Ga0495637_0006157 | 3300046520 | Bacteria | 6036 |
| 921 | Ga0495643_0000009 | 3300046522 | Bacteria | 344767 |
| 922 | Ga0495643_0032803 | 3300046522 | Bacteria | 2879 |
| 923 | Ga0495644_0029123 | 3300046523 | Bacteria | 2087 |
| 924 | Ga0495644_0037512 | 3300046523 | Bacteria | 1829 |
| 925 | Ga0495648_0000032 | 3300046524 | Bacteria | 205970 |
| 926 | Ga0495648_0002686 | 3300046524 | Bacteria | 16072 |
| 927 | Ga0495648_0134859 | 3300046524 | Bacteria | 1307 |
| 928 | Ga0495663_0000003 | 3300046525 | Bacteria | 362694 |
| 929 | Ga0495666_0003729 | 3300046526 | Bacteria | 7699 |
| 930 | Ga0495666_0034265 | 3300046526 | Bacteria | 2478 |
| 931 | Ga0495666_0053055 | 3300046526 | Bacteria | 1947 |
| 932 | Ga0495652_0064544 | 3300046529 | Bacteria | 3079 |
| 933 | Ga0495652_0074129 | 3300046529 | Bacteria | 2831 |
| 934 | Ga0495652_0117068 | 3300046529 | Bacteria | 2132 |
| 935 | Ga0495652_0177613 | 3300046529 | Bacteria | 1637 |
| 936 | Ga0495652_0203878 | 3300046529 | Bacteria | 1499 |
| 937 | Ga0495654_0070152 | 3300046530 | Bacteria | 1662 |
| 938 | Ga0495665_0000079 | 3300046531 | Bacteria | 42321 |
| 939 | Ga0495665_0020095 | 3300046531 | Bacteria | 3588 |
| 940 | Ga0495665_0163905 | 3300046531 | Bacteria | 1158 |
| 941 | Ga0495640_0000544 | 3300046533 | Bacteria | 27687 |
| 942 | Ga0495640_0003085 | 3300046533 | Bacteria | 13431 |
| 943 | Ga0495640_0009778 | 3300046533 | Bacteria | 7451 |
| 944 | Ga0495640_0036273 | 3300046533 | Bacteria | 3484 |
| 945 | Ga0495640_0057977 | 3300046533 | Bacteria | 2642 |
| 946 | Ga0495640_0099925 | 3300046533 | Bacteria | 1906 |
| 947 | Ga0495586_0097140 | 3300046535 | Bacteria | 1632 |
| 948 | Ga0495587_0000599 | 3300046536 | Bacteria | 24689 |
| 949 | Ga0495587_0041927 | 3300046536 | Bacteria | 2731 |
| 950 | Ga0495598_0006329 | 3300046537 | Bacteria | 2671 |
| 951 | Ga0495609_0085810 | 3300046538 | Bacteria | 1373 |
| 952 | Ga0495609_0086862 | 3300046538 | Bacteria | 1363 |
| 953 | Ga0495621_0013233 | 3300046539 | Bacteria | 2589 |
| 954 | Ga0495645_0002211 | 3300046543 | Bacteria | 13235 |
| 955 | Ga0495645_0026193 | 3300046543 | Bacteria | 4232 |
| 956 | Ga0495645_0026869 | 3300046543 | Bacteria | 4180 |
| 957 | Ga0495645_0100441 | 3300046543 | Bacteria | 2058 |
| 958 | Ga0495622_0000987 | 3300046557 | Bacteria | 15239 |
| 959 | Ga0495622_0042359 | 3300046557 | Bacteria | 2116 |
| 960 | Ga0495633_0000102 | 3300046558 | Bacteria | 115655 |
| 961 | Ga0495633_0000786 | 3300046558 | Bacteria | 28391 |
| 962 | Ga0495633_0079091 | 3300046558 | Bacteria | 1531 |
| 963 | Ga0495667_0006293 | 3300046559 | Bacteria | 8054 |
| 964 | Ga0495667_0032424 | 3300046559 | Bacteria | 3502 |
| 965 | Ga0495667_0043859 | 3300046559 | Bacteria | 2963 |
| 966 | Ga0495667_0056782 | 3300046559 | Bacteria | 2574 |
| 967 | Ga0495656_0016225 | 3300046615 | Bacteria | 2824 |
| 968 | Ga0495656_0060648 | 3300046615 | Bacteria | 1649 |
| 969 | Ga0495656_0078564 | 3300046615 | Bacteria | 1483 |
| 970 | Ga0495656_0090968 | 3300046615 | Bacteria | 1395 |
| 971 | Ga0495668_0000001 | 3300046616 | Bacteria | 1013420 |
| 972 | Ga0495668_0046640 | 3300046616 | Bacteria | 2407 |
| 973 | Ga0495668_0230353 | 3300046616 | Bacteria | 1014 |
| 974 | Ga0495634_0004026 | 3300046642 | Bacteria | 11657 |
| 975 | Ga0495634_0007670 | 3300046642 | Bacteria | 8079 |
| 976 | Ga0495634_0017214 | 3300046642 | Bacteria | 5161 |
| 977 | Ga0495634_0089976 | 3300046642 | Bacteria | 1994 |
| 978 | Ga0495634_0122922 | 3300046642 | Bacteria | 1661 |
| 979 | Ga0495634_0124835 | 3300046642 | Bacteria | 1646 |
| 980 | Ga0495611_0058626 | 3300046648 | Bacteria | 1746 |
| 981 | Ga0495611_0063062 | 3300046648 | Bacteria | 1686 |
| 982 | Ga0495611_0125309 | 3300046648 | Bacteria | 1198 |
| 983 | Ga0495625_0000751 | 3300046660 | Bacteria | 45255 |
| 984 | Ga0495635_0004288 | 3300046663 | Bacteria | 9872 |
| 985 | Ga0495635_0006922 | 3300046663 | Bacteria | 7920 |
| 986 | Ga0495635_0051635 | 3300046663 | Bacteria | 2832 |
| 987 | Ga0495635_0173248 | 3300046663 | Bacteria | 1467 |
| 988 | Ga0495659_0029756 | 3300046664 | Bacteria | 1897 |
| 989 | Ga0495588_0023653 | 3300046674 | Bacteria | 3044 |
| 990 | Ga0495657_0014016 | 3300046675 | Bacteria | 5889 |
| 991 | Ga0495657_0103148 | 3300046675 | Bacteria | 1815 |
| 992 | Ga0495657_0150578 | 3300046675 | Bacteria | 1445 |
| 993 | Ga0495599_0005233 | 3300046678 | Bacteria | 7740 |
| 994 | Ga0495599_0012657 | 3300046678 | Bacteria | 5203 |
| 995 | Ga0495599_0039924 | 3300046678 | Bacteria | 2949 |
| 996 | Ga0495599_0061226 | 3300046678 | Bacteria | 2352 |
| 997 | Ga0495623_0006342 | 3300046679 | Bacteria | 7687 |
| 998 | Ga0495646_0038525 | 3300046680 | Bacteria | 2951 |
| 999 | Ga0495647_0000562 | 3300046681 | Bacteria | 10934 |
| 1000 | Ga0495647_0029527 | 3300046681 | Bacteria | 2028 |
| 1001 | Ga0495658_0000733 | 3300046683 | Bacteria | 17682 |
| 1002 | Ga0495658_0001039 | 3300046683 | Bacteria | 14680 |
| 1003 | Ga0495658_0154370 | 3300046683 | Bacteria | 1412 |
| 1004 | Ga0495658_0156532 | 3300046683 | Bacteria | 1403 |
| 1005 | Ga0495669_0012302 | 3300046684 | Bacteria | 3641 |
| 1006 | Ga0495669_0033891 | 3300046684 | Bacteria | 2250 |
| 1007 | Ga0495669_0081198 | 3300046684 | Bacteria | 1488 |
| 1008 | Ga0495613_0000543 | 3300046689 | Bacteria | 31253 |
| 1009 | Ga0495613_0044732 | 3300046689 | Bacteria | 3274 |
| 1010 | Ga0495624_0006648 | 3300046690 | Bacteria | 8175 |
| 1011 | Ga0495624_0048239 | 3300046690 | Bacteria | 2703 |
| 1012 | Ga0495624_0052513 | 3300046690 | Bacteria | 2575 |
| 1013 | Ga0495624_0068223 | 3300046690 | Bacteria | 2217 |
| 1014 | Ga0495670_0085783 | 3300046691 | Bacteria | 1607 |
| 1015 | Ga0495671_0000013 | 3300046692 | Bacteria | 344767 |
| 1016 | Ga0495649_0065369 | 3300046694 | Bacteria | 1952 |
| 1017 | Ga0495600_0001478 | 3300046809 | Bacteria | 13016 |
| 1018 | Ga0495581_0000024 | 3300047315 | Bacteria | 55574 |
| 1019 | Ga0495581_0004287 | 3300047315 | Bacteria | 8231 |
| 1020 | Ga0495604_0014602 | 3300047317 | Bacteria | 6259 |
| 1021 | Ga0495604_0017775 | 3300047317 | Bacteria | 5689 |
| 1022 | Ga0495604_0108363 | 3300047317 | Bacteria | 2029 |
| 1023 | Ga0495604_0385595 | 3300047317 | Bacteria | 925 |
| 1024 | Ga0495674_0001161 | 3300047319 | Bacteria | 25370 |
| 1025 | Ga0495674_0045284 | 3300047319 | Bacteria | 3906 |
| 1026 | Ga0495674_0197545 | 3300047319 | Bacteria | 1670 |
| 1027 | Ga0495672_0017804 | 3300047320 | Bacteria | 4740 |
| 1028 | Ga0495672_0114140 | 3300047320 | Bacteria | 1446 |
| 1029 | Ga0495676_0040839 | 3300047321 | Bacteria | 3825 |
| 1030 | Ga0495676_0056510 | 3300047321 | Bacteria | 3103 |
| 1031 | Ga0495676_0154833 | 3300047321 | Bacteria | 1627 |
| 1032 | Ga0495680_0000313 | 3300047322 | Bacteria | 54486 |
| 1033 | Ga0495680_0008182 | 3300047322 | Bacteria | 9536 |
| 1034 | Ga0495675_0058711 | 3300047444 | Bacteria | 2439 |
| 1035 | Ga0495675_0061217 | 3300047444 | Bacteria | 2385 |
| 1036 | Ga0495673_0020913 | 3300047469 | Bacteria | 3246 |
| 1037 | Ga0495673_0048974 | 3300047469 | Bacteria | 1861 |
| 1038 | Ga0495673_0109692 | 3300047469 | Bacteria | 1105 |
| 1039 | Ga0495681_0000202 | 3300047470 | Bacteria | 49721 |
| 1040 | Ga0495681_0068429 | 3300047470 | Bacteria | 1616 |
| 1041 | Ga0495684_0000845 | 3300047471 | Bacteria | 24740 |
| 1042 | Ga0495684_0003192 | 3300047471 | Bacteria | 12855 |
| 1043 | Ga0495684_0009222 | 3300047471 | Bacteria | 7619 |
| 1044 | Ga0495684_0010217 | 3300047471 | Bacteria | 7261 |
| 1045 | Ga0495684_0025703 | 3300047471 | Bacteria | 4524 |
| 1046 | Ga0495684_0123972 | 3300047471 | Bacteria | 1944 |
| 1047 | Ga0495684_0257886 | 3300047471 | Bacteria | 1266 |
| 1048 | Ga0495686_0043890 | 3300047472 | Bacteria | 2832 |
| 1049 | Ga0495593_0000019 | 3300047673 | Bacteria | 74042 |
| 1050 | Ga0495593_0011906 | 3300047673 | Bacteria | 4988 |
| 1051 | Ga0495593_0037204 | 3300047673 | Bacteria | 2634 |
| 1052 | Ga0495602_0059824 | 3300048088 | Bacteria | 3323 |
| 1053 | Ga0495602_0068416 | 3300048088 | Bacteria | 3049 |
| 1054 | Ga0495602_0246993 | 3300048088 | Bacteria | 1332 |
| 1055 | Ga0495614_0003524 | 3300048089 | Bacteria | 7011 |
| 1056 | Ga0495615_0000085 | 3300048090 | Bacteria | 27694 |
| 1057 | Ga0496100_0008443 | 3300048903 | Bacteria | 5744 |
| 1058 | Ga0496100_0015869 | 3300048903 | Bacteria | 4409 |
| 1059 | Ga0496100_0020444 | 3300048903 | Bacteria | 3969 |
| 1060 | Ga0496101_0001983 | 3300048904 | Bacteria | 12419 |
| 1061 | Ga0496101_0004532 | 3300048904 | Bacteria | 8770 |
| 1062 | Ga0496101_0141383 | 3300048904 | Bacteria | 1835 |
| 1063 | Ga0496102_0009611 | 3300048905 | Bacteria | 8317 |
| 1064 | Ga0496102_0110103 | 3300048905 | Bacteria | 2567 |
| 1065 | Ga0496102_0159788 | 3300048905 | Bacteria | 2119 |
| 1066 | Ga0496102_0180446 | 3300048905 | Bacteria | 1989 |
| 1067 | Ga0496102_0272046 | 3300048905 | Bacteria | 1597 |
| 1068 | Ga0496103_0013950 | 3300048906 | Bacteria | 4770 |
| 1069 | Ga0496104_0007514 | 3300048907 | Bacteria | 9635 |
| 1070 | Ga0496104_0009587 | 3300048907 | Bacteria | 8619 |
| 1071 | Ga0496104_0014513 | 3300048907 | Bacteria | 7116 |
| 1072 | Ga0496104_0014678 | 3300048907 | Bacteria | 7076 |
| 1073 | Ga0496104_0018299 | 3300048907 | Bacteria | 6392 |
| 1074 | Ga0496104_0025914 | 3300048907 | Bacteria | 5407 |
| 1075 | Ga0496105_0002708 | 3300048908 | Bacteria | 12919 |
| 1076 | Ga0496105_0159538 | 3300048908 | Bacteria | 1852 |
| 1077 | Ga0496105_0315551 | 3300048908 | Bacteria | 1254 |
| 1078 | Ga0496105_0337501 | 3300048908 | Bacteria | 1205 |
| 1079 | Ga0496106_0000634 | 3300048909 | Bacteria | 25214 |
| 1080 | Ga0496106_0006039 | 3300048909 | Bacteria | 8965 |
| 1081 | Ga0496106_0080469 | 3300048909 | Bacteria | 2502 |
| 1082 | Ga0496106_0145610 | 3300048909 | Bacteria | 1866 |
| 1083 | Ga0496106_0267991 | 3300048909 | Bacteria | 1367 |
| 1084 | Ga0496106_0276121 | 3300048909 | Bacteria | 1346 |
| 1085 | Ga0496106_0317929 | 3300048909 | Bacteria | 1249 |
| 1086 | Ga0496107_0002095 | 3300048910 | Bacteria | 12782 |
| 1087 | Ga0496107_0009028 | 3300048910 | Bacteria | 6913 |
| 1088 | Ga0496107_0019014 | 3300048910 | Bacteria | 4844 |
| 1089 | Ga0496108_0001003 | 3300048911 | Bacteria | 22020 |
| 1090 | Ga0496108_0009284 | 3300048911 | Bacteria | 7960 |
| 1091 | Ga0496108_0033687 | 3300048911 | Bacteria | 4255 |
| 1092 | Ga0496108_0110277 | 3300048911 | Bacteria | 2352 |
| 1093 | Ga0496108_0118090 | 3300048911 | Bacteria | 2273 |
| 1094 | Ga0496108_0134259 | 3300048911 | Bacteria | 2128 |
| 1095 | Ga0496108_0287562 | 3300048911 | Bacteria | 1431 |
| 1096 | Ga0496109_0000166 | 3300048912 | Bacteria | 64848 |
| 1097 | Ga0496109_0046847 | 3300048912 | Bacteria | 3928 |
| 1098 | Ga0496109_0057575 | 3300048912 | Bacteria | 3548 |
| 1099 | Ga0496109_0072226 | 3300048912 | Bacteria | 3169 |
| 1100 | Ga0496109_0195085 | 3300048912 | Bacteria | 1903 |
| 1101 | Ga0496109_0272144 | 3300048912 | Bacteria | 1596 |
| 1102 | Ga0496110_0012878 | 3300048913 | Bacteria | 6894 |
| 1103 | Ga0496110_0081141 | 3300048913 | Bacteria | 2891 |
| 1104 | Ga0496110_0103214 | 3300048913 | Bacteria | 2557 |
| 1105 | Ga0496110_0106657 | 3300048913 | Bacteria | 2514 |
| 1106 | Ga0496110_0132270 | 3300048913 | Bacteria | 2253 |
| 1107 | Ga0496110_0142547 | 3300048913 | Bacteria | 2166 |
| 1108 | Ga0496110_0212338 | 3300048913 | Bacteria | 1759 |
| 1109 | Ga0496111_0059949 | 3300048914 | Bacteria | 2758 |
| 1110 | Ga0496111_0063517 | 3300048914 | Bacteria | 2678 |
| 1111 | Ga0496111_0081065 | 3300048914 | Bacteria | 2368 |
| 1112 | Ga0496111_0094947 | 3300048914 | Bacteria | 2187 |
| 1113 | Ga0496111_0111787 | 3300048914 | Bacteria | 2012 |
| 1114 | Ga0496112_0000142 | 3300048915 | Bacteria | 44742 |
| 1115 | Ga0496112_0000358 | 3300048915 | Bacteria | 29716 |
| 1116 | Ga0496112_0007378 | 3300048915 | Bacteria | 9759 |
| 1117 | Ga0496112_0009986 | 3300048915 | Bacteria | 8591 |
| 1118 | Ga0496112_0035315 | 3300048915 | Bacteria | 4869 |
| 1119 | Ga0496112_0046849 | 3300048915 | Bacteria | 4241 |
| 1120 | Ga0496112_0048503 | 3300048915 | Bacteria | 4163 |
| 1121 | Ga0496112_0126707 | 3300048915 | Bacteria | 2524 |
| 1122 | Ga0496112_0283875 | 3300048915 | Bacteria | 1602 |
| 1123 | Ga0496112_0331623 | 3300048915 | Bacteria | 1465 |
| 1124 | Ga0496113_0004839 | 3300048916 | Bacteria | 8333 |
| 1125 | Ga0496113_0017064 | 3300048916 | Bacteria | 5031 |
| 1126 | Ga0496113_0024393 | 3300048916 | Bacteria | 4299 |
| 1127 | Ga0496114_0085730 | 3300048917 | Bacteria | 2668 |
| 1128 | Ga0496114_0180374 | 3300048917 | Bacteria | 1844 |
| 1129 | Ga0496115_0008385 | 3300048918 | Bacteria | 7647 |
| 1130 | Ga0496115_0008444 | 3300048918 | Bacteria | 7619 |
| 1131 | Ga0496115_0034316 | 3300048918 | Bacteria | 4010 |
| 1132 | Ga0496115_0050923 | 3300048918 | Bacteria | 3320 |
| 1133 | Ga0496115_0115596 | 3300048918 | Bacteria | 2206 |
| 1134 | Ga0496115_0124043 | 3300048918 | Bacteria | 2127 |
| 1135 | Ga0496115_0360388 | 3300048918 | Bacteria | 1185 |
| 1136 | Ga0496116_0078789 | 3300048919 | Bacteria | 2053 |
| 1137 | Ga0496117_0126685 | 3300048920 | Bacteria | 1557 |
| 1138 | Ga0496118_0210540 | 3300048921 | Bacteria | 1141 |
| 1139 | Ga0496119_0011287 | 3300048922 | Bacteria | 7421 |
| 1140 | Ga0496121_0001214 | 3300048924 | Bacteria | 44944 |
| 1141 | Ga0496121_0005804 | 3300048924 | Bacteria | 15651 |
| 1142 | Ga0496121_0005812 | 3300048924 | Bacteria | 15639 |
| 1143 | Ga0496121_0007712 | 3300048924 | Bacteria | 12910 |
| 1144 | Ga0496121_0056369 | 3300048924 | Bacteria | 3264 |
| 1145 | Ga0496121_0059432 | 3300048924 | Bacteria | 3152 |
| 1146 | Ga0496121_0177421 | 3300048924 | Bacteria | 1541 |
| 1147 | Ga0496121_0179979 | 3300048924 | Bacteria | 1527 |
| 1148 | Ga0496121_0216962 | 3300048924 | Bacteria | 1350 |
| 1149 | Ga0496121_0286124 | 3300048924 | Bacteria | 1125 |
| 1150 | Ga0496122_0004715 | 3300048925 | Bacteria | 16745 |
| 1151 | Ga0496122_0006838 | 3300048925 | Bacteria | 12935 |
| 1152 | Ga0496122_0029438 | 3300048925 | Bacteria | 4632 |
| 1153 | Ga0496122_0081360 | 3300048925 | Bacteria | 2255 |
| 1154 | Ga0496123_0000896 | 3300048926 | Bacteria | 47149 |
| 1155 | Ga0496123_0002007 | 3300048926 | Bacteria | 26274 |
| 1156 | Ga0496123_0008924 | 3300048926 | Bacteria | 9117 |
| 1157 | Ga0496124_0002458 | 3300048927 | Bacteria | 24217 |
| 1158 | Ga0496124_0283122 | 3300048927 | Bacteria | 1207 |
| 1159 | Ga0496125_0002535 | 3300048928 | Bacteria | 23546 |
| 1160 | Ga0496125_0056031 | 3300048928 | Bacteria | 3205 |
| 1161 | Ga0496125_0173659 | 3300048928 | Bacteria | 1445 |
| 1162 | Ga0496126_0001612 | 3300048929 | Bacteria | 34184 |
| 1163 | Ga0496126_0004467 | 3300048929 | Bacteria | 16697 |
| 1164 | Ga0496126_0006114 | 3300048929 | Bacteria | 13498 |
| 1165 | Ga0496126_0023193 | 3300048929 | Bacteria | 6016 |
| 1166 | Ga0496126_0047582 | 3300048929 | Bacteria | 3926 |
| 1167 | Ga0496126_0080441 | 3300048929 | Bacteria | 2884 |
| 1168 | Ga0496126_0100547 | 3300048929 | Bacteria | 2530 |
| 1169 | Ga0496126_0119352 | 3300048929 | Bacteria | 2288 |
| 1170 | Ga0496126_0132740 | 3300048929 | Bacteria | 2150 |
| 1171 | Ga0496126_0135659 | 3300048929 | Bacteria | 2123 |
| 1172 | Ga0496126_0168246 | 3300048929 | Bacteria | 1869 |
| 1173 | Ga0496126_0205257 | 3300048929 | Bacteria | 1662 |
| 1174 | Ga0496126_0216255 | 3300048929 | Bacteria | 1612 |
| 1175 | Ga0496126_0380234 | 3300048929 | Bacteria | 1150 |
| 1176 | Ga0495678_042737 | 3300049459 | Bacteria | 1805 |
| 1177 | Ga0495682_0034924 | 3300049460 | Bacteria | 1853 |
| 1178 | Ga0495682_0084648 | 3300049460 | Bacteria | 1140 |
| 1179 | Ga0501031_0004996 | 3300049568 | Bacteria | 8624 |
| 1180 | Ga0501031_0144281 | 3300049568 | Bacteria | 1556 |
| 1181 | Ga0501032_0099204 | 3300049569 | Bacteria | 1929 |
| 1182 | Ga0501033_0000447 | 3300049570 | Bacteria | 39400 |
| 1183 | Ga0501033_0017233 | 3300049570 | Bacteria | 5459 |
| 1184 | Ga0501033_0044800 | 3300049570 | Bacteria | 3293 |
| 1185 | Ga0501034_0000109 | 3300049571 | Bacteria | 151550 |
| 1186 | Ga0501034_0001175 | 3300049571 | Bacteria | 36278 |
| 1187 | Ga0501034_0011170 | 3300049571 | Bacteria | 9321 |
| 1188 | Ga0501034_0117991 | 3300049571 | Bacteria | 2641 |
| 1189 | Ga0501034_0136391 | 3300049571 | Bacteria | 2435 |
| 1190 | Ga0501034_0286335 | 3300049571 | Bacteria | 1587 |
| 1191 | Ga0501034_0367092 | 3300049571 | Bacteria | 1366 |
| 1192 | Ga0501034_0387252 | 3300049571 | Bacteria | 1322 |
| 1193 | Ga0501034_0517213 | 3300049571 | Bacteria | 1106 |
| 1194 | Ga0501036_0012191 | 3300049572 | Bacteria | 7121 |
| 1195 | Ga0501036_0013642 | 3300049572 | Bacteria | 6756 |
| 1196 | Ga0501036_0070213 | 3300049572 | Bacteria | 2962 |
| 1197 | Ga0501037_0001078 | 3300049573 | Bacteria | 20227 |
| 1198 | Ga0501037_0172105 | 3300049573 | Bacteria | 1539 |
| 1199 | Ga0501038_0071505 | 3300049574 | Bacteria | 2942 |
| 1200 | Ga0501039_0052494 | 3300049575 | Bacteria | 3154 |
| 1201 | Ga0501039_0110707 | 3300049575 | Bacteria | 2147 |
| 1202 | Ga0501043_0003281 | 3300049579 | Bacteria | 13334 |
| 1203 | Ga0501043_0019644 | 3300049579 | Bacteria | 5304 |
| 1204 | Ga0501043_0041532 | 3300049579 | Bacteria | 3614 |
| 1205 | Ga0501046_0034192 | 3300049580 | Bacteria | 4103 |
| 1206 | Ga0501046_0185844 | 3300049580 | Bacteria | 1552 |
| 1207 | Ga0501047_0012173 | 3300049581 | Bacteria | 8143 |
| 1208 | Ga0501047_0030884 | 3300049581 | Bacteria | 5165 |
| 1209 | Ga0501047_0132937 | 3300049581 | Bacteria | 2368 |
| 1210 | Ga0501047_0205392 | 3300049581 | Bacteria | 1829 |
| 1211 | Ga0501047_0321571 | 3300049581 | Bacteria | 1387 |
| 1212 | Ga0501047_0376022 | 3300049581 | Bacteria | 1255 |
| 1213 | Ga0501067_0013811 | 3300049583 | Bacteria | 4472 |
| 1214 | Ga0501068_0011640 | 3300049584 | Bacteria | 4971 |
| 1215 | Ga0501069_0025002 | 3300049585 | Bacteria | 3261 |
| 1216 | Ga0501069_0295505 | 3300049585 | Bacteria | 949 |
| 1217 | Ga0501070_0024998 | 3300049586 | Bacteria | 5009 |
| 1218 | Ga0501070_0125601 | 3300049586 | Bacteria | 2120 |
| 1219 | Ga0501070_0180587 | 3300049586 | Bacteria | 1737 |
| 1220 | Ga0501070_0204314 | 3300049586 | Bacteria | 1622 |
| 1221 | Ga0501071_0022307 | 3300049587 | Bacteria | 4414 |
| 1222 | Ga0501072_0168067 | 3300049588 | Bacteria | 1750 |
| 1223 | Ga0501073_0022644 | 3300049589 | Bacteria | 4521 |
| 1224 | Ga0501073_0050737 | 3300049589 | Bacteria | 2907 |
| 1225 | Ga0501073_0058167 | 3300049589 | Bacteria | 2702 |
| 1226 | Ga0501073_0092976 | 3300049589 | Bacteria | 2096 |
| 1227 | Ga0501073_0197079 | 3300049589 | Bacteria | 1393 |
| 1228 | Ga0501074_0069404 | 3300049590 | Bacteria | 2534 |
| 1229 | Ga0501074_0261272 | 3300049590 | Bacteria | 1231 |
| 1230 | Ga0501075_0046475 | 3300049591 | Bacteria | 3261 |
| 1231 | Ga0501075_0077585 | 3300049591 | Bacteria | 2514 |
| 1232 | Ga0501075_0319193 | 3300049591 | Bacteria | 1184 |
| 1233 | Ga0501076_0128678 | 3300049592 | Bacteria | 2053 |
| 1234 | Ga0501076_0171895 | 3300049592 | Bacteria | 1766 |
| 1235 | Ga0501076_0277831 | 3300049592 | Bacteria | 1372 |
| 1236 | Ga0501077_0292885 | 3300049593 | Bacteria | 1037 |
| 1237 | Ga0501211_003699 | 3300049658 | Bacteria | 1573 |
| 1238 | Ga0501223_000289 | 3300049663 | Bacteria | 12651 |
| 1239 | Ga0501224_000002 | 3300049664 | Bacteria | 229331 |
| 1240 | Ga0501233_006556 | 3300049668 | Bacteria | 2190 |
| 1241 | Ga0501225_0000045 | 3300049705 | Bacteria | 41541 |
| 1242 | Ga0501225_0018576 | 3300049705 | Bacteria | 1927 |
| 1243 | Ga0501234_000055 | 3300049707 | Bacteria | 13099 |
| 1244 | Ga0501079_0054277 | 3300049741 | Bacteria | 3091 |
| 1245 | Ga0501079_0143047 | 3300049741 | Bacteria | 1863 |
| 1246 | Ga0501079_0253254 | 3300049741 | Bacteria | 1376 |
| 1247 | Ga0501079_0366676 | 3300049741 | Bacteria | 1129 |
| 1248 | Ga0501079_0368635 | 3300049741 | Bacteria | 1126 |
| 1249 | Ga0501080_0111454 | 3300049742 | Bacteria | 2536 |
| 1250 | Ga0501081_0020783 | 3300049743 | Bacteria | 4379 |
| 1251 | Ga0501081_0132933 | 3300049743 | Bacteria | 1779 |
| 1252 | Ga0501083_0012517 | 3300049744 | Bacteria | 5935 |
| 1253 | Ga0501035_0002396 | 3300049822 | Bacteria | 18390 |
| 1254 | Ga0501035_0030042 | 3300049822 | Bacteria | 4955 |
| 1255 | Ga0501035_0056002 | 3300049822 | Bacteria | 3520 |
| 1256 | Ga0501035_0070987 | 3300049822 | Bacteria | 3084 |
| 1257 | Ga0501035_0071340 | 3300049822 | Bacteria | 3076 |
| 1258 | Ga0501035_0072618 | 3300049822 | Bacteria | 3045 |
| 1259 | Ga0501035_0154414 | 3300049822 | Bacteria | 1990 |
| 1260 | Ga0501044_0000266 | 3300049823 | Bacteria | 66205 |
| 1261 | Ga0501044_0029012 | 3300049823 | Bacteria | 5836 |
| 1262 | Ga0501044_0030690 | 3300049823 | Bacteria | 5663 |
| 1263 | Ga0501044_0041958 | 3300049823 | Bacteria | 4762 |
| 1264 | Ga0501044_0045060 | 3300049823 | Bacteria | 4574 |
| 1265 | Ga0501044_0067189 | 3300049823 | Bacteria | 3653 |
| 1266 | Ga0501044_0077325 | 3300049823 | Bacteria | 3375 |
| 1267 | Ga0501044_0172223 | 3300049823 | Bacteria | 2135 |
| 1268 | Ga0501045_0148673 | 3300049824 | Bacteria | 1743 |
| 1269 | Ga0501226_000026 | 3300049853 | Bacteria | 91031 |
| 1270 | nmdc:mga03683_138675_c1 | 3300050489 | Bacteria | 1092 |
| 1271 | nmdc:mga03n38_1841_c1 | 3300050490 | Bacteria | 6321 |
| 1272 | nmdc:mga00v17_134798_c1 | 3300050491 | Bacteria | 1580 |
| 1273 | nmdc:mga00v17_15240_c1 | 3300050491 | Bacteria | 4311 |
| 1274 | nmdc:mga00v17_162975_c1 | 3300050491 | Bacteria | 1436 |
| 1275 | nmdc:mga00v17_266129_c1 | 3300050491 | Bacteria | 1112 |
| 1276 | nmdc:mga00v17_58269_c1 | 3300050491 | Bacteria | 2366 |
| 1277 | nmdc:mga0yw44_1073_c2 | 3300050492 | Bacteria | 3816 |
| 1278 | nmdc:mga0yw44_115170_c1 | 3300050492 | Bacteria | 1726 |
| 1279 | nmdc:mga0yw44_64077_c1 | 3300050492 | Bacteria | 2261 |
| 1280 | nmdc:mga0yw44_813_c1 | 3300050492 | Bacteria | 11629 |
| 1281 | nmdc:mga0k408_221755_c1 | 3300050493 | Bacteria | 1129 |
| 1282 | nmdc:mga0k408_85015_c1 | 3300050493 | Bacteria | 1857 |
| 1283 | nmdc:mga06z11_12290_c1 | 3300050494 | Bacteria | 3720 |
| 1284 | nmdc:mga06z11_28342_c1 | 3300050494 | Bacteria | 2686 |
| 1285 | nmdc:mga06z11_67329_c1 | 3300050494 | Bacteria | 1885 |
| 1286 | nmdc:mga07m45_134096_c1 | 3300050496 | Bacteria | 1433 |
| 1287 | nmdc:mga07m45_19367_c1 | 3300050496 | Bacteria | 3687 |
| 1288 | nmdc:mga07m45_7723_c1 | 3300050496 | Bacteria | 5504 |
| 1289 | nmdc:mga05p37_154875_c1 | 3300050507 | Bacteria | 2801 |
| 1290 | nmdc:mga05p37_301611_c1 | 3300050507 | Bacteria | 1903 |
| 1291 | nmdc:mga05p37_358558_c1 | 3300050507 | Bacteria | 1715 |
| 1292 | nmdc:mga05p37_389441_c1 | 3300050507 | Bacteria | 1630 |
| 1293 | nmdc:mga05p37_602943_c1 | 3300050507 | Bacteria | 1239 |
| 1294 | nmdc:mga05p37_82855_c1 | 3300050507 | Bacteria | 3952 |
| 1295 | nmdc:mga09592_206097_c1 | 3300050508 | Bacteria | 1703 |
| 1296 | nmdc:mga0qj67_21529_c1 | 3300050509 | Bacteria | 1192 |
| 1297 | nmdc:mga0qj67_50_c1 | 3300050509 | Bacteria | 50243 |
| 1298 | nmdc:mga0qj67_74334_c1 | 3300050509 | Bacteria | 2716 |
| 1299 | nmdc:mga06r32_214387_c1 | 3300050510 | Bacteria | 1913 |
| 1300 | nmdc:mga06r32_345166_c1 | 3300050510 | Bacteria | 1473 |
| 1301 | nmdc:mga06r32_94551_c1 | 3300050510 | Bacteria | 2924 |
| 1302 | nmdc:mga0rr50_48411_c1 | 3300050513 | Bacteria | 3142 |
| 1303 | nmdc:mga08x19_334637_c1 | 3300050514 | Bacteria | 1055 |
| 1304 | nmdc:mga0a205_364436_c1 | 3300050515 | Bacteria | 1311 |
| 1305 | nmdc:mga0sz30_13149_c1 | 3300050516 | Bacteria | 3235 |
| 1306 | Ga0495601_0000589 | 3300053077 | Bacteria | 19331 |
| 1307 | Ga0495601_0010473 | 3300053077 | Bacteria | 5519 |
| 1308 | Ga0495601_0032032 | 3300053077 | Bacteria | 3270 |
| 1309 | Ga0495601_0062698 | 3300053077 | Bacteria | 2361 |
| 1310 | Ga0495612_0001270 | 3300053078 | Bacteria | 10413 |
| 1311 | Ga0495612_0002637 | 3300053078 | Bacteria | 7395 |
| 1312 | Ga0495612_0013700 | 3300053078 | Bacteria | 3266 |
| 1313 | Ga0495612_0027714 | 3300053078 | Bacteria | 2279 |
| 1314 | Ga0495612_0045474 | 3300053078 | Bacteria | 1797 |
| 1315 | Ga0500635_0072083 | 3300053080 | Bacteria | 1227 |
| 1316 | Ga0495595_0001037 | 3300053084 | Bacteria | 10708 |
| 1317 | Ga0495595_0099637 | 3300053084 | Bacteria | 1401 |
| 1318 | Ga0495595_0112432 | 3300053084 | Bacteria | 1321 |
| 1319 | Ga0495619_0005308 | 3300053085 | Bacteria | 8163 |
| 1320 | Ga0495619_0017953 | 3300053085 | Bacteria | 4485 |
| 1321 | Ga0495619_0211036 | 3300053085 | Bacteria | 1345 |
| 1322 | Ga0500643_000042 | 3300053087 | Bacteria | 158933 |
| 1323 | Ga0500643_001251 | 3300053087 | Bacteria | 15060 |
| 1324 | Ga0500643_058698 | 3300053087 | Bacteria | 1085 |
| 1325 | Ga0500644_0000533 | 3300053088 | Bacteria | 15780 |
| 1326 | Ga0500647_0024199 | 3300053091 | Bacteria | 2854 |
| 1327 | Ga0500647_0029042 | 3300053091 | Bacteria | 2621 |
| 1328 | Ga0500651_0000628 | 3300053093 | Bacteria | 17559 |
| 1329 | Ga0500651_0001643 | 3300053093 | Bacteria | 11381 |
| 1330 | Ga0500566_0000178 | 3300053094 | Bacteria | 32469 |
| 1331 | Ga0500566_0000834 | 3300053094 | Bacteria | 17566 |
| 1332 | Ga0500566_0010268 | 3300053094 | Bacteria | 5520 |
| 1333 | Ga0500566_0032693 | 3300053094 | Bacteria | 3034 |
| 1334 | Ga0500640_029138 | 3300053095 | Bacteria | 2412 |
| 1335 | Ga0500640_064959 | 3300053095 | Bacteria | 1575 |
| 1336 | Ga0500641_0003159 | 3300053096 | Bacteria | 5838 |
| 1337 | Ga0500641_0004944 | 3300053096 | Bacteria | 4725 |
| 1338 | Ga0500641_0067877 | 3300053096 | Bacteria | 1496 |
| 1339 | Ga0500641_0133642 | 3300053096 | Bacteria | 1071 |
| 1340 | Ga0500554_073532 | 3300053102 | Bacteria | 1116 |
| 1341 | Ga0500555_000735 | 3300053103 | Bacteria | 12142 |
| 1342 | Ga0500555_002532 | 3300053103 | Bacteria | 5281 |
| 1343 | Ga0500555_019657 | 3300053103 | Bacteria | 1945 |
| 1344 | Ga0500556_0000290 | 3300053104 | Bacteria | 39103 |
| 1345 | Ga0500556_0004619 | 3300053104 | Bacteria | 3913 |
| 1346 | Ga0500557_000006 | 3300053105 | Bacteria | 141252 |
| 1347 | Ga0500562_005693 | 3300053108 | Bacteria | 3138 |
| 1348 | Ga0500562_048309 | 3300053108 | Bacteria | 1136 |
| 1349 | Ga0500572_000041 | 3300053111 | Bacteria | 39295 |
| 1350 | Ga0500572_015508 | 3300053111 | Bacteria | 1923 |
| 1351 | Ga0500592_009871 | 3300053116 | Bacteria | 1519 |
| 1352 | Ga0500594_0031311 | 3300053118 | Bacteria | 1402 |
| 1353 | Ga0500595_000002 | 3300053119 | Bacteria | 1074388 |
| 1354 | Ga0500595_001597 | 3300053119 | Bacteria | 11940 |
| 1355 | Ga0500595_009190 | 3300053119 | Bacteria | 3999 |
| 1356 | Ga0500595_015184 | 3300053119 | Bacteria | 2894 |
| 1357 | Ga0500595_018294 | 3300053119 | Bacteria | 2566 |
| 1358 | Ga0500608_080244 | 3300053122 | Bacteria | 1540 |
| 1359 | Ga0500614_002436 | 3300053123 | Bacteria | 4154 |
| 1360 | Ga0500621_058891 | 3300053126 | Bacteria | 1553 |
| 1361 | Ga0500642_0000040 | 3300053130 | Bacteria | 96160 |
| 1362 | Ga0500642_0022271 | 3300053130 | Bacteria | 2525 |
| 1363 | Ga0500642_0099608 | 3300053130 | Bacteria | 1350 |
| 1364 | Ga0500652_082782 | 3300053131 | Bacteria | 1337 |
| 1365 | Ga0500658_0058151 | 3300053134 | Bacteria | 1600 |
| 1366 | Ga0500658_0068364 | 3300053134 | Bacteria | 1493 |
| 1367 | Ga0500559_0000597 | 3300053136 | Bacteria | 24582 |
| 1368 | Ga0500559_0006230 | 3300053136 | Bacteria | 5400 |
| 1369 | Ga0500561_0009191 | 3300053137 | Bacteria | 1997 |
| 1370 | Ga0500568_0003040 | 3300053139 | Bacteria | 9591 |
| 1371 | Ga0500568_0003788 | 3300053139 | Bacteria | 8277 |
| 1372 | Ga0500568_0013672 | 3300053139 | Bacteria | 3692 |
| 1373 | Ga0500568_0019093 | 3300053139 | Bacteria | 2987 |
| 1374 | Ga0500568_0033871 | 3300053139 | Bacteria | 2093 |
| 1375 | Ga0500588_0061365 | 3300053146 | Bacteria | 1206 |
| 1376 | Ga0500590_116353 | 3300053148 | Bacteria | 1260 |
| 1377 | Ga0500603_000312 | 3300053150 | Bacteria | 12796 |
| 1378 | Ga0500604_0016250 | 3300053151 | Bacteria | 2048 |
| 1379 | Ga0500616_0000002 | 3300053153 | Bacteria | 1611257 |
| 1380 | Ga0500616_0002157 | 3300053153 | Bacteria | 17033 |
| 1381 | Ga0500616_0008096 | 3300053153 | Bacteria | 6573 |
| 1382 | Ga0500616_0023517 | 3300053153 | Bacteria | 3432 |
| 1383 | Ga0500616_0027058 | 3300053153 | Bacteria | 3169 |
| 1384 | Ga0500622_0012774 | 3300053156 | Bacteria | 4537 |
| 1385 | Ga0500622_0089240 | 3300053156 | Bacteria | 1532 |
| 1386 | Ga0500627_0033845 | 3300053158 | Bacteria | 2162 |
| 1387 | Ga0500627_0127748 | 3300053158 | Bacteria | 1148 |
| 1388 | Ga0500627_0197651 | 3300053158 | Bacteria | 902 |
| 1389 | Ga0500630_000840 | 3300053159 | Bacteria | 14239 |
| 1390 | Ga0500633_0071169 | 3300053160 | Bacteria | 1242 |
| 1391 | Ga0500638_001878 | 3300053162 | Bacteria | 6970 |
| 1392 | Ga0500639_000029 | 3300053163 | Bacteria | 76014 |
| 1393 | Ga0500639_140429 | 3300053163 | Bacteria | 1130 |
| 1394 | Ga0500636_0000105 | 3300053177 | Bacteria | 43109 |
| 1395 | Ga0500636_0025642 | 3300053177 | Bacteria | 3485 |
| 1396 | Ga0500636_0075129 | 3300053177 | Bacteria | 1955 |
| 1397 | Ga0500636_0100425 | 3300053177 | Bacteria | 1645 |
| 1398 | Ga0500636_0155768 | 3300053177 | Bacteria | 1251 |
| 1399 | Ga0500637_0000215 | 3300053178 | Bacteria | 21698 |
| 1400 | Ga0500645_064109 | 3300053730 | Bacteria | 1060 |
| 1401 | Ga0500609_004989 | 3300053731 | Bacteria | 1817 |
| 1402 | Ga0500552_007034 | 3300053733 | Bacteria | 1284 |
| 1403 | Ga0500596_002014 | 3300053735 | Bacteria | 4061 |
| 1404 | Ga0500596_006334 | 3300053735 | Bacteria | 2013 |
| 1405 | Ga0500601_000682 | 3300053737 | Bacteria | 4577 |
| 1406 | Ga0500587_001664 | 3300053739 | Bacteria | 3161 |
| 1407 | Ga0501084_0015828 | 3300054114 | Bacteria | 6256 |
| 1408 | Ga0501084_0053971 | 3300054114 | Bacteria | 3361 |
| 1409 | Ga0501082_0018385 | 3300060353 | Bacteria | 6020 |
| 1410 | Ga0501082_0029700 | 3300060353 | Bacteria | 4710 |
| 1411 | Ga0501082_0312271 | 3300060353 | Bacteria | 1369 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300044712 | Ga0453684_1261641 | Ga0453684_1261641_23_763 | 240 |
| 2 | 3300026118 | Ga0207675_100272158 | Ga0207675_1002721582 | 243 |
| 3 | 3300006038 | Ga0075365_10063772 | Ga0075365_100637723 | 249 |
| 4 | 3300032004 | Ga0307414_10201129 | Ga0307414_102011293 | 251 |
| 5 | 3300038443 | Ga0395901_0362943 | Ga0395901_0362943_498_1382 | 251 |
| 6 | 3300003771 | Ga0055526_1000150 | Ga0055526_100015029 | 256 |
| 7 | 3300025295 | Ga0209564_1000015 | Ga0209564_1000015568 | 256 |
| 8 | 3300002987 | JGI25159J45721_1013877 | JGI25159J45721_10138772 | 257 |
| 9 | 3300003187 | JGI25151J46595_10000019 | JGI25151J46595_100000196 | 257 |
| 10 | 3300005262 | Ga0065165_1001200 | Ga0065165_100120030 | 257 |
| 11 | 3300006177 | Ga0075362_10166907 | Ga0075362_101669071 | 257 |
| 12 | 3300025284 | Ga0209130_1000343 | Ga0209130_10003438 | 257 |
| 13 | 3300025294 | Ga0209025_1000008 | Ga0209025_1000008491 | 257 |
| 14 | 3300025294 | Ga0209025_1000835 | Ga0209025_100083531 | 257 |
| 15 | 3300025297 | Ga0209758_1056030 | Ga0209758_10560302 | 257 |
| 16 | 3300049589 | Ga0501073_0197079 | Ga0501073_0197079_434_1348 | 258 |
| 17 | 3300009101 | Ga0105247_10022626 | Ga0105247_100226263 | 259 |
| 18 | 3300025900 | Ga0207710_10053419 | Ga0207710_100534192 | 259 |
| 19 | 3300026075 | Ga0207708_10444525 | Ga0207708_104445251 | 259 |
| 20 | 3300035691 | Ga0373931_0329918 | Ga0373931_0329918_47_883 | 259 |
| 21 | 3300048929 | Ga0496126_0047582 | Ga0496126_0047582_1813_2751 | 259 |
| 22 | 3300025299 | Ga0209256_1001342 | Ga0209256_100134218 | 260 |
| 23 | 3300035089 | Ga0373944_0009011 | Ga0373944_0009011_1508_2458 | 260 |
| 24 | 3300035116 | Ga0373945_0030108 | Ga0373945_0030108_559_1509 | 260 |
| 25 | 3300035170 | Ga0373943_0000755 | Ga0373943_0000755_6076_7026 | 260 |
| 26 | 3300035171 | Ga0373946_0004314 | Ga0373946_0004314_579_1529 | 260 |
| 27 | 3300035692 | Ga0373935_0019696 | Ga0373935_0019696_1897_2847 | 260 |
| 28 | 3300035695 | Ga0373927_0000113 | Ga0373927_0000113_24730_25680 | 260 |
| 29 | 3300035725 | Ga0373947_0002417 | Ga0373947_0002417_6995_7945 | 260 |
| 30 | 3300037068 | Ga0373925_0020265 | Ga0373925_0020265_556_1506 | 260 |
| 31 | 3300046472 | Ga0495580_0007886 | Ga0495580_0007886_1860_2810 | 260 |
| 32 | 3300046514 | Ga0495618_0152608 | Ga0495618_0152608_427_1377 | 260 |
| 33 | 3300046517 | Ga0495630_0006103 | Ga0495630_0006103_7372_8322 | 260 |
| 34 | 3300046526 | Ga0495666_0034265 | Ga0495666_0034265_1291_2241 | 260 |
| 35 | 3300046533 | Ga0495640_0057977 | Ga0495640_0057977_1029_1979 | 260 |
| 36 | 3300046689 | Ga0495613_0044732 | Ga0495613_0044732_911_1861 | 260 |
| 37 | 3300046690 | Ga0495624_0048239 | Ga0495624_0048239_1178_2128 | 260 |
| 38 | 3300047315 | Ga0495581_0004287 | Ga0495581_0004287_346_1296 | 260 |
| 39 | 3300047321 | Ga0495676_0056510 | Ga0495676_0056510_1515_2465 | 260 |
| 40 | 3300047471 | Ga0495684_0000845 | Ga0495684_0000845_552_1502 | 260 |
| 41 | 3300047673 | Ga0495593_0011906 | Ga0495593_0011906_2747_3697 | 260 |
| 42 | 3300025928 | Ga0207700_10189902 | Ga0207700_101899022 | 261 |
| 43 | 3300028800 | Ga0265338_10190710 | Ga0265338_101907102 | 261 |
| 44 | 3300046455 | Ga0495603_0323701 | Ga0495603_0323701_23_853 | 261 |
| 45 | 3300046472 | Ga0495580_0240952 | Ga0495580_0240952_26_856 | 261 |
| 46 | 3300046664 | Ga0495659_0029756 | Ga0495659_0029756_1042_1872 | 261 |
| 47 | 3300049822 | Ga0501035_0056002 | Ga0501035_0056002_43_927 | 261 |
| 48 | 3300050494 | nmdc:mga06z11_67329_c1 | nmdc:mga06z11_67329_c1_1045_1875 | 261 |
| 49 | 3300053111 | Ga0500572_000041 | Ga0500572_000041_18915_19808 | 261 |
| 50 | 3300053136 | Ga0500559_0000597 | Ga0500559_0000597_18244_19137 | 261 |
| 51 | 3300053163 | Ga0500639_140429 | Ga0500639_140429_72_965 | 261 |
| 52 | 3300053735 | Ga0500596_006334 | Ga0500596_006334_708_1601 | 261 |
| 53 | 3300005458 | Ga0070681_10092574 | Ga0070681_100925741 | 262 |
| 54 | 3300025294 | Ga0209025_1024276 | Ga0209025_10242764 | 262 |
| 55 | 3300013250 | Ga0171462_1006 | Ga0171462_1006285 | 263 |
| 56 | 3300031901 | Ga0307406_10004247 | Ga0307406_100042478 | 263 |
| 57 | 3300049575 | Ga0501039_0110707 | Ga0501039_0110707_230_1066 | 263 |
| 58 | 3300021377 | Ga0213874_10003862 | Ga0213874_100038625 | 264 |
| 59 | 3300021384 | Ga0213876_10053186 | Ga0213876_100531861 | 264 |
| 60 | 3300039437 | Ga0436365_1710304 | Ga0436365_1710304_1263_2150 | 264 |
| 61 | 3300039450 | Ga0436363_1471097 | Ga0436363_1471097_4289_5176 | 264 |
| 62 | 3300048903 | Ga0496100_0008443 | Ga0496100_0008443_2042_2932 | 264 |
| 63 | 3300048907 | Ga0496104_0007514 | Ga0496104_0007514_355_1245 | 264 |
| 64 | 3300048909 | Ga0496106_0000634 | Ga0496106_0000634_4583_5473 | 264 |
| 65 | 3300048910 | Ga0496107_0009028 | Ga0496107_0009028_2240_3130 | 264 |
| 66 | 3300048911 | Ga0496108_0001003 | Ga0496108_0001003_18163_19053 | 264 |
| 67 | 3300048912 | Ga0496109_0000166 | Ga0496109_0000166_16368_17258 | 264 |
| 68 | 3300048913 | Ga0496110_0012878 | Ga0496110_0012878_2118_3008 | 264 |
| 69 | 3300048914 | Ga0496111_0059949 | Ga0496111_0059949_36_926 | 264 |
| 70 | 3300048915 | Ga0496112_0000358 | Ga0496112_0000358_6897_7787 | 264 |
| 71 | 3300049593 | Ga0501077_0292885 | Ga0501077_0292885_34_873 | 264 |
| 72 | 3300050507 | nmdc:mga05p37_301611_c1 | nmdc:mga05p37_301611_c1_739_1650 | 264 |
| 73 | 3300003322 | rootL2_10059632 | rootL2_100596321 | 265 |
| 74 | 3300009551 | Ga0105238_10606520 | Ga0105238_106065201 | 265 |
| 75 | 3300010375 | Ga0105239_10388821 | Ga0105239_103888212 | 265 |
| 76 | 3300037471 | Ga0395905_0000123 | Ga0395905_0000123_109201_110088 | 265 |
| 77 | 3300050491 | nmdc:mga00v17_266129_c1 | nmdc:mga00v17_266129_c1_97_1020 | 265 |
| 78 | 3300025254 | Ga0209148_1018454 | Ga0209148_10184541 | 266 |
| 79 | 3300026116 | Ga0207674_10191273 | Ga0207674_101912732 | 266 |
| 80 | 3300049581 | Ga0501047_0376022 | Ga0501047_0376022_35_931 | 266 |
| 81 | 3300049586 | Ga0501070_0180587 | Ga0501070_0180587_593_1489 | 266 |
| 82 | 3300049822 | Ga0501035_0072618 | Ga0501035_0072618_140_1027 | 266 |
| 83 | 3300053096 | Ga0500641_0004944 | Ga0500641_0004944_1398_2300 | 266 |
| 84 | 3300005328 | Ga0070676_10092865 | Ga0070676_100928653 | 267 |
| 85 | 3300005356 | Ga0070674_100055392 | Ga0070674_1000553922 | 267 |
| 86 | 3300005981 | Ga0081538_10001580 | Ga0081538_1000158022 | 267 |
| 87 | 3300006880 | Ga0075429_100232719 | Ga0075429_1002327192 | 267 |
| 88 | 3300025907 | Ga0207645_10093764 | Ga0207645_100937642 | 267 |
| 89 | 3300025937 | Ga0207669_10110270 | Ga0207669_101102702 | 267 |
| 90 | 3300026121 | Ga0207683_10051243 | Ga0207683_100512434 | 267 |
| 91 | 3300037068 | Ga0373925_0447654 | Ga0373925_0447654_64_930 | 267 |
| 92 | 3300049568 | Ga0501031_0144281 | Ga0501031_0144281_565_1497 | 267 |
| 93 | 3300050508 | nmdc:mga09592_206097_c1 | nmdc:mga09592_206097_c1_511_1365 | 267 |
| 94 | 3300050510 | nmdc:mga06r32_345166_c1 | nmdc:mga06r32_345166_c1_482_1420 | 267 |
| 95 | 3300021377 | Ga0213874_10001203 | Ga0213874_100012032 | 268 |
| 96 | 3300025928 | Ga0207700_10092942 | Ga0207700_100929422 | 268 |
| 97 | 3300039450 | Ga0436363_1401795 | Ga0436363_1401795_7620_8507 | 268 |
| 98 | 3300048088 | Ga0495602_0068416 | Ga0495602_0068416_2048_2938 | 268 |
| 99 | 3300005355 | Ga0070671_100200532 | Ga0070671_1002005323 | 269 |
| 100 | 3300005367 | Ga0070667_100071421 | Ga0070667_1000714211 | 269 |
| 101 | 3300005456 | Ga0070678_100016373 | Ga0070678_1000163736 | 269 |
| 102 | 3300005617 | Ga0068859_100754882 | Ga0068859_1007548822 | 269 |
| 103 | 3300005843 | Ga0068860_100176074 | Ga0068860_1001760742 | 269 |
| 104 | 3300005983 | Ga0081540_1001733 | Ga0081540_100173316 | 269 |
| 105 | 3300006847 | Ga0075431_100318824 | Ga0075431_1003188242 | 269 |
| 106 | 3300006931 | Ga0097620_100754866 | Ga0097620_1007548662 | 269 |
| 107 | 3300006942 | Ga0099824_1023696 | Ga0099824_10236962 | 269 |
| 108 | 3300009148 | Ga0105243_10033198 | Ga0105243_100331981 | 269 |
| 109 | 3300014968 | Ga0157379_10206154 | Ga0157379_102061542 | 269 |
| 110 | 3300014969 | Ga0157376_10126647 | Ga0157376_101266471 | 269 |
| 111 | 3300021320 | Ga0214544_1000136 | Ga0214544_100013665 | 269 |
| 112 | 3300021321 | Ga0214542_1000127 | Ga0214542_100012765 | 269 |
| 113 | 3300021324 | Ga0214545_1000063 | Ga0214545_100006333 | 269 |
| 114 | 3300021327 | Ga0214543_1000238 | Ga0214543_100023845 | 269 |
| 115 | 3300021327 | Ga0214543_1041052 | Ga0214543_10410521 | 269 |
| 116 | 3300025907 | Ga0207645_10049857 | Ga0207645_100498572 | 269 |
| 117 | 3300025931 | Ga0207644_10172994 | Ga0207644_101729943 | 269 |
| 118 | 3300025938 | Ga0207704_10104069 | Ga0207704_101040693 | 269 |
| 119 | 3300025940 | Ga0207691_10229209 | Ga0207691_102292092 | 269 |
| 120 | 3300025960 | Ga0207651_10145749 | Ga0207651_101457493 | 269 |
| 121 | 3300027296 | Ga0209389_1000088 | Ga0209389_100008839 | 269 |
| 122 | 3300027357 | Ga0209589_1000189 | Ga0209589_100018929 | 269 |
| 123 | 3300027361 | Ga0209489_100085 | Ga0209489_10008578 | 269 |
| 124 | 3300028381 | Ga0268264_10044034 | Ga0268264_100440343 | 269 |
| 125 | 3300031711 | Ga0265314_10001759 | Ga0265314_1000175916 | 269 |
| 126 | 3300046523 | Ga0495644_0037512 | Ga0495644_0037512_595_1482 | 269 |
| 127 | 3300046615 | Ga0495656_0060648 | Ga0495656_0060648_285_1172 | 269 |
| 128 | 3300046684 | Ga0495669_0012302 | Ga0495669_0012302_2209_3096 | 269 |
| 129 | 3300003763 | Ga0055529_1012682 | Ga0055529_10126822 | 270 |
| 130 | 3300005843 | Ga0068860_100000324 | Ga0068860_10000032410 | 270 |
| 131 | 3300024227 | Ga0228598_1023939 | Ga0228598_10239392 | 270 |
| 132 | 3300025254 | Ga0209148_1005097 | Ga0209148_10050973 | 270 |
| 133 | 3300025261 | Ga0209233_1005247 | Ga0209233_10052473 | 270 |
| 134 | 3300025272 | Ga0209455_1003980 | Ga0209455_10039803 | 270 |
| 135 | 3300025901 | Ga0207688_10056128 | Ga0207688_100561282 | 270 |
| 136 | 3300028381 | Ga0268264_10000038 | Ga0268264_10000038311 | 270 |
| 137 | 3300031250 | Ga0265331_10022264 | Ga0265331_100222644 | 270 |
| 138 | 3300053095 | Ga0500640_064959 | Ga0500640_064959_418_1317 | 270 |
| 139 | 3300053103 | Ga0500555_002532 | Ga0500555_002532_829_1686 | 270 |
| 140 | 3300053111 | Ga0500572_015508 | Ga0500572_015508_964_1863 | 270 |
| 141 | 3300053177 | Ga0500636_0000105 | Ga0500636_0000105_22260_23159 | 270 |
| 142 | 3300053177 | Ga0500636_0155768 | Ga0500636_0155768_67_954 | 270 |
| 143 | 3300003320 | rootH2_10072203 | rootH2_100722035 | 271 |
| 144 | 3300004625 | Ga0055543_1005200 | Ga0055543_10052003 | 271 |
| 145 | 3300005262 | Ga0065165_1001308 | Ga0065165_10013084 | 271 |
| 146 | 3300005841 | Ga0068863_100260383 | Ga0068863_1002603832 | 271 |
| 147 | 3300006028 | Ga0070717_10000521 | Ga0070717_1000052119 | 271 |
| 148 | 3300006058 | Ga0075432_10001165 | Ga0075432_100011656 | 271 |
| 149 | 3300007788 | Ga0099795_10031291 | Ga0099795_100312912 | 271 |
| 150 | 3300025261 | Ga0209233_1003337 | Ga0209233_10033373 | 271 |
| 151 | 3300025904 | Ga0207647_10017981 | Ga0207647_100179814 | 271 |
| 152 | 3300031235 | Ga0265330_10003886 | Ga0265330_100038866 | 271 |
| 153 | 3300031247 | Ga0265340_10005741 | Ga0265340_100057415 | 271 |
| 154 | 3300035695 | Ga0373927_0028798 | Ga0373927_0028798_833_1720 | 271 |
| 155 | 3300035724 | Ga0373933_0004420 | Ga0373933_0004420_5596_6483 | 271 |
| 156 | 3300037068 | Ga0373925_0061215 | Ga0373925_0061215_353_1240 | 271 |
| 157 | 3300039447 | Ga0436361_0208634 | Ga0436361_0208634_2508_3407 | 271 |
| 158 | 3300046683 | Ga0495658_0156532 | Ga0495658_0156532_154_1041 | 271 |
| 159 | 3300047471 | Ga0495684_0010217 | Ga0495684_0010217_3077_4108 | 271 |
| 160 | 3300048924 | Ga0496121_0286124 | Ga0496121_0286124_166_1053 | 271 |
| 161 | 3300049570 | Ga0501033_0017233 | Ga0501033_0017233_3657_4544 | 271 |
| 162 | 3300049572 | Ga0501036_0013642 | Ga0501036_0013642_2669_3556 | 271 |
| 163 | 3300049579 | Ga0501043_0019644 | Ga0501043_0019644_2678_3565 | 271 |
| 164 | 3300049581 | Ga0501047_0030884 | Ga0501047_0030884_1680_2567 | 271 |
| 165 | 3300049822 | Ga0501035_0030042 | Ga0501035_0030042_1822_2709 | 271 |
| 166 | 3300049823 | Ga0501044_0077325 | Ga0501044_0077325_1786_2673 | 271 |
| 167 | 3300050514 | nmdc:mga08x19_334637_c1 | nmdc:mga08x19_334637_c1_43_960 | 271 |
| 168 | 3300053080 | Ga0500635_0072083 | Ga0500635_0072083_81_968 | 271 |
| 169 | 3300053119 | Ga0500595_018294 | Ga0500595_018294_390_1277 | 271 |
| 170 | 3300053177 | Ga0500636_0100425 | Ga0500636_0100425_34_921 | 271 |
| 171 | 3300053733 | Ga0500552_007034 | Ga0500552_007034_359_1246 | 271 |
| 172 | iso_pu_bacteria | 2883577096 | 2883577319 | 271 |
| 173 | 3300005328 | Ga0070676_10051847 | Ga0070676_100518474 | 272 |
| 174 | 3300005719 | Ga0068861_100193677 | Ga0068861_1001936772 | 272 |
| 175 | 3300005985 | Ga0081539_10065113 | Ga0081539_100651133 | 272 |
| 176 | 3300009147 | Ga0114129_10157410 | Ga0114129_101574102 | 272 |
| 177 | 3300009148 | Ga0105243_10260156 | Ga0105243_102601562 | 272 |
| 178 | 3300009551 | Ga0105238_10202290 | Ga0105238_102022901 | 272 |
| 179 | 3300025935 | Ga0207709_10317320 | Ga0207709_103173202 | 272 |
| 180 | 3300025972 | Ga0207668_10040041 | Ga0207668_100400412 | 272 |
| 181 | 3300031235 | Ga0265330_10062964 | Ga0265330_100629642 | 272 |
| 182 | 3300035112 | Ga0373932_0016637 | Ga0373932_0016637_240_1103 | 272 |
| 183 | 3300045976 | Ga0466967_0235265 | Ga0466967_0235265_229_1113 | 272 |
| 184 | 3300048918 | Ga0496115_0124043 | Ga0496115_0124043_1008_1898 | 272 |
| 185 | 3300050507 | nmdc:mga05p37_154875_c1 | nmdc:mga05p37_154875_c1_1120_2055 | 272 |
| 186 | 3300053177 | Ga0500636_0025642 | Ga0500636_0025642_386_1276 | 272 |
| 187 | 3300053730 | Ga0500645_064109 | Ga0500645_064109_11_880 | 272 |
| 188 | iso_pu_bacteria | 2617270735 | 2617347187 | 272 |
| 189 | iso_pu_bacteria | 8016566248 | 8016571468 | 272 |
| 190 | 3300005262 | Ga0065165_1016121 | Ga0065165_10161211 | 273 |
| 191 | 3300025302 | Ga0207426_1005196 | Ga0207426_10051966 | 273 |
| 192 | 3300039437 | Ga0436365_0012938 | Ga0436365_0012938_52_900 | 273 |
| 193 | 3300050513 | nmdc:mga0rr50_48411_c1 | nmdc:mga0rr50_48411_c1_319_1206 | 273 |
| 194 | 3300050515 | nmdc:mga0a205_364436_c1 | nmdc:mga0a205_364436_c1_53_931 | 273 |
| 195 | 3300005536 | Ga0070697_100045150 | Ga0070697_1000451505 | 274 |
| 196 | 3300010375 | Ga0105239_10240750 | Ga0105239_102407502 | 274 |
| 197 | 3300026041 | Ga0207639_10278024 | Ga0207639_102780242 | 274 |
| 198 | 3300026116 | Ga0207674_10098539 | Ga0207674_100985394 | 274 |
| 199 | 3300039062 | Ga0400483_063769 | Ga0400483_063769_19149_20000 | 274 |
| 200 | 3300049585 | Ga0501069_0025002 | Ga0501069_0025002_1048_1923 | 274 |
| 201 | 3300053108 | Ga0500562_005693 | Ga0500562_005693_285_1133 | 274 |
| 202 | iso_pu_bacteria | 2824671348 | 2824676835 | 274 |
| 203 | iso_pu_bacteria | 2824687955 | 2824693295 | 274 |
| 204 | iso_pu_bacteria | 2824696289 | 2824701316 | 274 |
| 205 | iso_pu_bacteria | 2824746037 | 2824751825 | 274 |
| 206 | iso_pu_bacteria | 2824773399 | 2824776099 | 274 |
| 207 | iso_pu_bacteria | 2838122688 | 2838127044 | 274 |
| 208 | iso_pu_bacteria | 2841941048 | 2841945474 | 274 |
| 209 | iso_pu_bacteria | 2841949485 | 2841955927 | 274 |
| 210 | iso_pu_bacteria | 2841966195 | 2841973998 | 274 |
| 211 | iso_pu_bacteria | 2841974524 | 2841980609 | 274 |
| 212 | iso_pu_bacteria | 2841983080 | 2841987145 | 274 |
| 213 | iso_pu_bacteria | 2847939898 | 2847939943 | 274 |
| 214 | iso_pu_bacteria | 2849076700 | 2849077853 | 274 |
| 215 | iso_pu_bacteria | 2874620515 | 2874625817 | 274 |
| 216 | iso_pu_bacteria | 2904666416 | 2904673822 | 274 |
| 217 | 3300005336 | Ga0070680_100107792 | Ga0070680_1001077922 | 275 |
| 218 | 3300005337 | Ga0070682_100164765 | Ga0070682_1001647652 | 275 |
| 219 | 3300005347 | Ga0070668_100018194 | Ga0070668_1000181946 | 275 |
| 220 | 3300005435 | Ga0070714_100088227 | Ga0070714_1000882274 | 275 |
| 221 | 3300005436 | Ga0070713_100021271 | Ga0070713_1000212715 | 275 |
| 222 | 3300005439 | Ga0070711_100027217 | Ga0070711_1000272172 | 275 |
| 223 | 3300005458 | Ga0070681_10149558 | Ga0070681_101495582 | 275 |
| 224 | 3300005459 | Ga0068867_100229408 | Ga0068867_1002294082 | 275 |
| 225 | 3300006175 | Ga0070712_100006981 | Ga0070712_1000069818 | 275 |
| 226 | 3300006195 | Ga0075366_10064465 | Ga0075366_100644652 | 275 |
| 227 | 3300013100 | Ga0157373_10030403 | Ga0157373_100304032 | 275 |
| 228 | 3300013307 | Ga0157372_10125611 | Ga0157372_101256112 | 275 |
| 229 | 3300025906 | Ga0207699_10049055 | Ga0207699_100490553 | 275 |
| 230 | 3300025912 | Ga0207707_10329085 | Ga0207707_103290852 | 275 |
| 231 | 3300025928 | Ga0207700_10157297 | Ga0207700_101572973 | 275 |
| 232 | 3300025932 | Ga0207690_10044119 | Ga0207690_100441192 | 275 |
| 233 | 3300025934 | Ga0207686_10034158 | Ga0207686_100341583 | 275 |
| 234 | 3300025949 | Ga0207667_10021274 | Ga0207667_100212744 | 275 |
| 235 | 3300026089 | Ga0207648_10274269 | Ga0207648_102742692 | 275 |
| 236 | 3300049571 | Ga0501034_0136391 | Ga0501034_0136391_643_1497 | 275 |
| 237 | 3300049573 | Ga0501037_0172105 | Ga0501037_0172105_468_1322 | 275 |
| 238 | 3300049588 | Ga0501072_0168067 | Ga0501072_0168067_775_1662 | 275 |
| 239 | 3300050507 | nmdc:mga05p37_358558_c1 | nmdc:mga05p37_358558_c1_507_1451 | 275 |
| 240 | 3300050510 | nmdc:mga06r32_214387_c1 | nmdc:mga06r32_214387_c1_930_1874 | 275 |
| 241 | 3300053087 | Ga0500643_001251 | Ga0500643_001251_1146_2045 | 275 |
| 242 | 3300053088 | Ga0500644_0000533 | Ga0500644_0000533_2776_3675 | 275 |
| 243 | 3300053093 | Ga0500651_0001643 | Ga0500651_0001643_5759_6658 | 275 |
| 244 | 3300053094 | Ga0500566_0032693 | Ga0500566_0032693_1709_2608 | 275 |
| 245 | 3300053119 | Ga0500595_000002 | Ga0500595_000002_981068_981967 | 275 |
| 246 | 3300053153 | Ga0500616_0000002 | Ga0500616_0000002_1091715_1092614 | 275 |
| 247 | iso_pu_bacteria | 2513237141 | 2513887472 | 275 |
| 248 | iso_pu_bacteria | 2894817345 | 2894820490 | 275 |
| 249 | iso_pu_bacteria | 2929199973 | 2929205503 | 275 |
| 250 | iso_pu_bacteria | 8001845381 | 8001849991 | 275 |
| 251 | iso_pu_bacteria | 8006994254 | 8006998552 | 275 |
| 252 | iso_pu_bacteria | 8055909800 | 8055914500 | 275 |
| 253 | 3300001989 | JGI24739J22299_10031199 | JGI24739J22299_100311993 | 276 |
| 254 | 3300005328 | Ga0070676_10056064 | Ga0070676_100560642 | 276 |
| 255 | 3300005330 | Ga0070690_100145626 | Ga0070690_1001456263 | 276 |
| 256 | 3300005331 | Ga0070670_100048139 | Ga0070670_1000481393 | 276 |
| 257 | 3300005334 | Ga0068869_100052862 | Ga0068869_1000528622 | 276 |
| 258 | 3300005335 | Ga0070666_10367110 | Ga0070666_103671101 | 276 |
| 259 | 3300005336 | Ga0070680_100030489 | Ga0070680_1000304892 | 276 |
| 260 | 3300005338 | Ga0068868_100047184 | Ga0068868_1000471842 | 276 |
| 261 | 3300005339 | Ga0070660_100241659 | Ga0070660_1002416592 | 276 |
| 262 | 3300005339 | Ga0070660_100334349 | Ga0070660_1003343491 | 276 |
| 263 | 3300005343 | Ga0070687_100031773 | Ga0070687_1000317733 | 276 |
| 264 | 3300005345 | Ga0070692_10142743 | Ga0070692_101427431 | 276 |
| 265 | 3300005347 | Ga0070668_100139662 | Ga0070668_1001396621 | 276 |
| 266 | 3300005354 | Ga0070675_100027856 | Ga0070675_1000278566 | 276 |
| 267 | 3300005355 | Ga0070671_100132984 | Ga0070671_1001329843 | 276 |
| 268 | 3300005364 | Ga0070673_100107335 | Ga0070673_1001073352 | 276 |
| 269 | 3300005366 | Ga0070659_100056042 | Ga0070659_1000560423 | 276 |
| 270 | 3300005366 | Ga0070659_100115383 | Ga0070659_1001153832 | 276 |
| 271 | 3300005367 | Ga0070667_100044105 | Ga0070667_1000441054 | 276 |
| 272 | 3300005367 | Ga0070667_100181233 | Ga0070667_1001812331 | 276 |
| 273 | 3300005435 | Ga0070714_100224507 | Ga0070714_1002245072 | 276 |
| 274 | 3300005436 | Ga0070713_100168782 | Ga0070713_1001687823 | 276 |
| 275 | 3300005437 | Ga0070710_10081532 | Ga0070710_100815322 | 276 |
| 276 | 3300005439 | Ga0070711_100319821 | Ga0070711_1003198212 | 276 |
| 277 | 3300005441 | Ga0070700_100422605 | Ga0070700_1004226051 | 276 |
| 278 | 3300005457 | Ga0070662_100020307 | Ga0070662_1000203071 | 276 |
| 279 | 3300005457 | Ga0070662_100248845 | Ga0070662_1002488452 | 276 |
| 280 | 3300005466 | Ga0070685_10014330 | Ga0070685_100143305 | 276 |
| 281 | 3300005467 | Ga0070706_100241629 | Ga0070706_1002416292 | 276 |
| 282 | 3300005468 | Ga0070707_100127762 | Ga0070707_1001277622 | 276 |
| 283 | 3300005471 | Ga0070698_100005261 | Ga0070698_1000052618 | 276 |
| 284 | 3300005539 | Ga0068853_100060774 | Ga0068853_1000607741 | 276 |
| 285 | 3300005539 | Ga0068853_100114427 | Ga0068853_1001144273 | 276 |
| 286 | 3300005547 | Ga0070693_100112991 | Ga0070693_1001129913 | 276 |
| 287 | 3300005549 | Ga0070704_100261957 | Ga0070704_1002619571 | 276 |
| 288 | 3300005578 | Ga0068854_100062641 | Ga0068854_1000626412 | 276 |
| 289 | 3300005616 | Ga0068852_100104089 | Ga0068852_1001040893 | 276 |
| 290 | 3300005719 | Ga0068861_100376780 | Ga0068861_1003767802 | 276 |
| 291 | 3300005834 | Ga0068851_10086111 | Ga0068851_100861112 | 276 |
| 292 | 3300005840 | Ga0068870_10004317 | Ga0068870_100043172 | 276 |
| 293 | 3300005841 | Ga0068863_100172388 | Ga0068863_1001723883 | 276 |
| 294 | 3300005843 | Ga0068860_100107413 | Ga0068860_1001074133 | 276 |
| 295 | 3300005844 | Ga0068862_100152635 | Ga0068862_1001526351 | 276 |
| 296 | 3300005983 | Ga0081540_1000027 | Ga0081540_100002734 | 276 |
| 297 | 3300006028 | Ga0070717_10002083 | Ga0070717_100020832 | 276 |
| 298 | 3300006028 | Ga0070717_10063067 | Ga0070717_100630673 | 276 |
| 299 | 3300006028 | Ga0070717_10174051 | Ga0070717_101740512 | 276 |
| 300 | 3300006028 | Ga0070717_10571280 | Ga0070717_105712802 | 276 |
| 301 | 3300006038 | Ga0075365_10001829 | Ga0075365_100018292 | 276 |
| 302 | 3300006038 | Ga0075365_10001918 | Ga0075365_100019182 | 276 |
| 303 | 3300006163 | Ga0070715_10057089 | Ga0070715_100570892 | 276 |
| 304 | 3300006175 | Ga0070712_100000210 | Ga0070712_10000021013 | 276 |
| 305 | 3300006175 | Ga0070712_100076021 | Ga0070712_1000760212 | 276 |
| 306 | 3300006175 | Ga0070712_100129627 | Ga0070712_1001296271 | 276 |
| 307 | 3300006178 | Ga0075367_10049089 | Ga0075367_100490891 | 276 |
| 308 | 3300006178 | Ga0075367_10097787 | Ga0075367_100977872 | 276 |
| 309 | 3300006237 | Ga0097621_100092306 | Ga0097621_1000923063 | 276 |
| 310 | 3300006846 | Ga0075430_100004969 | Ga0075430_1000049697 | 276 |
| 311 | 3300006881 | Ga0068865_100108753 | Ga0068865_1001087533 | 276 |
| 312 | 3300007788 | Ga0099795_10063617 | Ga0099795_100636172 | 276 |
| 313 | 3300009098 | Ga0105245_10004787 | Ga0105245_100047872 | 276 |
| 314 | 3300009098 | Ga0105245_10368055 | Ga0105245_103680551 | 276 |
| 315 | 3300009101 | Ga0105247_10003270 | Ga0105247_100032706 | 276 |
| 316 | 3300009148 | Ga0105243_10037948 | Ga0105243_100379484 | 276 |
| 317 | 3300009177 | Ga0105248_10025905 | Ga0105248_100259053 | 276 |
| 318 | 3300009545 | Ga0105237_10205238 | Ga0105237_102052383 | 276 |
| 319 | 3300009551 | Ga0105238_10297722 | Ga0105238_102977222 | 276 |
| 320 | 3300010159 | Ga0099796_10038401 | Ga0099796_100384012 | 276 |
| 321 | 3300010159 | Ga0099796_10072966 | Ga0099796_100729661 | 276 |
| 322 | 3300011119 | Ga0105246_10041134 | Ga0105246_100411342 | 276 |
| 323 | 3300013296 | Ga0157374_10095661 | Ga0157374_100956612 | 276 |
| 324 | 3300013297 | Ga0157378_10088994 | Ga0157378_100889942 | 276 |
| 325 | 3300014326 | Ga0157380_10059935 | Ga0157380_100599355 | 276 |
| 326 | 3300014968 | Ga0157379_10309899 | Ga0157379_103098991 | 276 |
| 327 | 3300021384 | Ga0213876_10000346 | Ga0213876_1000034613 | 276 |
| 328 | 3300021388 | Ga0213875_10000098 | Ga0213875_100000981 | 276 |
| 329 | 3300024227 | Ga0228598_1001518 | Ga0228598_10015182 | 276 |
| 330 | 3300025898 | Ga0207692_10283508 | Ga0207692_102835082 | 276 |
| 331 | 3300025901 | Ga0207688_10001072 | Ga0207688_1000107211 | 276 |
| 332 | 3300025903 | Ga0207680_10084601 | Ga0207680_100846012 | 276 |
| 333 | 3300025905 | Ga0207685_10037311 | Ga0207685_100373112 | 276 |
| 334 | 3300025906 | Ga0207699_10249241 | Ga0207699_102492411 | 276 |
| 335 | 3300025907 | Ga0207645_10005025 | Ga0207645_100050259 | 276 |
| 336 | 3300025908 | Ga0207643_10000532 | Ga0207643_1000053210 | 276 |
| 337 | 3300025910 | Ga0207684_10190965 | Ga0207684_101909652 | 276 |
| 338 | 3300025915 | Ga0207693_10002870 | Ga0207693_1000287012 | 276 |
| 339 | 3300025915 | Ga0207693_10005583 | Ga0207693_100055837 | 276 |
| 340 | 3300025915 | Ga0207693_10235354 | Ga0207693_102353542 | 276 |
| 341 | 3300025916 | Ga0207663_10162680 | Ga0207663_101626802 | 276 |
| 342 | 3300025918 | Ga0207662_10009678 | Ga0207662_100096783 | 276 |
| 343 | 3300025919 | Ga0207657_10019229 | Ga0207657_1001922911 | 276 |
| 344 | 3300025922 | Ga0207646_10251517 | Ga0207646_102515171 | 276 |
| 345 | 3300025923 | Ga0207681_10251936 | Ga0207681_102519362 | 276 |
| 346 | 3300025926 | Ga0207659_10051882 | Ga0207659_100518822 | 276 |
| 347 | 3300025927 | Ga0207687_10008071 | Ga0207687_100080711 | 276 |
| 348 | 3300025928 | Ga0207700_10063040 | Ga0207700_100630404 | 276 |
| 349 | 3300025928 | Ga0207700_10111611 | Ga0207700_101116113 | 276 |
| 350 | 3300025928 | Ga0207700_10303250 | Ga0207700_103032501 | 276 |
| 351 | 3300025931 | Ga0207644_10194363 | Ga0207644_101943633 | 276 |
| 352 | 3300025933 | Ga0207706_10017396 | Ga0207706_100173965 | 276 |
| 353 | 3300025936 | Ga0207670_10113184 | Ga0207670_101131842 | 276 |
| 354 | 3300025937 | Ga0207669_10078652 | Ga0207669_100786521 | 276 |
| 355 | 3300025940 | Ga0207691_10030766 | Ga0207691_100307668 | 276 |
| 356 | 3300025942 | Ga0207689_10009477 | Ga0207689_100094775 | 276 |
| 357 | 3300025960 | Ga0207651_10001012 | Ga0207651_100010126 | 276 |
| 358 | 3300025960 | Ga0207651_10098996 | Ga0207651_100989962 | 276 |
| 359 | 3300025960 | Ga0207651_10352342 | Ga0207651_103523422 | 276 |
| 360 | 3300025972 | Ga0207668_10330485 | Ga0207668_103304851 | 276 |
| 361 | 3300025986 | Ga0207658_10205748 | Ga0207658_102057482 | 276 |
| 362 | 3300025986 | Ga0207658_10291668 | Ga0207658_102916681 | 276 |
| 363 | 3300026023 | Ga0207677_10058963 | Ga0207677_100589632 | 276 |
| 364 | 3300026023 | Ga0207677_10213254 | Ga0207677_102132542 | 276 |
| 365 | 3300026041 | Ga0207639_10019630 | Ga0207639_100196305 | 276 |
| 366 | 3300026067 | Ga0207678_10020636 | Ga0207678_100206365 | 276 |
| 367 | 3300026075 | Ga0207708_10027941 | Ga0207708_100279414 | 276 |
| 368 | 3300026078 | Ga0207702_10564676 | Ga0207702_105646761 | 276 |
| 369 | 3300026088 | Ga0207641_10158085 | Ga0207641_101580853 | 276 |
| 370 | 3300026095 | Ga0207676_10339501 | Ga0207676_103395011 | 276 |
| 371 | 3300026118 | Ga0207675_100044992 | Ga0207675_1000449923 | 276 |
| 372 | 3300026121 | Ga0207683_10063915 | Ga0207683_100639154 | 276 |
| 373 | 3300026142 | Ga0207698_10108423 | Ga0207698_101084233 | 276 |
| 374 | 3300028380 | Ga0268265_10408757 | Ga0268265_104087572 | 276 |
| 375 | 3300028381 | Ga0268264_10691708 | Ga0268264_106917081 | 276 |
| 376 | 3300028577 | Ga0265318_10000046 | Ga0265318_10000046101 | 276 |
| 377 | 3300030760 | Ga0265762_1006912 | Ga0265762_10069122 | 276 |
| 378 | 3300031235 | Ga0265330_10047336 | Ga0265330_100473362 | 276 |
| 379 | 3300031247 | Ga0265340_10025504 | Ga0265340_100255042 | 276 |
| 380 | 3300031249 | Ga0265339_10002691 | Ga0265339_100026916 | 276 |
| 381 | 3300031595 | Ga0265313_10000024 | Ga0265313_10000024134 | 276 |
| 382 | 3300035111 | Ga0373923_0110406 | Ga0373923_0110406_252_1145 | 276 |
| 383 | 3300035119 | Ga0373956_0002426 | Ga0373956_0002426_4186_5079 | 276 |
| 384 | 3300035119 | Ga0373956_0024994 | Ga0373956_0024994_1646_2539 | 276 |
| 385 | 3300035170 | Ga0373943_0016037 | Ga0373943_0016037_895_1788 | 276 |
| 386 | 3300035172 | Ga0373955_0003015 | Ga0373955_0003015_5982_6875 | 276 |
| 387 | 3300035410 | Ga0373924_0127105 | Ga0373924_0127105_130_1023 | 276 |
| 388 | 3300035692 | Ga0373935_0070177 | Ga0373935_0070177_191_1099 | 276 |
| 389 | 3300035695 | Ga0373927_0031222 | Ga0373927_0031222_1052_1945 | 276 |
| 390 | 3300035695 | Ga0373927_0034162 | Ga0373927_0034162_976_1884 | 276 |
| 391 | 3300035695 | Ga0373927_0076618 | Ga0373927_0076618_324_1217 | 276 |
| 392 | 3300035724 | Ga0373933_0000258 | Ga0373933_0000258_12982_13875 | 276 |
| 393 | 3300035724 | Ga0373933_0124883 | Ga0373933_0124883_680_1573 | 276 |
| 394 | 3300036401 | Ga0373937_0049868 | Ga0373937_0049868_2592_3485 | 276 |
| 395 | 3300037068 | Ga0373925_0123671 | Ga0373925_0123671_611_1504 | 276 |
| 396 | 3300037853 | Ga0436364_0235209 | Ga0436364_0235209_641_1513 | 276 |
| 397 | 3300037853 | Ga0436364_1390920 | Ga0436364_1390920_356_1237 | 276 |
| 398 | 3300039437 | Ga0436365_0076921 | Ga0436365_0076921_8889_9785 | 276 |
| 399 | 3300039437 | Ga0436365_0731168 | Ga0436365_0731168_817_1689 | 276 |
| 400 | 3300039437 | Ga0436365_0798167 | Ga0436365_0798167_27724_28584 | 276 |
| 401 | 3300039437 | Ga0436365_1102823 | Ga0436365_1102823_320_1189 | 276 |
| 402 | 3300039438 | Ga0436360_1120596 | Ga0436360_1120596_361_1233 | 276 |
| 403 | 3300039447 | Ga0436361_1104477 | Ga0436361_1104477_659_1531 | 276 |
| 404 | 3300039453 | Ga0436362_1218894 | Ga0436362_1218894_138_1010 | 276 |
| 405 | 3300039453 | Ga0436362_1265935 | Ga0436362_1265935_2125_2997 | 276 |
| 406 | 3300046454 | Ga0495592_0003878 | Ga0495592_0003878_2457_3350 | 276 |
| 407 | 3300046459 | Ga0495629_0020090 | Ga0495629_0020090_1040_1933 | 276 |
| 408 | 3300046462 | Ga0495651_0025351 | Ga0495651_0025351_2533_3426 | 276 |
| 409 | 3300046462 | Ga0495651_0124654 | Ga0495651_0124654_173_1066 | 276 |
| 410 | 3300046463 | Ga0495653_0018848 | Ga0495653_0018848_2867_3760 | 276 |
| 411 | 3300046463 | Ga0495653_0113252 | Ga0495653_0113252_96_989 | 276 |
| 412 | 3300046477 | Ga0495664_0015258 | Ga0495664_0015258_935_1828 | 276 |
| 413 | 3300046511 | Ga0495608_0000398 | Ga0495608_0000398_17055_17948 | 276 |
| 414 | 3300046514 | Ga0495618_0223287 | Ga0495618_0223287_249_1142 | 276 |
| 415 | 3300046516 | Ga0495628_0046997 | Ga0495628_0046997_1608_2501 | 276 |
| 416 | 3300046516 | Ga0495628_0173442 | Ga0495628_0173442_373_1266 | 276 |
| 417 | 3300046529 | Ga0495652_0117068 | Ga0495652_0117068_1190_2083 | 276 |
| 418 | 3300046529 | Ga0495652_0177613 | Ga0495652_0177613_374_1267 | 276 |
| 419 | 3300046533 | Ga0495640_0036273 | Ga0495640_0036273_1509_2402 | 276 |
| 420 | 3300046536 | Ga0495587_0000599 | Ga0495587_0000599_15146_16039 | 276 |
| 421 | 3300046537 | Ga0495598_0006329 | Ga0495598_0006329_1379_2272 | 276 |
| 422 | 3300046538 | Ga0495609_0086862 | Ga0495609_0086862_428_1321 | 276 |
| 423 | 3300046543 | Ga0495645_0026193 | Ga0495645_0026193_3169_4062 | 276 |
| 424 | 3300046559 | Ga0495667_0043859 | Ga0495667_0043859_281_1174 | 276 |
| 425 | 3300046615 | Ga0495656_0016225 | Ga0495656_0016225_134_1030 | 276 |
| 426 | 3300046642 | Ga0495634_0017214 | Ga0495634_0017214_2925_3818 | 276 |
| 427 | 3300046663 | Ga0495635_0051635 | Ga0495635_0051635_1058_1951 | 276 |
| 428 | 3300046675 | Ga0495657_0014016 | Ga0495657_0014016_1980_2873 | 276 |
| 429 | 3300046675 | Ga0495657_0150578 | Ga0495657_0150578_307_1200 | 276 |
| 430 | 3300046678 | Ga0495599_0005233 | Ga0495599_0005233_5177_6070 | 276 |
| 431 | 3300046678 | Ga0495599_0039924 | Ga0495599_0039924_496_1389 | 276 |
| 432 | 3300046679 | Ga0495623_0006342 | Ga0495623_0006342_4149_5042 | 276 |
| 433 | 3300046684 | Ga0495669_0033891 | Ga0495669_0033891_1157_2050 | 276 |
| 434 | 3300046694 | Ga0495649_0065369 | Ga0495649_0065369_110_1003 | 276 |
| 435 | 3300046809 | Ga0495600_0001478 | Ga0495600_0001478_6258_7151 | 276 |
| 436 | 3300047317 | Ga0495604_0014602 | Ga0495604_0014602_680_1573 | 276 |
| 437 | 3300047317 | Ga0495604_0108363 | Ga0495604_0108363_604_1497 | 276 |
| 438 | 3300047319 | Ga0495674_0045284 | Ga0495674_0045284_1728_2621 | 276 |
| 439 | 3300047322 | Ga0495680_0000313 | Ga0495680_0000313_16051_16944 | 276 |
| 440 | 3300047471 | Ga0495684_0257886 | Ga0495684_0257886_232_1125 | 276 |
| 441 | 3300048088 | Ga0495602_0059824 | Ga0495602_0059824_1221_2114 | 276 |
| 442 | 3300048903 | Ga0496100_0015869 | Ga0496100_0015869_805_1698 | 276 |
| 443 | 3300048904 | Ga0496101_0001983 | Ga0496101_0001983_119_1012 | 276 |
| 444 | 3300048905 | Ga0496102_0159788 | Ga0496102_0159788_805_1698 | 276 |
| 445 | 3300048906 | Ga0496103_0013950 | Ga0496103_0013950_3313_4206 | 276 |
| 446 | 3300048909 | Ga0496106_0317929 | Ga0496106_0317929_94_987 | 276 |
| 447 | 3300048910 | Ga0496107_0019014 | Ga0496107_0019014_3753_4646 | 276 |
| 448 | 3300048911 | Ga0496108_0009284 | Ga0496108_0009284_3453_4346 | 276 |
| 449 | 3300048913 | Ga0496110_0142547 | Ga0496110_0142547_1216_2109 | 276 |
| 450 | 3300048914 | Ga0496111_0081065 | Ga0496111_0081065_1377_2270 | 276 |
| 451 | 3300048915 | Ga0496112_0007378 | Ga0496112_0007378_1744_2637 | 276 |
| 452 | 3300048915 | Ga0496112_0046849 | Ga0496112_0046849_364_1257 | 276 |
| 453 | 3300048916 | Ga0496113_0017064 | Ga0496113_0017064_401_1294 | 276 |
| 454 | 3300048918 | Ga0496115_0008385 | Ga0496115_0008385_6439_7332 | 276 |
| 455 | 3300049571 | Ga0501034_0011170 | Ga0501034_0011170_2521_3417 | 276 |
| 456 | 3300049571 | Ga0501034_0367092 | Ga0501034_0367092_160_1068 | 276 |
| 457 | 3300049572 | Ga0501036_0070213 | Ga0501036_0070213_1407_2294 | 276 |
| 458 | 3300049579 | Ga0501043_0041532 | Ga0501043_0041532_2495_3382 | 276 |
| 459 | 3300049581 | Ga0501047_0012173 | Ga0501047_0012173_3268_4179 | 276 |
| 460 | 3300049581 | Ga0501047_0205392 | Ga0501047_0205392_597_1484 | 276 |
| 461 | 3300049586 | Ga0501070_0024998 | Ga0501070_0024998_2589_3485 | 276 |
| 462 | 3300049586 | Ga0501070_0204314 | Ga0501070_0204314_627_1538 | 276 |
| 463 | 3300049587 | Ga0501071_0022307 | Ga0501071_0022307_2710_3606 | 276 |
| 464 | 3300049591 | Ga0501075_0046475 | Ga0501075_0046475_1977_2900 | 276 |
| 465 | 3300049591 | Ga0501075_0077585 | Ga0501075_0077585_1482_2390 | 276 |
| 466 | 3300049592 | Ga0501076_0171895 | Ga0501076_0171895_820_1743 | 276 |
| 467 | 3300049741 | Ga0501079_0054277 | Ga0501079_0054277_269_1192 | 276 |
| 468 | 3300049743 | Ga0501081_0132933 | Ga0501081_0132933_227_1150 | 276 |
| 469 | 3300049822 | Ga0501035_0070987 | Ga0501035_0070987_1750_2637 | 276 |
| 470 | 3300049822 | Ga0501035_0071340 | Ga0501035_0071340_978_1874 | 276 |
| 471 | 3300049823 | Ga0501044_0000266 | Ga0501044_0000266_56979_57887 | 276 |
| 472 | 3300049823 | Ga0501044_0030690 | Ga0501044_0030690_2557_3444 | 276 |
| 473 | 3300049823 | Ga0501044_0067189 | Ga0501044_0067189_1767_2663 | 276 |
| 474 | 3300049824 | Ga0501045_0148673 | Ga0501045_0148673_143_1066 | 276 |
| 475 | 3300050492 | nmdc:mga0yw44_1073_c2 | nmdc:mga0yw44_1073_c2_1148_2062 | 276 |
| 476 | 3300050492 | nmdc:mga0yw44_813_c1 | nmdc:mga0yw44_813_c1_10420_11313 | 276 |
| 477 | 3300050507 | nmdc:mga05p37_82855_c1 | nmdc:mga05p37_82855_c1_61_954 | 276 |
| 478 | 3300050509 | nmdc:mga0qj67_50_c1 | nmdc:mga0qj67_50_c1_12783_13676 | 276 |
| 479 | 3300050510 | nmdc:mga06r32_94551_c1 | nmdc:mga06r32_94551_c1_1242_2171 | 276 |
| 480 | 3300053077 | Ga0495601_0000589 | Ga0495601_0000589_2601_3494 | 276 |
| 481 | 3300053078 | Ga0495612_0002637 | Ga0495612_0002637_5022_5915 | 276 |
| 482 | 3300053084 | Ga0495595_0001037 | Ga0495595_0001037_2534_3427 | 276 |
| 483 | 3300053085 | Ga0495619_0005308 | Ga0495619_0005308_4734_5627 | 276 |
| 484 | 3300053096 | Ga0500641_0133642 | Ga0500641_0133642_112_1005 | 276 |
| 485 | 3300060353 | Ga0501082_0018385 | Ga0501082_0018385_2550_3446 | 276 |
| 486 | iso_pu_bacteria | 2508501042 | 2508690778 | 276 |
| 487 | iso_pu_bacteria | 2508501042 | 2508693413 | 276 |
| 488 | iso_pu_bacteria | 2511231028 | 2511397754 | 276 |
| 489 | iso_pu_bacteria | 2513237094 | 2513637168 | 276 |
| 490 | iso_pu_bacteria | 2513237095 | 2513651577 | 276 |
| 491 | iso_pu_bacteria | 2513237098 | 2513677753 | 276 |
| 492 | iso_pu_bacteria | 2513237101 | 2513693268 | 276 |
| 493 | iso_pu_bacteria | 2513237102 | 2513702709 | 276 |
| 494 | iso_pu_bacteria | 2513237104 | 2513717462 | 276 |
| 495 | iso_pu_bacteria | 2513237139 | 2513876138 | 276 |
| 496 | iso_pu_bacteria | 2513237139 | 2513876737 | 276 |
| 497 | iso_pu_bacteria | 2513237161 | 2514012222 | 276 |
| 498 | iso_pu_bacteria | 2517093001 | 2517104872 | 276 |
| 499 | iso_pu_bacteria | 2524023210 | 2524467739 | 276 |
| 500 | iso_pu_bacteria | 2528768022 | 2528857425 | 276 |
| 501 | iso_pu_bacteria | 2617270735 | 2617347987 | 276 |
| 502 | iso_pu_bacteria | 2643221651 | 2644289454 | 276 |
| 503 | iso_pu_bacteria | 2721755755 | 2723848178 | 276 |
| 504 | iso_pu_bacteria | 2791355196 | 2793065523 | 276 |
| 505 | iso_pu_bacteria | 2791355199 | 2793078112 | 276 |
| 506 | iso_pu_bacteria | 2802429603 | 2805918717 | 276 |
| 507 | iso_pu_bacteria | 2816332527 | 2818243838 | 276 |
| 508 | iso_pu_bacteria | 2824617872 | 2824623635 | 276 |
| 509 | iso_pu_bacteria | 2824626560 | 2824632448 | 276 |
| 510 | iso_pu_bacteria | 2824635225 | 2824639904 | 276 |
| 511 | iso_pu_bacteria | 2824644064 | 2824646462 | 276 |
| 512 | iso_pu_bacteria | 2824661429 | 2824668480 | 276 |
| 513 | iso_pu_bacteria | 2824679649 | 2824684180 | 276 |
| 514 | iso_pu_bacteria | 2824704595 | 2824708427 | 276 |
| 515 | iso_pu_bacteria | 2824714736 | 2824717231 | 276 |
| 516 | iso_pu_bacteria | 2824723954 | 2824726929 | 276 |
| 517 | iso_pu_bacteria | 2824753945 | 2824762391 | 276 |
| 518 | iso_pu_bacteria | 2824763712 | 2824770742 | 276 |
| 519 | iso_pu_bacteria | 2829745981 | 2829750286 | 276 |
| 520 | iso_pu_bacteria | 2841957949 | 2841961629 | 276 |
| 521 | iso_pu_bacteria | 2842038055 | 2842041221 | 276 |
| 522 | iso_pu_bacteria | 2842045827 | 2842045834 | 276 |
| 523 | iso_pu_bacteria | 2847930680 | 2847938002 | 276 |
| 524 | iso_pu_bacteria | 2861691609 | 2861696454 | 276 |
| 525 | iso_pu_bacteria | 2874604998 | 2874608834 | 276 |
| 526 | iso_pu_bacteria | 2874620515 | 2874625446 | 276 |
| 527 | iso_pu_bacteria | 2874628541 | 2874632845 | 276 |
| 528 | iso_pu_bacteria | 2876761206 | 2876769076 | 276 |
| 529 | iso_pu_bacteria | 2876808645 | 2876813897 | 276 |
| 530 | iso_pu_bacteria | 2879083081 | 2879084450 | 276 |
| 531 | iso_pu_bacteria | 2879099564 | 2879105326 | 276 |
| 532 | iso_pu_bacteria | 2879110137 | 2879115438 | 276 |
| 533 | iso_pu_bacteria | 2881364244 | 2881367852 | 276 |
| 534 | iso_pu_bacteria | 2885366525 | 2885368428 | 276 |
| 535 | iso_pu_bacteria | 2885383462 | 2885390392 | 276 |
| 536 | iso_pu_bacteria | 2888378607 | 2888385980 | 276 |
| 537 | iso_pu_bacteria | 2889033259 | 2889037306 | 276 |
| 538 | iso_pu_bacteria | 2903768456 | 2903774286 | 276 |
| 539 | iso_pu_bacteria | 2904666416 | 2904670595 | 276 |
| 540 | iso_pu_bacteria | 2904711408 | 2904711415 | 276 |
| 541 | iso_pu_bacteria | 2906626472 | 2906626594 | 276 |
| 542 | iso_pu_bacteria | 2906643746 | 2906647068 | 276 |
| 543 | iso_pu_bacteria | 2922361189 | 2922361436 | 276 |
| 544 | iso_pu_bacteria | 2922368715 | 2922376300 | 276 |
| 545 | iso_pu_bacteria | 2922386360 | 2922388859 | 276 |
| 546 | iso_pu_bacteria | 2922393267 | 2922399985 | 276 |
| 547 | iso_pu_bacteria | 2929615660 | 2929624268 | 276 |
| 548 | iso_pu_bacteria | 2929624759 | 2929633306 | 276 |
| 549 | iso_pu_bacteria | 2932784394 | 2932789450 | 276 |
| 550 | iso_pu_bacteria | 2932784394 | 2932793600 | 276 |
| 551 | iso_pu_bacteria | 2932801729 | 2932804303 | 276 |
| 552 | iso_pu_bacteria | 2932809354 | 2932816499 | 276 |
| 553 | iso_pu_bacteria | 2932818245 | 2932827380 | 276 |
| 554 | iso_pu_bacteria | 2932828146 | 2932832057 | 276 |
| 555 | iso_pu_bacteria | 2933577622 | 2933585983 | 276 |
| 556 | iso_pu_bacteria | 2935616580 | 2935621996 | 276 |
| 557 | iso_pu_bacteria | 2935638405 | 2935643994 | 276 |
| 558 | iso_pu_bacteria | 2935648319 | 2935653099 | 276 |
| 559 | iso_pu_bacteria | 2935648319 | 2935654378 | 276 |
| 560 | iso_pu_bacteria | 2935656913 | 2935661682 | 276 |
| 561 | iso_pu_bacteria | 2935656913 | 2935663258 | 276 |
| 562 | iso_pu_bacteria | 2935665750 | 2935669091 | 276 |
| 563 | iso_pu_bacteria | 2935675223 | 2935683351 | 276 |
| 564 | iso_pu_bacteria | 2935684952 | 2935692292 | 276 |
| 565 | iso_pu_bacteria | 2935694250 | 2935700537 | 276 |
| 566 | iso_pu_bacteria | 2935703347 | 2935708834 | 276 |
| 567 | iso_pu_bacteria | 2935713505 | 2935720470 | 276 |
| 568 | iso_pu_bacteria | 2935722832 | 2935729751 | 276 |
| 569 | iso_pu_bacteria | 2935732158 | 2935739267 | 276 |
| 570 | iso_pu_bacteria | 2935741537 | 2935748192 | 276 |
| 571 | iso_pu_bacteria | 2935750917 | 2935758395 | 276 |
| 572 | iso_pu_bacteria | 2935760218 | 2935767474 | 276 |
| 573 | iso_pu_bacteria | 2935760218 | 2935769628 | 276 |
| 574 | iso_pu_bacteria | 2935801545 | 2935805807 | 276 |
| 575 | iso_pu_bacteria | 2935810662 | 2935815635 | 276 |
| 576 | iso_pu_bacteria | 2935827899 | 2935833246 | 276 |
| 577 | iso_pu_bacteria | 2935837841 | 2935843179 | 276 |
| 578 | iso_pu_bacteria | 2935837841 | 2935845911 | 276 |
| 579 | iso_pu_bacteria | 2935855204 | 2935860243 | 276 |
| 580 | iso_pu_bacteria | 2935864058 | 2935867640 | 276 |
| 581 | iso_pu_bacteria | 2935873716 | 2935878550 | 276 |
| 582 | iso_pu_bacteria | 2935873716 | 2935880038 | 276 |
| 583 | iso_pu_bacteria | 2935908558 | 2935912805 | 276 |
| 584 | iso_pu_bacteria | 2935916978 | 2935922876 | 276 |
| 585 | iso_pu_bacteria | 2935926038 | 2935930301 | 276 |
| 586 | iso_pu_bacteria | 2935934488 | 2935939201 | 276 |
| 587 | iso_pu_bacteria | 2935942939 | 2935946149 | 276 |
| 588 | iso_pu_bacteria | 2935951376 | 2935955486 | 276 |
| 589 | iso_pu_bacteria | 2935967501 | 2935972143 | 276 |
| 590 | iso_pu_bacteria | 2935992306 | 2935998173 | 276 |
| 591 | iso_pu_bacteria | 2936002035 | 2936006873 | 276 |
| 592 | iso_pu_bacteria | 2936011229 | 2936015961 | 276 |
| 593 | iso_pu_bacteria | 2936011229 | 2936017414 | 276 |
| 594 | iso_pu_bacteria | 2936019824 | 2936024603 | 276 |
| 595 | iso_pu_bacteria | 2936019824 | 2936025916 | 276 |
| 596 | iso_pu_bacteria | 2936028420 | 2936033833 | 276 |
| 597 | iso_pu_bacteria | 2936028420 | 2936034676 | 276 |
| 598 | iso_pu_bacteria | 2936037263 | 2936040873 | 276 |
| 599 | iso_pu_bacteria | 2936046547 | 2936051704 | 276 |
| 600 | iso_pu_bacteria | 2936046547 | 2936052733 | 276 |
| 601 | iso_pu_bacteria | 2936055302 | 2936059928 | 276 |
| 602 | iso_pu_bacteria | 2936055302 | 2936061662 | 276 |
| 603 | iso_pu_bacteria | 2940556831 | 2940564299 | 276 |
| 604 | iso_pu_bacteria | 2941538514 | 2941544725 | 276 |
| 605 | iso_pu_bacteria | 2941538514 | 2941546054 | 276 |
| 606 | iso_pu_bacteria | 3005506211 | 3005511563 | 276 |
| 607 | iso_pu_bacteria | 3005710791 | 3005716261 | 276 |
| 608 | iso_pu_bacteria | 8006926726 | 8006931418 | 276 |
| 609 | iso_pu_bacteria | 8006933436 | 8006934483 | 276 |
| 610 | iso_pu_bacteria | 8006964411 | 8006968886 | 276 |
| 611 | iso_pu_bacteria | 8006984368 | 8006985233 | 276 |
| 612 | iso_pu_bacteria | 8016511872 | 8016520110 | 276 |
| 613 | iso_pu_bacteria | 8016603502 | 8016603725 | 276 |
| 614 | iso_pu_bacteria | 8016613128 | 8016613780 | 276 |
| 615 | iso_pu_bacteria | 8017057580 | 8017065444 | 276 |
| 616 | iso_pu_bacteria | 8019576017 | 8019584841 | 276 |
| 617 | iso_pu_bacteria | 8019586578 | 8019592790 | 276 |
| 618 | iso_pu_bacteria | 8019597564 | 8019598659 | 276 |
| 619 | iso_pu_bacteria | 8019608314 | 8019609711 | 276 |
| 620 | iso_pu_bacteria | 8055742211 | 8055744573 | 276 |
| 621 | iso_pu_bacteria | 8056673599 | 8056675915 | 276 |
| 622 | 3300003203 | JGI25406J46586_10000449 | JGI25406J46586_1000044918 | 277 |
| 623 | 3300005329 | Ga0070683_100065303 | Ga0070683_1000653032 | 277 |
| 624 | 3300005339 | Ga0070660_100283425 | Ga0070660_1002834252 | 277 |
| 625 | 3300005344 | Ga0070661_100139477 | Ga0070661_1001394771 | 277 |
| 626 | 3300005366 | Ga0070659_100243918 | Ga0070659_1002439181 | 277 |
| 627 | 3300005435 | Ga0070714_100430100 | Ga0070714_1004301002 | 277 |
| 628 | 3300005441 | Ga0070700_100368708 | Ga0070700_1003687081 | 277 |
| 629 | 3300005535 | Ga0070684_100069991 | Ga0070684_1000699912 | 277 |
| 630 | 3300005548 | Ga0070665_100020638 | Ga0070665_1000206383 | 277 |
| 631 | 3300005548 | Ga0070665_100032502 | Ga0070665_1000325028 | 277 |
| 632 | 3300005614 | Ga0068856_100040183 | Ga0068856_1000401832 | 277 |
| 633 | 3300005981 | Ga0081538_10016342 | Ga0081538_100163425 | 277 |
| 634 | 3300005985 | Ga0081539_10001290 | Ga0081539_1000129020 | 277 |
| 635 | 3300006028 | Ga0070717_10266080 | Ga0070717_102660802 | 277 |
| 636 | 3300006028 | Ga0070717_10280886 | Ga0070717_102808862 | 277 |
| 637 | 3300006051 | Ga0075364_10247364 | Ga0075364_102473642 | 277 |
| 638 | 3300006163 | Ga0070715_10033829 | Ga0070715_100338292 | 277 |
| 639 | 3300006195 | Ga0075366_10097533 | Ga0075366_100975331 | 277 |
| 640 | 3300006846 | Ga0075430_100009540 | Ga0075430_1000095402 | 277 |
| 641 | 3300006846 | Ga0075430_100219005 | Ga0075430_1002190052 | 277 |
| 642 | 3300006846 | Ga0075430_100236589 | Ga0075430_1002365892 | 277 |
| 643 | 3300009147 | Ga0114129_10035205 | Ga0114129_100352057 | 277 |
| 644 | 3300009148 | Ga0105243_10158934 | Ga0105243_101589343 | 277 |
| 645 | 3300009545 | Ga0105237_10765192 | Ga0105237_107651921 | 277 |
| 646 | 3300013102 | Ga0157371_10275834 | Ga0157371_102758342 | 277 |
| 647 | 3300013297 | Ga0157378_10398268 | Ga0157378_103982682 | 277 |
| 648 | 3300013307 | Ga0157372_10026601 | Ga0157372_100266016 | 277 |
| 649 | 3300013307 | Ga0157372_10136025 | Ga0157372_101360252 | 277 |
| 650 | 3300014326 | Ga0157380_10197691 | Ga0157380_101976912 | 277 |
| 651 | 3300021388 | Ga0213875_10000122 | Ga0213875_1000012247 | 277 |
| 652 | 3300025302 | Ga0207426_1010749 | Ga0207426_10107492 | 277 |
| 653 | 3300025906 | Ga0207699_10007606 | Ga0207699_100076064 | 277 |
| 654 | 3300025919 | Ga0207657_10215280 | Ga0207657_102152803 | 277 |
| 655 | 3300025919 | Ga0207657_10315064 | Ga0207657_103150642 | 277 |
| 656 | 3300025924 | Ga0207694_10077700 | Ga0207694_100777002 | 277 |
| 657 | 3300025932 | Ga0207690_10201295 | Ga0207690_102012952 | 277 |
| 658 | 3300025939 | Ga0207665_10125730 | Ga0207665_101257302 | 277 |
| 659 | 3300025939 | Ga0207665_10183928 | Ga0207665_101839281 | 277 |
| 660 | 3300025940 | Ga0207691_10214545 | Ga0207691_102145452 | 277 |
| 661 | 3300025944 | Ga0207661_10191420 | Ga0207661_101914202 | 277 |
| 662 | 3300025986 | Ga0207658_10495527 | Ga0207658_104955271 | 277 |
| 663 | 3300026041 | Ga0207639_10312904 | Ga0207639_103129042 | 277 |
| 664 | 3300026078 | Ga0207702_10014085 | Ga0207702_100140854 | 277 |
| 665 | 3300026142 | Ga0207698_10120100 | Ga0207698_101201001 | 277 |
| 666 | 3300031824 | Ga0307413_10172951 | Ga0307413_101729511 | 277 |
| 667 | 3300031901 | Ga0307406_10256942 | Ga0307406_102569422 | 277 |
| 668 | 3300031903 | Ga0307407_10094299 | Ga0307407_100942991 | 277 |
| 669 | 3300031995 | Ga0307409_100051758 | Ga0307409_1000517582 | 277 |
| 670 | 3300032002 | Ga0307416_100105994 | Ga0307416_1001059942 | 277 |
| 671 | 3300032126 | Ga0307415_100005649 | Ga0307415_1000056495 | 277 |
| 672 | 3300032126 | Ga0307415_100493549 | Ga0307415_1004935492 | 277 |
| 673 | 3300035113 | Ga0373936_0031865 | Ga0373936_0031865_627_1514 | 277 |
| 674 | 3300035398 | Ga0316574_0102778 | Ga0316574_0102778_860_1762 | 277 |
| 675 | 3300037853 | Ga0436364_0423755 | Ga0436364_0423755_47463_48353 | 277 |
| 676 | 3300039437 | Ga0436365_0293736 | Ga0436365_0293736_58_948 | 277 |
| 677 | 3300042001 | Ga0439441_022654 | Ga0439441_022654_78_950 | 277 |
| 678 | 3300044656 | Ga0466969_0063638 | Ga0466969_0063638_795_1679 | 277 |
| 679 | 3300044694 | Ga0466963_0020642 | Ga0466963_0020642_1073_1936 | 277 |
| 680 | 3300044706 | Ga0466964_0026242 | Ga0466964_0026242_320_1183 | 277 |
| 681 | 3300044842 | Ga0466957_0010425 | Ga0466957_0010425_3511_4374 | 277 |
| 682 | 3300045976 | Ga0466967_0002368 | Ga0466967_0002368_4587_5450 | 277 |
| 683 | 3300046507 | Ga0495606_0003208 | Ga0495606_0003208_6068_6946 | 277 |
| 684 | 3300047320 | Ga0495672_0114140 | Ga0495672_0114140_97_969 | 277 |
| 685 | 3300049571 | Ga0501034_0001175 | Ga0501034_0001175_33696_34559 | 277 |
| 686 | 3300049571 | Ga0501034_0387252 | Ga0501034_0387252_415_1278 | 277 |
| 687 | 3300049581 | Ga0501047_0132937 | Ga0501047_0132937_918_1781 | 277 |
| 688 | 3300049585 | Ga0501069_0295505 | Ga0501069_0295505_30_911 | 277 |
| 689 | 3300049589 | Ga0501073_0022644 | Ga0501073_0022644_175_1089 | 277 |
| 690 | 3300049589 | Ga0501073_0058167 | Ga0501073_0058167_289_1170 | 277 |
| 691 | 3300049590 | Ga0501074_0069404 | Ga0501074_0069404_1489_2403 | 277 |
| 692 | 3300049741 | Ga0501079_0253254 | Ga0501079_0253254_368_1249 | 277 |
| 693 | 3300049741 | Ga0501079_0368635 | Ga0501079_0368635_25_966 | 277 |
| 694 | 3300049742 | Ga0501080_0111454 | Ga0501080_0111454_1490_2371 | 277 |
| 695 | 3300049744 | Ga0501083_0012517 | Ga0501083_0012517_263_1144 | 277 |
| 696 | 3300049823 | Ga0501044_0029012 | Ga0501044_0029012_1758_2639 | 277 |
| 697 | 3300050496 | nmdc:mga07m45_134096_c1 | nmdc:mga07m45_134096_c1_29_934 | 277 |
| 698 | 3300050509 | nmdc:mga0qj67_21529_c1 | nmdc:mga0qj67_21529_c1_53_973 | 277 |
| 699 | 3300050509 | nmdc:mga0qj67_74334_c1 | nmdc:mga0qj67_74334_c1_24_983 | 277 |
| 700 | 3300053153 | Ga0500616_0023517 | Ga0500616_0023517_97_978 | 277 |
| 701 | 3300053158 | Ga0500627_0127748 | Ga0500627_0127748_150_1055 | 277 |
| 702 | 3300054114 | Ga0501084_0053971 | Ga0501084_0053971_2339_3220 | 277 |
| 703 | 3300060353 | Ga0501082_0029700 | Ga0501082_0029700_182_1063 | 277 |
| 704 | 3300060353 | Ga0501082_0312271 | Ga0501082_0312271_84_974 | 277 |
| 705 | iso_pu_bacteria | 2508501050 | 2508727836 | 277 |
| 706 | iso_pu_bacteria | 2508501114 | 2509077574 | 277 |
| 707 | iso_pu_bacteria | 2513237092 | 2513627066 | 277 |
| 708 | iso_pu_bacteria | 2513237096 | 2513655772 | 277 |
| 709 | iso_pu_bacteria | 2513237137 | 2513856734 | 277 |
| 710 | iso_pu_bacteria | 2513237145 | 2513917315 | 277 |
| 711 | iso_pu_bacteria | 2517572143 | 2517895399 | 277 |
| 712 | iso_pu_bacteria | 2524023228 | 2524540499 | 277 |
| 713 | iso_pu_bacteria | 2617270741 | 2617377787 | 277 |
| 714 | iso_pu_bacteria | 2643221733 | 2644731760 | 277 |
| 715 | iso_pu_bacteria | 2728368998 | 2728750867 | 277 |
| 716 | iso_pu_bacteria | 2738541281 | 2738743832 | 277 |
| 717 | iso_pu_bacteria | 2738543032 | 2739353062 | 277 |
| 718 | iso_pu_bacteria | 2773857925 | 2774870387 | 277 |
| 719 | iso_pu_bacteria | 2775506901 | 2776258551 | 277 |
| 720 | iso_pu_bacteria | 2791355197 | 2793069373 | 277 |
| 721 | iso_pu_bacteria | 2824732956 | 2824737328 | 277 |
| 722 | iso_pu_bacteria | 2835312727 | 2835315213 | 277 |
| 723 | iso_pu_bacteria | 2841911363 | 2841915835 | 277 |
| 724 | iso_pu_bacteria | 2841917233 | 2841921785 | 277 |
| 725 | iso_pu_bacteria | 2842698319 | 2842698688 | 277 |
| 726 | iso_pu_bacteria | 2851182111 | 2851187290 | 277 |
| 727 | iso_pu_bacteria | 2874612657 | 2874616833 | 277 |
| 728 | iso_pu_bacteria | 2881665667 | 2881668801 | 277 |
| 729 | iso_pu_bacteria | 2882456835 | 2882460560 | 277 |
| 730 | iso_pu_bacteria | 2885374607 | 2885378936 | 277 |
| 731 | iso_pu_bacteria | 2894232714 | 2894233833 | 277 |
| 732 | iso_pu_bacteria | 2903748898 | 2903759079 | 277 |
| 733 | iso_pu_bacteria | 2904699407 | 2904710862 | 277 |
| 734 | iso_pu_bacteria | 2906610324 | 2906615991 | 277 |
| 735 | iso_pu_bacteria | 2906635258 | 2906639078 | 277 |
| 736 | iso_pu_bacteria | 2906660503 | 2906665223 | 277 |
| 737 | iso_pu_bacteria | 2908775508 | 2908782163 | 277 |
| 738 | iso_pu_bacteria | 2917699015 | 2917704471 | 277 |
| 739 | iso_pu_bacteria | 2922425934 | 2922432042 | 277 |
| 740 | iso_pu_bacteria | 2935630451 | 2935631082 | 277 |
| 741 | iso_pu_bacteria | 2935675223 | 2935680983 | 277 |
| 742 | iso_pu_bacteria | 2935992306 | 2935993692 | 277 |
| 743 | iso_pu_bacteria | 2941507105 | 2941507734 | 277 |
| 744 | iso_pu_bacteria | 2941515067 | 2941516161 | 277 |
| 745 | iso_pu_bacteria | 2941523033 | 2941523131 | 277 |
| 746 | iso_pu_bacteria | 2941531003 | 2941531679 | 277 |
| 747 | iso_pu_bacteria | 3005474847 | 3005476936 | 277 |
| 748 | iso_pu_bacteria | 3005483717 | 3005485622 | 277 |
| 749 | iso_pu_bacteria | 3005587118 | 3005594446 | 277 |
| 750 | iso_pu_bacteria | 8006973647 | 8006974453 | 277 |
| 751 | iso_pu_bacteria | 8019555841 | 8019564199 | 277 |
| 752 | iso_pu_bacteria | 8019565922 | 8019574276 | 277 |
| 753 | iso_pu_bacteria | 8057529695 | 8057531110 | 277 |
| 754 | 3300001979 | JGI24740J21852_10002132 | JGI24740J21852_100021324 | 278 |
| 755 | 3300003203 | JGI25406J46586_10007061 | JGI25406J46586_100070615 | 278 |
| 756 | 3300003215 | JGI25153J46596_10001471 | JGI25153J46596_100014714 | 278 |
| 757 | 3300003354 | JGI25160J50197_1000851 | JGI25160J50197_10008515 | 278 |
| 758 | 3300003659 | JGI25404J52841_10007296 | JGI25404J52841_100072963 | 278 |
| 759 | 3300003659 | JGI25404J52841_10015597 | JGI25404J52841_100155972 | 278 |
| 760 | 3300003752 | Ga0055539_1005268 | Ga0055539_10052682 | 278 |
| 761 | 3300003794 | Ga0055531_10007025 | Ga0055531_100070257 | 278 |
| 762 | 3300005262 | Ga0065165_1001015 | Ga0065165_100101529 | 278 |
| 763 | 3300005262 | Ga0065165_1056808 | Ga0065165_10568081 | 278 |
| 764 | 3300005327 | Ga0070658_10074317 | Ga0070658_100743173 | 278 |
| 765 | 3300005329 | Ga0070683_100107348 | Ga0070683_1001073482 | 278 |
| 766 | 3300005329 | Ga0070683_100152795 | Ga0070683_1001527952 | 278 |
| 767 | 3300005331 | Ga0070670_100463664 | Ga0070670_1004636641 | 278 |
| 768 | 3300005334 | Ga0068869_100089048 | Ga0068869_1000890483 | 278 |
| 769 | 3300005336 | Ga0070680_100014862 | Ga0070680_1000148626 | 278 |
| 770 | 3300005336 | Ga0070680_100018980 | Ga0070680_1000189803 | 278 |
| 771 | 3300005336 | Ga0070680_100056438 | Ga0070680_1000564383 | 278 |
| 772 | 3300005337 | Ga0070682_100049913 | Ga0070682_1000499133 | 278 |
| 773 | 3300005338 | Ga0068868_100019171 | Ga0068868_1000191716 | 278 |
| 774 | 3300005338 | Ga0068868_100128947 | Ga0068868_1001289472 | 278 |
| 775 | 3300005338 | Ga0068868_100499830 | Ga0068868_1004998301 | 278 |
| 776 | 3300005347 | Ga0070668_100011646 | Ga0070668_1000116466 | 278 |
| 777 | 3300005347 | Ga0070668_100093723 | Ga0070668_1000937233 | 278 |
| 778 | 3300005347 | Ga0070668_100154949 | Ga0070668_1001549492 | 278 |
| 779 | 3300005347 | Ga0070668_100551145 | Ga0070668_1005511451 | 278 |
| 780 | 3300005354 | Ga0070675_100121009 | Ga0070675_1001210093 | 278 |
| 781 | 3300005355 | Ga0070671_100185850 | Ga0070671_1001858502 | 278 |
| 782 | 3300005355 | Ga0070671_100306662 | Ga0070671_1003066621 | 278 |
| 783 | 3300005366 | Ga0070659_100049654 | Ga0070659_1000496544 | 278 |
| 784 | 3300005367 | Ga0070667_100179772 | Ga0070667_1001797722 | 278 |
| 785 | 3300005367 | Ga0070667_100200543 | Ga0070667_1002005432 | 278 |
| 786 | 3300005434 | Ga0070709_10002072 | Ga0070709_100020724 | 278 |
| 787 | 3300005434 | Ga0070709_10148464 | Ga0070709_101484642 | 278 |
| 788 | 3300005435 | Ga0070714_100013419 | Ga0070714_1000134191 | 278 |
| 789 | 3300005435 | Ga0070714_100057152 | Ga0070714_1000571525 | 278 |
| 790 | 3300005435 | Ga0070714_100374816 | Ga0070714_1003748161 | 278 |
| 791 | 3300005436 | Ga0070713_100037676 | Ga0070713_1000376762 | 278 |
| 792 | 3300005436 | Ga0070713_100063344 | Ga0070713_1000633443 | 278 |
| 793 | 3300005436 | Ga0070713_100192212 | Ga0070713_1001922122 | 278 |
| 794 | 3300005436 | Ga0070713_100396108 | Ga0070713_1003961081 | 278 |
| 795 | 3300005437 | Ga0070710_10003520 | Ga0070710_100035205 | 278 |
| 796 | 3300005439 | Ga0070711_100011413 | Ga0070711_1000114132 | 278 |
| 797 | 3300005439 | Ga0070711_100156833 | Ga0070711_1001568332 | 278 |
| 798 | 3300005445 | Ga0070708_100047917 | Ga0070708_1000479174 | 278 |
| 799 | 3300005455 | Ga0070663_100015327 | Ga0070663_1000153275 | 278 |
| 800 | 3300005455 | Ga0070663_100029415 | Ga0070663_1000294152 | 278 |
| 801 | 3300005455 | Ga0070663_100043607 | Ga0070663_1000436074 | 278 |
| 802 | 3300005455 | Ga0070663_100053294 | Ga0070663_1000532943 | 278 |
| 803 | 3300005455 | Ga0070663_100192040 | Ga0070663_1001920402 | 278 |
| 804 | 3300005455 | Ga0070663_100209096 | Ga0070663_1002090962 | 278 |
| 805 | 3300005456 | Ga0070678_100026225 | Ga0070678_1000262252 | 278 |
| 806 | 3300005456 | Ga0070678_100131264 | Ga0070678_1001312643 | 278 |
| 807 | 3300005456 | Ga0070678_100167776 | Ga0070678_1001677761 | 278 |
| 808 | 3300005456 | Ga0070678_100230267 | Ga0070678_1002302671 | 278 |
| 809 | 3300005457 | Ga0070662_100024830 | Ga0070662_1000248302 | 278 |
| 810 | 3300005458 | Ga0070681_10039132 | Ga0070681_100391322 | 278 |
| 811 | 3300005458 | Ga0070681_10120467 | Ga0070681_101204673 | 278 |
| 812 | 3300005458 | Ga0070681_10222783 | Ga0070681_102227832 | 278 |
| 813 | 3300005466 | Ga0070685_10048997 | Ga0070685_100489974 | 278 |
| 814 | 3300005471 | Ga0070698_100095596 | Ga0070698_1000955963 | 278 |
| 815 | 3300005530 | Ga0070679_100025223 | Ga0070679_1000252236 | 278 |
| 816 | 3300005530 | Ga0070679_100109221 | Ga0070679_1001092212 | 278 |
| 817 | 3300005535 | Ga0070684_100065744 | Ga0070684_1000657443 | 278 |
| 818 | 3300005535 | Ga0070684_100155743 | Ga0070684_1001557432 | 278 |
| 819 | 3300005539 | Ga0068853_100034208 | Ga0068853_1000342085 | 278 |
| 820 | 3300005539 | Ga0068853_100066013 | Ga0068853_1000660132 | 278 |
| 821 | 3300005539 | Ga0068853_100239452 | Ga0068853_1002394521 | 278 |
| 822 | 3300005547 | Ga0070693_100050228 | Ga0070693_1000502283 | 278 |
| 823 | 3300005547 | Ga0070693_100067096 | Ga0070693_1000670961 | 278 |
| 824 | 3300005548 | Ga0070665_100042843 | Ga0070665_1000428436 | 278 |
| 825 | 3300005548 | Ga0070665_100046098 | Ga0070665_1000460982 | 278 |
| 826 | 3300005548 | Ga0070665_100221673 | Ga0070665_1002216733 | 278 |
| 827 | 3300005548 | Ga0070665_100458561 | Ga0070665_1004585612 | 278 |
| 828 | 3300005563 | Ga0068855_100022551 | Ga0068855_1000225512 | 278 |
| 829 | 3300005563 | Ga0068855_100083171 | Ga0068855_1000831715 | 278 |
| 830 | 3300005563 | Ga0068855_100142681 | Ga0068855_1001426812 | 278 |
| 831 | 3300005563 | Ga0068855_100260993 | Ga0068855_1002609933 | 278 |
| 832 | 3300005564 | Ga0070664_100043999 | Ga0070664_1000439992 | 278 |
| 833 | 3300005577 | Ga0068857_100068387 | Ga0068857_1000683873 | 278 |
| 834 | 3300005577 | Ga0068857_100171945 | Ga0068857_1001719452 | 278 |
| 835 | 3300005577 | Ga0068857_100222594 | Ga0068857_1002225942 | 278 |
| 836 | 3300005578 | Ga0068854_100027292 | Ga0068854_1000272923 | 278 |
| 837 | 3300005578 | Ga0068854_100192023 | Ga0068854_1001920232 | 278 |
| 838 | 3300005614 | Ga0068856_100039721 | Ga0068856_1000397213 | 278 |
| 839 | 3300005614 | Ga0068856_100107964 | Ga0068856_1001079643 | 278 |
| 840 | 3300005616 | Ga0068852_100038691 | Ga0068852_1000386912 | 278 |
| 841 | 3300005616 | Ga0068852_100530297 | Ga0068852_1005302971 | 278 |
| 842 | 3300005617 | Ga0068859_100164000 | Ga0068859_1001640003 | 278 |
| 843 | 3300005617 | Ga0068859_100191528 | Ga0068859_1001915283 | 278 |
| 844 | 3300005618 | Ga0068864_100011654 | Ga0068864_1000116543 | 278 |
| 845 | 3300005618 | Ga0068864_100123779 | Ga0068864_1001237792 | 278 |
| 846 | 3300005719 | Ga0068861_100090532 | Ga0068861_1000905323 | 278 |
| 847 | 3300005834 | Ga0068851_10003264 | Ga0068851_100032641 | 278 |
| 848 | 3300005841 | Ga0068863_100055359 | Ga0068863_1000553594 | 278 |
| 849 | 3300005841 | Ga0068863_100190541 | Ga0068863_1001905413 | 278 |
| 850 | 3300005841 | Ga0068863_100374385 | Ga0068863_1003743852 | 278 |
| 851 | 3300005842 | Ga0068858_100092104 | Ga0068858_1000921043 | 278 |
| 852 | 3300005937 | Ga0081455_10038767 | Ga0081455_100387675 | 278 |
| 853 | 3300005937 | Ga0081455_10044492 | Ga0081455_100444925 | 278 |
| 854 | 3300005937 | Ga0081455_10232590 | Ga0081455_102325901 | 278 |
| 855 | 3300005983 | Ga0081540_1007198 | Ga0081540_10071984 | 278 |
| 856 | 3300005983 | Ga0081540_1011781 | Ga0081540_10117813 | 278 |
| 857 | 3300005983 | Ga0081540_1018982 | Ga0081540_10189822 | 278 |
| 858 | 3300005983 | Ga0081540_1021410 | Ga0081540_10214103 | 278 |
| 859 | 3300005983 | Ga0081540_1021535 | Ga0081540_10215353 | 278 |
| 860 | 3300005983 | Ga0081540_1023827 | Ga0081540_10238272 | 278 |
| 861 | 3300005983 | Ga0081540_1030775 | Ga0081540_10307756 | 278 |
| 862 | 3300005985 | Ga0081539_10000306 | Ga0081539_1000030627 | 278 |
| 863 | 3300005985 | Ga0081539_10035506 | Ga0081539_100355062 | 278 |
| 864 | 3300005985 | Ga0081539_10036165 | Ga0081539_100361653 | 278 |
| 865 | 3300006038 | Ga0075365_10057269 | Ga0075365_100572692 | 278 |
| 866 | 3300006038 | Ga0075365_10064317 | Ga0075365_100643171 | 278 |
| 867 | 3300006038 | Ga0075365_10112194 | Ga0075365_101121943 | 278 |
| 868 | 3300006042 | Ga0075368_10044308 | Ga0075368_100443083 | 278 |
| 869 | 3300006048 | Ga0075363_100005107 | Ga0075363_1000051076 | 278 |
| 870 | 3300006048 | Ga0075363_100111851 | Ga0075363_1001118512 | 278 |
| 871 | 3300006051 | Ga0075364_10011122 | Ga0075364_100111225 | 278 |
| 872 | 3300006051 | Ga0075364_10134993 | Ga0075364_101349932 | 278 |
| 873 | 3300006163 | Ga0070715_10034300 | Ga0070715_100343003 | 278 |
| 874 | 3300006173 | Ga0070716_100142970 | Ga0070716_1001429702 | 278 |
| 875 | 3300006175 | Ga0070712_100243594 | Ga0070712_1002435942 | 278 |
| 876 | 3300006177 | Ga0075362_10063047 | Ga0075362_100630472 | 278 |
| 877 | 3300006177 | Ga0075362_10085750 | Ga0075362_100857502 | 278 |
| 878 | 3300006178 | Ga0075367_10016972 | Ga0075367_100169723 | 278 |
| 879 | 3300006178 | Ga0075367_10025808 | Ga0075367_100258084 | 278 |
| 880 | 3300006178 | Ga0075367_10031445 | Ga0075367_100314452 | 278 |
| 881 | 3300006178 | Ga0075367_10033657 | Ga0075367_100336574 | 278 |
| 882 | 3300006237 | Ga0097621_100255253 | Ga0097621_1002552532 | 278 |
| 883 | 3300006353 | Ga0075370_10007146 | Ga0075370_100071464 | 278 |
| 884 | 3300006353 | Ga0075370_10044151 | Ga0075370_100441513 | 278 |
| 885 | 3300006353 | Ga0075370_10149513 | Ga0075370_101495132 | 278 |
| 886 | 3300006358 | Ga0068871_100113715 | Ga0068871_1001137152 | 278 |
| 887 | 3300006358 | Ga0068871_100521004 | Ga0068871_1005210041 | 278 |
| 888 | 3300006844 | Ga0075428_100458633 | Ga0075428_1004586331 | 278 |
| 889 | 3300006931 | Ga0097620_100164003 | Ga0097620_1001640032 | 278 |
| 890 | 3300006931 | Ga0097620_100191521 | Ga0097620_1001915211 | 278 |
| 891 | 3300006944 | Ga0099823_1020698 | Ga0099823_10206984 | 278 |
| 892 | 3300007788 | Ga0099795_10008505 | Ga0099795_100085054 | 278 |
| 893 | 3300009092 | Ga0105250_10031361 | Ga0105250_100313612 | 278 |
| 894 | 3300009093 | Ga0105240_10013788 | Ga0105240_100137889 | 278 |
| 895 | 3300009093 | Ga0105240_10016073 | Ga0105240_100160737 | 278 |
| 896 | 3300009093 | Ga0105240_10079684 | Ga0105240_100796844 | 278 |
| 897 | 3300009094 | Ga0111539_10380217 | Ga0111539_103802173 | 278 |
| 898 | 3300009098 | Ga0105245_10084292 | Ga0105245_100842923 | 278 |
| 899 | 3300009098 | Ga0105245_10232066 | Ga0105245_102320662 | 278 |
| 900 | 3300009101 | Ga0105247_10257812 | Ga0105247_102578121 | 278 |
| 901 | 3300009101 | Ga0105247_10294940 | Ga0105247_102949401 | 278 |
| 902 | 3300009147 | Ga0114129_10060760 | Ga0114129_100607603 | 278 |
| 903 | 3300009147 | Ga0114129_10473554 | Ga0114129_104735543 | 278 |
| 904 | 3300009148 | Ga0105243_10047590 | Ga0105243_100475904 | 278 |
| 905 | 3300009174 | Ga0105241_10001008 | Ga0105241_1000100817 | 278 |
| 906 | 3300009176 | Ga0105242_10315799 | Ga0105242_103157992 | 278 |
| 907 | 3300009545 | Ga0105237_10013142 | Ga0105237_100131427 | 278 |
| 908 | 3300009545 | Ga0105237_10015187 | Ga0105237_100151872 | 278 |
| 909 | 3300009545 | Ga0105237_10157999 | Ga0105237_101579993 | 278 |
| 910 | 3300009545 | Ga0105237_10216219 | Ga0105237_102162192 | 278 |
| 911 | 3300009551 | Ga0105238_10014477 | Ga0105238_100144775 | 278 |
| 912 | 3300009551 | Ga0105238_10017578 | Ga0105238_100175786 | 278 |
| 913 | 3300009551 | Ga0105238_10057485 | Ga0105238_100574854 | 278 |
| 914 | 3300009551 | Ga0105238_10267982 | Ga0105238_102679822 | 278 |
| 915 | 3300010159 | Ga0099796_10038515 | Ga0099796_100385152 | 278 |
| 916 | 3300010159 | Ga0099796_10054450 | Ga0099796_100544502 | 278 |
| 917 | 3300010375 | Ga0105239_10004106 | Ga0105239_1000410614 | 278 |
| 918 | 3300010375 | Ga0105239_10075959 | Ga0105239_100759593 | 278 |
| 919 | 3300010375 | Ga0105239_10153484 | Ga0105239_101534842 | 278 |
| 920 | 3300010375 | Ga0105239_10301160 | Ga0105239_103011603 | 278 |
| 921 | 3300011119 | Ga0105246_10091525 | Ga0105246_100915252 | 278 |
| 922 | 3300013105 | Ga0157369_10005277 | Ga0157369_1000527710 | 278 |
| 923 | 3300013105 | Ga0157369_10013807 | Ga0157369_1001380710 | 278 |
| 924 | 3300013105 | Ga0157369_10036963 | Ga0157369_100369633 | 278 |
| 925 | 3300013296 | Ga0157374_10003779 | Ga0157374_1000377911 | 278 |
| 926 | 3300013296 | Ga0157374_10083182 | Ga0157374_100831823 | 278 |
| 927 | 3300013306 | Ga0163162_10027469 | Ga0163162_100274696 | 278 |
| 928 | 3300013306 | Ga0163162_10032877 | Ga0163162_100328774 | 278 |
| 929 | 3300013306 | Ga0163162_10051503 | Ga0163162_100515033 | 278 |
| 930 | 3300014325 | Ga0163163_10055459 | Ga0163163_100554593 | 278 |
| 931 | 3300014325 | Ga0163163_10121364 | Ga0163163_101213644 | 278 |
| 932 | 3300014325 | Ga0163163_10531547 | Ga0163163_105315472 | 278 |
| 933 | 3300014968 | Ga0157379_10145562 | Ga0157379_101455622 | 278 |
| 934 | 3300014969 | Ga0157376_10075336 | Ga0157376_100753362 | 278 |
| 935 | 3300014969 | Ga0157376_10125927 | Ga0157376_101259272 | 278 |
| 936 | 3300014969 | Ga0157376_10698410 | Ga0157376_106984101 | 278 |
| 937 | 3300017792 | Ga0163161_10233747 | Ga0163161_102337472 | 278 |
| 938 | 3300021384 | Ga0213876_10024127 | Ga0213876_100241273 | 278 |
| 939 | 3300021388 | Ga0213875_10018956 | Ga0213875_100189563 | 278 |
| 940 | 3300025229 | Ga0209147_101667 | Ga0209147_1016672 | 278 |
| 941 | 3300025230 | Ga0209563_102268 | Ga0209563_1022682 | 278 |
| 942 | 3300025253 | Ga0209677_100344 | Ga0209677_10034415 | 278 |
| 943 | 3300025253 | Ga0209677_103699 | Ga0209677_1036996 | 278 |
| 944 | 3300025272 | Ga0209455_1001850 | Ga0209455_10018507 | 278 |
| 945 | 3300025295 | Ga0209564_1004802 | Ga0209564_10048021 | 278 |
| 946 | 3300025297 | Ga0209758_1000011 | Ga0209758_1000011841 | 278 |
| 947 | 3300025297 | Ga0209758_1000455 | Ga0209758_100045562 | 278 |
| 948 | 3300025297 | Ga0209758_1000720 | Ga0209758_100072015 | 278 |
| 949 | 3300025297 | Ga0209758_1001990 | Ga0209758_100199011 | 278 |
| 950 | 3300025297 | Ga0209758_1021230 | Ga0209758_10212304 | 278 |
| 951 | 3300025297 | Ga0209758_1029293 | Ga0209758_10292932 | 278 |
| 952 | 3300025297 | Ga0209758_1056739 | Ga0209758_10567392 | 278 |
| 953 | 3300025299 | Ga0209256_1002097 | Ga0209256_100209715 | 278 |
| 954 | 3300025302 | Ga0207426_1000480 | Ga0207426_100048050 | 278 |
| 955 | 3300025302 | Ga0207426_1001491 | Ga0207426_10014913 | 278 |
| 956 | 3300025304 | Ga0209257_1000936 | Ga0209257_100093634 | 278 |
| 957 | 3300025304 | Ga0209257_1007849 | Ga0209257_10078497 | 278 |
| 958 | 3300025321 | Ga0207656_10002484 | Ga0207656_100024843 | 278 |
| 959 | 3300025904 | Ga0207647_10004039 | Ga0207647_100040395 | 278 |
| 960 | 3300025904 | Ga0207647_10032878 | Ga0207647_100328781 | 278 |
| 961 | 3300025905 | Ga0207685_10016487 | Ga0207685_100164873 | 278 |
| 962 | 3300025906 | Ga0207699_10008554 | Ga0207699_100085544 | 278 |
| 963 | 3300025906 | Ga0207699_10024585 | Ga0207699_100245854 | 278 |
| 964 | 3300025906 | Ga0207699_10049293 | Ga0207699_100492932 | 278 |
| 965 | 3300025907 | Ga0207645_10032981 | Ga0207645_100329815 | 278 |
| 966 | 3300025911 | Ga0207654_10004108 | Ga0207654_100041082 | 278 |
| 967 | 3300025911 | Ga0207654_10027201 | Ga0207654_100272013 | 278 |
| 968 | 3300025911 | Ga0207654_10074355 | Ga0207654_100743552 | 278 |
| 969 | 3300025912 | Ga0207707_10003605 | Ga0207707_100036052 | 278 |
| 970 | 3300025912 | Ga0207707_10004780 | Ga0207707_100047805 | 278 |
| 971 | 3300025912 | Ga0207707_10010530 | Ga0207707_100105303 | 278 |
| 972 | 3300025912 | Ga0207707_10078899 | Ga0207707_100788995 | 278 |
| 973 | 3300025913 | Ga0207695_10000157 | Ga0207695_10000157167 | 278 |
| 974 | 3300025913 | Ga0207695_10001596 | Ga0207695_1000159617 | 278 |
| 975 | 3300025913 | Ga0207695_10062576 | Ga0207695_100625764 | 278 |
| 976 | 3300025914 | Ga0207671_10033853 | Ga0207671_100338534 | 278 |
| 977 | 3300025914 | Ga0207671_10136860 | Ga0207671_101368603 | 278 |
| 978 | 3300025915 | Ga0207693_10013523 | Ga0207693_100135232 | 278 |
| 979 | 3300025915 | Ga0207693_10084313 | Ga0207693_100843132 | 278 |
| 980 | 3300025916 | Ga0207663_10000211 | Ga0207663_1000021116 | 278 |
| 981 | 3300025916 | Ga0207663_10032353 | Ga0207663_100323533 | 278 |
| 982 | 3300025917 | Ga0207660_10001786 | Ga0207660_1000178610 | 278 |
| 983 | 3300025917 | Ga0207660_10105387 | Ga0207660_101053872 | 278 |
| 984 | 3300025917 | Ga0207660_10156950 | Ga0207660_101569501 | 278 |
| 985 | 3300025919 | Ga0207657_10017803 | Ga0207657_100178031 | 278 |
| 986 | 3300025919 | Ga0207657_10078209 | Ga0207657_100782092 | 278 |
| 987 | 3300025919 | Ga0207657_10100066 | Ga0207657_101000662 | 278 |
| 988 | 3300025919 | Ga0207657_10113079 | Ga0207657_101130793 | 278 |
| 989 | 3300025921 | Ga0207652_10002365 | Ga0207652_1000236510 | 278 |
| 990 | 3300025921 | Ga0207652_10049408 | Ga0207652_100494081 | 278 |
| 991 | 3300025921 | Ga0207652_10151833 | Ga0207652_101518332 | 278 |
| 992 | 3300025921 | Ga0207652_10316120 | Ga0207652_103161201 | 278 |
| 993 | 3300025924 | Ga0207694_10000757 | Ga0207694_1000075716 | 278 |
| 994 | 3300025924 | Ga0207694_10075811 | Ga0207694_100758113 | 278 |
| 995 | 3300025925 | Ga0207650_10144680 | Ga0207650_101446802 | 278 |
| 996 | 3300025927 | Ga0207687_10055560 | Ga0207687_100555603 | 278 |
| 997 | 3300025928 | Ga0207700_10149786 | Ga0207700_101497862 | 278 |
| 998 | 3300025928 | Ga0207700_10439593 | Ga0207700_104395932 | 278 |
| 999 | 3300025929 | Ga0207664_10063187 | Ga0207664_100631873 | 278 |
| 1000 | 3300025931 | Ga0207644_10314876 | Ga0207644_103148761 | 278 |
| 1001 | 3300025932 | Ga0207690_10139140 | Ga0207690_101391402 | 278 |
| 1002 | 3300025932 | Ga0207690_10194786 | Ga0207690_101947861 | 278 |
| 1003 | 3300025933 | Ga0207706_10065152 | Ga0207706_100651523 | 278 |
| 1004 | 3300025934 | Ga0207686_10116429 | Ga0207686_101164292 | 278 |
| 1005 | 3300025935 | Ga0207709_10296888 | Ga0207709_102968882 | 278 |
| 1006 | 3300025936 | Ga0207670_10365632 | Ga0207670_103656322 | 278 |
| 1007 | 3300025937 | Ga0207669_10302709 | Ga0207669_103027092 | 278 |
| 1008 | 3300025938 | Ga0207704_10021550 | Ga0207704_100215502 | 278 |
| 1009 | 3300025941 | Ga0207711_10046779 | Ga0207711_100467794 | 278 |
| 1010 | 3300025942 | Ga0207689_10111351 | Ga0207689_101113512 | 278 |
| 1011 | 3300025944 | Ga0207661_10084573 | Ga0207661_100845733 | 278 |
| 1012 | 3300025944 | Ga0207661_10537881 | Ga0207661_105378812 | 278 |
| 1013 | 3300025945 | Ga0207679_10284134 | Ga0207679_102841342 | 278 |
| 1014 | 3300025945 | Ga0207679_10293986 | Ga0207679_102939862 | 278 |
| 1015 | 3300025949 | Ga0207667_10013120 | Ga0207667_100131207 | 278 |
| 1016 | 3300025949 | Ga0207667_10109742 | Ga0207667_101097423 | 278 |
| 1017 | 3300025949 | Ga0207667_10158436 | Ga0207667_101584361 | 278 |
| 1018 | 3300025949 | Ga0207667_10246951 | Ga0207667_102469512 | 278 |
| 1019 | 3300025949 | Ga0207667_10302965 | Ga0207667_103029652 | 278 |
| 1020 | 3300025949 | Ga0207667_10511890 | Ga0207667_105118902 | 278 |
| 1021 | 3300025960 | Ga0207651_10334633 | Ga0207651_103346331 | 278 |
| 1022 | 3300025972 | Ga0207668_10111304 | Ga0207668_101113043 | 278 |
| 1023 | 3300025972 | Ga0207668_10123658 | Ga0207668_101236582 | 278 |
| 1024 | 3300025981 | Ga0207640_10045297 | Ga0207640_100452973 | 278 |
| 1025 | 3300025981 | Ga0207640_10134059 | Ga0207640_101340593 | 278 |
| 1026 | 3300025981 | Ga0207640_10150476 | Ga0207640_101504761 | 278 |
| 1027 | 3300026023 | Ga0207677_10029898 | Ga0207677_100298984 | 278 |
| 1028 | 3300026041 | Ga0207639_10012898 | Ga0207639_100128982 | 278 |
| 1029 | 3300026041 | Ga0207639_10013907 | Ga0207639_100139076 | 278 |
| 1030 | 3300026041 | Ga0207639_10014848 | Ga0207639_100148482 | 278 |
| 1031 | 3300026041 | Ga0207639_10088539 | Ga0207639_100885393 | 278 |
| 1032 | 3300026041 | Ga0207639_10161946 | Ga0207639_101619462 | 278 |
| 1033 | 3300026041 | Ga0207639_10171739 | Ga0207639_101717391 | 278 |
| 1034 | 3300026041 | Ga0207639_10343195 | Ga0207639_103431952 | 278 |
| 1035 | 3300026067 | Ga0207678_10003302 | Ga0207678_1000330214 | 278 |
| 1036 | 3300026067 | Ga0207678_10023203 | Ga0207678_100232034 | 278 |
| 1037 | 3300026067 | Ga0207678_10027731 | Ga0207678_100277315 | 278 |
| 1038 | 3300026067 | Ga0207678_10056727 | Ga0207678_100567274 | 278 |
| 1039 | 3300026067 | Ga0207678_10516441 | Ga0207678_105164412 | 278 |
| 1040 | 3300026078 | Ga0207702_10000003 | Ga0207702_10000003328 | 278 |
| 1041 | 3300026095 | Ga0207676_10075837 | Ga0207676_100758373 | 278 |
| 1042 | 3300026095 | Ga0207676_10142072 | Ga0207676_101420722 | 278 |
| 1043 | 3300026095 | Ga0207676_10208533 | Ga0207676_102085332 | 278 |
| 1044 | 3300026116 | Ga0207674_10052521 | Ga0207674_100525213 | 278 |
| 1045 | 3300026116 | Ga0207674_10088541 | Ga0207674_100885412 | 278 |
| 1046 | 3300026116 | Ga0207674_10187970 | Ga0207674_101879702 | 278 |
| 1047 | 3300026116 | Ga0207674_10256684 | Ga0207674_102566842 | 278 |
| 1048 | 3300026118 | Ga0207675_100204825 | Ga0207675_1002048252 | 278 |
| 1049 | 3300026121 | Ga0207683_10065026 | Ga0207683_100650263 | 278 |
| 1050 | 3300026121 | Ga0207683_10075863 | Ga0207683_100758634 | 278 |
| 1051 | 3300026121 | Ga0207683_10132912 | Ga0207683_101329122 | 278 |
| 1052 | 3300026121 | Ga0207683_10212588 | Ga0207683_102125882 | 278 |
| 1053 | 3300026142 | Ga0207698_10008823 | Ga0207698_100088233 | 278 |
| 1054 | 3300026142 | Ga0207698_10027211 | Ga0207698_100272113 | 278 |
| 1055 | 3300026142 | Ga0207698_10106915 | Ga0207698_101069152 | 278 |
| 1056 | 3300026142 | Ga0207698_10168842 | Ga0207698_101688423 | 278 |
| 1057 | 3300026142 | Ga0207698_10240254 | Ga0207698_102402541 | 278 |
| 1058 | 3300027296 | Ga0209389_1000009 | Ga0209389_100000966 | 278 |
| 1059 | 3300027361 | Ga0209489_100050 | Ga0209489_10005059 | 278 |
| 1060 | 3300027363 | Ga0209700_100016 | Ga0209700_100016167 | 278 |
| 1061 | 3300027512 | Ga0209179_1015550 | Ga0209179_10155501 | 278 |
| 1062 | 3300027671 | Ga0209588_1044110 | Ga0209588_10441101 | 278 |
| 1063 | 3300028379 | Ga0268266_10010017 | Ga0268266_100100173 | 278 |
| 1064 | 3300028379 | Ga0268266_10019820 | Ga0268266_100198207 | 278 |
| 1065 | 3300028379 | Ga0268266_10030342 | Ga0268266_100303424 | 278 |
| 1066 | 3300028380 | Ga0268265_10067985 | Ga0268265_100679854 | 278 |
| 1067 | 3300028381 | Ga0268264_10217737 | Ga0268264_102177372 | 278 |
| 1068 | 3300028786 | Ga0307517_10000512 | Ga0307517_100005128 | 278 |
| 1069 | 3300028794 | Ga0307515_10022025 | Ga0307515_1002202510 | 278 |
| 1070 | 3300031238 | Ga0265332_10000839 | Ga0265332_1000083916 | 278 |
| 1071 | 3300031241 | Ga0265325_10032340 | Ga0265325_100323404 | 278 |
| 1072 | 3300031247 | Ga0265340_10000382 | Ga0265340_1000038214 | 278 |
| 1073 | 3300031249 | Ga0265339_10001051 | Ga0265339_1000105113 | 278 |
| 1074 | 3300031249 | Ga0265339_10003487 | Ga0265339_100034872 | 278 |
| 1075 | 3300031250 | Ga0265331_10032490 | Ga0265331_100324902 | 278 |
| 1076 | 3300031250 | Ga0265331_10039516 | Ga0265331_100395161 | 278 |
| 1077 | 3300031507 | Ga0307509_10228195 | Ga0307509_102281952 | 278 |
| 1078 | 3300031548 | Ga0307408_100159116 | Ga0307408_1001591163 | 278 |
| 1079 | 3300031616 | Ga0307508_10362640 | Ga0307508_103626402 | 278 |
| 1080 | 3300031711 | Ga0265314_10019173 | Ga0265314_100191734 | 278 |
| 1081 | 3300031711 | Ga0265314_10084820 | Ga0265314_100848203 | 278 |
| 1082 | 3300031712 | Ga0265342_10000179 | Ga0265342_1000017931 | 278 |
| 1083 | 3300031712 | Ga0265342_10006885 | Ga0265342_100068856 | 278 |
| 1084 | 3300031730 | Ga0307516_10113504 | Ga0307516_101135043 | 278 |
| 1085 | 3300031731 | Ga0307405_10108479 | Ga0307405_101084793 | 278 |
| 1086 | 3300031824 | Ga0307413_10201728 | Ga0307413_102017282 | 278 |
| 1087 | 3300031911 | Ga0307412_10331127 | Ga0307412_103311271 | 278 |
| 1088 | 3300031911 | Ga0307412_10349352 | Ga0307412_103493521 | 278 |
| 1089 | 3300031995 | Ga0307409_100373028 | Ga0307409_1003730282 | 278 |
| 1090 | 3300032005 | Ga0307411_10025647 | Ga0307411_100256475 | 278 |
| 1091 | 3300032126 | Ga0307415_100122163 | Ga0307415_1001221633 | 278 |
| 1092 | 3300033179 | Ga0307507_10133866 | Ga0307507_101338662 | 278 |
| 1093 | 3300033180 | Ga0307510_10009742 | Ga0307510_100097425 | 278 |
| 1094 | 3300033180 | Ga0307510_10050764 | Ga0307510_100507644 | 278 |
| 1095 | 3300035089 | Ga0373944_0013282 | Ga0373944_0013282_949_1887 | 278 |
| 1096 | 3300035089 | Ga0373944_0047494 | Ga0373944_0047494_90_977 | 278 |
| 1097 | 3300035111 | Ga0373923_0024351 | Ga0373923_0024351_1360_2298 | 278 |
| 1098 | 3300035111 | Ga0373923_0065895 | Ga0373923_0065895_600_1487 | 278 |
| 1099 | 3300035113 | Ga0373936_0015883 | Ga0373936_0015883_961_1848 | 278 |
| 1100 | 3300035116 | Ga0373945_0104221 | Ga0373945_0104221_212_1099 | 278 |
| 1101 | 3300035117 | Ga0373953_0008522 | Ga0373953_0008522_1291_2229 | 278 |
| 1102 | 3300035170 | Ga0373943_0003068 | Ga0373943_0003068_40_927 | 278 |
| 1103 | 3300035172 | Ga0373955_0030906 | Ga0373955_0030906_936_1823 | 278 |
| 1104 | 3300035172 | Ga0373955_0032541 | Ga0373955_0032541_1686_2600 | 278 |
| 1105 | 3300035410 | Ga0373924_0017111 | Ga0373924_0017111_1572_2510 | 278 |
| 1106 | 3300035692 | Ga0373935_0001766 | Ga0373935_0001766_882_1769 | 278 |
| 1107 | 3300035692 | Ga0373935_0019355 | Ga0373935_0019355_40_978 | 278 |
| 1108 | 3300035695 | Ga0373927_0000346 | Ga0373927_0000346_17560_18447 | 278 |
| 1109 | 3300035695 | Ga0373927_0003142 | Ga0373927_0003142_4084_4971 | 278 |
| 1110 | 3300035695 | Ga0373927_0018992 | Ga0373927_0018992_1185_2072 | 278 |
| 1111 | 3300035695 | Ga0373927_0021985 | Ga0373927_0021985_2062_2949 | 278 |
| 1112 | 3300035695 | Ga0373927_0073207 | Ga0373927_0073207_796_1683 | 278 |
| 1113 | 3300035724 | Ga0373933_0024198 | Ga0373933_0024198_786_1724 | 278 |
| 1114 | 3300035725 | Ga0373947_0001267 | Ga0373947_0001267_8494_9381 | 278 |
| 1115 | 3300035725 | Ga0373947_0036794 | Ga0373947_0036794_1667_2554 | 278 |
| 1116 | 3300035725 | Ga0373947_0066104 | Ga0373947_0066104_538_1476 | 278 |
| 1117 | 3300036401 | Ga0373937_0023839 | Ga0373937_0023839_2690_3628 | 278 |
| 1118 | 3300036401 | Ga0373937_0038979 | Ga0373937_0038979_1523_2410 | 278 |
| 1119 | 3300036401 | Ga0373937_0486385 | Ga0373937_0486385_37_924 | 278 |
| 1120 | 3300037068 | Ga0373925_0001404 | Ga0373925_0001404_6798_7685 | 278 |
| 1121 | 3300037068 | Ga0373925_0030842 | Ga0373925_0030842_2600_3487 | 278 |
| 1122 | 3300037312 | Ga0395899_0017832 | Ga0395899_0017832_3656_4534 | 278 |
| 1123 | 3300037312 | Ga0395899_0069735 | Ga0395899_0069735_968_1855 | 278 |
| 1124 | 3300037312 | Ga0395899_0079770 | Ga0395899_0079770_682_1569 | 278 |
| 1125 | 3300037418 | Ga0395900_0000134 | Ga0395900_0000134_82034_82921 | 278 |
| 1126 | 3300037418 | Ga0395900_0065161 | Ga0395900_0065161_1125_2003 | 278 |
| 1127 | 3300037418 | Ga0395900_0140876 | Ga0395900_0140876_470_1357 | 278 |
| 1128 | 3300037466 | Ga0395898_0037354 | Ga0395898_0037354_3420_4307 | 278 |
| 1129 | 3300037471 | Ga0395905_0013864 | Ga0395905_0013864_2464_3351 | 278 |
| 1130 | 3300037853 | Ga0436364_1139859 | Ga0436364_1139859_5253_6140 | 278 |
| 1131 | 3300038443 | Ga0395901_0013321 | Ga0395901_0013321_5404_6291 | 278 |
| 1132 | 3300038443 | Ga0395901_0084968 | Ga0395901_0084968_1825_2712 | 278 |
| 1133 | 3300038443 | Ga0395901_0086295 | Ga0395901_0086295_1216_2094 | 278 |
| 1134 | 3300039437 | Ga0436365_0061308 | Ga0436365_0061308_517_1413 | 278 |
| 1135 | 3300039437 | Ga0436365_0481444 | Ga0436365_0481444_6013_6900 | 278 |
| 1136 | 3300039437 | Ga0436365_0741042 | Ga0436365_0741042_587_1474 | 278 |
| 1137 | 3300039453 | Ga0436362_0088818 | Ga0436362_0088818_1770_2657 | 278 |
| 1138 | 3300039453 | Ga0436362_0429757 | Ga0436362_0429757_1983_2870 | 278 |
| 1139 | 3300041452 | Ga0451793_0652808 | Ga0451793_0652808_127_1014 | 278 |
| 1140 | 3300042993 | Ga0439440_0030274 | Ga0439440_0030274_289_1176 | 278 |
| 1141 | 3300044658 | Ga0466972_0001603 | Ga0466972_0001603_9963_10850 | 278 |
| 1142 | 3300044684 | Ga0466966_0005030 | Ga0466966_0005030_2469_3368 | 278 |
| 1143 | 3300044684 | Ga0466966_0075035 | Ga0466966_0075035_104_991 | 278 |
| 1144 | 3300044693 | Ga0466961_0000060 | Ga0466961_0000060_52025_52924 | 278 |
| 1145 | 3300044706 | Ga0466964_0065741 | Ga0466964_0065741_130_1029 | 278 |
| 1146 | 3300044719 | Ga0466971_0141290 | Ga0466971_0141290_181_1080 | 278 |
| 1147 | 3300044842 | Ga0466957_0038885 | Ga0466957_0038885_1213_2112 | 278 |
| 1148 | 3300045049 | Ga0466959_0001866 | Ga0466959_0001866_1085_1984 | 278 |
| 1149 | 3300046452 | Ga0495617_051104 | Ga0495617_051104_150_1037 | 278 |
| 1150 | 3300046454 | Ga0495592_0006304 | Ga0495592_0006304_4688_5575 | 278 |
| 1151 | 3300046454 | Ga0495592_0034880 | Ga0495592_0034880_1608_2495 | 278 |
| 1152 | 3300046455 | Ga0495603_0000092 | Ga0495603_0000092_11096_11983 | 278 |
| 1153 | 3300046455 | Ga0495603_0031557 | Ga0495603_0031557_2026_2913 | 278 |
| 1154 | 3300046455 | Ga0495603_0035014 | Ga0495603_0035014_1040_1927 | 278 |
| 1155 | 3300046455 | Ga0495603_0120014 | Ga0495603_0120014_261_1148 | 278 |
| 1156 | 3300046459 | Ga0495629_0000181 | Ga0495629_0000181_37980_38867 | 278 |
| 1157 | 3300046460 | Ga0495638_0009594 | Ga0495638_0009594_1209_2096 | 278 |
| 1158 | 3300046461 | Ga0495641_0001499 | Ga0495641_0001499_7542_8429 | 278 |
| 1159 | 3300046462 | Ga0495651_0043114 | Ga0495651_0043114_741_1628 | 278 |
| 1160 | 3300046462 | Ga0495651_0132580 | Ga0495651_0132580_862_1749 | 278 |
| 1161 | 3300046463 | Ga0495653_0031775 | Ga0495653_0031775_2697_3584 | 278 |
| 1162 | 3300046472 | Ga0495580_0001467 | Ga0495580_0001467_1848_2735 | 278 |
| 1163 | 3300046472 | Ga0495580_0063846 | Ga0495580_0063846_726_1664 | 278 |
| 1164 | 3300046472 | Ga0495580_0368284 | Ga0495580_0368284_10_897 | 278 |
| 1165 | 3300046473 | Ga0495582_0000039 | Ga0495582_0000039_34931_35818 | 278 |
| 1166 | 3300046474 | Ga0495605_0061747 | Ga0495605_0061747_262_1149 | 278 |
| 1167 | 3300046475 | Ga0495639_0000489 | Ga0495639_0000489_13293_14180 | 278 |
| 1168 | 3300046475 | Ga0495639_0049551 | Ga0495639_0049551_129_1067 | 278 |
| 1169 | 3300046476 | Ga0495662_0000343 | Ga0495662_0000343_12687_13574 | 278 |
| 1170 | 3300046477 | Ga0495664_0002664 | Ga0495664_0002664_2990_3877 | 278 |
| 1171 | 3300046477 | Ga0495664_0063746 | Ga0495664_0063746_1151_2089 | 278 |
| 1172 | 3300046491 | Ga0495584_0079078 | Ga0495584_0079078_147_1034 | 278 |
| 1173 | 3300046491 | Ga0495584_0114570 | Ga0495584_0114570_295_1182 | 278 |
| 1174 | 3300046492 | Ga0495585_0081330 | Ga0495585_0081330_540_1427 | 278 |
| 1175 | 3300046492 | Ga0495585_0091525 | Ga0495585_0091525_183_1070 | 278 |
| 1176 | 3300046499 | Ga0495594_0000619 | Ga0495594_0000619_7162_8049 | 278 |
| 1177 | 3300046500 | Ga0495596_0073887 | Ga0495596_0073887_264_1151 | 278 |
| 1178 | 3300046501 | Ga0495607_0132886 | Ga0495607_0132886_248_1135 | 278 |
| 1179 | 3300046507 | Ga0495606_0103057 | Ga0495606_0103057_578_1465 | 278 |
| 1180 | 3300046507 | Ga0495606_0105250 | Ga0495606_0105250_89_976 | 278 |
| 1181 | 3300046512 | Ga0495610_0054926 | Ga0495610_0054926_346_1233 | 278 |
| 1182 | 3300046516 | Ga0495628_0056656 | Ga0495628_0056656_1839_2726 | 278 |
| 1183 | 3300046516 | Ga0495628_0073295 | Ga0495628_0073295_907_1821 | 278 |
| 1184 | 3300046517 | Ga0495630_0001653 | Ga0495630_0001653_10494_11381 | 278 |
| 1185 | 3300046517 | Ga0495630_0209914 | Ga0495630_0209914_147_1085 | 278 |
| 1186 | 3300046519 | Ga0495632_0023362 | Ga0495632_0023362_2307_3194 | 278 |
| 1187 | 3300046520 | Ga0495637_0006157 | Ga0495637_0006157_1773_2657 | 278 |
| 1188 | 3300046522 | Ga0495643_0000009 | Ga0495643_0000009_231976_232860 | 278 |
| 1189 | 3300046522 | Ga0495643_0032803 | Ga0495643_0032803_708_1595 | 278 |
| 1190 | 3300046523 | Ga0495644_0029123 | Ga0495644_0029123_917_1804 | 278 |
| 1191 | 3300046524 | Ga0495648_0134859 | Ga0495648_0134859_50_937 | 278 |
| 1192 | 3300046526 | Ga0495666_0003729 | Ga0495666_0003729_887_1774 | 278 |
| 1193 | 3300046526 | Ga0495666_0053055 | Ga0495666_0053055_866_1804 | 278 |
| 1194 | 3300046529 | Ga0495652_0074129 | Ga0495652_0074129_691_1578 | 278 |
| 1195 | 3300046529 | Ga0495652_0203878 | Ga0495652_0203878_277_1164 | 278 |
| 1196 | 3300046530 | Ga0495654_0070152 | Ga0495654_0070152_298_1185 | 278 |
| 1197 | 3300046531 | Ga0495665_0000079 | Ga0495665_0000079_22897_23784 | 278 |
| 1198 | 3300046531 | Ga0495665_0020095 | Ga0495665_0020095_108_1046 | 278 |
| 1199 | 3300046533 | Ga0495640_0003085 | Ga0495640_0003085_10483_11370 | 278 |
| 1200 | 3300046533 | Ga0495640_0009778 | Ga0495640_0009778_2439_3377 | 278 |
| 1201 | 3300046538 | Ga0495609_0085810 | Ga0495609_0085810_327_1214 | 278 |
| 1202 | 3300046539 | Ga0495621_0013233 | Ga0495621_0013233_54_941 | 278 |
| 1203 | 3300046543 | Ga0495645_0026869 | Ga0495645_0026869_730_1617 | 278 |
| 1204 | 3300046543 | Ga0495645_0100441 | Ga0495645_0100441_956_1870 | 278 |
| 1205 | 3300046557 | Ga0495622_0000987 | Ga0495622_0000987_682_1569 | 278 |
| 1206 | 3300046557 | Ga0495622_0042359 | Ga0495622_0042359_263_1162 | 278 |
| 1207 | 3300046558 | Ga0495633_0000102 | Ga0495633_0000102_5258_6142 | 278 |
| 1208 | 3300046558 | Ga0495633_0079091 | Ga0495633_0079091_153_1040 | 278 |
| 1209 | 3300046559 | Ga0495667_0006293 | Ga0495667_0006293_2333_3220 | 278 |
| 1210 | 3300046559 | Ga0495667_0056782 | Ga0495667_0056782_589_1476 | 278 |
| 1211 | 3300046615 | Ga0495656_0078564 | Ga0495656_0078564_458_1345 | 278 |
| 1212 | 3300046615 | Ga0495656_0090968 | Ga0495656_0090968_265_1152 | 278 |
| 1213 | 3300046616 | Ga0495668_0230353 | Ga0495668_0230353_42_929 | 278 |
| 1214 | 3300046642 | Ga0495634_0004026 | Ga0495634_0004026_8564_9451 | 278 |
| 1215 | 3300046642 | Ga0495634_0089976 | Ga0495634_0089976_108_1046 | 278 |
| 1216 | 3300046642 | Ga0495634_0122922 | Ga0495634_0122922_730_1617 | 278 |
| 1217 | 3300046648 | Ga0495611_0058626 | Ga0495611_0058626_566_1453 | 278 |
| 1218 | 3300046648 | Ga0495611_0063062 | Ga0495611_0063062_196_1083 | 278 |
| 1219 | 3300046648 | Ga0495611_0125309 | Ga0495611_0125309_281_1168 | 278 |
| 1220 | 3300046663 | Ga0495635_0006922 | Ga0495635_0006922_276_1163 | 278 |
| 1221 | 3300046663 | Ga0495635_0173248 | Ga0495635_0173248_285_1172 | 278 |
| 1222 | 3300046674 | Ga0495588_0023653 | Ga0495588_0023653_285_1172 | 278 |
| 1223 | 3300046675 | Ga0495657_0103148 | Ga0495657_0103148_316_1203 | 278 |
| 1224 | 3300046678 | Ga0495599_0012657 | Ga0495599_0012657_804_1691 | 278 |
| 1225 | 3300046678 | Ga0495599_0061226 | Ga0495599_0061226_1267_2154 | 278 |
| 1226 | 3300046680 | Ga0495646_0038525 | Ga0495646_0038525_2004_2891 | 278 |
| 1227 | 3300046681 | Ga0495647_0000562 | Ga0495647_0000562_5105_5992 | 278 |
| 1228 | 3300046683 | Ga0495658_0000733 | Ga0495658_0000733_1668_2555 | 278 |
| 1229 | 3300046683 | Ga0495658_0154370 | Ga0495658_0154370_25_912 | 278 |
| 1230 | 3300046684 | Ga0495669_0081198 | Ga0495669_0081198_42_929 | 278 |
| 1231 | 3300046689 | Ga0495613_0000543 | Ga0495613_0000543_14786_15673 | 278 |
| 1232 | 3300046690 | Ga0495624_0006648 | Ga0495624_0006648_6669_7556 | 278 |
| 1233 | 3300046690 | Ga0495624_0068223 | Ga0495624_0068223_1247_2185 | 278 |
| 1234 | 3300046691 | Ga0495670_0085783 | Ga0495670_0085783_175_1062 | 278 |
| 1235 | 3300046692 | Ga0495671_0000013 | Ga0495671_0000013_231976_232860 | 278 |
| 1236 | 3300047315 | Ga0495581_0000024 | Ga0495581_0000024_4763_5650 | 278 |
| 1237 | 3300047317 | Ga0495604_0017775 | Ga0495604_0017775_1657_2544 | 278 |
| 1238 | 3300047317 | Ga0495604_0385595 | Ga0495604_0385595_21_908 | 278 |
| 1239 | 3300047319 | Ga0495674_0001161 | Ga0495674_0001161_24114_25001 | 278 |
| 1240 | 3300047319 | Ga0495674_0197545 | Ga0495674_0197545_331_1218 | 278 |
| 1241 | 3300047320 | Ga0495672_0017804 | Ga0495672_0017804_1007_1894 | 278 |
| 1242 | 3300047321 | Ga0495676_0040839 | Ga0495676_0040839_619_1506 | 278 |
| 1243 | 3300047321 | Ga0495676_0154833 | Ga0495676_0154833_710_1609 | 278 |
| 1244 | 3300047322 | Ga0495680_0008182 | Ga0495680_0008182_3926_4813 | 278 |
| 1245 | 3300047444 | Ga0495675_0058711 | Ga0495675_0058711_963_1850 | 278 |
| 1246 | 3300047444 | Ga0495675_0061217 | Ga0495675_0061217_708_1646 | 278 |
| 1247 | 3300047469 | Ga0495673_0020913 | Ga0495673_0020913_1430_2317 | 278 |
| 1248 | 3300047469 | Ga0495673_0048974 | Ga0495673_0048974_545_1432 | 278 |
| 1249 | 3300047469 | Ga0495673_0109692 | Ga0495673_0109692_99_992 | 278 |
| 1250 | 3300047470 | Ga0495681_0000202 | Ga0495681_0000202_1560_2444 | 278 |
| 1251 | 3300047470 | Ga0495681_0068429 | Ga0495681_0068429_389_1276 | 278 |
| 1252 | 3300047471 | Ga0495684_0009222 | Ga0495684_0009222_3452_4390 | 278 |
| 1253 | 3300047471 | Ga0495684_0025703 | Ga0495684_0025703_2096_2983 | 278 |
| 1254 | 3300047471 | Ga0495684_0123972 | Ga0495684_0123972_561_1448 | 278 |
| 1255 | 3300047673 | Ga0495593_0000019 | Ga0495593_0000019_60926_61813 | 278 |
| 1256 | 3300047673 | Ga0495593_0037204 | Ga0495593_0037204_42_935 | 278 |
| 1257 | 3300048089 | Ga0495614_0003524 | Ga0495614_0003524_681_1568 | 278 |
| 1258 | 3300048903 | Ga0496100_0020444 | Ga0496100_0020444_711_1598 | 278 |
| 1259 | 3300048904 | Ga0496101_0004532 | Ga0496101_0004532_2561_3448 | 278 |
| 1260 | 3300048905 | Ga0496102_0009611 | Ga0496102_0009611_5349_6236 | 278 |
| 1261 | 3300048905 | Ga0496102_0180446 | Ga0496102_0180446_155_1042 | 278 |
| 1262 | 3300048905 | Ga0496102_0272046 | Ga0496102_0272046_557_1444 | 278 |
| 1263 | 3300048907 | Ga0496104_0009587 | Ga0496104_0009587_6734_7621 | 278 |
| 1264 | 3300048907 | Ga0496104_0014513 | Ga0496104_0014513_1690_2577 | 278 |
| 1265 | 3300048907 | Ga0496104_0014678 | Ga0496104_0014678_678_1565 | 278 |
| 1266 | 3300048908 | Ga0496105_0002708 | Ga0496105_0002708_10888_11775 | 278 |
| 1267 | 3300048908 | Ga0496105_0159538 | Ga0496105_0159538_716_1603 | 278 |
| 1268 | 3300048909 | Ga0496106_0006039 | Ga0496106_0006039_4695_5582 | 278 |
| 1269 | 3300048909 | Ga0496106_0080469 | Ga0496106_0080469_1211_2098 | 278 |
| 1270 | 3300048909 | Ga0496106_0145610 | Ga0496106_0145610_539_1426 | 278 |
| 1271 | 3300048909 | Ga0496106_0276121 | Ga0496106_0276121_35_922 | 278 |
| 1272 | 3300048910 | Ga0496107_0002095 | Ga0496107_0002095_5950_6837 | 278 |
| 1273 | 3300048911 | Ga0496108_0110277 | Ga0496108_0110277_928_1815 | 278 |
| 1274 | 3300048911 | Ga0496108_0134259 | Ga0496108_0134259_749_1636 | 278 |
| 1275 | 3300048911 | Ga0496108_0287562 | Ga0496108_0287562_439_1326 | 278 |
| 1276 | 3300048912 | Ga0496109_0046847 | Ga0496109_0046847_439_1326 | 278 |
| 1277 | 3300048912 | Ga0496109_0057575 | Ga0496109_0057575_607_1494 | 278 |
| 1278 | 3300048912 | Ga0496109_0072226 | Ga0496109_0072226_670_1557 | 278 |
| 1279 | 3300048912 | Ga0496109_0195085 | Ga0496109_0195085_407_1294 | 278 |
| 1280 | 3300048913 | Ga0496110_0081141 | Ga0496110_0081141_781_1668 | 278 |
| 1281 | 3300048913 | Ga0496110_0106657 | Ga0496110_0106657_1486_2442 | 278 |
| 1282 | 3300048913 | Ga0496110_0132270 | Ga0496110_0132270_397_1284 | 278 |
| 1283 | 3300048913 | Ga0496110_0212338 | Ga0496110_0212338_558_1445 | 278 |
| 1284 | 3300048914 | Ga0496111_0094947 | Ga0496111_0094947_227_1114 | 278 |
| 1285 | 3300048914 | Ga0496111_0111787 | Ga0496111_0111787_515_1402 | 278 |
| 1286 | 3300048915 | Ga0496112_0000142 | Ga0496112_0000142_24234_25121 | 278 |
| 1287 | 3300048915 | Ga0496112_0009986 | Ga0496112_0009986_5740_6627 | 278 |
| 1288 | 3300048915 | Ga0496112_0035315 | Ga0496112_0035315_372_1259 | 278 |
| 1289 | 3300048915 | Ga0496112_0048503 | Ga0496112_0048503_619_1506 | 278 |
| 1290 | 3300048915 | Ga0496112_0126707 | Ga0496112_0126707_1151_2038 | 278 |
| 1291 | 3300048915 | Ga0496112_0283875 | Ga0496112_0283875_168_1055 | 278 |
| 1292 | 3300048915 | Ga0496112_0331623 | Ga0496112_0331623_202_1089 | 278 |
| 1293 | 3300048916 | Ga0496113_0004839 | Ga0496113_0004839_927_1814 | 278 |
| 1294 | 3300048917 | Ga0496114_0085730 | Ga0496114_0085730_1024_1911 | 278 |
| 1295 | 3300048918 | Ga0496115_0008444 | Ga0496115_0008444_6174_7061 | 278 |
| 1296 | 3300048918 | Ga0496115_0034316 | Ga0496115_0034316_452_1339 | 278 |
| 1297 | 3300048918 | Ga0496115_0115596 | Ga0496115_0115596_457_1344 | 278 |
| 1298 | 3300048918 | Ga0496115_0360388 | Ga0496115_0360388_286_1173 | 278 |
| 1299 | 3300048920 | Ga0496117_0126685 | Ga0496117_0126685_110_997 | 278 |
| 1300 | 3300048921 | Ga0496118_0210540 | Ga0496118_0210540_96_983 | 278 |
| 1301 | 3300048922 | Ga0496119_0011287 | Ga0496119_0011287_381_1310 | 278 |
| 1302 | 3300048924 | Ga0496121_0005804 | Ga0496121_0005804_11813_12712 | 278 |
| 1303 | 3300048924 | Ga0496121_0005812 | Ga0496121_0005812_13003_13890 | 278 |
| 1304 | 3300048924 | Ga0496121_0007712 | Ga0496121_0007712_264_1157 | 278 |
| 1305 | 3300048924 | Ga0496121_0056369 | Ga0496121_0056369_937_1824 | 278 |
| 1306 | 3300048924 | Ga0496121_0179979 | Ga0496121_0179979_26_919 | 278 |
| 1307 | 3300048924 | Ga0496121_0216962 | Ga0496121_0216962_260_1147 | 278 |
| 1308 | 3300048925 | Ga0496122_0004715 | Ga0496122_0004715_4263_5192 | 278 |
| 1309 | 3300048926 | Ga0496123_0000896 | Ga0496123_0000896_28853_29782 | 278 |
| 1310 | 3300048927 | Ga0496124_0283122 | Ga0496124_0283122_219_1106 | 278 |
| 1311 | 3300048928 | Ga0496125_0056031 | Ga0496125_0056031_590_1477 | 278 |
| 1312 | 3300048928 | Ga0496125_0173659 | Ga0496125_0173659_170_1057 | 278 |
| 1313 | 3300048929 | Ga0496126_0001612 | Ga0496126_0001612_2607_3494 | 278 |
| 1314 | 3300048929 | Ga0496126_0004467 | Ga0496126_0004467_6066_6953 | 278 |
| 1315 | 3300048929 | Ga0496126_0023193 | Ga0496126_0023193_2587_3474 | 278 |
| 1316 | 3300048929 | Ga0496126_0080441 | Ga0496126_0080441_1566_2453 | 278 |
| 1317 | 3300048929 | Ga0496126_0100547 | Ga0496126_0100547_755_1642 | 278 |
| 1318 | 3300048929 | Ga0496126_0119352 | Ga0496126_0119352_885_1772 | 278 |
| 1319 | 3300048929 | Ga0496126_0135659 | Ga0496126_0135659_188_1075 | 278 |
| 1320 | 3300048929 | Ga0496126_0168246 | Ga0496126_0168246_200_1087 | 278 |
| 1321 | 3300048929 | Ga0496126_0205257 | Ga0496126_0205257_712_1599 | 278 |
| 1322 | 3300048929 | Ga0496126_0216255 | Ga0496126_0216255_610_1500 | 278 |
| 1323 | 3300049459 | Ga0495678_042737 | Ga0495678_042737_383_1270 | 278 |
| 1324 | 3300049460 | Ga0495682_0034924 | Ga0495682_0034924_895_1794 | 278 |
| 1325 | 3300049460 | Ga0495682_0084648 | Ga0495682_0084648_38_925 | 278 |
| 1326 | 3300049568 | Ga0501031_0004996 | Ga0501031_0004996_3947_4861 | 278 |
| 1327 | 3300049569 | Ga0501032_0099204 | Ga0501032_0099204_387_1301 | 278 |
| 1328 | 3300049570 | Ga0501033_0000447 | Ga0501033_0000447_34804_35718 | 278 |
| 1329 | 3300049570 | Ga0501033_0044800 | Ga0501033_0044800_956_1843 | 278 |
| 1330 | 3300049571 | Ga0501034_0000109 | Ga0501034_0000109_19244_20107 | 278 |
| 1331 | 3300049571 | Ga0501034_0117991 | Ga0501034_0117991_1607_2521 | 278 |
| 1332 | 3300049571 | Ga0501034_0286335 | Ga0501034_0286335_22_909 | 278 |
| 1333 | 3300049572 | Ga0501036_0012191 | Ga0501036_0012191_3213_4127 | 278 |
| 1334 | 3300049573 | Ga0501037_0001078 | Ga0501037_0001078_17878_18792 | 278 |
| 1335 | 3300049574 | Ga0501038_0071505 | Ga0501038_0071505_1436_2350 | 278 |
| 1336 | 3300049575 | Ga0501039_0052494 | Ga0501039_0052494_1776_2690 | 278 |
| 1337 | 3300049579 | Ga0501043_0003281 | Ga0501043_0003281_8665_9579 | 278 |
| 1338 | 3300049580 | Ga0501046_0034192 | Ga0501046_0034192_1436_2350 | 278 |
| 1339 | 3300049580 | Ga0501046_0185844 | Ga0501046_0185844_629_1516 | 278 |
| 1340 | 3300049581 | Ga0501047_0321571 | Ga0501047_0321571_21_908 | 278 |
| 1341 | 3300049584 | Ga0501068_0011640 | Ga0501068_0011640_949_1812 | 278 |
| 1342 | 3300049586 | Ga0501070_0125601 | Ga0501070_0125601_1077_1964 | 278 |
| 1343 | 3300049589 | Ga0501073_0092976 | Ga0501073_0092976_887_1801 | 278 |
| 1344 | 3300049591 | Ga0501075_0319193 | Ga0501075_0319193_94_981 | 278 |
| 1345 | 3300049592 | Ga0501076_0128678 | Ga0501076_0128678_931_1818 | 278 |
| 1346 | 3300049741 | Ga0501079_0366676 | Ga0501079_0366676_187_1101 | 278 |
| 1347 | 3300049822 | Ga0501035_0002396 | Ga0501035_0002396_10556_11470 | 278 |
| 1348 | 3300049822 | Ga0501035_0154414 | Ga0501035_0154414_1034_1921 | 278 |
| 1349 | 3300049823 | Ga0501044_0041958 | Ga0501044_0041958_2367_3281 | 278 |
| 1350 | 3300049823 | Ga0501044_0045060 | Ga0501044_0045060_3019_3906 | 278 |
| 1351 | 3300049823 | Ga0501044_0172223 | Ga0501044_0172223_1110_1973 | 278 |
| 1352 | 3300050489 | nmdc:mga03683_138675_c1 | nmdc:mga03683_138675_c1_32_919 | 278 |
| 1353 | 3300050490 | nmdc:mga03n38_1841_c1 | nmdc:mga03n38_1841_c1_5008_5895 | 278 |
| 1354 | 3300050491 | nmdc:mga00v17_134798_c1 | nmdc:mga00v17_134798_c1_210_1097 | 278 |
| 1355 | 3300050491 | nmdc:mga00v17_162975_c1 | nmdc:mga00v17_162975_c1_43_930 | 278 |
| 1356 | 3300050491 | nmdc:mga00v17_58269_c1 | nmdc:mga00v17_58269_c1_850_1737 | 278 |
| 1357 | 3300050492 | nmdc:mga0yw44_115170_c1 | nmdc:mga0yw44_115170_c1_303_1190 | 278 |
| 1358 | 3300050492 | nmdc:mga0yw44_64077_c1 | nmdc:mga0yw44_64077_c1_326_1225 | 278 |
| 1359 | 3300050493 | nmdc:mga0k408_221755_c1 | nmdc:mga0k408_221755_c1_87_974 | 278 |
| 1360 | 3300050493 | nmdc:mga0k408_85015_c1 | nmdc:mga0k408_85015_c1_574_1461 | 278 |
| 1361 | 3300050494 | nmdc:mga06z11_12290_c1 | nmdc:mga06z11_12290_c1_567_1454 | 278 |
| 1362 | 3300050494 | nmdc:mga06z11_28342_c1 | nmdc:mga06z11_28342_c1_303_1190 | 278 |
| 1363 | 3300050496 | nmdc:mga07m45_19367_c1 | nmdc:mga07m45_19367_c1_1091_1978 | 278 |
| 1364 | 3300050496 | nmdc:mga07m45_7723_c1 | nmdc:mga07m45_7723_c1_3189_4076 | 278 |
| 1365 | 3300050507 | nmdc:mga05p37_602943_c1 | nmdc:mga05p37_602943_c1_279_1166 | 278 |
| 1366 | 3300050516 | nmdc:mga0sz30_13149_c1 | nmdc:mga0sz30_13149_c1_938_1825 | 278 |
| 1367 | 3300053078 | Ga0495612_0013700 | Ga0495612_0013700_786_1724 | 278 |
| 1368 | 3300053078 | Ga0495612_0027714 | Ga0495612_0027714_1035_1922 | 278 |
| 1369 | 3300053084 | Ga0495595_0099637 | Ga0495595_0099637_405_1292 | 278 |
| 1370 | 3300053085 | Ga0495619_0211036 | Ga0495619_0211036_440_1327 | 278 |
| 1371 | 3300053087 | Ga0500643_000042 | Ga0500643_000042_52220_53119 | 278 |
| 1372 | 3300053087 | Ga0500643_058698 | Ga0500643_058698_28_915 | 278 |
| 1373 | 3300053091 | Ga0500647_0024199 | Ga0500647_0024199_202_1101 | 278 |
| 1374 | 3300053093 | Ga0500651_0000628 | Ga0500651_0000628_15208_16095 | 278 |
| 1375 | 3300053094 | Ga0500566_0000178 | Ga0500566_0000178_13454_14341 | 278 |
| 1376 | 3300053094 | Ga0500566_0000834 | Ga0500566_0000834_16353_17252 | 278 |
| 1377 | 3300053094 | Ga0500566_0010268 | Ga0500566_0010268_2333_3223 | 278 |
| 1378 | 3300053095 | Ga0500640_029138 | Ga0500640_029138_20_907 | 278 |
| 1379 | 3300053096 | Ga0500641_0003159 | Ga0500641_0003159_1037_1924 | 278 |
| 1380 | 3300053096 | Ga0500641_0067877 | Ga0500641_0067877_529_1428 | 278 |
| 1381 | 3300053102 | Ga0500554_073532 | Ga0500554_073532_153_1043 | 278 |
| 1382 | 3300053103 | Ga0500555_000735 | Ga0500555_000735_99_986 | 278 |
| 1383 | 3300053103 | Ga0500555_019657 | Ga0500555_019657_663_1550 | 278 |
| 1384 | 3300053104 | Ga0500556_0000290 | Ga0500556_0000290_28640_29569 | 278 |
| 1385 | 3300053104 | Ga0500556_0004619 | Ga0500556_0004619_1289_2176 | 278 |
| 1386 | 3300053105 | Ga0500557_000006 | Ga0500557_000006_82265_83164 | 278 |
| 1387 | 3300053108 | Ga0500562_048309 | Ga0500562_048309_16_903 | 278 |
| 1388 | 3300053118 | Ga0500594_0031311 | Ga0500594_0031311_276_1163 | 278 |
| 1389 | 3300053119 | Ga0500595_001597 | Ga0500595_001597_2964_3854 | 278 |
| 1390 | 3300053119 | Ga0500595_009190 | Ga0500595_009190_2903_3796 | 278 |
| 1391 | 3300053119 | Ga0500595_015184 | Ga0500595_015184_1700_2587 | 278 |
| 1392 | 3300053123 | Ga0500614_002436 | Ga0500614_002436_802_1689 | 278 |
| 1393 | 3300053126 | Ga0500621_058891 | Ga0500621_058891_640_1527 | 278 |
| 1394 | 3300053130 | Ga0500642_0000040 | Ga0500642_0000040_47851_48750 | 278 |
| 1395 | 3300053130 | Ga0500642_0022271 | Ga0500642_0022271_760_1659 | 278 |
| 1396 | 3300053130 | Ga0500642_0099608 | Ga0500642_0099608_302_1189 | 278 |
| 1397 | 3300053131 | Ga0500652_082782 | Ga0500652_082782_301_1200 | 278 |
| 1398 | 3300053134 | Ga0500658_0068364 | Ga0500658_0068364_351_1238 | 278 |
| 1399 | 3300053136 | Ga0500559_0006230 | Ga0500559_0006230_2847_3734 | 278 |
| 1400 | 3300053137 | Ga0500561_0009191 | Ga0500561_0009191_628_1515 | 278 |
| 1401 | 3300053139 | Ga0500568_0003788 | Ga0500568_0003788_6789_7688 | 278 |
| 1402 | 3300053139 | Ga0500568_0033871 | Ga0500568_0033871_304_1191 | 278 |
| 1403 | 3300053146 | Ga0500588_0061365 | Ga0500588_0061365_253_1140 | 278 |
| 1404 | 3300053150 | Ga0500603_000312 | Ga0500603_000312_6030_6917 | 278 |
| 1405 | 3300053151 | Ga0500604_0016250 | Ga0500604_0016250_57_944 | 278 |
| 1406 | 3300053156 | Ga0500622_0012774 | Ga0500622_0012774_3451_4338 | 278 |
| 1407 | 3300053156 | Ga0500622_0089240 | Ga0500622_0089240_26_913 | 278 |
| 1408 | 3300053158 | Ga0500627_0033845 | Ga0500627_0033845_230_1117 | 278 |
| 1409 | 3300053159 | Ga0500630_000840 | Ga0500630_000840_5296_6183 | 278 |
| 1410 | 3300053160 | Ga0500633_0071169 | Ga0500633_0071169_121_1008 | 278 |
| 1411 | 3300053162 | Ga0500638_001878 | Ga0500638_001878_1367_2257 | 278 |
| 1412 | 3300053163 | Ga0500639_000029 | Ga0500639_000029_16307_17194 | 278 |
| 1413 | 3300053177 | Ga0500636_0075129 | Ga0500636_0075129_1018_1905 | 278 |
| 1414 | 3300053178 | Ga0500637_0000215 | Ga0500637_0000215_18798_19688 | 278 |
| 1415 | 3300053731 | Ga0500609_004989 | Ga0500609_004989_466_1353 | 278 |
| 1416 | 3300053735 | Ga0500596_002014 | Ga0500596_002014_2975_3862 | 278 |
| 1417 | 3300053737 | Ga0500601_000682 | Ga0500601_000682_2316_3215 | 278 |
| 1418 | iso_pu_bacteria | 2507262055 | 2507507203 | 278 |
| 1419 | iso_pu_bacteria | 2508501009 | 2508541257 | 278 |
| 1420 | iso_pu_bacteria | 2515154112 | 2515628774 | 278 |
| 1421 | iso_pu_bacteria | 2524023205 | 2524440677 | 278 |
| 1422 | iso_pu_bacteria | 2744054633 | 2745077477 | 278 |
| 1423 | iso_pu_bacteria | 2824600985 | 2824607836 | 278 |
| 1424 | iso_pu_bacteria | 2824609381 | 2824616935 | 278 |
| 1425 | iso_pu_bacteria | 2824653114 | 2824658969 | 278 |
| 1426 | iso_pu_bacteria | 2844315083 | 2844320473 | 278 |
| 1427 | iso_pu_bacteria | 2857509624 | 2857511049 | 278 |
| 1428 | iso_pu_bacteria | 2874590934 | 2874596057 | 278 |
| 1429 | iso_pu_bacteria | 2874645413 | 2874650881 | 278 |
| 1430 | iso_pu_bacteria | 2876771140 | 2876776115 | 278 |
| 1431 | iso_pu_bacteria | 2876818435 | 2876820613 | 278 |
| 1432 | iso_pu_bacteria | 2879074833 | 2879080204 | 278 |
| 1433 | iso_pu_bacteria | 2879127579 | 2879129977 | 278 |
| 1434 | iso_pu_bacteria | 2879142872 | 2879147456 | 278 |
| 1435 | iso_pu_bacteria | 2888388044 | 2888392327 | 278 |
| 1436 | iso_pu_bacteria | 2888419890 | 2888426083 | 278 |
| 1437 | iso_pu_bacteria | 2903727486 | 2903732882 | 278 |
| 1438 | iso_pu_bacteria | 2906602504 | 2906606989 | 278 |
| 1439 | iso_pu_bacteria | 2932794094 | 2932797786 | 278 |
| 1440 | iso_pu_bacteria | 2935608549 | 2935610419 | 278 |
| 1441 | iso_pu_bacteria | 2935769743 | 2935771049 | 278 |
| 1442 | iso_pu_bacteria | 2935777560 | 2935781217 | 278 |
| 1443 | iso_pu_bacteria | 2935785616 | 2935786250 | 278 |
| 1444 | iso_pu_bacteria | 2935793552 | 2935793953 | 278 |
| 1445 | iso_pu_bacteria | 2935819856 | 2935823580 | 278 |
| 1446 | iso_pu_bacteria | 2935847175 | 2935849105 | 278 |
| 1447 | iso_pu_bacteria | 2935883170 | 2935888330 | 278 |
| 1448 | iso_pu_bacteria | 2935959822 | 2935965311 | 278 |
| 1449 | iso_pu_bacteria | 2935975950 | 2935976072 | 278 |
| 1450 | iso_pu_bacteria | 3005594810 | 3005600848 | 278 |
| 1451 | iso_pu_bacteria | 3005718088 | 3005723641 | 278 |
| 1452 | iso_pu_bacteria | 8016522445 | 8016528024 | 278 |
| 1453 | iso_pu_bacteria | 8016530956 | 8016533148 | 278 |
| 1454 | iso_pu_bacteria | 8016539877 | 8016546386 | 278 |
| 1455 | iso_pu_bacteria | 8016548790 | 8016555740 | 278 |
| 1456 | iso_pu_bacteria | 8016557553 | 8016564092 | 278 |
| 1457 | iso_pu_bacteria | 8016575299 | 8016575723 | 278 |
| 1458 | iso_pu_bacteria | 8016583857 | 8016594971 | 278 |
| 1459 | iso_pu_bacteria | 8016595262 | 8016601798 | 278 |
| 1460 | iso_pu_bacteria | 8016603502 | 8016608450 | 278 |
| 1461 | iso_pu_bacteria | 8016613128 | 8016616415 | 278 |
| 1462 | iso_pu_bacteria | 8016622563 | 8016624723 | 278 |
| 1463 | iso_pu_bacteria | 8016630954 | 8016638219 | 278 |
| 1464 | iso_pu_bacteria | 8019530166 | 8019532945 | 278 |
| 1465 | iso_pu_bacteria | 8019538911 | 8019546908 | 278 |
| 1466 | iso_pu_bacteria | 8019629233 | 8019632799 | 278 |
| 1467 | iso_pu_bacteria | 8019638758 | 8019647128 | 278 |
| 1468 | iso_pu_bacteria | 8019648815 | 8019655564 | 278 |
| 1469 | iso_pu_bacteria | 8019659431 | 8019660662 | 278 |
| 1470 | iso_pu_bacteria | 8019668869 | 8019670077 | 278 |
| 1471 | iso_pu_bacteria | 8019678201 | 8019686016 | 278 |
| 1472 | iso_pu_bacteria | 8019687851 | 8019692181 | 278 |
| 1473 | iso_pu_bacteria | 8056967851 | 8056971855 | 278 |
| 1474 | 3300005436 | Ga0070713_100011888 | Ga0070713_1000118885 | 279 |
| 1475 | 3300005437 | Ga0070710_10002467 | Ga0070710_100024672 | 279 |
| 1476 | 3300005439 | Ga0070711_100008018 | Ga0070711_1000080182 | 279 |
| 1477 | 3300005548 | Ga0070665_100051909 | Ga0070665_1000519091 | 279 |
| 1478 | 3300006051 | Ga0075364_10015623 | Ga0075364_100156234 | 279 |
| 1479 | 3300006175 | Ga0070712_100369824 | Ga0070712_1003698242 | 279 |
| 1480 | 3300006914 | Ga0075436_100074121 | Ga0075436_1000741212 | 279 |
| 1481 | 3300006943 | Ga0099822_1001510 | Ga0099822_100151024 | 279 |
| 1482 | 3300009093 | Ga0105240_10175366 | Ga0105240_101753662 | 279 |
| 1483 | 3300021384 | Ga0213876_10037137 | Ga0213876_100371373 | 279 |
| 1484 | 3300025906 | Ga0207699_10008437 | Ga0207699_100084371 | 279 |
| 1485 | 3300025915 | Ga0207693_10003944 | Ga0207693_100039443 | 279 |
| 1486 | 3300025916 | Ga0207663_10036712 | Ga0207663_100367122 | 279 |
| 1487 | 3300027357 | Ga0209589_1000007 | Ga0209589_1000007168 | 279 |
| 1488 | 3300027361 | Ga0209489_100008 | Ga0209489_100008168 | 279 |
| 1489 | 3300027363 | Ga0209700_100009 | Ga0209700_100009168 | 279 |
| 1490 | 3300033442 | Ga0315911_1000004 | Ga0315911_1000004365 | 279 |
| 1491 | 3300035116 | Ga0373945_0014901 | Ga0373945_0014901_1539_2408 | 279 |
| 1492 | 3300035170 | Ga0373943_0045194 | Ga0373943_0045194_1064_1933 | 279 |
| 1493 | 3300035170 | Ga0373943_0051417 | Ga0373943_0051417_186_1223 | 279 |
| 1494 | 3300035171 | Ga0373946_0012162 | Ga0373946_0012162_1550_2419 | 279 |
| 1495 | 3300035410 | Ga0373924_0007778 | Ga0373924_0007778_853_1890 | 279 |
| 1496 | 3300035695 | Ga0373927_0038647 | Ga0373927_0038647_160_1197 | 279 |
| 1497 | 3300035695 | Ga0373927_0087313 | Ga0373927_0087313_642_1544 | 279 |
| 1498 | 3300035725 | Ga0373947_0121693 | Ga0373947_0121693_776_1645 | 279 |
| 1499 | 3300036401 | Ga0373937_0140279 | Ga0373937_0140279_157_1059 | 279 |
| 1500 | 3300037068 | Ga0373925_0004601 | Ga0373925_0004601_6149_7018 | 279 |
| 1501 | 3300037068 | Ga0373925_0055678 | Ga0373925_0055678_1157_2194 | 279 |
| 1502 | 3300037068 | Ga0373925_0366525 | Ga0373925_0366525_258_1127 | 279 |
| 1503 | 3300037853 | Ga0436364_0838358 | Ga0436364_0838358_142_1044 | 279 |
| 1504 | 3300039437 | Ga0436365_0768275 | Ga0436365_0768275_9337_10257 | 279 |
| 1505 | 3300039437 | Ga0436365_1160728 | Ga0436365_1160728_2308_3210 | 279 |
| 1506 | 3300039437 | Ga0436365_1523930 | Ga0436365_1523930_1188_2090 | 279 |
| 1507 | 3300039438 | Ga0436360_0938879 | Ga0436360_0938879_1821_2723 | 279 |
| 1508 | 3300046459 | Ga0495629_0062627 | Ga0495629_0062627_235_1104 | 279 |
| 1509 | 3300046459 | Ga0495629_0159207 | Ga0495629_0159207_39_989 | 279 |
| 1510 | 3300046462 | Ga0495651_0182590 | Ga0495651_0182590_187_1089 | 279 |
| 1511 | 3300046463 | Ga0495653_0064907 | Ga0495653_0064907_986_2023 | 279 |
| 1512 | 3300046471 | Ga0495650_0045002 | Ga0495650_0045002_943_1842 | 279 |
| 1513 | 3300046473 | Ga0495582_0131633 | Ga0495582_0131633_375_1244 | 279 |
| 1514 | 3300046476 | Ga0495662_0000223 | Ga0495662_0000223_113_1063 | 279 |
| 1515 | 3300046477 | Ga0495664_0000800 | Ga0495664_0000800_14028_15065 | 279 |
| 1516 | 3300046514 | Ga0495618_0005331 | Ga0495618_0005331_1727_2764 | 279 |
| 1517 | 3300046514 | Ga0495618_0215734 | Ga0495618_0215734_168_1070 | 279 |
| 1518 | 3300046517 | Ga0495630_0037785 | Ga0495630_0037785_1499_2536 | 279 |
| 1519 | 3300046529 | Ga0495652_0064544 | Ga0495652_0064544_854_1891 | 279 |
| 1520 | 3300046531 | Ga0495665_0163905 | Ga0495665_0163905_109_1059 | 279 |
| 1521 | 3300046533 | Ga0495640_0000544 | Ga0495640_0000544_13772_14809 | 279 |
| 1522 | 3300046533 | Ga0495640_0099925 | Ga0495640_0099925_773_1675 | 279 |
| 1523 | 3300046535 | Ga0495586_0097140 | Ga0495586_0097140_248_1198 | 279 |
| 1524 | 3300046536 | Ga0495587_0041927 | Ga0495587_0041927_1768_2670 | 279 |
| 1525 | 3300046543 | Ga0495645_0002211 | Ga0495645_0002211_5503_6540 | 279 |
| 1526 | 3300046559 | Ga0495667_0032424 | Ga0495667_0032424_443_1345 | 279 |
| 1527 | 3300046642 | Ga0495634_0007670 | Ga0495634_0007670_4200_5237 | 279 |
| 1528 | 3300046642 | Ga0495634_0124835 | Ga0495634_0124835_467_1369 | 279 |
| 1529 | 3300046663 | Ga0495635_0004288 | Ga0495635_0004288_8407_9444 | 279 |
| 1530 | 3300046681 | Ga0495647_0029527 | Ga0495647_0029527_215_1165 | 279 |
| 1531 | 3300046683 | Ga0495658_0001039 | Ga0495658_0001039_12643_13512 | 279 |
| 1532 | 3300046690 | Ga0495624_0052513 | Ga0495624_0052513_1429_2466 | 279 |
| 1533 | 3300047471 | Ga0495684_0003192 | Ga0495684_0003192_7032_8069 | 279 |
| 1534 | 3300048088 | Ga0495602_0246993 | Ga0495602_0246993_235_1137 | 279 |
| 1535 | 3300048905 | Ga0496102_0110103 | Ga0496102_0110103_824_1726 | 279 |
| 1536 | 3300048908 | Ga0496105_0315551 | Ga0496105_0315551_235_1137 | 279 |
| 1537 | 3300048909 | Ga0496106_0267991 | Ga0496106_0267991_169_1071 | 279 |
| 1538 | 3300048912 | Ga0496109_0272144 | Ga0496109_0272144_533_1435 | 279 |
| 1539 | 3300048914 | Ga0496111_0063517 | Ga0496111_0063517_90_992 | 279 |
| 1540 | 3300048917 | Ga0496114_0180374 | Ga0496114_0180374_690_1592 | 279 |
| 1541 | 3300048924 | Ga0496121_0177421 | Ga0496121_0177421_95_991 | 279 |
| 1542 | 3300048929 | Ga0496126_0380234 | Ga0496126_0380234_155_1051 | 279 |
| 1543 | 3300049571 | Ga0501034_0517213 | Ga0501034_0517213_86_955 | 279 |
| 1544 | 3300049583 | Ga0501067_0013811 | Ga0501067_0013811_3510_4457 | 279 |
| 1545 | 3300049589 | Ga0501073_0050737 | Ga0501073_0050737_1962_2882 | 279 |
| 1546 | 3300050491 | nmdc:mga00v17_15240_c1 | nmdc:mga00v17_15240_c1_1814_2752 | 279 |
| 1547 | 3300053077 | Ga0495601_0010473 | Ga0495601_0010473_754_1656 | 279 |
| 1548 | 3300053077 | Ga0495601_0032032 | Ga0495601_0032032_1672_2574 | 279 |
| 1549 | 3300053077 | Ga0495601_0062698 | Ga0495601_0062698_1024_2061 | 279 |
| 1550 | 3300053078 | Ga0495612_0001270 | Ga0495612_0001270_2012_3049 | 279 |
| 1551 | 3300053078 | Ga0495612_0045474 | Ga0495612_0045474_472_1374 | 279 |
| 1552 | 3300053084 | Ga0495595_0112432 | Ga0495595_0112432_122_1024 | 279 |
| 1553 | 3300053085 | Ga0495619_0017953 | Ga0495619_0017953_1727_2764 | 279 |
| 1554 | 3300053091 | Ga0500647_0029042 | Ga0500647_0029042_1029_1919 | 279 |
| 1555 | 3300053122 | Ga0500608_080244 | Ga0500608_080244_464_1399 | 279 |
| 1556 | 3300053134 | Ga0500658_0058151 | Ga0500658_0058151_72_992 | 279 |
| 1557 | 3300053139 | Ga0500568_0013672 | Ga0500568_0013672_1490_2386 | 279 |
| 1558 | 3300053139 | Ga0500568_0019093 | Ga0500568_0019093_1649_2569 | 279 |
| 1559 | 3300053148 | Ga0500590_116353 | Ga0500590_116353_258_1193 | 279 |
| 1560 | 3300053153 | Ga0500616_0008096 | Ga0500616_0008096_321_1256 | 279 |
| 1561 | 3300054114 | Ga0501084_0015828 | Ga0501084_0015828_1612_2559 | 279 |
| 1562 | iso_pu_bacteria | 2775507255 | 2778126252 | 279 |
| 1563 | 3300005563 | Ga0068855_100349099 | Ga0068855_1003490992 | 280 |
| 1564 | 3300005577 | Ga0068857_100044596 | Ga0068857_1000445963 | 280 |
| 1565 | 3300005937 | Ga0081455_10015269 | Ga0081455_100152699 | 280 |
| 1566 | 3300005937 | Ga0081455_10137647 | Ga0081455_101376472 | 280 |
| 1567 | 3300006175 | Ga0070712_100082360 | Ga0070712_1000823603 | 280 |
| 1568 | 3300006186 | Ga0075369_10112321 | Ga0075369_101123212 | 280 |
| 1569 | 3300013104 | Ga0157370_10199275 | Ga0157370_101992752 | 280 |
| 1570 | 3300025928 | Ga0207700_10048834 | Ga0207700_100488344 | 280 |
| 1571 | 3300026116 | Ga0207674_10019244 | Ga0207674_100192443 | 280 |
| 1572 | 3300037312 | Ga0395899_0019536 | Ga0395899_0019536_4156_5079 | 280 |
| 1573 | 3300037418 | Ga0395900_0302164 | Ga0395900_0302164_181_1104 | 280 |
| 1574 | 3300037466 | Ga0395898_0087335 | Ga0395898_0087335_209_1132 | 280 |
| 1575 | 3300038443 | Ga0395901_0000880 | Ga0395901_0000880_19984_20907 | 280 |
| 1576 | 3300038443 | Ga0395901_0081261 | Ga0395901_0081261_139_1062 | 280 |
| 1577 | 3300048904 | Ga0496101_0141383 | Ga0496101_0141383_758_1717 | 280 |
| 1578 | 3300048907 | Ga0496104_0018299 | Ga0496104_0018299_3099_4025 | 280 |
| 1579 | 3300048907 | Ga0496104_0025914 | Ga0496104_0025914_2213_3172 | 280 |
| 1580 | 3300048908 | Ga0496105_0337501 | Ga0496105_0337501_262_1188 | 280 |
| 1581 | 3300048916 | Ga0496113_0024393 | Ga0496113_0024393_2302_3228 | 280 |
| 1582 | 3300048918 | Ga0496115_0050923 | Ga0496115_0050923_210_1169 | 280 |
| 1583 | 3300049590 | Ga0501074_0261272 | Ga0501074_0261272_223_1197 | 280 |
| 1584 | 3300049592 | Ga0501076_0277831 | Ga0501076_0277831_381_1355 | 280 |
| 1585 | 3300049741 | Ga0501079_0143047 | Ga0501079_0143047_99_1073 | 280 |
| 1586 | 3300049743 | Ga0501081_0020783 | Ga0501081_0020783_57_1031 | 280 |
| 1587 | 3300053153 | Ga0500616_0002157 | Ga0500616_0002157_4783_5706 | 280 |
| 1588 | 3300003781 | Ga0055536_1005334 | Ga0055536_10053343 | 281 |
| 1589 | 3300025292 | Ga0209676_1000238 | Ga0209676_1000238113 | 281 |
| 1590 | 3300025298 | Ga0209050_1016456 | Ga0209050_10164564 | 281 |
| 1591 | 3300031250 | Ga0265331_10144471 | Ga0265331_101444711 | 281 |
| 1592 | 3300039447 | Ga0436361_0904010 | Ga0436361_0904010_934_1842 | 281 |
| 1593 | 3300050507 | nmdc:mga05p37_389441_c1 | nmdc:mga05p37_389441_c1_64_909 | 281 |
| 1594 | 3300031548 | Ga0307408_100072109 | Ga0307408_1000721092 | 282 |
| 1595 | 3300031731 | Ga0307405_10024417 | Ga0307405_100244173 | 282 |
| 1596 | 3300031911 | Ga0307412_10039929 | Ga0307412_100399293 | 282 |
| 1597 | 3300032004 | Ga0307414_10006076 | Ga0307414_100060763 | 282 |
| 1598 | 3300032005 | Ga0307411_10037015 | Ga0307411_100370154 | 282 |
| 1599 | 3300046524 | Ga0495648_0000032 | Ga0495648_0000032_145937_146785 | 282 |
| 1600 | 3300049663 | Ga0501223_000289 | Ga0501223_000289_5907_6755 | 282 |
| 1601 | 3300049664 | Ga0501224_000002 | Ga0501224_000002_100340_101188 | 282 |
| 1602 | 3300049668 | Ga0501233_006556 | Ga0501233_006556_585_1433 | 282 |
| 1603 | 3300049705 | Ga0501225_0000045 | Ga0501225_0000045_22325_23173 | 282 |
| 1604 | 3300049707 | Ga0501234_000055 | Ga0501234_000055_8916_9764 | 282 |
| 1605 | 3300049853 | Ga0501226_000026 | Ga0501226_000026_80962_81810 | 282 |
| 1606 | iso_pu_bacteria | 2643221563 | 2643835571 | 282 |
| 1607 | iso_pu_bacteria | 2643221608 | 2644056497 | 282 |
| 1608 | iso_pu_bacteria | 2852653556 | 2852655173 | 282 |
| 1609 | iso_pu_bacteria | 2852680915 | 2852681269 | 282 |
| 1610 | 3300001904 | JGI24736J21556_1006437 | JGI24736J21556_10064372 | 283 |
| 1611 | 3300001915 | JGI24741J21665_1000512 | JGI24741J21665_100051212 | 283 |
| 1612 | 3300001979 | JGI24740J21852_10006507 | JGI24740J21852_100065072 | 283 |
| 1613 | 3300002067 | JGI24735J21928_10007012 | JGI24735J21928_100070124 | 283 |
| 1614 | 3300005339 | Ga0070660_100322397 | Ga0070660_1003223972 | 283 |
| 1615 | 3300005344 | Ga0070661_100038289 | Ga0070661_1000382894 | 283 |
| 1616 | 3300005614 | Ga0068856_100050744 | Ga0068856_1000507442 | 283 |
| 1617 | 3300009147 | Ga0114129_10427101 | Ga0114129_104271013 | 283 |
| 1618 | 3300009174 | Ga0105241_10001825 | Ga0105241_1000182516 | 283 |
| 1619 | 3300013100 | Ga0157373_10041007 | Ga0157373_100410072 | 283 |
| 1620 | 3300025920 | Ga0207649_10032745 | Ga0207649_100327452 | 283 |
| 1621 | 3300025933 | Ga0207706_10004051 | Ga0207706_100040514 | 283 |
| 1622 | 3300026041 | Ga0207639_10020336 | Ga0207639_100203362 | 283 |
| 1623 | 3300026067 | Ga0207678_10000095 | Ga0207678_1000009578 | 283 |
| 1624 | 3300026116 | Ga0207674_10011995 | Ga0207674_100119955 | 283 |
| 1625 | 3300031901 | Ga0307406_10081169 | Ga0307406_100811693 | 283 |
| 1626 | 3300031995 | Ga0307409_100543160 | Ga0307409_1005431602 | 283 |
| 1627 | 3300053153 | Ga0500616_0027058 | Ga0500616_0027058_959_1813 | 283 |
| 1628 | 3300005548 | Ga0070665_100000195 | Ga0070665_10000019586 | 284 |
| 1629 | 3300028379 | Ga0268266_10001710 | Ga0268266_100017108 | 284 |
| 1630 | 3300053739 | Ga0500587_001664 | Ga0500587_001664_77_1006 | 284 |
| 1631 | 3300046616 | Ga0495668_0046640 | Ga0495668_0046640_115_975 | 285 |
| 1632 | 3300053116 | Ga0500592_009871 | Ga0500592_009871_579_1439 | 285 |
| 1633 | 3300053158 | Ga0500627_0197651 | Ga0500627_0197651_26_886 | 285 |
| 1634 | 3300003781 | Ga0055536_1001293 | Ga0055536_100129314 | 286 |
| 1635 | 3300003791 | Ga0055530_10000310 | Ga0055530_1000031014 | 286 |
| 1636 | 3300025291 | Ga0209675_1000025 | Ga0209675_1000025165 | 286 |
| 1637 | 3300025292 | Ga0209676_1000571 | Ga0209676_100057164 | 286 |
| 1638 | 3300025292 | Ga0209676_1001500 | Ga0209676_100150023 | 286 |
| 1639 | 3300025297 | Ga0209758_1037173 | Ga0209758_10371732 | 286 |
| 1640 | 3300025298 | Ga0209050_1000104 | Ga0209050_100010423 | 286 |
| 1641 | 3300025298 | Ga0209050_1001457 | Ga0209050_100145721 | 286 |
| 1642 | 3300025304 | Ga0209257_1000120 | Ga0209257_10001203 | 286 |
| 1643 | 3300025304 | Ga0209257_1000323 | Ga0209257_1000323105 | 286 |
| 1644 | 3300046506 | Ga0495583_0077489 | Ga0495583_0077489_399_1274 | 286 |
| 1645 | 3300046616 | Ga0495668_0000001 | Ga0495668_0000001_344164_345024 | 286 |
| 1646 | 3300046660 | Ga0495625_0000751 | Ga0495625_0000751_36241_37101 | 286 |
| 1647 | 3300048090 | Ga0495615_0000085 | Ga0495615_0000085_13534_14409 | 286 |
| 1648 | 3300048925 | Ga0496122_0006838 | Ga0496122_0006838_4872_5747 | 286 |
| 1649 | 3300048926 | Ga0496123_0002007 | Ga0496123_0002007_13260_14135 | 286 |
| 1650 | 3300053139 | Ga0500568_0003040 | Ga0500568_0003040_7299_8159 | 286 |
| 1651 | 2162886007 | SwRhRL2b_contig_2347511 | SwRhRL2b_0389.00001910 | 287 |
| 1652 | 2162886007 | SwRhRL2b_contig_2406991 | SwRhRL2b_0789.00009750 | 287 |
| 1653 | 3300005289 | Ga0065704_10001979 | Ga0065704_100019797 | 287 |
| 1654 | 3300005289 | Ga0065704_10090027 | Ga0065704_100900274 | 287 |
| 1655 | 3300005289 | Ga0065704_10114843 | Ga0065704_101148431 | 287 |
| 1656 | 3300005331 | Ga0070670_100020327 | Ga0070670_1000203272 | 287 |
| 1657 | 3300005347 | Ga0070668_100013005 | Ga0070668_1000130055 | 287 |
| 1658 | 3300009978 | Ga0105148_100170 | Ga0105148_1001704 | 287 |
| 1659 | 3300025931 | Ga0207644_10056256 | Ga0207644_100562563 | 287 |
| 1660 | 3300025961 | Ga0207712_10131992 | Ga0207712_101319922 | 287 |
| 1661 | 3300025972 | Ga0207668_10026041 | Ga0207668_100260413 | 287 |
| 1662 | 3300046519 | Ga0495632_0000075 | Ga0495632_0000075_13840_14724 | 287 |
| 1663 | 3300046524 | Ga0495648_0002686 | Ga0495648_0002686_1524_2408 | 287 |
| 1664 | 3300046525 | Ga0495663_0000003 | Ga0495663_0000003_60524_61408 | 287 |
| 1665 | 3300046558 | Ga0495633_0000786 | Ga0495633_0000786_21471_22355 | 287 |
| 1666 | 3300047472 | Ga0495686_0043890 | Ga0495686_0043890_1142_2026 | 287 |
| 1667 | 3300048911 | Ga0496108_0033687 | Ga0496108_0033687_1665_2528 | 287 |
| 1668 | 3300048911 | Ga0496108_0118090 | Ga0496108_0118090_180_1043 | 287 |
| 1669 | 3300048913 | Ga0496110_0103214 | Ga0496110_0103214_1053_1916 | 287 |
| 1670 | 3300048919 | Ga0496116_0078789 | Ga0496116_0078789_385_1248 | 287 |
| 1671 | 3300048924 | Ga0496121_0001214 | Ga0496121_0001214_1755_2618 | 287 |
| 1672 | 3300048924 | Ga0496121_0059432 | Ga0496121_0059432_991_1854 | 287 |
| 1673 | 3300048925 | Ga0496122_0029438 | Ga0496122_0029438_1574_2437 | 287 |
| 1674 | 3300048925 | Ga0496122_0081360 | Ga0496122_0081360_1306_2169 | 287 |
| 1675 | 3300048926 | Ga0496123_0008924 | Ga0496123_0008924_7031_7894 | 287 |
| 1676 | 3300048927 | Ga0496124_0002458 | Ga0496124_0002458_5596_6459 | 287 |
| 1677 | 3300048928 | Ga0496125_0002535 | Ga0496125_0002535_1878_2741 | 287 |
| 1678 | 3300048929 | Ga0496126_0006114 | Ga0496126_0006114_10754_11617 | 287 |
| 1679 | 3300048929 | Ga0496126_0132740 | Ga0496126_0132740_202_1065 | 287 |
| 1680 | 3300049658 | Ga0501211_003699 | Ga0501211_003699_607_1470 | 287 |
| 1681 | 3300049705 | Ga0501225_0018576 | Ga0501225_0018576_586_1449 | 287 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5eo6-assembly1.cif.gz_B | coproporphyrinogen iii oxidase (hemf) from acinetobacter baumannii | 0.943 | 10 | 287 |
| 3e8j-assembly1.cif.gz_B | coproporphyrinogen iii oxidase from leishmania naiffi | 0.9363 | 10 | 287 |
| 3dwr-assembly1.cif.gz_B | leishmania major coproporphyrinogen iii oxidase with bound ligand | 0.9339 | 8 | 287 |
| 3e8j-assembly1.cif.gz_A | coproporphyrinogen iii oxidase from leishmania naiffi | 0.9222 | 10 | 287 |
| 8t7w-assembly1.cif.gz_A | crystal structure of oxygen-dependent coproporphyrinogen-iii oxidase (hemf) from klebsiella aerogenes | 0.9189 | 10 | 287 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3dwsA00 | Alpha Beta;3-Layer(aba) Sandwich;oxygen-dependent coproporphyrinogen oxidase;Coproporphyrinogen III oxidase, aerobic | 0.9014 | 10 | 287 | 3.40.1500.10 |
| af_Q9UTE2_2_312_3.40.1500.10 | Alpha Beta;3-Layer(aba) Sandwich;oxygen-dependent coproporphyrinogen oxidase;Coproporphyrinogen III oxidase, aerobic | 0.8685 | 1 | 287 | 3.40.1500.10 |
| af_Q9UTE2_2_312_3.40.1500.10 | Alpha Beta;3-Layer(aba) Sandwich;oxygen-dependent coproporphyrinogen oxidase;Coproporphyrinogen III oxidase, aerobic | 0.8655 | 1 | 287 | 3.40.1500.10 |
| af_Q7XPL2_53_398_3.40.1500.10 | Alpha Beta;3-Layer(aba) Sandwich;oxygen-dependent coproporphyrinogen oxidase;Coproporphyrinogen III oxidase, aerobic | 0.8557 | 12 | 287 | 3.40.1500.10 |
| af_Q54IA7_2_331_3.40.1500.10 | Alpha Beta;3-Layer(aba) Sandwich;oxygen-dependent coproporphyrinogen oxidase;Coproporphyrinogen III oxidase, aerobic | 0.8548 | 5 | 287 | 3.40.1500.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3D4M0P0-F1-model_v4 | deleted | 0.989 | 103 | 287 |
|
| AF-A0A1R1YWK0-F1-model_v4 | coproporphyrinogen oxidase (EC 1.3.3.3) | 0.9871 | 3 | 287 |
GO:0004109
GO:0005737 GO:0006782 |
| AF-A0A3D2P2U3-F1-model_v4 | coproporphyrinogen oxidase (EC 1.3.3.3) | 0.9869 | 69 | 177 |
GO:0004109
GO:0005737 GO:0006782 |
| AF-A0A3M1G5I1-F1-model_v4 | coproporphyrinogen oxidase (EC 1.3.3.3) | 0.9853 | 67 | 287 |
GO:0004109
GO:0005737 GO:0006782 |
| AF-A0A848SJ21-F1-model_v4 | deleted | 0.982 | 128 | 287 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar